F491585
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1200 | 405 | 1196 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300050514|nmdc:mga08x19_39022_c1|nmdc:mga08x19_39022_c1_950_1948 |
| Length | 332 |
| Sequence | VIRTETNSSFIKERRNESGKQENRRNFQIGFFSCVPAFLIFMSVLVDKNTRLLVQGITGSAGAFHTRQCIEYGTNVVAGVTPGKGGQKFDDKIPVFDTVWEAKQKTNCNVSMIFVPAAFAADSILEAVDADIDLVVCITEGIPVMDMIRVKAMMRGKRTRLIGPNCPGIITPGACKIGIMPGYIHKEGNVGVISRSGTLTYEAVWQLTSRGYGQSTCIGIGGDPIGGLSHLDAVKLFNDDKNTDAVILIGEIGGSAEEEAAAWIKDNCKKPVAAFIAGITAPPGRRMGHAGAIVSGGKGTAAGKIEALKAAGIAVAETPATIADTLIAQLKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 2 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
| 3 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 4 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 5 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 224 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 226 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 228 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 230 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 231 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 234 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 235 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 236 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 238 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 239 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 240 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 242 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 243 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 244 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 245 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 251 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 260 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 262 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 263 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 264 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 266 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 274 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 275 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 276 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 277 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 278 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 279 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 280 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 281 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 282 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 283 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 284 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 285 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 288 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 336 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 344 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 345 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 346 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 349 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 351 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 352 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 353 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 374 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 375 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 376 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 377 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 378 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 379 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 380 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 387 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 388 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 399 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 400 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 402 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 403 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 404 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.83 |
| Metatranscriptomes | 0.83 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.58 |
| Nodule | 0 |
| Rhizoplane | 3.5 |
| Rhizosphere | 92.83 |
| Stem | 0 |
| Stem Tuber | 0.08 |
| Unclassified | 2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24035J26624_1001291 | 3300002126 | Unclassified | 2375 |
| 2 | JGI24751J29686_10000050 | 3300002459 | Bacteria | 68540 |
| 3 | JGI25406J46586_10001426 | 3300003203 | Bacteria | 11273 |
| 4 | JGI25406J46586_10017169 | 3300003203 | Bacteria | 2997 |
| 5 | JGI25406J46586_10037474 | 3300003203 | Bacteria | 1747 |
| 6 | rootH2_10071534 | 3300003320 | Bacteria | 9121 |
| 7 | Ga0055530_10015453 | 3300003791 | Bacteria | 2491 |
| 8 | JGI25405J52794_10005555 | 3300003911 | Bacteria | 2277 |
| 9 | Ga0065714_10002297 | 3300005288 | Bacteria | 27065 |
| 10 | Ga0065704_10111650 | 3300005289 | Bacteria | 1952 |
| 11 | Ga0065712_10005682 | 3300005290 | Bacteria | 3064 |
| 12 | Ga0065712_10005725 | 3300005290 | Bacteria | 4138 |
| 13 | Ga0065712_10074234 | 3300005290 | Bacteria | 4148 |
| 14 | Ga0065715_10000207 | 3300005293 | Bacteria | 34609 |
| 15 | Ga0065715_10002046 | 3300005293 | Bacteria | 6097 |
| 16 | Ga0065715_10018359 | 3300005293 | Bacteria | 1760 |
| 17 | Ga0065715_10018423 | 3300005293 | Bacteria | 2092 |
| 18 | Ga0065715_10027319 | 3300005293 | Bacteria | 2161 |
| 19 | Ga0065715_10091684 | 3300005293 | Bacteria | 5619 |
| 20 | Ga0065715_10095093 | 3300005293 | Bacteria | 4166 |
| 21 | Ga0065715_10137580 | 3300005293 | Bacteria | 1905 |
| 22 | Ga0065715_10274696 | 3300005293 | Unclassified | 1102 |
| 23 | Ga0065707_10005149 | 3300005295 | Bacteria | 3363 |
| 24 | Ga0065707_10086298 | 3300005295 | Bacteria | 5543 |
| 25 | Ga0065707_10098125 | 3300005295 | Bacteria | 3111 |
| 26 | Ga0065707_10102852 | 3300005295 | Bacteria | 2782 |
| 27 | Ga0065707_10106880 | 3300005295 | Bacteria | 2578 |
| 28 | Ga0065707_10203563 | 3300005295 | Bacteria | 1299 |
| 29 | Ga0070676_10009128 | 3300005328 | Bacteria | 5365 |
| 30 | Ga0070676_10067588 | 3300005328 | Bacteria | 2137 |
| 31 | Ga0070676_10093831 | 3300005328 | Bacteria | 1843 |
| 32 | Ga0070683_100043281 | 3300005329 | Bacteria | 4150 |
| 33 | Ga0070683_100062437 | 3300005329 | Bacteria | 3464 |
| 34 | Ga0070690_100008756 | 3300005330 | Bacteria | 5843 |
| 35 | Ga0070690_100014700 | 3300005330 | Bacteria | 4648 |
| 36 | Ga0070690_100043845 | 3300005330 | Bacteria | 2838 |
| 37 | Ga0070690_100291490 | 3300005330 | Bacteria | 1167 |
| 38 | Ga0070670_100000439 | 3300005331 | Bacteria | 33957 |
| 39 | Ga0070670_100001583 | 3300005331 | Bacteria | 18353 |
| 40 | Ga0070670_100017743 | 3300005331 | Bacteria | 6107 |
| 41 | Ga0070670_100123738 | 3300005331 | Bacteria | 2232 |
| 42 | Ga0070670_100245730 | 3300005331 | Bacteria | 1558 |
| 43 | Ga0068869_100001716 | 3300005334 | Bacteria | 13080 |
| 44 | Ga0068869_100009103 | 3300005334 | Bacteria | 6433 |
| 45 | Ga0068869_100192053 | 3300005334 | Bacteria | 1606 |
| 46 | Ga0070666_10002748 | 3300005335 | Bacteria | 10625 |
| 47 | Ga0070666_10007841 | 3300005335 | Bacteria | 6595 |
| 48 | Ga0070680_100000797 | 3300005336 | Bacteria | 22198 |
| 49 | Ga0070680_100040932 | 3300005336 | Bacteria | 3755 |
| 50 | Ga0070680_100091242 | 3300005336 | Bacteria | 2522 |
| 51 | Ga0070680_100213387 | 3300005336 | Bacteria | 1629 |
| 52 | Ga0070682_100000167 | 3300005337 | Bacteria | 50701 |
| 53 | Ga0070682_100000587 | 3300005337 | Bacteria | 22186 |
| 54 | Ga0070682_100003960 | 3300005337 | Bacteria | 8223 |
| 55 | Ga0070682_100024319 | 3300005337 | Bacteria | 3603 |
| 56 | Ga0068868_100024117 | 3300005338 | Bacteria | 4611 |
| 57 | Ga0068868_100030702 | 3300005338 | Bacteria | 4121 |
| 58 | Ga0068868_100055109 | 3300005338 | Bacteria | 3136 |
| 59 | Ga0068868_100095734 | 3300005338 | Bacteria | 2397 |
| 60 | Ga0068868_100237746 | 3300005338 | Bacteria | 1529 |
| 61 | Ga0068868_100343380 | 3300005338 | Bacteria | 1277 |
| 62 | Ga0070660_100026636 | 3300005339 | Bacteria | 4307 |
| 63 | Ga0070660_100029344 | 3300005339 | Bacteria | 4122 |
| 64 | Ga0070660_100097669 | 3300005339 | Bacteria | 2324 |
| 65 | Ga0070660_100186000 | 3300005339 | Bacteria | 1682 |
| 66 | Ga0070689_100009616 | 3300005340 | Bacteria | 6863 |
| 67 | Ga0070689_100012040 | 3300005340 | Bacteria | 6218 |
| 68 | Ga0070689_100016838 | 3300005340 | Bacteria | 5358 |
| 69 | Ga0070689_100021935 | 3300005340 | Bacteria | 4761 |
| 70 | Ga0070689_100031202 | 3300005340 | Bacteria | 4049 |
| 71 | Ga0070689_100092466 | 3300005340 | Bacteria | 2386 |
| 72 | Ga0070689_100169064 | 3300005340 | Bacteria | 1771 |
| 73 | Ga0070689_100173684 | 3300005340 | Bacteria | 1747 |
| 74 | Ga0070689_100190356 | 3300005340 | Bacteria | 1671 |
| 75 | Ga0070689_100471764 | 3300005340 | Bacteria | 1071 |
| 76 | Ga0070687_100018304 | 3300005343 | Bacteria | 3238 |
| 77 | Ga0070687_100029620 | 3300005343 | Bacteria | 2667 |
| 78 | Ga0070661_100031848 | 3300005344 | Bacteria | 3814 |
| 79 | Ga0070661_100178510 | 3300005344 | Bacteria | 1615 |
| 80 | Ga0070692_10027516 | 3300005345 | Unclassified | 2819 |
| 81 | Ga0070668_100006277 | 3300005347 | Bacteria | 8799 |
| 82 | Ga0070668_100016062 | 3300005347 | Bacteria | 5601 |
| 83 | Ga0070668_100093761 | 3300005347 | Bacteria | 2370 |
| 84 | Ga0070668_100165700 | 3300005347 | Unclassified | 1796 |
| 85 | Ga0070669_100001219 | 3300005353 | Bacteria | 18671 |
| 86 | Ga0070669_100005130 | 3300005353 | Bacteria | 9474 |
| 87 | Ga0070669_100005514 | 3300005353 | Bacteria | 9133 |
| 88 | Ga0070669_100070552 | 3300005353 | Bacteria | 2583 |
| 89 | Ga0070669_100071535 | 3300005353 | Bacteria | 2566 |
| 90 | Ga0070669_100084848 | 3300005353 | Bacteria | 2364 |
| 91 | Ga0070669_100097198 | 3300005353 | Bacteria | 2216 |
| 92 | Ga0070669_100150138 | 3300005353 | Bacteria | 1803 |
| 93 | Ga0070669_100347753 | 3300005353 | Bacteria | 1203 |
| 94 | Ga0070669_100507479 | 3300005353 | Bacteria | 1001 |
| 95 | Ga0070675_100001835 | 3300005354 | Bacteria | 15705 |
| 96 | Ga0070675_100014335 | 3300005354 | Bacteria | 6249 |
| 97 | Ga0070675_100027122 | 3300005354 | Bacteria | 4601 |
| 98 | Ga0070675_100044859 | 3300005354 | Bacteria | 3616 |
| 99 | Ga0070675_100113725 | 3300005354 | Bacteria | 2293 |
| 100 | Ga0070675_100153054 | 3300005354 | Bacteria | 1978 |
| 101 | Ga0070675_100258828 | 3300005354 | Bacteria | 1524 |
| 102 | Ga0070671_100003791 | 3300005355 | Bacteria | 11859 |
| 103 | Ga0070671_100011256 | 3300005355 | Bacteria | 7186 |
| 104 | Ga0070671_100014619 | 3300005355 | Bacteria | 6346 |
| 105 | Ga0070671_100183767 | 3300005355 | Bacteria | 1771 |
| 106 | Ga0070674_100003718 | 3300005356 | Bacteria | 8601 |
| 107 | Ga0070674_100012161 | 3300005356 | Bacteria | 5277 |
| 108 | Ga0070674_100046801 | 3300005356 | Bacteria | 2961 |
| 109 | Ga0070673_100006575 | 3300005364 | Bacteria | 7565 |
| 110 | Ga0070673_100035044 | 3300005364 | Bacteria | 3803 |
| 111 | Ga0070673_100079801 | 3300005364 | Bacteria | 2651 |
| 112 | Ga0070673_100188280 | 3300005364 | Bacteria | 1771 |
| 113 | Ga0070688_100010755 | 3300005365 | Bacteria | 5057 |
| 114 | Ga0070688_100064482 | 3300005365 | Bacteria | 2325 |
| 115 | Ga0070688_100349085 | 3300005365 | Bacteria | 1083 |
| 116 | Ga0070659_100006504 | 3300005366 | Bacteria | 8435 |
| 117 | Ga0070659_100018586 | 3300005366 | Bacteria | 5246 |
| 118 | Ga0070659_100515195 | 3300005366 | Bacteria | 1021 |
| 119 | Ga0070667_100002725 | 3300005367 | Bacteria | 15294 |
| 120 | Ga0070703_10013403 | 3300005406 | Bacteria | 2328 |
| 121 | Ga0070714_100162250 | 3300005435 | Bacteria | 2023 |
| 122 | Ga0070714_100199567 | 3300005435 | Bacteria | 1829 |
| 123 | Ga0070714_100228246 | 3300005435 | Bacteria | 1714 |
| 124 | Ga0070714_100379687 | 3300005435 | Bacteria | 1332 |
| 125 | Ga0070713_100199704 | 3300005436 | Bacteria | 1805 |
| 126 | Ga0070701_10006009 | 3300005438 | Bacteria | 5074 |
| 127 | Ga0070701_10014396 | 3300005438 | Bacteria | 3626 |
| 128 | Ga0070711_100000573 | 3300005439 | Bacteria | 19204 |
| 129 | Ga0070711_100011584 | 3300005439 | Bacteria | 5482 |
| 130 | Ga0070705_100102927 | 3300005440 | Bacteria | 1807 |
| 131 | Ga0070705_100118379 | 3300005440 | Bacteria | 1706 |
| 132 | Ga0070700_100000873 | 3300005441 | Bacteria | 14847 |
| 133 | Ga0070700_100010778 | 3300005441 | Bacteria | 5052 |
| 134 | Ga0070700_100140713 | 3300005441 | Bacteria | 1639 |
| 135 | Ga0070700_100178679 | 3300005441 | Bacteria | 1475 |
| 136 | Ga0070700_100185414 | 3300005441 | Bacteria | 1451 |
| 137 | Ga0070700_100327379 | 3300005441 | Bacteria | 1128 |
| 138 | Ga0070694_100007979 | 3300005444 | Bacteria | 6471 |
| 139 | Ga0070694_100016139 | 3300005444 | Bacteria | 4701 |
| 140 | Ga0070694_100020354 | 3300005444 | Bacteria | 4229 |
| 141 | Ga0070694_100121480 | 3300005444 | Bacteria | 1875 |
| 142 | Ga0070694_100200345 | 3300005444 | Bacteria | 1488 |
| 143 | Ga0070708_100002874 | 3300005445 | Bacteria | 13363 |
| 144 | Ga0070708_100007162 | 3300005445 | Bacteria | 8902 |
| 145 | Ga0070708_100108813 | 3300005445 | Bacteria | 2546 |
| 146 | Ga0070708_100131073 | 3300005445 | Bacteria | 2320 |
| 147 | Ga0070708_100143829 | 3300005445 | Bacteria | 2213 |
| 148 | Ga0070708_100187614 | 3300005445 | Bacteria | 1934 |
| 149 | Ga0070708_100222381 | 3300005445 | Bacteria | 1771 |
| 150 | Ga0070708_100309654 | 3300005445 | Bacteria | 1487 |
| 151 | Ga0070708_100571710 | 3300005445 | Bacteria | 1066 |
| 152 | Ga0070708_100609100 | 3300005445 | Bacteria | 1030 |
| 153 | Ga0070663_100010247 | 3300005455 | Bacteria | 5838 |
| 154 | Ga0070678_100002470 | 3300005456 | Bacteria | 10128 |
| 155 | Ga0070678_100022270 | 3300005456 | Bacteria | 4194 |
| 156 | Ga0070678_100073268 | 3300005456 | Bacteria | 2570 |
| 157 | Ga0070678_100230187 | 3300005456 | Bacteria | 1545 |
| 158 | Ga0070662_100042004 | 3300005457 | Bacteria | 3265 |
| 159 | Ga0070662_100251226 | 3300005457 | Unclassified | 1422 |
| 160 | Ga0070662_100254346 | 3300005457 | Bacteria | 1413 |
| 161 | Ga0070681_10004276 | 3300005458 | Bacteria | 13556 |
| 162 | Ga0070681_10032172 | 3300005458 | Bacteria | 5264 |
| 163 | Ga0070681_10106650 | 3300005458 | Bacteria | 2743 |
| 164 | Ga0068867_100103857 | 3300005459 | Bacteria | 2174 |
| 165 | Ga0068867_100186133 | 3300005459 | Bacteria | 1654 |
| 166 | Ga0068867_100377956 | 3300005459 | Bacteria | 1189 |
| 167 | Ga0068867_100506244 | 3300005459 | Bacteria | 1039 |
| 168 | Ga0070685_10011484 | 3300005466 | Bacteria | 4636 |
| 169 | Ga0070706_100000300 | 3300005467 | Bacteria | 60347 |
| 170 | Ga0070706_100000324 | 3300005467 | Bacteria | 58179 |
| 171 | Ga0070706_100002853 | 3300005467 | Bacteria | 17254 |
| 172 | Ga0070706_100005770 | 3300005467 | Bacteria | 11760 |
| 173 | Ga0070706_100010526 | 3300005467 | Bacteria | 8585 |
| 174 | Ga0070706_100037208 | 3300005467 | Bacteria | 4495 |
| 175 | Ga0070706_100045174 | 3300005467 | Bacteria | 4069 |
| 176 | Ga0070706_100047206 | 3300005467 | Bacteria | 3973 |
| 177 | Ga0070706_100061000 | 3300005467 | Bacteria | 3482 |
| 178 | Ga0070706_100098289 | 3300005467 | Bacteria | 2720 |
| 179 | Ga0070706_100112232 | 3300005467 | Bacteria | 2537 |
| 180 | Ga0070706_100130000 | 3300005467 | Unclassified | 2350 |
| 181 | Ga0070706_100195373 | 3300005467 | Bacteria | 1890 |
| 182 | Ga0070706_100210458 | 3300005467 | Bacteria | 1816 |
| 183 | Ga0070706_100216245 | 3300005467 | Bacteria | 1789 |
| 184 | Ga0070706_100327815 | 3300005467 | Bacteria | 1428 |
| 185 | Ga0070707_100000134 | 3300005468 | Bacteria | 69611 |
| 186 | Ga0070707_100000410 | 3300005468 | Bacteria | 42459 |
| 187 | Ga0070707_100010272 | 3300005468 | Bacteria | 8719 |
| 188 | Ga0070707_100012475 | 3300005468 | Bacteria | 7937 |
| 189 | Ga0070707_100041760 | 3300005468 | Bacteria | 4390 |
| 190 | Ga0070707_100043311 | 3300005468 | Bacteria | 4309 |
| 191 | Ga0070707_100073922 | 3300005468 | Bacteria | 3286 |
| 192 | Ga0070707_100077531 | 3300005468 | Bacteria | 3207 |
| 193 | Ga0070707_100125636 | 3300005468 | Bacteria | 2492 |
| 194 | Ga0070707_100190623 | 3300005468 | Bacteria | 1999 |
| 195 | Ga0070707_100197402 | 3300005468 | Bacteria | 1961 |
| 196 | Ga0070707_100246452 | 3300005468 | Bacteria | 1739 |
| 197 | Ga0070707_100342260 | 3300005468 | Bacteria | 1453 |
| 198 | Ga0070707_100371939 | 3300005468 | Bacteria | 1388 |
| 199 | Ga0070698_100005364 | 3300005471 | Bacteria | 14023 |
| 200 | Ga0070698_100006202 | 3300005471 | Bacteria | 13017 |
| 201 | Ga0070698_100010399 | 3300005471 | Bacteria | 9938 |
| 202 | Ga0070698_100012448 | 3300005471 | Bacteria | 9003 |
| 203 | Ga0070698_100048959 | 3300005471 | Bacteria | 4317 |
| 204 | Ga0070698_100052816 | 3300005471 | Bacteria | 4132 |
| 205 | Ga0070698_100069732 | 3300005471 | Bacteria | 3528 |
| 206 | Ga0070698_100085466 | 3300005471 | Bacteria | 3142 |
| 207 | Ga0070698_100122724 | 3300005471 | Bacteria | 2556 |
| 208 | Ga0070698_100171560 | 3300005471 | Bacteria | 2110 |
| 209 | Ga0070698_100244272 | 3300005471 | Bacteria | 1728 |
| 210 | Ga0070698_100343149 | 3300005471 | Bacteria | 1425 |
| 211 | Ga0070699_100002048 | 3300005518 | Bacteria | 18222 |
| 212 | Ga0070699_100136302 | 3300005518 | Bacteria | 2166 |
| 213 | Ga0070679_100000855 | 3300005530 | Bacteria | 26483 |
| 214 | Ga0070679_100011324 | 3300005530 | Bacteria | 8503 |
| 215 | Ga0070679_100046538 | 3300005530 | Bacteria | 4323 |
| 216 | Ga0070679_100081100 | 3300005530 | Bacteria | 3234 |
| 217 | Ga0070679_100218388 | 3300005530 | Bacteria | 1868 |
| 218 | Ga0070684_100000767 | 3300005535 | Bacteria | 22255 |
| 219 | Ga0070684_100070238 | 3300005535 | Bacteria | 3081 |
| 220 | Ga0070684_100106316 | 3300005535 | Bacteria | 2512 |
| 221 | Ga0070697_100000073 | 3300005536 | Bacteria | 79804 |
| 222 | Ga0070697_100000434 | 3300005536 | Bacteria | 32091 |
| 223 | Ga0070697_100009541 | 3300005536 | Bacteria | 7581 |
| 224 | Ga0070697_100010698 | 3300005536 | Bacteria | 7162 |
| 225 | Ga0070697_100022676 | 3300005536 | Bacteria | 4987 |
| 226 | Ga0070697_100055191 | 3300005536 | Bacteria | 3230 |
| 227 | Ga0070697_100152914 | 3300005536 | Bacteria | 1946 |
| 228 | Ga0068853_100091746 | 3300005539 | Bacteria | 2672 |
| 229 | Ga0068853_100478669 | 3300005539 | Bacteria | 1173 |
| 230 | Ga0070672_100020621 | 3300005543 | Bacteria | 4811 |
| 231 | Ga0070672_100050713 | 3300005543 | Bacteria | 3234 |
| 232 | Ga0070672_100065252 | 3300005543 | Bacteria | 2879 |
| 233 | Ga0070672_100080599 | 3300005543 | Bacteria | 2608 |
| 234 | Ga0070672_100390418 | 3300005543 | Bacteria | 1192 |
| 235 | Ga0070672_100617106 | 3300005543 | Bacteria | 945 |
| 236 | Ga0070686_100001814 | 3300005544 | Bacteria | 11907 |
| 237 | Ga0070686_100005111 | 3300005544 | Bacteria | 7243 |
| 238 | Ga0070686_100036953 | 3300005544 | Bacteria | 3027 |
| 239 | Ga0070695_100073291 | 3300005545 | Bacteria | 2247 |
| 240 | Ga0070695_100089194 | 3300005545 | Bacteria | 2055 |
| 241 | Ga0070695_100297090 | 3300005545 | Bacteria | 1192 |
| 242 | Ga0070695_100315487 | 3300005545 | Bacteria | 1160 |
| 243 | Ga0070695_100428682 | 3300005545 | Bacteria | 1009 |
| 244 | Ga0070696_100034477 | 3300005546 | Bacteria | 3482 |
| 245 | Ga0070696_100068312 | 3300005546 | Bacteria | 2495 |
| 246 | Ga0070696_100422675 | 3300005546 | Bacteria | 1047 |
| 247 | Ga0070693_100012304 | 3300005547 | Bacteria | 4328 |
| 248 | Ga0070693_100032890 | 3300005547 | Bacteria | 2857 |
| 249 | Ga0070693_100164552 | 3300005547 | Bacteria | 1416 |
| 250 | Ga0070665_100015168 | 3300005548 | Bacteria | 7737 |
| 251 | Ga0070665_100015437 | 3300005548 | Bacteria | 7670 |
| 252 | Ga0070665_100045184 | 3300005548 | Bacteria | 4423 |
| 253 | Ga0070665_100072418 | 3300005548 | Bacteria | 3454 |
| 254 | Ga0070665_100099176 | 3300005548 | Bacteria | 2917 |
| 255 | Ga0070665_100118414 | 3300005548 | Bacteria | 2650 |
| 256 | Ga0070665_100228242 | 3300005548 | Bacteria | 1862 |
| 257 | Ga0070665_100561529 | 3300005548 | Bacteria | 1154 |
| 258 | Ga0070704_100006310 | 3300005549 | Bacteria | 6985 |
| 259 | Ga0070704_100065911 | 3300005549 | Bacteria | 2609 |
| 260 | Ga0070704_100196946 | 3300005549 | Bacteria | 1624 |
| 261 | Ga0070704_100246759 | 3300005549 | Bacteria | 1464 |
| 262 | Ga0070704_100365696 | 3300005549 | Bacteria | 1222 |
| 263 | Ga0068855_100000317 | 3300005563 | Bacteria | 60056 |
| 264 | Ga0068855_100016293 | 3300005563 | Bacteria | 8939 |
| 265 | Ga0068855_100246781 | 3300005563 | Bacteria | 1993 |
| 266 | Ga0068855_100620805 | 3300005563 | Bacteria | 1164 |
| 267 | Ga0070664_100001757 | 3300005564 | Bacteria | 17353 |
| 268 | Ga0068857_100018683 | 3300005577 | Bacteria | 6085 |
| 269 | Ga0068857_100085810 | 3300005577 | Bacteria | 2814 |
| 270 | Ga0068857_100601794 | 3300005577 | Bacteria | 1039 |
| 271 | Ga0068854_100042948 | 3300005578 | Bacteria | 3202 |
| 272 | Ga0068854_100189738 | 3300005578 | Bacteria | 1610 |
| 273 | Ga0068854_100230753 | 3300005578 | Bacteria | 1469 |
| 274 | Ga0068856_100047226 | 3300005614 | Bacteria | 4241 |
| 275 | Ga0068856_100091023 | 3300005614 | Bacteria | 3035 |
| 276 | Ga0068856_100148366 | 3300005614 | Bacteria | 2353 |
| 277 | Ga0070702_100006879 | 3300005615 | Bacteria | 5414 |
| 278 | Ga0070702_100036426 | 3300005615 | Bacteria | 2725 |
| 279 | Ga0070702_100136457 | 3300005615 | Unclassified | 1557 |
| 280 | Ga0070702_100156106 | 3300005615 | Bacteria | 1470 |
| 281 | Ga0068852_100716771 | 3300005616 | Bacteria | 1011 |
| 282 | Ga0068859_100027035 | 3300005617 | Bacteria | 5755 |
| 283 | Ga0068859_100093076 | 3300005617 | Bacteria | 3066 |
| 284 | Ga0068859_100120098 | 3300005617 | Unclassified | 2695 |
| 285 | Ga0068859_100232342 | 3300005617 | Bacteria | 1932 |
| 286 | Ga0068859_100267383 | 3300005617 | Bacteria | 1802 |
| 287 | Ga0068859_100392189 | 3300005617 | Bacteria | 1484 |
| 288 | Ga0068864_100002273 | 3300005618 | Bacteria | 15887 |
| 289 | Ga0068864_100017314 | 3300005618 | Bacteria | 6008 |
| 290 | Ga0068864_100024947 | 3300005618 | Bacteria | 5031 |
| 291 | Ga0068864_100186109 | 3300005618 | Bacteria | 1901 |
| 292 | Ga0068864_100606335 | 3300005618 | Bacteria | 1063 |
| 293 | Ga0068864_100934592 | 3300005618 | Bacteria | 857 |
| 294 | Ga0068866_10001025 | 3300005718 | Bacteria | 12288 |
| 295 | Ga0068866_10031102 | 3300005718 | Bacteria | 2568 |
| 296 | Ga0068861_100070068 | 3300005719 | Bacteria | 2715 |
| 297 | Ga0068861_100118413 | 3300005719 | Bacteria | 2133 |
| 298 | Ga0068861_100158919 | 3300005719 | Bacteria | 1862 |
| 299 | Ga0068851_10009338 | 3300005834 | Bacteria | 4556 |
| 300 | Ga0068870_10029737 | 3300005840 | Bacteria | 2754 |
| 301 | Ga0068870_10035367 | 3300005840 | Bacteria | 2563 |
| 302 | Ga0068863_100030593 | 3300005841 | Bacteria | 5140 |
| 303 | Ga0068863_100036293 | 3300005841 | Bacteria | 4695 |
| 304 | Ga0068863_100120637 | 3300005841 | Bacteria | 2500 |
| 305 | Ga0068863_100146048 | 3300005841 | Bacteria | 2262 |
| 306 | Ga0068863_100147631 | 3300005841 | Bacteria | 2250 |
| 307 | Ga0068863_100773500 | 3300005841 | Bacteria | 957 |
| 308 | Ga0068858_100025999 | 3300005842 | Bacteria | 5444 |
| 309 | Ga0068858_100062964 | 3300005842 | Bacteria | 3431 |
| 310 | Ga0068858_100096659 | 3300005842 | Bacteria | 2753 |
| 311 | Ga0068858_100150457 | 3300005842 | Bacteria | 2188 |
| 312 | Ga0068858_100251953 | 3300005842 | Bacteria | 1677 |
| 313 | Ga0068858_100313982 | 3300005842 | Bacteria | 1497 |
| 314 | Ga0068860_100009989 | 3300005843 | Bacteria | 9407 |
| 315 | Ga0068860_100012441 | 3300005843 | Bacteria | 8380 |
| 316 | Ga0068860_100041635 | 3300005843 | Unclassified | 4388 |
| 317 | Ga0068860_100119954 | 3300005843 | Bacteria | 2518 |
| 318 | Ga0068860_100234084 | 3300005843 | Bacteria | 1785 |
| 319 | Ga0068860_100324855 | 3300005843 | Bacteria | 1510 |
| 320 | Ga0068862_100017359 | 3300005844 | Bacteria | 5992 |
| 321 | Ga0068862_100040100 | 3300005844 | Bacteria | 3980 |
| 322 | Ga0068862_100128165 | 3300005844 | Bacteria | 2242 |
| 323 | Ga0068862_100478769 | 3300005844 | Bacteria | 1178 |
| 324 | Ga0081455_10001854 | 3300005937 | Bacteria | 25440 |
| 325 | Ga0081455_10004819 | 3300005937 | Bacteria | 14992 |
| 326 | Ga0081455_10022064 | 3300005937 | Bacteria | 5959 |
| 327 | Ga0081455_10031049 | 3300005937 | Bacteria | 4841 |
| 328 | Ga0081455_10032755 | 3300005937 | Bacteria | 4679 |
| 329 | Ga0081455_10035616 | 3300005937 | Bacteria | 4445 |
| 330 | Ga0081455_10161693 | 3300005937 | Bacteria | 1715 |
| 331 | Ga0081540_1000127 | 3300005983 | Bacteria | 80551 |
| 332 | Ga0081540_1012719 | 3300005983 | Bacteria | 5516 |
| 333 | Ga0081539_10000138 | 3300005985 | Bacteria | 170633 |
| 334 | Ga0081539_10000990 | 3300005985 | Bacteria | 52811 |
| 335 | Ga0081539_10001905 | 3300005985 | Bacteria | 32324 |
| 336 | Ga0081539_10002025 | 3300005985 | Bacteria | 30560 |
| 337 | Ga0081539_10068826 | 3300005985 | Bacteria | 1908 |
| 338 | Ga0081539_10088408 | 3300005985 | Bacteria | 1607 |
| 339 | Ga0070717_10018213 | 3300006028 | Bacteria | 5481 |
| 340 | Ga0070717_10043237 | 3300006028 | Bacteria | 3676 |
| 341 | Ga0070717_10292274 | 3300006028 | Bacteria | 1447 |
| 342 | Ga0070715_10000279 | 3300006163 | Bacteria | 12439 |
| 343 | Ga0070715_10000601 | 3300006163 | Bacteria | 9503 |
| 344 | Ga0070715_10025869 | 3300006163 | Bacteria | 2329 |
| 345 | Ga0070716_100240270 | 3300006173 | Bacteria | 1228 |
| 346 | Ga0070716_100294463 | 3300006173 | Bacteria | 1126 |
| 347 | Ga0070712_100397421 | 3300006175 | Bacteria | 1138 |
| 348 | Ga0075362_10000964 | 3300006177 | Bacteria | 8805 |
| 349 | Ga0075366_10008847 | 3300006195 | Bacteria | 5609 |
| 350 | Ga0075366_10075139 | 3300006195 | Bacteria | 2016 |
| 351 | Ga0097621_100009963 | 3300006237 | Bacteria | 6926 |
| 352 | Ga0097621_100030540 | 3300006237 | Bacteria | 4267 |
| 353 | Ga0097621_100067046 | 3300006237 | Bacteria | 2957 |
| 354 | Ga0097621_100373227 | 3300006237 | Bacteria | 1273 |
| 355 | Ga0075370_10000297 | 3300006353 | Bacteria | 17823 |
| 356 | Ga0068871_100001915 | 3300006358 | Bacteria | 14079 |
| 357 | Ga0068871_100012233 | 3300006358 | Bacteria | 6318 |
| 358 | Ga0068871_100028997 | 3300006358 | Bacteria | 4344 |
| 359 | Ga0068871_100032982 | 3300006358 | Bacteria | 4095 |
| 360 | Ga0068871_100034330 | 3300006358 | Bacteria | 4025 |
| 361 | Ga0068871_100058797 | 3300006358 | Bacteria | 3131 |
| 362 | Ga0068871_100081325 | 3300006358 | Bacteria | 2684 |
| 363 | Ga0068871_100226258 | 3300006358 | Bacteria | 1622 |
| 364 | Ga0075428_100000046 | 3300006844 | Bacteria | 96992 |
| 365 | Ga0075428_100087688 | 3300006844 | Bacteria | 3394 |
| 366 | Ga0075428_100095554 | 3300006844 | Bacteria | 3240 |
| 367 | Ga0075428_100439281 | 3300006844 | Bacteria | 1398 |
| 368 | Ga0075431_100056921 | 3300006847 | Bacteria | 4032 |
| 369 | Ga0075433_10053355 | 3300006852 | Bacteria | 3524 |
| 370 | Ga0075433_10080661 | 3300006852 | Bacteria | 2869 |
| 371 | Ga0075434_100075295 | 3300006871 | Bacteria | 3368 |
| 372 | Ga0075434_100092275 | 3300006871 | Bacteria | 3030 |
| 373 | Ga0075434_100103542 | 3300006871 | Bacteria | 2855 |
| 374 | Ga0075434_100127995 | 3300006871 | Bacteria | 2557 |
| 375 | Ga0075434_100312698 | 3300006871 | Bacteria | 1591 |
| 376 | Ga0075434_100412573 | 3300006871 | Bacteria | 1371 |
| 377 | Ga0075434_100542006 | 3300006871 | Bacteria | 1183 |
| 378 | Ga0075429_100041851 | 3300006880 | Bacteria | 3988 |
| 379 | Ga0075429_100111008 | 3300006880 | Bacteria | 2397 |
| 380 | Ga0075429_100134230 | 3300006880 | Bacteria | 2165 |
| 381 | Ga0075429_100224920 | 3300006880 | Bacteria | 1644 |
| 382 | Ga0068865_100202506 | 3300006881 | Bacteria | 1542 |
| 383 | Ga0068865_100251390 | 3300006881 | Bacteria | 1395 |
| 384 | Ga0068865_100442236 | 3300006881 | Bacteria | 1073 |
| 385 | Ga0075436_100038914 | 3300006914 | Bacteria | 3282 |
| 386 | Ga0075436_100073735 | 3300006914 | Bacteria | 2363 |
| 387 | Ga0097620_100027036 | 3300006931 | Bacteria | 5755 |
| 388 | Ga0097620_100093077 | 3300006931 | Bacteria | 3066 |
| 389 | Ga0097620_100120101 | 3300006931 | Unclassified | 2695 |
| 390 | Ga0097620_100232352 | 3300006931 | Bacteria | 1932 |
| 391 | Ga0097620_100267377 | 3300006931 | Bacteria | 1802 |
| 392 | Ga0097620_100392207 | 3300006931 | Bacteria | 1484 |
| 393 | Ga0075435_100371439 | 3300007076 | Bacteria | 1228 |
| 394 | Ga0075435_100492164 | 3300007076 | Bacteria | 1060 |
| 395 | Ga0099795_10028348 | 3300007788 | Bacteria | 1903 |
| 396 | Ga0105251_10014266 | 3300009011 | Bacteria | 4405 |
| 397 | Ga0105244_10005357 | 3300009036 | Bacteria | 8541 |
| 398 | Ga0105250_10000409 | 3300009092 | Bacteria | 31536 |
| 399 | Ga0105240_10335846 | 3300009093 | Bacteria | 1718 |
| 400 | Ga0105240_10428430 | 3300009093 | Bacteria | 1485 |
| 401 | Ga0111539_10003012 | 3300009094 | Bacteria | 22343 |
| 402 | Ga0111539_10005064 | 3300009094 | Bacteria | 17116 |
| 403 | Ga0111539_10008045 | 3300009094 | Bacteria | 13445 |
| 404 | Ga0111539_10018805 | 3300009094 | Bacteria | 8549 |
| 405 | Ga0111539_10037428 | 3300009094 | Bacteria | 5859 |
| 406 | Ga0111539_10055294 | 3300009094 | Bacteria | 4718 |
| 407 | Ga0111539_10169136 | 3300009094 | Bacteria | 2554 |
| 408 | Ga0111539_10585435 | 3300009094 | Bacteria | 1299 |
| 409 | Ga0105245_10025480 | 3300009098 | Bacteria | 5201 |
| 410 | Ga0105245_10030189 | 3300009098 | Bacteria | 4792 |
| 411 | Ga0105245_10149933 | 3300009098 | Bacteria | 2204 |
| 412 | Ga0105245_10376039 | 3300009098 | Bacteria | 1414 |
| 413 | Ga0105245_10509986 | 3300009098 | Bacteria | 1220 |
| 414 | Ga0105245_10793981 | 3300009098 | Bacteria | 984 |
| 415 | Ga0105247_10000816 | 3300009101 | Bacteria | 23727 |
| 416 | Ga0105247_10002962 | 3300009101 | Bacteria | 11267 |
| 417 | Ga0114129_10020897 | 3300009147 | Bacteria | 9300 |
| 418 | Ga0114129_10066910 | 3300009147 | Bacteria | 5010 |
| 419 | Ga0114129_10074687 | 3300009147 | Bacteria | 4722 |
| 420 | Ga0114129_10101431 | 3300009147 | Bacteria | 3982 |
| 421 | Ga0114129_10159056 | 3300009147 | Bacteria | 3088 |
| 422 | Ga0114129_10247622 | 3300009147 | Bacteria | 2393 |
| 423 | Ga0114129_10257617 | 3300009147 | Bacteria | 2340 |
| 424 | Ga0114129_10285856 | 3300009147 | Bacteria | 2202 |
| 425 | Ga0114129_10312165 | 3300009147 | Bacteria | 2092 |
| 426 | Ga0114129_10576563 | 3300009147 | Bacteria | 1460 |
| 427 | Ga0114129_11034620 | 3300009147 | Bacteria | 1032 |
| 428 | Ga0105243_10000344 | 3300009148 | Bacteria | 50059 |
| 429 | Ga0105243_10014385 | 3300009148 | Bacteria | 5989 |
| 430 | Ga0105243_10034846 | 3300009148 | Bacteria | 3900 |
| 431 | Ga0105241_10006658 | 3300009174 | Bacteria | 8504 |
| 432 | Ga0105241_10014564 | 3300009174 | Bacteria | 5759 |
| 433 | Ga0105241_10446249 | 3300009174 | Bacteria | 1144 |
| 434 | Ga0105242_10004323 | 3300009176 | Bacteria | 11064 |
| 435 | Ga0105248_10012309 | 3300009177 | Bacteria | 9434 |
| 436 | Ga0105248_10043719 | 3300009177 | Bacteria | 5024 |
| 437 | Ga0105248_10046511 | 3300009177 | Bacteria | 4864 |
| 438 | Ga0105237_10134185 | 3300009545 | Bacteria | 2470 |
| 439 | Ga0105238_10019792 | 3300009551 | Bacteria | 6851 |
| 440 | Ga0105238_10211430 | 3300009551 | Bacteria | 1916 |
| 441 | Ga0105238_10250766 | 3300009551 | Bacteria | 1748 |
| 442 | Ga0105249_10000028 | 3300009553 | Bacteria | 230039 |
| 443 | Ga0105249_10008154 | 3300009553 | Bacteria | 9131 |
| 444 | Ga0105249_10010884 | 3300009553 | Bacteria | 7994 |
| 445 | Ga0105249_10044336 | 3300009553 | Bacteria | 4045 |
| 446 | Ga0099796_10029044 | 3300010159 | Bacteria | 1780 |
| 447 | Ga0105239_10028211 | 3300010375 | Bacteria | 6174 |
| 448 | Ga0105239_10069721 | 3300010375 | Bacteria | 3862 |
| 449 | Ga0105239_10283105 | 3300010375 | Bacteria | 1867 |
| 450 | Ga0105246_10236687 | 3300011119 | Bacteria | 1441 |
| 451 | Ga0105246_10302929 | 3300011119 | Bacteria | 1291 |
| 452 | Ga0105246_10321207 | 3300011119 | Bacteria | 1258 |
| 453 | Ga0157374_10003663 | 3300013296 | Bacteria | 12919 |
| 454 | Ga0157374_10010403 | 3300013296 | Bacteria | 7999 |
| 455 | Ga0157374_10013259 | 3300013296 | Bacteria | 7191 |
| 456 | Ga0157374_10056057 | 3300013296 | Bacteria | 3679 |
| 457 | Ga0157374_10089726 | 3300013296 | Bacteria | 2929 |
| 458 | Ga0157374_10105063 | 3300013296 | Bacteria | 2712 |
| 459 | Ga0157374_10294866 | 3300013296 | Bacteria | 1604 |
| 460 | Ga0157378_10000019 | 3300013297 | Bacteria | 132704 |
| 461 | Ga0157378_10002954 | 3300013297 | Bacteria | 15117 |
| 462 | Ga0157378_10005123 | 3300013297 | Bacteria | 11506 |
| 463 | Ga0157378_10005155 | 3300013297 | Bacteria | 11472 |
| 464 | Ga0157378_10023819 | 3300013297 | Bacteria | 5386 |
| 465 | Ga0157378_10073043 | 3300013297 | Bacteria | 3083 |
| 466 | Ga0157378_10222625 | 3300013297 | Bacteria | 1794 |
| 467 | Ga0157378_10300211 | 3300013297 | Bacteria | 1554 |
| 468 | Ga0157378_10429427 | 3300013297 | Bacteria | 1307 |
| 469 | Ga0157378_10436697 | 3300013297 | Unclassified | 1297 |
| 470 | Ga0163162_10000019 | 3300013306 | Bacteria | 220603 |
| 471 | Ga0163162_10006123 | 3300013306 | Bacteria | 11647 |
| 472 | Ga0163162_10008619 | 3300013306 | Bacteria | 9937 |
| 473 | Ga0163162_10010329 | 3300013306 | Bacteria | 9074 |
| 474 | Ga0163162_10012362 | 3300013306 | Bacteria | 8335 |
| 475 | Ga0163162_10039944 | 3300013306 | Bacteria | 4690 |
| 476 | Ga0163162_10176119 | 3300013306 | Unclassified | 2264 |
| 477 | Ga0163162_10256493 | 3300013306 | Bacteria | 1880 |
| 478 | Ga0157372_10031112 | 3300013307 | Bacteria | 5843 |
| 479 | Ga0157372_10042615 | 3300013307 | Bacteria | 5021 |
| 480 | Ga0157372_10099993 | 3300013307 | Bacteria | 3309 |
| 481 | Ga0157372_10779115 | 3300013307 | Bacteria | 1112 |
| 482 | Ga0157375_10002221 | 3300013308 | Bacteria | 16802 |
| 483 | Ga0157375_10006370 | 3300013308 | Bacteria | 10290 |
| 484 | Ga0157375_10016243 | 3300013308 | Bacteria | 6679 |
| 485 | Ga0157375_10023125 | 3300013308 | Bacteria | 5730 |
| 486 | Ga0157375_10071072 | 3300013308 | Bacteria | 3492 |
| 487 | Ga0157375_10236130 | 3300013308 | Bacteria | 1987 |
| 488 | Ga0157375_10257587 | 3300013308 | Bacteria | 1906 |
| 489 | Ga0157375_10915424 | 3300013308 | Bacteria | 1020 |
| 490 | Ga0163163_10000993 | 3300014325 | Bacteria | 23985 |
| 491 | Ga0163163_10009086 | 3300014325 | Bacteria | 8856 |
| 492 | Ga0163163_10009099 | 3300014325 | Bacteria | 8849 |
| 493 | Ga0163163_10009309 | 3300014325 | Bacteria | 8762 |
| 494 | Ga0163163_10025012 | 3300014325 | Bacteria | 5688 |
| 495 | Ga0163163_10161349 | 3300014325 | Bacteria | 2287 |
| 496 | Ga0163163_10221479 | 3300014325 | Bacteria | 1941 |
| 497 | Ga0163163_10429462 | 3300014325 | Bacteria | 1380 |
| 498 | Ga0157380_10004065 | 3300014326 | Bacteria | 10092 |
| 499 | Ga0157380_10144961 | 3300014326 | Bacteria | 2045 |
| 500 | Ga0182008_10020630 | 3300014497 | Bacteria | 3390 |
| 501 | Ga0157377_10047051 | 3300014745 | Unclassified | 2415 |
| 502 | Ga0157377_10206795 | 3300014745 | Bacteria | 1249 |
| 503 | Ga0157379_10018618 | 3300014968 | Bacteria | 6123 |
| 504 | Ga0157379_10025219 | 3300014968 | Bacteria | 5279 |
| 505 | Ga0157379_10082707 | 3300014968 | Bacteria | 2877 |
| 506 | Ga0157376_10002237 | 3300014969 | Bacteria | 13041 |
| 507 | Ga0157376_10005905 | 3300014969 | Bacteria | 8595 |
| 508 | Ga0157376_10036976 | 3300014969 | Bacteria | 3959 |
| 509 | Ga0157376_10073085 | 3300014969 | Bacteria | 2919 |
| 510 | Ga0157376_10228058 | 3300014969 | Bacteria | 1729 |
| 511 | Ga0157376_10421000 | 3300014969 | Bacteria | 1296 |
| 512 | Ga0182006_1045418 | 3300015261 | Bacteria | 1709 |
| 513 | Ga0163161_10005272 | 3300017792 | Bacteria | 8999 |
| 514 | Ga0163161_10444623 | 3300017792 | Bacteria | 1047 |
| 515 | Ga0213876_10000179 | 3300021384 | Bacteria | 65505 |
| 516 | Ga0213876_10000326 | 3300021384 | Bacteria | 41743 |
| 517 | Ga0213876_10000705 | 3300021384 | Bacteria | 23431 |
| 518 | Ga0207666_1000205 | 3300025271 | Bacteria | 8841 |
| 519 | Ga0207666_1002921 | 3300025271 | Bacteria | 2080 |
| 520 | Ga0207673_1000664 | 3300025290 | Bacteria | 3651 |
| 521 | Ga0209050_1000297 | 3300025298 | Bacteria | 104630 |
| 522 | Ga0207697_10000183 | 3300025315 | Bacteria | 32539 |
| 523 | Ga0207697_10000468 | 3300025315 | Bacteria | 22811 |
| 524 | Ga0207697_10003009 | 3300025315 | Bacteria | 8483 |
| 525 | Ga0207697_10003924 | 3300025315 | Bacteria | 7243 |
| 526 | Ga0207697_10005410 | 3300025315 | Bacteria | 5936 |
| 527 | Ga0207697_10030323 | 3300025315 | Bacteria | 2213 |
| 528 | Ga0207696_1000059 | 3300025711 | Bacteria | 245763 |
| 529 | Ga0207655_1004852 | 3300025728 | Bacteria | 9342 |
| 530 | Ga0207713_1000005 | 3300025735 | Bacteria | 649958 |
| 531 | Ga0207653_10001165 | 3300025885 | Bacteria | 8590 |
| 532 | Ga0207653_10004697 | 3300025885 | Bacteria | 4282 |
| 533 | Ga0207682_10035079 | 3300025893 | Bacteria | 2025 |
| 534 | Ga0207692_10128404 | 3300025898 | Bacteria | 1428 |
| 535 | Ga0207642_10000626 | 3300025899 | Bacteria | 10844 |
| 536 | Ga0207642_10063774 | 3300025899 | Bacteria | 1725 |
| 537 | Ga0207710_10000753 | 3300025900 | Bacteria | 17806 |
| 538 | Ga0207710_10001106 | 3300025900 | Bacteria | 13825 |
| 539 | Ga0207688_10000989 | 3300025901 | Bacteria | 14498 |
| 540 | Ga0207688_10001969 | 3300025901 | Bacteria | 11005 |
| 541 | Ga0207688_10009622 | 3300025901 | Bacteria | 5264 |
| 542 | Ga0207680_10008920 | 3300025903 | Bacteria | 4946 |
| 543 | Ga0207647_10005868 | 3300025904 | Bacteria | 8952 |
| 544 | Ga0207647_10021846 | 3300025904 | Unclassified | 4261 |
| 545 | Ga0207685_10000221 | 3300025905 | Bacteria | 8803 |
| 546 | Ga0207685_10008319 | 3300025905 | Bacteria | 2949 |
| 547 | Ga0207645_10003527 | 3300025907 | Bacteria | 11839 |
| 548 | Ga0207645_10007764 | 3300025907 | Bacteria | 7550 |
| 549 | Ga0207645_10012070 | 3300025907 | Bacteria | 5874 |
| 550 | Ga0207645_10019772 | 3300025907 | Bacteria | 4411 |
| 551 | Ga0207645_10145131 | 3300025907 | Bacteria | 1547 |
| 552 | Ga0207645_10201941 | 3300025907 | Bacteria | 1308 |
| 553 | Ga0207643_10011379 | 3300025908 | Bacteria | 4804 |
| 554 | Ga0207643_10025758 | 3300025908 | Bacteria | 3253 |
| 555 | Ga0207705_10341054 | 3300025909 | Bacteria | 1153 |
| 556 | Ga0207684_10000367 | 3300025910 | Bacteria | 60978 |
| 557 | Ga0207684_10000390 | 3300025910 | Bacteria | 58658 |
| 558 | Ga0207684_10002571 | 3300025910 | Bacteria | 18213 |
| 559 | Ga0207684_10008914 | 3300025910 | Bacteria | 8904 |
| 560 | Ga0207684_10009462 | 3300025910 | Bacteria | 8604 |
| 561 | Ga0207684_10026662 | 3300025910 | Bacteria | 4926 |
| 562 | Ga0207684_10031901 | 3300025910 | Bacteria | 4483 |
| 563 | Ga0207684_10043327 | 3300025910 | Bacteria | 3815 |
| 564 | Ga0207684_10049257 | 3300025910 | Bacteria | 3574 |
| 565 | Ga0207684_10070004 | 3300025910 | Unclassified | 2981 |
| 566 | Ga0207684_10103316 | 3300025910 | Bacteria | 2436 |
| 567 | Ga0207684_10138232 | 3300025910 | Unclassified | 2093 |
| 568 | Ga0207684_10173629 | 3300025910 | Bacteria | 1858 |
| 569 | Ga0207684_10226564 | 3300025910 | Bacteria | 1613 |
| 570 | Ga0207684_10333597 | 3300025910 | Bacteria | 1306 |
| 571 | Ga0207654_10002697 | 3300025911 | Bacteria | 9015 |
| 572 | Ga0207654_10012881 | 3300025911 | Bacteria | 4290 |
| 573 | Ga0207707_10000031 | 3300025912 | Bacteria | 159505 |
| 574 | Ga0207707_10014487 | 3300025912 | Bacteria | 6867 |
| 575 | Ga0207707_10539476 | 3300025912 | Bacteria | 992 |
| 576 | Ga0207671_10055990 | 3300025914 | Bacteria | 2921 |
| 577 | Ga0207671_10311148 | 3300025914 | Bacteria | 1245 |
| 578 | Ga0207693_10000233 | 3300025915 | Bacteria | 51090 |
| 579 | Ga0207693_10073155 | 3300025915 | Bacteria | 2683 |
| 580 | Ga0207693_10076038 | 3300025915 | Bacteria | 2630 |
| 581 | Ga0207663_10007610 | 3300025916 | Bacteria | 5626 |
| 582 | Ga0207663_10208959 | 3300025916 | Bacteria | 1413 |
| 583 | Ga0207663_10421228 | 3300025916 | Bacteria | 1025 |
| 584 | Ga0207660_10002124 | 3300025917 | Bacteria | 13138 |
| 585 | Ga0207660_10151888 | 3300025917 | Bacteria | 1780 |
| 586 | Ga0207662_10006099 | 3300025918 | Bacteria | 6483 |
| 587 | Ga0207662_10032169 | 3300025918 | Unclassified | 3052 |
| 588 | Ga0207662_10032390 | 3300025918 | Bacteria | 3043 |
| 589 | Ga0207662_10051473 | 3300025918 | Bacteria | 2450 |
| 590 | Ga0207662_10066910 | 3300025918 | Bacteria | 2166 |
| 591 | Ga0207662_10163408 | 3300025918 | Bacteria | 1424 |
| 592 | Ga0207662_10193636 | 3300025918 | Bacteria | 1313 |
| 593 | Ga0207657_10023660 | 3300025919 | Bacteria | 5714 |
| 594 | Ga0207657_10062380 | 3300025919 | Bacteria | 3192 |
| 595 | Ga0207657_10175648 | 3300025919 | Bacteria | 1733 |
| 596 | Ga0207657_10202437 | 3300025919 | Bacteria | 1596 |
| 597 | Ga0207657_10269173 | 3300025919 | Bacteria | 1354 |
| 598 | Ga0207649_10024833 | 3300025920 | Bacteria | 3487 |
| 599 | Ga0207649_10126762 | 3300025920 | Bacteria | 1729 |
| 600 | Ga0207649_10176896 | 3300025920 | Bacteria | 1491 |
| 601 | Ga0207652_10000087 | 3300025921 | Bacteria | 99945 |
| 602 | Ga0207652_10019300 | 3300025921 | Bacteria | 5606 |
| 603 | Ga0207652_10027904 | 3300025921 | Bacteria | 4708 |
| 604 | Ga0207652_10068152 | 3300025921 | Bacteria | 3086 |
| 605 | Ga0207652_10184733 | 3300025921 | Bacteria | 1875 |
| 606 | Ga0207646_10000108 | 3300025922 | Bacteria | 112950 |
| 607 | Ga0207646_10001029 | 3300025922 | Bacteria | 35628 |
| 608 | Ga0207646_10048732 | 3300025922 | Bacteria | 3796 |
| 609 | Ga0207646_10055462 | 3300025922 | Bacteria | 3542 |
| 610 | Ga0207646_10099621 | 3300025922 | Bacteria | 2604 |
| 611 | Ga0207646_10101696 | 3300025922 | Bacteria | 2577 |
| 612 | Ga0207646_10115218 | 3300025922 | Bacteria | 2414 |
| 613 | Ga0207646_10126429 | 3300025922 | Bacteria | 2299 |
| 614 | Ga0207646_10133720 | 3300025922 | Bacteria | 2233 |
| 615 | Ga0207646_10143444 | 3300025922 | Bacteria | 2151 |
| 616 | Ga0207646_10378417 | 3300025922 | Bacteria | 1279 |
| 617 | Ga0207646_10438620 | 3300025922 | Bacteria | 1178 |
| 618 | Ga0207646_10491209 | 3300025922 | Bacteria | 1106 |
| 619 | Ga0207646_10517696 | 3300025922 | Bacteria | 1074 |
| 620 | Ga0207681_10000869 | 3300025923 | Bacteria | 19867 |
| 621 | Ga0207681_10003720 | 3300025923 | Bacteria | 9484 |
| 622 | Ga0207681_10023886 | 3300025923 | Bacteria | 3916 |
| 623 | Ga0207681_10041805 | 3300025923 | Bacteria | 3058 |
| 624 | Ga0207681_10056585 | 3300025923 | Bacteria | 2676 |
| 625 | Ga0207681_10153879 | 3300025923 | Bacteria | 1726 |
| 626 | Ga0207681_10252861 | 3300025923 | Bacteria | 1376 |
| 627 | Ga0207694_10007178 | 3300025924 | Bacteria | 8458 |
| 628 | Ga0207694_10203543 | 3300025924 | Bacteria | 1611 |
| 629 | Ga0207694_10338743 | 3300025924 | Bacteria | 1243 |
| 630 | Ga0207650_10000022 | 3300025925 | Bacteria | 318878 |
| 631 | Ga0207650_10009105 | 3300025925 | Bacteria | 6785 |
| 632 | Ga0207650_10012767 | 3300025925 | Bacteria | 5804 |
| 633 | Ga0207650_10364940 | 3300025925 | Bacteria | 1190 |
| 634 | Ga0207659_10026962 | 3300025926 | Bacteria | 3884 |
| 635 | Ga0207687_10016926 | 3300025927 | Bacteria | 4792 |
| 636 | Ga0207687_10068428 | 3300025927 | Bacteria | 2530 |
| 637 | Ga0207700_10010114 | 3300025928 | Bacteria | 5932 |
| 638 | Ga0207700_10175861 | 3300025928 | Bacteria | 1789 |
| 639 | Ga0207664_10141640 | 3300025929 | Bacteria | 2035 |
| 640 | Ga0207664_10217954 | 3300025929 | Bacteria | 1654 |
| 641 | Ga0207664_10315818 | 3300025929 | Bacteria | 1378 |
| 642 | Ga0207644_10001481 | 3300025931 | Bacteria | 15096 |
| 643 | Ga0207644_10010974 | 3300025931 | Bacteria | 5984 |
| 644 | Ga0207644_10023417 | 3300025931 | Bacteria | 4229 |
| 645 | Ga0207644_10043868 | 3300025931 | Bacteria | 3175 |
| 646 | Ga0207644_10054681 | 3300025931 | Bacteria | 2876 |
| 647 | Ga0207644_10071671 | 3300025931 | Bacteria | 2535 |
| 648 | Ga0207644_10074328 | 3300025931 | Bacteria | 2494 |
| 649 | Ga0207690_10019982 | 3300025932 | Bacteria | 4131 |
| 650 | Ga0207690_10040599 | 3300025932 | Bacteria | 3043 |
| 651 | Ga0207690_10165910 | 3300025932 | Bacteria | 1650 |
| 652 | Ga0207706_10038016 | 3300025933 | Bacteria | 4271 |
| 653 | Ga0207706_10049764 | 3300025933 | Bacteria | 3703 |
| 654 | Ga0207706_10075973 | 3300025933 | Bacteria | 2955 |
| 655 | Ga0207706_10086661 | 3300025933 | Bacteria | 2753 |
| 656 | Ga0207706_10290429 | 3300025933 | Unclassified | 1426 |
| 657 | Ga0207686_10074687 | 3300025934 | Bacteria | 2191 |
| 658 | Ga0207709_10000498 | 3300025935 | Bacteria | 35179 |
| 659 | Ga0207709_10012460 | 3300025935 | Bacteria | 4683 |
| 660 | Ga0207709_10097564 | 3300025935 | Bacteria | 1936 |
| 661 | Ga0207670_10000001 | 3300025936 | Bacteria | 949312 |
| 662 | Ga0207670_10023971 | 3300025936 | Unclassified | 3807 |
| 663 | Ga0207670_10025296 | 3300025936 | Bacteria | 3724 |
| 664 | Ga0207670_10025949 | 3300025936 | Bacteria | 3687 |
| 665 | Ga0207670_10031775 | 3300025936 | Bacteria | 3388 |
| 666 | Ga0207670_10146826 | 3300025936 | Bacteria | 1745 |
| 667 | Ga0207670_10311049 | 3300025936 | Bacteria | 1237 |
| 668 | Ga0207669_10024183 | 3300025937 | Bacteria | 3261 |
| 669 | Ga0207669_10036787 | 3300025937 | Bacteria | 2801 |
| 670 | Ga0207669_10067652 | 3300025937 | Bacteria | 2227 |
| 671 | Ga0207704_10036901 | 3300025938 | Bacteria | 2817 |
| 672 | Ga0207704_10252483 | 3300025938 | Bacteria | 1325 |
| 673 | Ga0207704_10277564 | 3300025938 | Bacteria | 1272 |
| 674 | Ga0207665_10006742 | 3300025939 | Bacteria | 7612 |
| 675 | Ga0207665_10124202 | 3300025939 | Bacteria | 1826 |
| 676 | Ga0207665_10363270 | 3300025939 | Bacteria | 1095 |
| 677 | Ga0207691_10000800 | 3300025940 | Bacteria | 31245 |
| 678 | Ga0207691_10045704 | 3300025940 | Bacteria | 4024 |
| 679 | Ga0207691_10048715 | 3300025940 | Bacteria | 3883 |
| 680 | Ga0207691_10062659 | 3300025940 | Bacteria | 3373 |
| 681 | Ga0207691_10197067 | 3300025940 | Bacteria | 1754 |
| 682 | Ga0207691_10297011 | 3300025940 | Bacteria | 1388 |
| 683 | Ga0207691_10299500 | 3300025940 | Bacteria | 1382 |
| 684 | Ga0207711_10005862 | 3300025941 | Bacteria | 10374 |
| 685 | Ga0207711_10026290 | 3300025941 | Bacteria | 4884 |
| 686 | Ga0207711_10037446 | 3300025941 | Bacteria | 4120 |
| 687 | Ga0207689_10004054 | 3300025942 | Bacteria | 13306 |
| 688 | Ga0207689_10014345 | 3300025942 | Bacteria | 6742 |
| 689 | Ga0207689_10088601 | 3300025942 | Bacteria | 2542 |
| 690 | Ga0207689_10089750 | 3300025942 | Bacteria | 2525 |
| 691 | Ga0207689_10315462 | 3300025942 | Bacteria | 1297 |
| 692 | Ga0207661_10027814 | 3300025944 | Bacteria | 4324 |
| 693 | Ga0207661_10102383 | 3300025944 | Bacteria | 2407 |
| 694 | Ga0207679_10013997 | 3300025945 | Bacteria | 5262 |
| 695 | Ga0207679_10074216 | 3300025945 | Bacteria | 2577 |
| 696 | Ga0207679_10106264 | 3300025945 | Bacteria | 2206 |
| 697 | Ga0207679_10252866 | 3300025945 | Bacteria | 1499 |
| 698 | Ga0207667_10002080 | 3300025949 | Bacteria | 25078 |
| 699 | Ga0207667_10012816 | 3300025949 | Bacteria | 9632 |
| 700 | Ga0207651_10013490 | 3300025960 | Bacteria | 4678 |
| 701 | Ga0207651_10028454 | 3300025960 | Bacteria | 3526 |
| 702 | Ga0207651_10448739 | 3300025960 | Bacteria | 1106 |
| 703 | Ga0207712_10000068 | 3300025961 | Bacteria | 130032 |
| 704 | Ga0207712_10065705 | 3300025961 | Bacteria | 2590 |
| 705 | Ga0207668_10010416 | 3300025972 | Bacteria | 5615 |
| 706 | Ga0207668_10033927 | 3300025972 | Bacteria | 3384 |
| 707 | Ga0207668_10141608 | 3300025972 | Unclassified | 1850 |
| 708 | Ga0207668_10225407 | 3300025972 | Bacteria | 1508 |
| 709 | Ga0207668_10233407 | 3300025972 | Bacteria | 1484 |
| 710 | Ga0207668_10288317 | 3300025972 | Bacteria | 1349 |
| 711 | Ga0207640_10101151 | 3300025981 | Bacteria | 2021 |
| 712 | Ga0207640_10224572 | 3300025981 | Bacteria | 1440 |
| 713 | Ga0207677_10019794 | 3300026023 | Bacteria | 4073 |
| 714 | Ga0207677_10054394 | 3300026023 | Bacteria | 2731 |
| 715 | Ga0207677_10240669 | 3300026023 | Bacteria | 1464 |
| 716 | Ga0207677_10314959 | 3300026023 | Bacteria | 1298 |
| 717 | Ga0207703_10040489 | 3300026035 | Bacteria | 3729 |
| 718 | Ga0207703_10048763 | 3300026035 | Bacteria | 3420 |
| 719 | Ga0207703_10090630 | 3300026035 | Bacteria | 2570 |
| 720 | Ga0207703_10184384 | 3300026035 | Bacteria | 1844 |
| 721 | Ga0207639_10002838 | 3300026041 | Bacteria | 11623 |
| 722 | Ga0207639_10068554 | 3300026041 | Bacteria | 2765 |
| 723 | Ga0207639_10583505 | 3300026041 | Bacteria | 1029 |
| 724 | Ga0207678_10008966 | 3300026067 | Bacteria | 8804 |
| 725 | Ga0207678_10021083 | 3300026067 | Bacteria | 5712 |
| 726 | Ga0207708_10000340 | 3300026075 | Bacteria | 36852 |
| 727 | Ga0207708_10011859 | 3300026075 | Bacteria | 6490 |
| 728 | Ga0207708_10020250 | 3300026075 | Bacteria | 5017 |
| 729 | Ga0207708_10021633 | 3300026075 | Bacteria | 4851 |
| 730 | Ga0207708_10022189 | 3300026075 | Bacteria | 4794 |
| 731 | Ga0207708_10045653 | 3300026075 | Bacteria | 3338 |
| 732 | Ga0207708_10111039 | 3300026075 | Bacteria | 2128 |
| 733 | Ga0207708_10196029 | 3300026075 | Bacteria | 1609 |
| 734 | Ga0207702_10131695 | 3300026078 | Bacteria | 2251 |
| 735 | Ga0207702_10353794 | 3300026078 | Bacteria | 1406 |
| 736 | Ga0207641_10028499 | 3300026088 | Bacteria | 4615 |
| 737 | Ga0207641_10101447 | 3300026088 | Bacteria | 2536 |
| 738 | Ga0207641_10160793 | 3300026088 | Bacteria | 2042 |
| 739 | Ga0207641_10173337 | 3300026088 | Bacteria | 1971 |
| 740 | Ga0207641_10368646 | 3300026088 | Bacteria | 1373 |
| 741 | Ga0207648_10033690 | 3300026089 | Bacteria | 4517 |
| 742 | Ga0207648_10043816 | 3300026089 | Bacteria | 3928 |
| 743 | Ga0207648_10053356 | 3300026089 | Bacteria | 3534 |
| 744 | Ga0207648_10069294 | 3300026089 | Bacteria | 3073 |
| 745 | Ga0207648_10250541 | 3300026089 | Bacteria | 1579 |
| 746 | Ga0207676_10002507 | 3300026095 | Bacteria | 13082 |
| 747 | Ga0207676_10093014 | 3300026095 | Bacteria | 2481 |
| 748 | Ga0207676_10110041 | 3300026095 | Bacteria | 2304 |
| 749 | Ga0207676_10124786 | 3300026095 | Bacteria | 2178 |
| 750 | Ga0207674_10001039 | 3300026116 | Bacteria | 36064 |
| 751 | Ga0207674_10075746 | 3300026116 | Bacteria | 3374 |
| 752 | Ga0207675_100002039 | 3300026118 | Bacteria | 20154 |
| 753 | Ga0207675_100007403 | 3300026118 | Bacteria | 10375 |
| 754 | Ga0207675_100027424 | 3300026118 | Bacteria | 5305 |
| 755 | Ga0207675_100090879 | 3300026118 | Bacteria | 2870 |
| 756 | Ga0207675_100294967 | 3300026118 | Bacteria | 1578 |
| 757 | Ga0207675_100451145 | 3300026118 | Bacteria | 1274 |
| 758 | Ga0207683_10003536 | 3300026121 | Bacteria | 13627 |
| 759 | Ga0207683_10020785 | 3300026121 | Bacteria | 5616 |
| 760 | Ga0207683_10031317 | 3300026121 | Bacteria | 4616 |
| 761 | Ga0207683_10050855 | 3300026121 | Bacteria | 3630 |
| 762 | Ga0207698_10125377 | 3300026142 | Bacteria | 2183 |
| 763 | Ga0207698_10158473 | 3300026142 | Bacteria | 1976 |
| 764 | Ga0207698_10202074 | 3300026142 | Bacteria | 1780 |
| 765 | Ga0207698_10560889 | 3300026142 | Bacteria | 1121 |
| 766 | Ga0209998_10007442 | 3300027717 | Bacteria | 2271 |
| 767 | Ga0209974_10011412 | 3300027876 | Bacteria | 2983 |
| 768 | Ga0207428_10004079 | 3300027907 | Bacteria | 13992 |
| 769 | Ga0207428_10008809 | 3300027907 | Bacteria | 9100 |
| 770 | Ga0207428_10094881 | 3300027907 | Bacteria | 2311 |
| 771 | Ga0268266_10004452 | 3300028379 | Bacteria | 13400 |
| 772 | Ga0268266_10018440 | 3300028379 | Bacteria | 5946 |
| 773 | Ga0268266_10043315 | 3300028379 | Bacteria | 3846 |
| 774 | Ga0268266_10072831 | 3300028379 | Bacteria | 2980 |
| 775 | Ga0268266_10121817 | 3300028379 | Bacteria | 2322 |
| 776 | Ga0268266_10126509 | 3300028379 | Bacteria | 2281 |
| 777 | Ga0268266_10463418 | 3300028379 | Unclassified | 1206 |
| 778 | Ga0268265_10019938 | 3300028380 | Bacteria | 4671 |
| 779 | Ga0268265_10076684 | 3300028380 | Bacteria | 2623 |
| 780 | Ga0268265_10173869 | 3300028380 | Bacteria | 1844 |
| 781 | Ga0268265_10202348 | 3300028380 | Bacteria | 1724 |
| 782 | Ga0268265_10361295 | 3300028380 | Bacteria | 1329 |
| 783 | Ga0268264_10004034 | 3300028381 | Bacteria | 12574 |
| 784 | Ga0268264_10019083 | 3300028381 | Bacteria | 5606 |
| 785 | Ga0268264_10206756 | 3300028381 | Bacteria | 1799 |
| 786 | Ga0265337_1003995 | 3300028556 | Bacteria | 6240 |
| 787 | Ga0265337_1035432 | 3300028556 | Bacteria | 1462 |
| 788 | Ga0265334_10001475 | 3300028573 | Bacteria | 11338 |
| 789 | Ga0265318_10000008 | 3300028577 | Bacteria | 279221 |
| 790 | Ga0265318_10000180 | 3300028577 | Bacteria | 55904 |
| 791 | Ga0265318_10002167 | 3300028577 | Bacteria | 10646 |
| 792 | Ga0265318_10004680 | 3300028577 | Bacteria | 6572 |
| 793 | Ga0265338_10011598 | 3300028800 | Bacteria | 10158 |
| 794 | Ga0265338_10083512 | 3300028800 | Bacteria | 2671 |
| 795 | Ga0265338_10163280 | 3300028800 | Bacteria | 1718 |
| 796 | Ga0265324_10002968 | 3300029957 | Bacteria | 8299 |
| 797 | Ga0265330_10001004 | 3300031235 | Bacteria | 17173 |
| 798 | Ga0265330_10052710 | 3300031235 | Bacteria | 1781 |
| 799 | Ga0265332_10000359 | 3300031238 | Bacteria | 33943 |
| 800 | Ga0265332_10006786 | 3300031238 | Bacteria | 5188 |
| 801 | Ga0265328_10006299 | 3300031239 | Bacteria | 5038 |
| 802 | Ga0265328_10014019 | 3300031239 | Bacteria | 3163 |
| 803 | Ga0265320_10000132 | 3300031240 | Bacteria | 64612 |
| 804 | Ga0265320_10001253 | 3300031240 | Bacteria | 18635 |
| 805 | Ga0265320_10005602 | 3300031240 | Bacteria | 8028 |
| 806 | Ga0265320_10066480 | 3300031240 | Bacteria | 1708 |
| 807 | Ga0265325_10001876 | 3300031241 | Bacteria | 14502 |
| 808 | Ga0265329_10000642 | 3300031242 | Bacteria | 17841 |
| 809 | Ga0265329_10011713 | 3300031242 | Bacteria | 3179 |
| 810 | Ga0265340_10008907 | 3300031247 | Bacteria | 5407 |
| 811 | Ga0265331_10000004 | 3300031250 | Bacteria | 476985 |
| 812 | Ga0265331_10000107 | 3300031250 | Bacteria | 112221 |
| 813 | Ga0265331_10003038 | 3300031250 | Bacteria | 11011 |
| 814 | Ga0265331_10060813 | 3300031250 | Bacteria | 1784 |
| 815 | Ga0265316_10003795 | 3300031344 | Bacteria | 15187 |
| 816 | Ga0265316_10033762 | 3300031344 | Bacteria | 4162 |
| 817 | Ga0265316_10066087 | 3300031344 | Bacteria | 2799 |
| 818 | Ga0265316_10068740 | 3300031344 | Bacteria | 2735 |
| 819 | Ga0307513_10072931 | 3300031456 | Bacteria | 3576 |
| 820 | Ga0307513_10135603 | 3300031456 | Bacteria | 2398 |
| 821 | Ga0265313_10000005 | 3300031595 | Bacteria | 187978 |
| 822 | Ga0265313_10008560 | 3300031595 | Bacteria | 6775 |
| 823 | Ga0265313_10025639 | 3300031595 | Bacteria | 3118 |
| 824 | Ga0265313_10029971 | 3300031595 | Bacteria | 2807 |
| 825 | Ga0265313_10059262 | 3300031595 | Bacteria | 1801 |
| 826 | Ga0265313_10075513 | 3300031595 | Bacteria | 1542 |
| 827 | Ga0307508_10001711 | 3300031616 | Bacteria | 24345 |
| 828 | Ga0307508_10015699 | 3300031616 | Bacteria | 6901 |
| 829 | Ga0307514_10136217 | 3300031649 | Bacteria | 1680 |
| 830 | Ga0316575_10015656 | 3300031665 | Bacteria | 2860 |
| 831 | Ga0316575_10024897 | 3300031665 | Bacteria | 2319 |
| 832 | Ga0316575_10039769 | 3300031665 | Bacteria | 1857 |
| 833 | Ga0316579_10005547 | 3300031691 | Bacteria | 5103 |
| 834 | Ga0316579_10052553 | 3300031691 | Bacteria | 1908 |
| 835 | Ga0265314_10000014 | 3300031711 | Bacteria | 400363 |
| 836 | Ga0265314_10014645 | 3300031711 | Bacteria | 6259 |
| 837 | Ga0265342_10002890 | 3300031712 | Bacteria | 14484 |
| 838 | Ga0265342_10014365 | 3300031712 | Bacteria | 5258 |
| 839 | Ga0316576_10001523 | 3300031727 | Bacteria | 12541 |
| 840 | Ga0316576_10003780 | 3300031727 | Bacteria | 8948 |
| 841 | Ga0316576_10005532 | 3300031727 | Bacteria | 7734 |
| 842 | Ga0316576_10009486 | 3300031727 | Bacteria | 6284 |
| 843 | Ga0316576_10037418 | 3300031727 | Bacteria | 3474 |
| 844 | Ga0316576_10050002 | 3300031727 | Bacteria | 3038 |
| 845 | Ga0316576_10111352 | 3300031727 | Bacteria | 2052 |
| 846 | Ga0316576_10124977 | 3300031727 | Bacteria | 1933 |
| 847 | Ga0316578_10000298 | 3300031728 | Bacteria | 15146 |
| 848 | Ga0316578_10001642 | 3300031728 | Bacteria | 9286 |
| 849 | Ga0316578_10003723 | 3300031728 | Bacteria | 7045 |
| 850 | Ga0316578_10003753 | 3300031728 | Bacteria | 7025 |
| 851 | Ga0316578_10011873 | 3300031728 | Bacteria | 4574 |
| 852 | Ga0316578_10034042 | 3300031728 | Bacteria | 2923 |
| 853 | Ga0316578_10061058 | 3300031728 | Bacteria | 2220 |
| 854 | Ga0316577_10003314 | 3300031733 | Bacteria | 8115 |
| 855 | Ga0316577_10006633 | 3300031733 | Bacteria | 6128 |
| 856 | Ga0316577_10052834 | 3300031733 | Bacteria | 2267 |
| 857 | Ga0316577_10074495 | 3300031733 | Bacteria | 1895 |
| 858 | Ga0326468_10003958 | 3300031889 | Bacteria | 1277 |
| 859 | Ga0316583_10000505 | 3300032133 | Bacteria | 11690 |
| 860 | Ga0316583_10009740 | 3300032133 | Bacteria | 3462 |
| 861 | Ga0316585_10045646 | 3300032137 | Bacteria | 1402 |
| 862 | Ga0316580_10000153 | 3300032139 | Bacteria | 13473 |
| 863 | Ga0316580_10004207 | 3300032139 | Bacteria | 4156 |
| 864 | Ga0316580_10044053 | 3300032139 | Bacteria | 1377 |
| 865 | Ga0316593_10000959 | 3300032168 | Bacteria | 5951 |
| 866 | Ga0316593_10003375 | 3300032168 | Bacteria | 3955 |
| 867 | Ga0316592_1000668 | 3300033524 | Bacteria | 5017 |
| 868 | Ga0316592_1000957 | 3300033524 | Bacteria | 4436 |
| 869 | Ga0316588_1000091 | 3300033528 | Bacteria | 8336 |
| 870 | Ga0316588_1000365 | 3300033528 | Bacteria | 5871 |
| 871 | Ga0316587_1004347 | 3300033529 | Bacteria | 2058 |
| 872 | Ga0316596_1000506 | 3300033541 | Bacteria | 6646 |
| 873 | Ga0316596_1007623 | 3300033541 | Bacteria | 2562 |
| 874 | Ga0373926_0003662 | 3300035083 | Bacteria | 4992 |
| 875 | Ga0373926_0008228 | 3300035083 | Bacteria | 3472 |
| 876 | Ga0373934_0039508 | 3300035086 | Bacteria | 1861 |
| 877 | Ga0373944_0000300 | 3300035089 | Bacteria | 11008 |
| 878 | Ga0373923_0007689 | 3300035111 | Bacteria | 3804 |
| 879 | Ga0373923_0026065 | 3300035111 | Bacteria | 2323 |
| 880 | Ga0373936_0001801 | 3300035113 | Bacteria | 7878 |
| 881 | Ga0373945_0001062 | 3300035116 | Bacteria | 8257 |
| 882 | Ga0373954_0015706 | 3300035118 | Bacteria | 3387 |
| 883 | Ga0373954_0026976 | 3300035118 | Bacteria | 2635 |
| 884 | Ga0373943_0009602 | 3300035170 | Bacteria | 4337 |
| 885 | Ga0373943_0021970 | 3300035170 | Bacteria | 2951 |
| 886 | Ga0373943_0033948 | 3300035170 | Bacteria | 2433 |
| 887 | Ga0373943_0107302 | 3300035170 | Bacteria | 1468 |
| 888 | Ga0373943_0164165 | 3300035170 | Bacteria | 1211 |
| 889 | Ga0373946_0004684 | 3300035171 | Bacteria | 4912 |
| 890 | Ga0316574_0000893 | 3300035398 | Bacteria | 13204 |
| 891 | Ga0316574_0003767 | 3300035398 | Bacteria | 7856 |
| 892 | Ga0316574_0004153 | 3300035398 | Bacteria | 7545 |
| 893 | Ga0316574_0005203 | 3300035398 | Bacteria | 6917 |
| 894 | Ga0316574_0013618 | 3300035398 | Bacteria | 4680 |
| 895 | Ga0316574_0054821 | 3300035398 | Bacteria | 2491 |
| 896 | Ga0316574_0060801 | 3300035398 | Bacteria | 2372 |
| 897 | Ga0316574_0078769 | 3300035398 | Bacteria | 2089 |
| 898 | Ga0316574_0138411 | 3300035398 | Bacteria | 1568 |
| 899 | Ga0316574_0174634 | 3300035398 | Bacteria | 1383 |
| 900 | Ga0373935_0012338 | 3300035692 | Bacteria | 5142 |
| 901 | Ga0373935_0090812 | 3300035692 | Bacteria | 2000 |
| 902 | Ga0373927_0017296 | 3300035695 | Bacteria | 4747 |
| 903 | Ga0373927_0025437 | 3300035695 | Bacteria | 3870 |
| 904 | Ga0373927_0072817 | 3300035695 | Bacteria | 2224 |
| 905 | Ga0373933_0025859 | 3300035724 | Bacteria | 3368 |
| 906 | Ga0373933_0061395 | 3300035724 | Bacteria | 2268 |
| 907 | Ga0373933_0313419 | 3300035724 | Bacteria | 1017 |
| 908 | Ga0373947_0032854 | 3300035725 | Bacteria | 3060 |
| 909 | Ga0373937_0065710 | 3300036401 | Bacteria | 3339 |
| 910 | Ga0373937_0177187 | 3300036401 | Bacteria | 2001 |
| 911 | Ga0373937_0335685 | 3300036401 | Bacteria | 1431 |
| 912 | Ga0316582_0001897 | 3300036647 | Bacteria | 9508 |
| 913 | Ga0316582_0012384 | 3300036647 | Bacteria | 4757 |
| 914 | Ga0316582_0014120 | 3300036647 | Bacteria | 4522 |
| 915 | Ga0316582_0049380 | 3300036647 | Bacteria | 2661 |
| 916 | Ga0316582_0049512 | 3300036647 | Bacteria | 2658 |
| 917 | Ga0316582_0076514 | 3300036647 | Bacteria | 2177 |
| 918 | Ga0316584_0001074 | 3300036712 | Bacteria | 15985 |
| 919 | Ga0316584_0006706 | 3300036712 | Bacteria | 7808 |
| 920 | Ga0316584_0010384 | 3300036712 | Bacteria | 6503 |
| 921 | Ga0316584_0149609 | 3300036712 | Bacteria | 1738 |
| 922 | Ga0316584_0169645 | 3300036712 | Bacteria | 1619 |
| 923 | Ga0316584_0317498 | 3300036712 | Bacteria | 1125 |
| 924 | Ga0373925_0117130 | 3300037068 | Bacteria | 2064 |
| 925 | Ga0373925_0362394 | 3300037068 | Bacteria | 1178 |
| 926 | Ga0395900_0011095 | 3300037418 | Bacteria | 9210 |
| 927 | Ga0395898_0003987 | 3300037466 | Bacteria | 16251 |
| 928 | Ga0395898_0331115 | 3300037466 | Bacteria | 1452 |
| 929 | Ga0395905_0049970 | 3300037471 | Bacteria | 3919 |
| 930 | Ga0395905_0135095 | 3300037471 | Bacteria | 2320 |
| 931 | Ga0395905_0285311 | 3300037471 | Bacteria | 1538 |
| 932 | Ga0395905_0374596 | 3300037471 | Bacteria | 1317 |
| 933 | Ga0316581_0012938 | 3300037588 | Bacteria | 2358 |
| 934 | Ga0395901_0011017 | 3300038443 | Bacteria | 9159 |
| 935 | Ga0395901_0361882 | 3300038443 | Bacteria | 1496 |
| 936 | Ga0395901_0444269 | 3300038443 | Bacteria | 1327 |
| 937 | Ga0400490_39170 | 3300038726 | Bacteria | 18291 |
| 938 | Ga0400485_18933 | 3300038735 | Bacteria | 34504 |
| 939 | Ga0400488_45668 | 3300038741 | Bacteria | 7510 |
| 940 | Ga0400488_52774 | 3300038741 | Bacteria | 1939 |
| 941 | Ga0400486_27561 | 3300038742 | Bacteria | 87898 |
| 942 | Ga0400489_45403 | 3300039093 | Bacteria | 1334 |
| 943 | Ga0400489_56002 | 3300039093 | Bacteria | 3238 |
| 944 | Ga0400487_07588 | 3300039110 | Bacteria | 2978 |
| 945 | Ga0400487_44815 | 3300039110 | Bacteria | 38740 |
| 946 | Ga0436365_0655171 | 3300039437 | Bacteria | 48662 |
| 947 | Ga0436365_0832581 | 3300039437 | Bacteria | 2300 |
| 948 | Ga0436365_1013692 | 3300039437 | Bacteria | 2077 |
| 949 | Ga0436365_1447325 | 3300039437 | Bacteria | 4349 |
| 950 | Ga0436362_0838041 | 3300039453 | Bacteria | 1316 |
| 951 | Ga0451804_0616426 | 3300041463 | Bacteria | 1562 |
| 952 | Ga0439455_0022535 | 3300042012 | Unclassified | 1510 |
| 953 | Ga0439434_0029046 | 3300042435 | Bacteria | 1676 |
| 954 | Ga0451577_0000062 | 3300042876 | Bacteria | 267945 |
| 955 | Ga0451577_0001080 | 3300042876 | Bacteria | 39089 |
| 956 | Ga0451577_0001358 | 3300042876 | Bacteria | 33020 |
| 957 | Ga0451577_0001729 | 3300042876 | Bacteria | 28147 |
| 958 | Ga0451577_0004291 | 3300042876 | Bacteria | 15138 |
| 959 | Ga0451577_0007527 | 3300042876 | Bacteria | 10694 |
| 960 | Ga0451577_0010592 | 3300042876 | Bacteria | 8794 |
| 961 | Ga0451577_0024870 | 3300042876 | Bacteria | 5440 |
| 962 | Ga0451577_0043273 | 3300042876 | Bacteria | 4034 |
| 963 | Ga0451577_0095906 | 3300042876 | Bacteria | 2648 |
| 964 | Ga0451577_0124316 | 3300042876 | Bacteria | 2311 |
| 965 | Ga0451577_0513264 | 3300042876 | Bacteria | 1088 |
| 966 | Ga0453683_0000571 | 3300044673 | Bacteria | 40713 |
| 967 | Ga0453683_0002186 | 3300044673 | Bacteria | 15557 |
| 968 | Ga0453683_0010074 | 3300044673 | Bacteria | 6281 |
| 969 | Ga0453683_0140089 | 3300044673 | Bacteria | 1526 |
| 970 | Ga0466965_0085186 | 3300044683 | Bacteria | 1602 |
| 971 | Ga0453684_0000020 | 3300044712 | Bacteria | 879938 |
| 972 | Ga0453684_0000258 | 3300044712 | Bacteria | 228312 |
| 973 | Ga0453684_0000749 | 3300044712 | Bacteria | 113060 |
| 974 | Ga0453684_0000877 | 3300044712 | Bacteria | 100674 |
| 975 | Ga0453684_0006977 | 3300044712 | Bacteria | 21144 |
| 976 | Ga0453684_0137697 | 3300044712 | Bacteria | 2920 |
| 977 | Ga0453684_0224507 | 3300044712 | Bacteria | 2173 |
| 978 | Ga0453684_0252304 | 3300044712 | Bacteria | 2025 |
| 979 | Ga0453684_0258707 | 3300044712 | Bacteria | 1995 |
| 980 | Ga0453684_0297024 | 3300044712 | Bacteria | 1837 |
| 981 | Ga0453684_0703623 | 3300044712 | Bacteria | 1098 |
| 982 | Ga0451576_0004827 | 3300045051 | Bacteria | 17259 |
| 983 | Ga0451576_0038233 | 3300045051 | Bacteria | 5079 |
| 984 | Ga0451576_0047981 | 3300045051 | Bacteria | 4488 |
| 985 | Ga0451576_0051337 | 3300045051 | Bacteria | 4324 |
| 986 | Ga0451576_0255481 | 3300045051 | Bacteria | 1831 |
| 987 | Ga0451576_0357240 | 3300045051 | Bacteria | 1530 |
| 988 | Ga0451576_0510312 | 3300045051 | Bacteria | 1263 |
| 989 | Ga0451576_0633530 | 3300045051 | Unclassified | 1123 |
| 990 | Ga0451576_0794048 | 3300045051 | Bacteria | 994 |
| 991 | Ga0466967_0116300 | 3300045976 | Bacteria | 2464 |
| 992 | Ga0495592_0131917 | 3300046454 | Bacteria | 1747 |
| 993 | Ga0495592_0146646 | 3300046454 | Bacteria | 1635 |
| 994 | Ga0495603_0015230 | 3300046455 | Bacteria | 4653 |
| 995 | Ga0495629_0036726 | 3300046459 | Bacteria | 3456 |
| 996 | Ga0495641_0026565 | 3300046461 | Bacteria | 2823 |
| 997 | Ga0495651_0063110 | 3300046462 | Bacteria | 2833 |
| 998 | Ga0495582_0010834 | 3300046473 | Bacteria | 5018 |
| 999 | Ga0495639_0001643 | 3300046475 | Bacteria | 9957 |
| 1000 | Ga0495639_0019588 | 3300046475 | Bacteria | 2955 |
| 1001 | Ga0495639_0093535 | 3300046475 | Bacteria | 1413 |
| 1002 | Ga0495662_0006174 | 3300046476 | Bacteria | 5990 |
| 1003 | Ga0495585_0010471 | 3300046492 | Bacteria | 5515 |
| 1004 | Ga0495618_0229209 | 3300046514 | Bacteria | 1170 |
| 1005 | Ga0495628_0003533 | 3300046516 | Bacteria | 13997 |
| 1006 | Ga0495630_0004915 | 3300046517 | Bacteria | 9394 |
| 1007 | Ga0495630_0078942 | 3300046517 | Bacteria | 2482 |
| 1008 | Ga0495630_0191155 | 3300046517 | Bacteria | 1562 |
| 1009 | Ga0495632_0063816 | 3300046519 | Bacteria | 1783 |
| 1010 | Ga0495643_0000208 | 3300046522 | Bacteria | 90476 |
| 1011 | Ga0495663_0003270 | 3300046525 | Bacteria | 4708 |
| 1012 | Ga0495666_0009535 | 3300046526 | Bacteria | 4850 |
| 1013 | Ga0495652_0070216 | 3300046529 | Bacteria | 2929 |
| 1014 | Ga0495652_0262995 | 3300046529 | Bacteria | 1272 |
| 1015 | Ga0495665_0007185 | 3300046531 | Bacteria | 6010 |
| 1016 | Ga0495665_0010876 | 3300046531 | Bacteria | 4923 |
| 1017 | Ga0495640_0014561 | 3300046533 | Bacteria | 5947 |
| 1018 | Ga0495586_0003922 | 3300046535 | Bacteria | 7979 |
| 1019 | Ga0495586_0045644 | 3300046535 | Bacteria | 2361 |
| 1020 | Ga0495598_0000613 | 3300046537 | Bacteria | 6748 |
| 1021 | Ga0495621_0000644 | 3300046539 | Bacteria | 8780 |
| 1022 | Ga0495621_0014785 | 3300046539 | Bacteria | 2478 |
| 1023 | Ga0495645_0095555 | 3300046543 | Bacteria | 2118 |
| 1024 | Ga0495667_0094114 | 3300046559 | Bacteria | 1940 |
| 1025 | Ga0495656_0002008 | 3300046615 | Bacteria | 6699 |
| 1026 | Ga0495656_0036890 | 3300046615 | Bacteria | 2016 |
| 1027 | Ga0495668_0063726 | 3300046616 | Bacteria | 2030 |
| 1028 | Ga0495634_0031361 | 3300046642 | Bacteria | 3662 |
| 1029 | Ga0495635_0004445 | 3300046663 | Bacteria | 9714 |
| 1030 | Ga0495659_0084201 | 3300046664 | Bacteria | 1212 |
| 1031 | Ga0495588_0000461 | 3300046674 | Bacteria | 20406 |
| 1032 | Ga0495623_0103376 | 3300046679 | Bacteria | 1733 |
| 1033 | Ga0495647_0007010 | 3300046681 | Bacteria | 3755 |
| 1034 | Ga0495658_0000868 | 3300046683 | Bacteria | 16237 |
| 1035 | Ga0495658_0047056 | 3300046683 | Bacteria | 2427 |
| 1036 | Ga0495658_0093790 | 3300046683 | Bacteria | 1782 |
| 1037 | Ga0495658_0122049 | 3300046683 | Bacteria | 1577 |
| 1038 | Ga0495658_0155627 | 3300046683 | Bacteria | 1407 |
| 1039 | Ga0495658_0193414 | 3300046683 | Bacteria | 1266 |
| 1040 | Ga0495658_0315602 | 3300046683 | Bacteria | 990 |
| 1041 | Ga0495613_0007750 | 3300046689 | Bacteria | 7990 |
| 1042 | Ga0495613_0143610 | 3300046689 | Bacteria | 1704 |
| 1043 | Ga0495624_0006404 | 3300046690 | Bacteria | 8351 |
| 1044 | Ga0495624_0115269 | 3300046690 | Bacteria | 1652 |
| 1045 | Ga0495670_0017881 | 3300046691 | Bacteria | 3491 |
| 1046 | Ga0495600_0276939 | 3300046809 | Bacteria | 1063 |
| 1047 | Ga0495581_0002010 | 3300047315 | Bacteria | 11424 |
| 1048 | Ga0495581_0032140 | 3300047315 | Bacteria | 3039 |
| 1049 | Ga0495674_0011893 | 3300047319 | Bacteria | 8204 |
| 1050 | Ga0495674_0179775 | 3300047319 | Bacteria | 1762 |
| 1051 | Ga0495672_0168785 | 3300047320 | Bacteria | 1118 |
| 1052 | Ga0495672_0190656 | 3300047320 | Bacteria | 1031 |
| 1053 | Ga0495680_0010498 | 3300047322 | Bacteria | 8264 |
| 1054 | Ga0495684_0022126 | 3300047471 | Bacteria | 4895 |
| 1055 | Ga0495684_0181472 | 3300047471 | Unclassified | 1560 |
| 1056 | Ga0495602_0073348 | 3300048088 | Bacteria | 2914 |
| 1057 | Ga0496100_0010082 | 3300048903 | Bacteria | 5337 |
| 1058 | Ga0496101_0011665 | 3300048904 | Bacteria | 5838 |
| 1059 | Ga0496101_0142129 | 3300048904 | Bacteria | 1830 |
| 1060 | Ga0496102_0020269 | 3300048905 | Bacteria | 5875 |
| 1061 | Ga0496102_0063143 | 3300048905 | Bacteria | 3391 |
| 1062 | Ga0496102_0075339 | 3300048905 | Bacteria | 3102 |
| 1063 | Ga0496103_0022958 | 3300048906 | Bacteria | 3760 |
| 1064 | Ga0496103_0065336 | 3300048906 | Bacteria | 2269 |
| 1065 | Ga0496104_0185538 | 3300048907 | Bacteria | 1991 |
| 1066 | Ga0496105_0045143 | 3300048908 | Bacteria | 3636 |
| 1067 | Ga0496105_0168048 | 3300048908 | Bacteria | 1799 |
| 1068 | Ga0496106_0024207 | 3300048909 | Bacteria | 4512 |
| 1069 | Ga0496106_0208113 | 3300048909 | Bacteria | 1558 |
| 1070 | Ga0496106_0323222 | 3300048909 | Bacteria | 1238 |
| 1071 | Ga0496106_0361660 | 3300048909 | Bacteria | 1166 |
| 1072 | Ga0496107_0004978 | 3300048910 | Bacteria | 9043 |
| 1073 | Ga0496107_0149136 | 3300048910 | Bacteria | 1730 |
| 1074 | Ga0496108_0013859 | 3300048911 | Bacteria | 6575 |
| 1075 | Ga0496108_0107889 | 3300048911 | Bacteria | 2378 |
| 1076 | Ga0496108_0159356 | 3300048911 | Bacteria | 1950 |
| 1077 | Ga0496109_0007664 | 3300048912 | Bacteria | 9152 |
| 1078 | Ga0496109_0022989 | 3300048912 | Bacteria | 5528 |
| 1079 | Ga0496109_0417315 | 3300048912 | Bacteria | 1268 |
| 1080 | Ga0496109_0427052 | 3300048912 | Bacteria | 1252 |
| 1081 | Ga0496110_0003658 | 3300048913 | Bacteria | 11829 |
| 1082 | Ga0496110_0250574 | 3300048913 | Bacteria | 1612 |
| 1083 | Ga0496110_0371110 | 3300048913 | Bacteria | 1304 |
| 1084 | Ga0496110_0449973 | 3300048913 | Bacteria | 1174 |
| 1085 | Ga0496111_0004083 | 3300048914 | Bacteria | 9169 |
| 1086 | Ga0496112_0067619 | 3300048915 | Bacteria | 3527 |
| 1087 | Ga0496112_0077789 | 3300048915 | Bacteria | 3281 |
| 1088 | Ga0496112_0122475 | 3300048915 | Bacteria | 2571 |
| 1089 | Ga0496112_0412433 | 3300048915 | Bacteria | 1290 |
| 1090 | Ga0496112_0454355 | 3300048915 | Bacteria | 1219 |
| 1091 | Ga0496113_0039232 | 3300048916 | Bacteria | 3485 |
| 1092 | Ga0496114_0031652 | 3300048917 | Bacteria | 4351 |
| 1093 | Ga0496114_0050987 | 3300048917 | Bacteria | 3445 |
| 1094 | Ga0496114_0435025 | 3300048917 | Bacteria | 1162 |
| 1095 | Ga0496115_0018253 | 3300048918 | Bacteria | 5382 |
| 1096 | Ga0496115_0235859 | 3300048918 | Bacteria | 1508 |
| 1097 | Ga0501309_012284 | 3300049129 | Bacteria | 1126 |
| 1098 | Ga0501292_002995 | 3300049515 | Bacteria | 2223 |
| 1099 | Ga0501297_004268 | 3300049520 | Bacteria | 1454 |
| 1100 | Ga0501298_034083 | 3300049521 | Bacteria | 1011 |
| 1101 | Ga0501033_0087604 | 3300049570 | Bacteria | 2279 |
| 1102 | Ga0501034_0033027 | 3300049571 | Bacteria | 5255 |
| 1103 | Ga0501034_0132934 | 3300049571 | Bacteria | 2471 |
| 1104 | Ga0501036_0003125 | 3300049572 | Bacteria | 13213 |
| 1105 | Ga0501036_0051739 | 3300049572 | Bacteria | 3478 |
| 1106 | Ga0501037_0072433 | 3300049573 | Bacteria | 2506 |
| 1107 | Ga0501038_0073618 | 3300049574 | Bacteria | 2892 |
| 1108 | Ga0501039_0049609 | 3300049575 | Bacteria | 3245 |
| 1109 | Ga0501040_0049075 | 3300049576 | Bacteria | 2885 |
| 1110 | Ga0501041_0129563 | 3300049577 | Bacteria | 1571 |
| 1111 | Ga0501042_0035799 | 3300049578 | Bacteria | 3522 |
| 1112 | Ga0501046_0030490 | 3300049580 | Bacteria | 4377 |
| 1113 | Ga0501047_0107839 | 3300049581 | Bacteria | 2667 |
| 1114 | Ga0501048_0006833 | 3300049582 | Bacteria | 8669 |
| 1115 | Ga0501067_0029041 | 3300049583 | Bacteria | 3066 |
| 1116 | Ga0501071_0006225 | 3300049587 | Bacteria | 7742 |
| 1117 | Ga0501071_0233292 | 3300049587 | Bacteria | 1387 |
| 1118 | Ga0501072_0019250 | 3300049588 | Bacteria | 5274 |
| 1119 | Ga0501073_0120872 | 3300049589 | Bacteria | 1815 |
| 1120 | Ga0501073_0136708 | 3300049589 | Bacteria | 1698 |
| 1121 | Ga0501073_0219710 | 3300049589 | Bacteria | 1313 |
| 1122 | Ga0501074_0067954 | 3300049590 | Bacteria | 2562 |
| 1123 | Ga0501075_0007763 | 3300049591 | Bacteria | 7445 |
| 1124 | Ga0501076_0295909 | 3300049592 | Bacteria | 1326 |
| 1125 | Ga0501077_0067672 | 3300049593 | Bacteria | 2264 |
| 1126 | Ga0501077_0115271 | 3300049593 | Bacteria | 1703 |
| 1127 | Ga0501202_003940 | 3300049652 | Bacteria | 2570 |
| 1128 | Ga0501216_003400 | 3300049660 | Bacteria | 2316 |
| 1129 | Ga0501217_023498 | 3300049661 | Bacteria | 1469 |
| 1130 | Ga0501227_002619 | 3300049665 | Bacteria | 3946 |
| 1131 | Ga0501227_043102 | 3300049665 | Bacteria | 1120 |
| 1132 | Ga0501233_055554 | 3300049668 | Bacteria | 970 |
| 1133 | Ga0501249_012831 | 3300049679 | Bacteria | 1775 |
| 1134 | Ga0501234_004398 | 3300049707 | Bacteria | 2215 |
| 1135 | Ga0501079_0022783 | 3300049741 | Bacteria | 4807 |
| 1136 | Ga0501080_0020421 | 3300049742 | Bacteria | 6130 |
| 1137 | Ga0501080_0190316 | 3300049742 | Bacteria | 1886 |
| 1138 | Ga0501083_0001562 | 3300049744 | Bacteria | 15658 |
| 1139 | Ga0501083_0004579 | 3300049744 | Bacteria | 9768 |
| 1140 | Ga0501035_0080250 | 3300049822 | Bacteria | 2881 |
| 1141 | Ga0501045_0000203 | 3300049824 | Bacteria | 33847 |
| 1142 | nmdc:mga03683_2331_c1 | 3300050489 | Bacteria | 5874 |
| 1143 | nmdc:mga03n38_66521_c1 | 3300050490 | Bacteria | 1656 |
| 1144 | nmdc:mga0k408_2689_c1 | 3300050493 | Bacteria | 9422 |
| 1145 | nmdc:mga0k408_297_c1 | 3300050493 | Bacteria | 26903 |
| 1146 | nmdc:mga0k408_52632_c1 | 3300050493 | Bacteria | 2360 |
| 1147 | nmdc:mga07m45_552_c1 | 3300050496 | Bacteria | 8215 |
| 1148 | nmdc:mga05p37_264819_c1 | 3300050507 | Bacteria | 2055 |
| 1149 | nmdc:mga05p37_309777_c1 | 3300050507 | Bacteria | 1872 |
| 1150 | nmdc:mga05p37_430460_c1 | 3300050507 | Bacteria | 1533 |
| 1151 | nmdc:mga05p37_562304_c1 | 3300050507 | Bacteria | 1296 |
| 1152 | nmdc:mga05p37_660079_c1 | 3300050507 | Bacteria | 1169 |
| 1153 | nmdc:mga09592_282174_c1 | 3300050508 | Bacteria | 1440 |
| 1154 | nmdc:mga09592_49210_c1 | 3300050508 | Bacteria | 3554 |
| 1155 | nmdc:mga09592_516992_c1 | 3300050508 | Bacteria | 1027 |
| 1156 | nmdc:mga09592_7872_c1 | 3300050508 | Bacteria | 8662 |
| 1157 | nmdc:mga09592_82183_c1 | 3300050508 | Bacteria | 2745 |
| 1158 | nmdc:mga0qj67_258266_c1 | 3300050509 | Bacteria | 1413 |
| 1159 | nmdc:mga08y16_100123_c1 | 3300050511 | Bacteria | 3017 |
| 1160 | nmdc:mga08y16_117863_c1 | 3300050511 | Bacteria | 2763 |
| 1161 | nmdc:mga08y16_128204_c1 | 3300050511 | Bacteria | 2639 |
| 1162 | nmdc:mga08y16_212372_c1 | 3300050511 | Bacteria | 2004 |
| 1163 | nmdc:mga08y16_21619_c1 | 3300050511 | Bacteria | 6794 |
| 1164 | nmdc:mga08y16_21782_c1 | 3300050511 | Bacteria | 6763 |
| 1165 | nmdc:mga08y16_2819_c1 | 3300050511 | Bacteria | 17855 |
| 1166 | nmdc:mga08y16_427976_c1 | 3300050511 | Bacteria | 1352 |
| 1167 | nmdc:mga08y16_49197_c1 | 3300050511 | Bacteria | 4412 |
| 1168 | nmdc:mga08y16_59840_c1 | 3300050511 | Bacteria | 3979 |
| 1169 | nmdc:mga0n895_176338_c1 | 3300050512 | Bacteria | 2168 |
| 1170 | nmdc:mga0n895_240011_c1 | 3300050512 | Bacteria | 1839 |
| 1171 | nmdc:mga0n895_280369_c1 | 3300050512 | Bacteria | 1690 |
| 1172 | nmdc:mga0n895_31225_c1 | 3300050512 | Bacteria | 5098 |
| 1173 | nmdc:mga0n895_363596_c1 | 3300050512 | Bacteria | 1465 |
| 1174 | nmdc:mga0n895_388763_c1 | 3300050512 | Bacteria | 1411 |
| 1175 | nmdc:mga0rr50_106249_c1 | 3300050513 | Bacteria | 2215 |
| 1176 | nmdc:mga0rr50_376847_c1 | 3300050513 | Bacteria | 1196 |
| 1177 | nmdc:mga08x19_2748_c1 | 3300050514 | Bacteria | 10628 |
| 1178 | nmdc:mga08x19_39022_c1 | 3300050514 | Bacteria | 3018 |
| 1179 | nmdc:mga0a205_17518_c1 | 3300050515 | Bacteria | 6718 |
| 1180 | nmdc:mga0a205_58416_c1 | 3300050515 | Bacteria | 3726 |
| 1181 | nmdc:mga0a205_65592_c1 | 3300050515 | Bacteria | 3508 |
| 1182 | nmdc:mga0a205_80281_c1 | 3300050515 | Bacteria | 3152 |
| 1183 | nmdc:mga0a205_86837_c1 | 3300050515 | Bacteria | 3022 |
| 1184 | Ga0495619_0004035 | 3300053085 | Bacteria | 9401 |
| 1185 | Ga0495619_0137318 | 3300053085 | Bacteria | 1682 |
| 1186 | Ga0500578_0177322 | 3300053086 | Bacteria | 1315 |
| 1187 | Ga0500555_000025 | 3300053103 | Bacteria | 119960 |
| 1188 | Ga0500555_000321 | 3300053103 | Bacteria | 20635 |
| 1189 | Ga0500556_0000370 | 3300053104 | Bacteria | 32830 |
| 1190 | Ga0500642_0006150 | 3300053130 | Bacteria | 3932 |
| 1191 | Ga0500616_0005952 | 3300053153 | Bacteria | 8136 |
| 1192 | Ga0500622_0001124 | 3300053156 | Bacteria | 22305 |
| 1193 | Ga0501084_0003199 | 3300054114 | Bacteria | 13258 |
| 1194 | Ga0501084_0018958 | 3300054114 | Bacteria | 5728 |
| 1195 | Ga0501084_0153393 | 3300054114 | Bacteria | 1942 |
| 1196 | Ga0530510_0020650 | 3300061734 | Bacteria | 4682 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005459 | Ga0068867_100186133 | Ga0068867_1001861332 | 237 |
| 2 | 3300005578 | Ga0068854_100230753 | Ga0068854_1002307533 | 237 |
| 3 | 3300006847 | Ga0075431_100056921 | Ga0075431_1000569216 | 237 |
| 4 | 3300009147 | Ga0114129_11034620 | Ga0114129_110346201 | 237 |
| 5 | 3300009174 | Ga0105241_10446249 | Ga0105241_104462491 | 237 |
| 6 | 3300013308 | Ga0157375_10915424 | Ga0157375_109154241 | 237 |
| 7 | 3300050512 | nmdc:mga0n895_388763_c1 | nmdc:mga0n895_388763_c1_591_1382 | 238 |
| 8 | 3300005618 | Ga0068864_100934592 | Ga0068864_1009345921 | 239 |
| 9 | 3300046475 | Ga0495639_0093535 | Ga0495639_0093535_582_1376 | 239 |
| 10 | 3300046683 | Ga0495658_0155627 | Ga0495658_0155627_29_823 | 239 |
| 11 | 3300005577 | Ga0068857_100085810 | Ga0068857_1000858103 | 242 |
| 12 | 3300048912 | Ga0496109_0427052 | Ga0496109_0427052_160_1020 | 242 |
| 13 | 3300005618 | Ga0068864_100606335 | Ga0068864_1006063351 | 244 |
| 14 | 3300026089 | Ga0207648_10043816 | Ga0207648_100438163 | 244 |
| 15 | 3300025924 | Ga0207694_10007178 | Ga0207694_100071782 | 246 |
| 16 | 3300009147 | Ga0114129_10101431 | Ga0114129_101014317 | 248 |
| 17 | 3300028380 | Ga0268265_10019938 | Ga0268265_100199384 | 248 |
| 18 | 3300002459 | JGI24751J29686_10000050 | JGI24751J29686_1000005043 | 252 |
| 19 | 3300003203 | JGI25406J46586_10001426 | JGI25406J46586_100014265 | 252 |
| 20 | 3300003203 | JGI25406J46586_10037474 | JGI25406J46586_100374743 | 252 |
| 21 | 3300005288 | Ga0065714_10002297 | Ga0065714_100022976 | 252 |
| 22 | 3300005289 | Ga0065704_10111650 | Ga0065704_101116503 | 252 |
| 23 | 3300005293 | Ga0065715_10018359 | Ga0065715_100183591 | 252 |
| 24 | 3300005295 | Ga0065707_10005149 | Ga0065707_100051494 | 252 |
| 25 | 3300005295 | Ga0065707_10203563 | Ga0065707_102035631 | 252 |
| 26 | 3300005331 | Ga0070670_100000439 | Ga0070670_10000043923 | 252 |
| 27 | 3300005337 | Ga0070682_100003960 | Ga0070682_1000039607 | 252 |
| 28 | 3300005337 | Ga0070682_100024319 | Ga0070682_1000243191 | 252 |
| 29 | 3300005345 | Ga0070692_10027516 | Ga0070692_100275162 | 252 |
| 30 | 3300005353 | Ga0070669_100084848 | Ga0070669_1000848482 | 252 |
| 31 | 3300005440 | Ga0070705_100118379 | Ga0070705_1001183791 | 252 |
| 32 | 3300005441 | Ga0070700_100010778 | Ga0070700_1000107782 | 252 |
| 33 | 3300005467 | Ga0070706_100061000 | Ga0070706_1000610002 | 252 |
| 34 | 3300005471 | Ga0070698_100005364 | Ga0070698_1000053647 | 252 |
| 35 | 3300005543 | Ga0070672_100390418 | Ga0070672_1003904182 | 252 |
| 36 | 3300005578 | Ga0068854_100042948 | Ga0068854_1000429482 | 252 |
| 37 | 3300005615 | Ga0070702_100006879 | Ga0070702_1000068792 | 252 |
| 38 | 3300005834 | Ga0068851_10009338 | Ga0068851_100093383 | 252 |
| 39 | 3300005842 | Ga0068858_100096659 | Ga0068858_1000966592 | 252 |
| 40 | 3300005842 | Ga0068858_100313982 | Ga0068858_1003139822 | 252 |
| 41 | 3300005843 | Ga0068860_100009989 | Ga0068860_1000099896 | 252 |
| 42 | 3300006237 | Ga0097621_100067046 | Ga0097621_1000670462 | 252 |
| 43 | 3300006237 | Ga0097621_100373227 | Ga0097621_1003732272 | 252 |
| 44 | 3300006871 | Ga0075434_100412573 | Ga0075434_1004125731 | 252 |
| 45 | 3300006914 | Ga0075436_100073735 | Ga0075436_1000737352 | 252 |
| 46 | 3300009093 | Ga0105240_10335846 | Ga0105240_103358461 | 252 |
| 47 | 3300009094 | Ga0111539_10003012 | Ga0111539_1000301219 | 252 |
| 48 | 3300009101 | Ga0105247_10000816 | Ga0105247_100008169 | 252 |
| 49 | 3300009551 | Ga0105238_10019792 | Ga0105238_100197928 | 252 |
| 50 | 3300009551 | Ga0105238_10250766 | Ga0105238_102507662 | 252 |
| 51 | 3300009553 | Ga0105249_10044336 | Ga0105249_100443364 | 252 |
| 52 | 3300014325 | Ga0163163_10000993 | Ga0163163_1000099324 | 252 |
| 53 | 3300014969 | Ga0157376_10002237 | Ga0157376_1000223714 | 252 |
| 54 | 3300025885 | Ga0207653_10001165 | Ga0207653_100011658 | 252 |
| 55 | 3300025914 | Ga0207671_10311148 | Ga0207671_103111481 | 252 |
| 56 | 3300025924 | Ga0207694_10203543 | Ga0207694_102035431 | 252 |
| 57 | 3300025933 | Ga0207706_10086661 | Ga0207706_100866614 | 252 |
| 58 | 3300025940 | Ga0207691_10197067 | Ga0207691_101970672 | 252 |
| 59 | 3300025940 | Ga0207691_10299500 | Ga0207691_102995002 | 252 |
| 60 | 3300025941 | Ga0207711_10037446 | Ga0207711_100374465 | 252 |
| 61 | 3300025945 | Ga0207679_10252866 | Ga0207679_102528662 | 252 |
| 62 | 3300025981 | Ga0207640_10224572 | Ga0207640_102245722 | 252 |
| 63 | 3300026041 | Ga0207639_10583505 | Ga0207639_105835051 | 252 |
| 64 | 3300026075 | Ga0207708_10020250 | Ga0207708_100202502 | 252 |
| 65 | 3300026142 | Ga0207698_10202074 | Ga0207698_102020742 | 252 |
| 66 | 3300049515 | Ga0501292_002995 | Ga0501292_002995_314_1144 | 252 |
| 67 | 3300049520 | Ga0501297_004268 | Ga0501297_004268_109_939 | 252 |
| 68 | 3300049587 | Ga0501071_0233292 | Ga0501071_0233292_501_1331 | 252 |
| 69 | 3300050511 | nmdc:mga08y16_21782_c1 | nmdc:mga08y16_21782_c1_3969_4799 | 252 |
| 70 | 3300050515 | nmdc:mga0a205_80281_c1 | nmdc:mga0a205_80281_c1_2074_2904 | 252 |
| 71 | 3300005444 | Ga0070694_100121480 | Ga0070694_1001214801 | 253 |
| 72 | 3300005467 | Ga0070706_100210458 | Ga0070706_1002104582 | 253 |
| 73 | 3300005471 | Ga0070698_100052816 | Ga0070698_1000528164 | 253 |
| 74 | 3300005530 | Ga0070679_100218388 | Ga0070679_1002183882 | 253 |
| 75 | 3300009094 | Ga0111539_10037428 | Ga0111539_100374286 | 253 |
| 76 | 3300009147 | Ga0114129_10074687 | Ga0114129_100746873 | 253 |
| 77 | 3300013306 | Ga0163162_10008619 | Ga0163162_100086193 | 253 |
| 78 | 3300014968 | Ga0157379_10082707 | Ga0157379_100827072 | 253 |
| 79 | 3300025910 | Ga0207684_10173629 | Ga0207684_101736292 | 253 |
| 80 | 3300049521 | Ga0501298_034083 | Ga0501298_034083_75_908 | 253 |
| 81 | 3300049652 | Ga0501202_003940 | Ga0501202_003940_730_1563 | 253 |
| 82 | 3300049660 | Ga0501216_003400 | Ga0501216_003400_1305_2138 | 253 |
| 83 | 3300049661 | Ga0501217_023498 | Ga0501217_023498_527_1357 | 253 |
| 84 | 3300049665 | Ga0501227_002619 | Ga0501227_002619_1205_2038 | 253 |
| 85 | 3300049668 | Ga0501233_055554 | Ga0501233_055554_57_890 | 253 |
| 86 | 3300049679 | Ga0501249_012831 | Ga0501249_012831_472_1305 | 253 |
| 87 | 3300050509 | nmdc:mga0qj67_258266_c1 | nmdc:mga0qj67_258266_c1_564_1397 | 253 |
| 88 | 3300005330 | Ga0070690_100008756 | Ga0070690_1000087566 | 254 |
| 89 | 3300005985 | Ga0081539_10001905 | Ga0081539_1000190528 | 256 |
| 90 | 3300005445 | Ga0070708_100222381 | Ga0070708_1002223812 | 257 |
| 91 | 3300005536 | Ga0070697_100152914 | Ga0070697_1001529141 | 257 |
| 92 | 3300010375 | Ga0105239_10283105 | Ga0105239_102831052 | 260 |
| 93 | 3300014325 | Ga0163163_10009099 | Ga0163163_100090996 | 261 |
| 94 | 3300005336 | Ga0070680_100091242 | Ga0070680_1000912422 | 262 |
| 95 | 3300005340 | Ga0070689_100471764 | Ga0070689_1004717641 | 262 |
| 96 | 3300005364 | Ga0070673_100188280 | Ga0070673_1001882802 | 262 |
| 97 | 3300005441 | Ga0070700_100185414 | Ga0070700_1001854142 | 262 |
| 98 | 3300005615 | Ga0070702_100156106 | Ga0070702_1001561062 | 262 |
| 99 | 3300009094 | Ga0111539_10018805 | Ga0111539_1001880512 | 262 |
| 100 | 3300009147 | Ga0114129_10285856 | Ga0114129_102858561 | 262 |
| 101 | 3300009147 | Ga0114129_10312165 | Ga0114129_103121652 | 262 |
| 102 | 3300009177 | Ga0105248_10012309 | Ga0105248_100123093 | 262 |
| 103 | 3300026089 | Ga0207648_10250541 | Ga0207648_102505412 | 262 |
| 104 | 3300005467 | Ga0070706_100130000 | Ga0070706_1001300003 | 263 |
| 105 | 3300005545 | Ga0070695_100315487 | Ga0070695_1003154872 | 263 |
| 106 | 3300006163 | Ga0070715_10000279 | Ga0070715_100002798 | 263 |
| 107 | 3300009147 | Ga0114129_10247622 | Ga0114129_102476222 | 263 |
| 108 | 3300025905 | Ga0207685_10000221 | Ga0207685_100002215 | 263 |
| 109 | 3300025910 | Ga0207684_10138232 | Ga0207684_101382322 | 263 |
| 110 | 3300046519 | Ga0495632_0063816 | Ga0495632_0063816_509_1384 | 263 |
| 111 | 3300050513 | nmdc:mga0rr50_106249_c1 | nmdc:mga0rr50_106249_c1_487_1353 | 263 |
| 112 | 3300005290 | Ga0065712_10074234 | Ga0065712_100742344 | 264 |
| 113 | 3300005293 | Ga0065715_10002046 | Ga0065715_100020466 | 264 |
| 114 | 3300005293 | Ga0065715_10091684 | Ga0065715_100916841 | 264 |
| 115 | 3300005330 | Ga0070690_100291490 | Ga0070690_1002914901 | 264 |
| 116 | 3300005334 | Ga0068869_100192053 | Ga0068869_1001920532 | 264 |
| 117 | 3300005336 | Ga0070680_100213387 | Ga0070680_1002133871 | 264 |
| 118 | 3300005339 | Ga0070660_100026636 | Ga0070660_1000266366 | 264 |
| 119 | 3300005340 | Ga0070689_100016838 | Ga0070689_1000168385 | 264 |
| 120 | 3300005343 | Ga0070687_100029620 | Ga0070687_1000296202 | 264 |
| 121 | 3300005353 | Ga0070669_100507479 | Ga0070669_1005074791 | 264 |
| 122 | 3300005365 | Ga0070688_100349085 | Ga0070688_1003490851 | 264 |
| 123 | 3300005366 | Ga0070659_100006504 | Ga0070659_1000065047 | 264 |
| 124 | 3300005444 | Ga0070694_100016139 | Ga0070694_1000161392 | 264 |
| 125 | 3300005444 | Ga0070694_100200345 | Ga0070694_1002003452 | 264 |
| 126 | 3300005457 | Ga0070662_100042004 | Ga0070662_1000420042 | 264 |
| 127 | 3300005457 | Ga0070662_100254346 | Ga0070662_1002543461 | 264 |
| 128 | 3300005458 | Ga0070681_10004276 | Ga0070681_100042763 | 264 |
| 129 | 3300005459 | Ga0068867_100506244 | Ga0068867_1005062441 | 264 |
| 130 | 3300005467 | Ga0070706_100000300 | Ga0070706_1000003005 | 264 |
| 131 | 3300005518 | Ga0070699_100002048 | Ga0070699_10000204813 | 264 |
| 132 | 3300005530 | Ga0070679_100081100 | Ga0070679_1000811001 | 264 |
| 133 | 3300005539 | Ga0068853_100478669 | Ga0068853_1004786691 | 264 |
| 134 | 3300005544 | Ga0070686_100005111 | Ga0070686_1000051116 | 264 |
| 135 | 3300005545 | Ga0070695_100297090 | Ga0070695_1002970901 | 264 |
| 136 | 3300005547 | Ga0070693_100012304 | Ga0070693_1000123045 | 264 |
| 137 | 3300005549 | Ga0070704_100196946 | Ga0070704_1001969462 | 264 |
| 138 | 3300005549 | Ga0070704_100365696 | Ga0070704_1003656962 | 264 |
| 139 | 3300005563 | Ga0068855_100000317 | Ga0068855_10000031719 | 264 |
| 140 | 3300005564 | Ga0070664_100001757 | Ga0070664_10000175713 | 264 |
| 141 | 3300005577 | Ga0068857_100018683 | Ga0068857_1000186837 | 264 |
| 142 | 3300005617 | Ga0068859_100027035 | Ga0068859_1000270358 | 264 |
| 143 | 3300005617 | Ga0068859_100093076 | Ga0068859_1000930762 | 264 |
| 144 | 3300005617 | Ga0068859_100232342 | Ga0068859_1002323422 | 264 |
| 145 | 3300005718 | Ga0068866_10001025 | Ga0068866_100010254 | 264 |
| 146 | 3300005719 | Ga0068861_100070068 | Ga0068861_1000700684 | 264 |
| 147 | 3300005840 | Ga0068870_10029737 | Ga0068870_100297373 | 264 |
| 148 | 3300005842 | Ga0068858_100251953 | Ga0068858_1002519532 | 264 |
| 149 | 3300005843 | Ga0068860_100119954 | Ga0068860_1001199544 | 264 |
| 150 | 3300005985 | Ga0081539_10000990 | Ga0081539_1000099015 | 264 |
| 151 | 3300005985 | Ga0081539_10088408 | Ga0081539_100884082 | 264 |
| 152 | 3300006358 | Ga0068871_100001915 | Ga0068871_1000019156 | 264 |
| 153 | 3300006871 | Ga0075434_100127995 | Ga0075434_1001279952 | 264 |
| 154 | 3300006880 | Ga0075429_100224920 | Ga0075429_1002249202 | 264 |
| 155 | 3300006931 | Ga0097620_100027036 | Ga0097620_1000270361 | 264 |
| 156 | 3300006931 | Ga0097620_100093077 | Ga0097620_1000930772 | 264 |
| 157 | 3300006931 | Ga0097620_100232352 | Ga0097620_1002323522 | 264 |
| 158 | 3300009101 | Ga0105247_10002962 | Ga0105247_100029627 | 264 |
| 159 | 3300009174 | Ga0105241_10014564 | Ga0105241_100145646 | 264 |
| 160 | 3300011119 | Ga0105246_10302929 | Ga0105246_103029292 | 264 |
| 161 | 3300011119 | Ga0105246_10321207 | Ga0105246_103212071 | 264 |
| 162 | 3300013297 | Ga0157378_10002954 | Ga0157378_1000295415 | 264 |
| 163 | 3300013297 | Ga0157378_10023819 | Ga0157378_100238194 | 264 |
| 164 | 3300014325 | Ga0163163_10009309 | Ga0163163_100093099 | 264 |
| 165 | 3300014326 | Ga0157380_10144961 | Ga0157380_101449612 | 264 |
| 166 | 3300014745 | Ga0157377_10206795 | Ga0157377_102067952 | 264 |
| 167 | 3300025899 | Ga0207642_10000626 | Ga0207642_100006262 | 264 |
| 168 | 3300025899 | Ga0207642_10063774 | Ga0207642_100637742 | 264 |
| 169 | 3300025900 | Ga0207710_10000753 | Ga0207710_1000075315 | 264 |
| 170 | 3300025900 | Ga0207710_10001106 | Ga0207710_100011067 | 264 |
| 171 | 3300025904 | Ga0207647_10005868 | Ga0207647_100058686 | 264 |
| 172 | 3300025908 | Ga0207643_10011379 | Ga0207643_100113792 | 264 |
| 173 | 3300025910 | Ga0207684_10000367 | Ga0207684_100003675 | 264 |
| 174 | 3300025911 | Ga0207654_10012881 | Ga0207654_100128815 | 264 |
| 175 | 3300025912 | Ga0207707_10014487 | Ga0207707_100144873 | 264 |
| 176 | 3300025917 | Ga0207660_10151888 | Ga0207660_101518882 | 264 |
| 177 | 3300025918 | Ga0207662_10032390 | Ga0207662_100323902 | 264 |
| 178 | 3300025920 | Ga0207649_10176896 | Ga0207649_101768962 | 264 |
| 179 | 3300025921 | Ga0207652_10068152 | Ga0207652_100681521 | 264 |
| 180 | 3300025923 | Ga0207681_10003720 | Ga0207681_100037204 | 264 |
| 181 | 3300025925 | Ga0207650_10000022 | Ga0207650_1000002257 | 264 |
| 182 | 3300025932 | Ga0207690_10040599 | Ga0207690_100405993 | 264 |
| 183 | 3300025936 | Ga0207670_10025296 | Ga0207670_100252962 | 264 |
| 184 | 3300025941 | Ga0207711_10026290 | Ga0207711_100262905 | 264 |
| 185 | 3300025942 | Ga0207689_10089750 | Ga0207689_100897502 | 264 |
| 186 | 3300025942 | Ga0207689_10315462 | Ga0207689_103154621 | 264 |
| 187 | 3300025945 | Ga0207679_10013997 | Ga0207679_100139974 | 264 |
| 188 | 3300025949 | Ga0207667_10002080 | Ga0207667_1000208019 | 264 |
| 189 | 3300026035 | Ga0207703_10090630 | Ga0207703_100906302 | 264 |
| 190 | 3300026075 | Ga0207708_10021633 | Ga0207708_100216336 | 264 |
| 191 | 3300026095 | Ga0207676_10110041 | Ga0207676_101100412 | 264 |
| 192 | 3300026116 | Ga0207674_10001039 | Ga0207674_1000103920 | 264 |
| 193 | 3300026142 | Ga0207698_10560889 | Ga0207698_105608892 | 264 |
| 194 | 3300027907 | Ga0207428_10008809 | Ga0207428_100088094 | 264 |
| 195 | 3300031616 | Ga0307508_10001711 | Ga0307508_1000171117 | 264 |
| 196 | 3300037466 | Ga0395898_0331115 | Ga0395898_0331115_58_924 | 264 |
| 197 | 3300038443 | Ga0395901_0361882 | Ga0395901_0361882_384_1250 | 264 |
| 198 | 3300041463 | Ga0451804_0616426 | Ga0451804_0616426_532_1425 | 264 |
| 199 | 3300044683 | Ga0466965_0085186 | Ga0466965_0085186_470_1363 | 264 |
| 200 | 3300045051 | Ga0451576_0357240 | Ga0451576_0357240_353_1219 | 264 |
| 201 | 3300046525 | Ga0495663_0003270 | Ga0495663_0003270_3002_3958 | 264 |
| 202 | 3300046537 | Ga0495598_0000613 | Ga0495598_0000613_2654_3523 | 264 |
| 203 | 3300046539 | Ga0495621_0000644 | Ga0495621_0000644_7692_8561 | 264 |
| 204 | 3300047320 | Ga0495672_0168785 | Ga0495672_0168785_139_1032 | 264 |
| 205 | 3300048915 | Ga0496112_0412433 | Ga0496112_0412433_202_1068 | 264 |
| 206 | 3300049707 | Ga0501234_004398 | Ga0501234_004398_1041_1907 | 264 |
| 207 | 3300049742 | Ga0501080_0190316 | Ga0501080_0190316_492_1385 | 264 |
| 208 | 3300050507 | nmdc:mga05p37_264819_c1 | nmdc:mga05p37_264819_c1_339_1205 | 264 |
| 209 | 3300050507 | nmdc:mga05p37_660079_c1 | nmdc:mga05p37_660079_c1_59_925 | 264 |
| 210 | 3300050511 | nmdc:mga08y16_100123_c1 | nmdc:mga08y16_100123_c1_1553_2419 | 264 |
| 211 | 3300050511 | nmdc:mga08y16_212372_c1 | nmdc:mga08y16_212372_c1_856_1722 | 264 |
| 212 | 3300050512 | nmdc:mga0n895_363596_c1 | nmdc:mga0n895_363596_c1_377_1243 | 264 |
| 213 | 3300050514 | nmdc:mga08x19_2748_c1 | nmdc:mga08x19_2748_c1_9119_9985 | 264 |
| 214 | 3300050515 | nmdc:mga0a205_86837_c1 | nmdc:mga0a205_86837_c1_699_1565 | 264 |
| 215 | 3300005295 | Ga0065707_10098125 | Ga0065707_100981252 | 265 |
| 216 | 3300005336 | Ga0070680_100000797 | Ga0070680_10000079712 | 265 |
| 217 | 3300005353 | Ga0070669_100005514 | Ga0070669_1000055149 | 265 |
| 218 | 3300005355 | Ga0070671_100011256 | Ga0070671_1000112566 | 265 |
| 219 | 3300005441 | Ga0070700_100000873 | Ga0070700_1000008737 | 265 |
| 220 | 3300005444 | Ga0070694_100020354 | Ga0070694_1000203545 | 265 |
| 221 | 3300005458 | Ga0070681_10032172 | Ga0070681_100321723 | 265 |
| 222 | 3300005468 | Ga0070707_100000134 | Ga0070707_10000013437 | 265 |
| 223 | 3300005468 | Ga0070707_100371939 | Ga0070707_1003719391 | 265 |
| 224 | 3300005471 | Ga0070698_100006202 | Ga0070698_10000620211 | 265 |
| 225 | 3300005471 | Ga0070698_100343149 | Ga0070698_1003431492 | 265 |
| 226 | 3300005530 | Ga0070679_100000855 | Ga0070679_10000085512 | 265 |
| 227 | 3300005539 | Ga0068853_100091746 | Ga0068853_1000917461 | 265 |
| 228 | 3300005546 | Ga0070696_100068312 | Ga0070696_1000683122 | 265 |
| 229 | 3300005547 | Ga0070693_100164552 | Ga0070693_1001645522 | 265 |
| 230 | 3300005549 | Ga0070704_100065911 | Ga0070704_1000659113 | 265 |
| 231 | 3300005577 | Ga0068857_100601794 | Ga0068857_1006017941 | 265 |
| 232 | 3300005719 | Ga0068861_100118413 | Ga0068861_1001184133 | 265 |
| 233 | 3300005844 | Ga0068862_100017359 | Ga0068862_1000173593 | 265 |
| 234 | 3300006871 | Ga0075434_100092275 | Ga0075434_1000922753 | 265 |
| 235 | 3300006871 | Ga0075434_100103542 | Ga0075434_1001035421 | 265 |
| 236 | 3300007076 | Ga0075435_100371439 | Ga0075435_1003714392 | 265 |
| 237 | 3300009093 | Ga0105240_10428430 | Ga0105240_104284302 | 265 |
| 238 | 3300009094 | Ga0111539_10055294 | Ga0111539_100552946 | 265 |
| 239 | 3300009094 | Ga0111539_10169136 | Ga0111539_101691362 | 265 |
| 240 | 3300009147 | Ga0114129_10020897 | Ga0114129_100208972 | 265 |
| 241 | 3300010375 | Ga0105239_10069721 | Ga0105239_100697215 | 265 |
| 242 | 3300013297 | Ga0157378_10222625 | Ga0157378_102226252 | 265 |
| 243 | 3300013307 | Ga0157372_10042615 | Ga0157372_100426155 | 265 |
| 244 | 3300014326 | Ga0157380_10004065 | Ga0157380_100040657 | 265 |
| 245 | 3300025912 | Ga0207707_10000031 | Ga0207707_1000003195 | 265 |
| 246 | 3300025917 | Ga0207660_10002124 | Ga0207660_1000212416 | 265 |
| 247 | 3300025921 | Ga0207652_10000087 | Ga0207652_1000008735 | 265 |
| 248 | 3300025921 | Ga0207652_10184733 | Ga0207652_101847332 | 265 |
| 249 | 3300025922 | Ga0207646_10101696 | Ga0207646_101016961 | 265 |
| 250 | 3300025922 | Ga0207646_10115218 | Ga0207646_101152182 | 265 |
| 251 | 3300025923 | Ga0207681_10023886 | Ga0207681_100238864 | 265 |
| 252 | 3300025931 | Ga0207644_10010974 | Ga0207644_100109743 | 265 |
| 253 | 3300025961 | Ga0207712_10065705 | Ga0207712_100657052 | 265 |
| 254 | 3300026041 | Ga0207639_10068554 | Ga0207639_100685542 | 265 |
| 255 | 3300026075 | Ga0207708_10000340 | Ga0207708_1000034018 | 265 |
| 256 | 3300026118 | Ga0207675_100027424 | Ga0207675_1000274245 | 265 |
| 257 | 3300048905 | Ga0496102_0063143 | Ga0496102_0063143_775_1644 | 265 |
| 258 | 3300048909 | Ga0496106_0208113 | Ga0496106_0208113_487_1356 | 265 |
| 259 | 3300049129 | Ga0501309_012284 | Ga0501309_012284_161_1054 | 265 |
| 260 | 3300050507 | nmdc:mga05p37_562304_c1 | nmdc:mga05p37_562304_c1_106_975 | 265 |
| 261 | 3300050511 | nmdc:mga08y16_128204_c1 | nmdc:mga08y16_128204_c1_306_1181 | 265 |
| 262 | 3300050511 | nmdc:mga08y16_59840_c1 | nmdc:mga08y16_59840_c1_2831_3700 | 265 |
| 263 | 3300050513 | nmdc:mga0rr50_376847_c1 | nmdc:mga0rr50_376847_c1_245_1114 | 265 |
| 264 | 3300050515 | nmdc:mga0a205_17518_c1 | nmdc:mga0a205_17518_c1_5409_6278 | 265 |
| 265 | 3300005295 | Ga0065707_10086298 | Ga0065707_100862983 | 266 |
| 266 | 3300005337 | Ga0070682_100000167 | Ga0070682_10000016725 | 266 |
| 267 | 3300005438 | Ga0070701_10006009 | Ga0070701_100060095 | 266 |
| 268 | 3300005441 | Ga0070700_100140713 | Ga0070700_1001407131 | 266 |
| 269 | 3300005444 | Ga0070694_100007979 | Ga0070694_1000079796 | 266 |
| 270 | 3300005467 | Ga0070706_100002853 | Ga0070706_1000028533 | 266 |
| 271 | 3300005544 | Ga0070686_100001814 | Ga0070686_10000181410 | 266 |
| 272 | 3300005545 | Ga0070695_100428682 | Ga0070695_1004286821 | 266 |
| 273 | 3300005618 | Ga0068864_100186109 | Ga0068864_1001861092 | 266 |
| 274 | 3300013297 | Ga0157378_10005155 | Ga0157378_1000515513 | 266 |
| 275 | 3300013308 | Ga0157375_10236130 | Ga0157375_102361302 | 266 |
| 276 | 3300017792 | Ga0163161_10444623 | Ga0163161_104446231 | 266 |
| 277 | 3300025893 | Ga0207682_10035079 | Ga0207682_100350792 | 266 |
| 278 | 3300025910 | Ga0207684_10002571 | Ga0207684_1000257111 | 266 |
| 279 | 3300025910 | Ga0207684_10070004 | Ga0207684_100700043 | 266 |
| 280 | 3300025918 | Ga0207662_10066910 | Ga0207662_100669102 | 266 |
| 281 | 3300025938 | Ga0207704_10252483 | Ga0207704_102524831 | 266 |
| 282 | 3300026075 | Ga0207708_10045653 | Ga0207708_100456532 | 266 |
| 283 | 3300026116 | Ga0207674_10075746 | Ga0207674_100757464 | 266 |
| 284 | 3300039437 | Ga0436365_1013692 | Ga0436365_1013692_414_1295 | 266 |
| 285 | 3300048915 | Ga0496112_0454355 | Ga0496112_0454355_25_897 | 266 |
| 286 | 3300049589 | Ga0501073_0136708 | Ga0501073_0136708_423_1316 | 266 |
| 287 | 3300049742 | Ga0501080_0020421 | Ga0501080_0020421_3904_4797 | 266 |
| 288 | 3300049744 | Ga0501083_0001562 | Ga0501083_0001562_589_1482 | 266 |
| 289 | 3300049744 | Ga0501083_0004579 | Ga0501083_0004579_2972_3865 | 266 |
| 290 | 3300054114 | Ga0501084_0003199 | Ga0501084_0003199_9380_10273 | 266 |
| 291 | 3300054114 | Ga0501084_0018958 | Ga0501084_0018958_4230_5123 | 266 |
| 292 | 3300005293 | Ga0065715_10137580 | Ga0065715_101375801 | 267 |
| 293 | 3300005295 | Ga0065707_10106880 | Ga0065707_101068801 | 267 |
| 294 | 3300005334 | Ga0068869_100001716 | Ga0068869_1000017168 | 267 |
| 295 | 3300005334 | Ga0068869_100009103 | Ga0068869_1000091033 | 267 |
| 296 | 3300005338 | Ga0068868_100024117 | Ga0068868_1000241173 | 267 |
| 297 | 3300005445 | Ga0070708_100571710 | Ga0070708_1005717101 | 267 |
| 298 | 3300005467 | Ga0070706_100037208 | Ga0070706_1000372083 | 267 |
| 299 | 3300005468 | Ga0070707_100190623 | Ga0070707_1001906232 | 267 |
| 300 | 3300005471 | Ga0070698_100244272 | Ga0070698_1002442722 | 267 |
| 301 | 3300005536 | Ga0070697_100000073 | Ga0070697_10000007327 | 267 |
| 302 | 3300005543 | Ga0070672_100050713 | Ga0070672_1000507134 | 267 |
| 303 | 3300005548 | Ga0070665_100561529 | Ga0070665_1005615292 | 267 |
| 304 | 3300005549 | Ga0070704_100246759 | Ga0070704_1002467591 | 267 |
| 305 | 3300005563 | Ga0068855_100016293 | Ga0068855_1000162938 | 267 |
| 306 | 3300005614 | Ga0068856_100091023 | Ga0068856_1000910232 | 267 |
| 307 | 3300005618 | Ga0068864_100002273 | Ga0068864_10000227316 | 267 |
| 308 | 3300005841 | Ga0068863_100120637 | Ga0068863_1001206371 | 267 |
| 309 | 3300005842 | Ga0068858_100025999 | Ga0068858_1000259995 | 267 |
| 310 | 3300005843 | Ga0068860_100012441 | Ga0068860_1000124412 | 267 |
| 311 | 3300005843 | Ga0068860_100234084 | Ga0068860_1002340842 | 267 |
| 312 | 3300005844 | Ga0068862_100128165 | Ga0068862_1001281651 | 267 |
| 313 | 3300006237 | Ga0097621_100009963 | Ga0097621_1000099635 | 267 |
| 314 | 3300006358 | Ga0068871_100028997 | Ga0068871_1000289973 | 267 |
| 315 | 3300006871 | Ga0075434_100312698 | Ga0075434_1003126982 | 267 |
| 316 | 3300006881 | Ga0068865_100251390 | Ga0068865_1002513901 | 267 |
| 317 | 3300009098 | Ga0105245_10030189 | Ga0105245_100301895 | 267 |
| 318 | 3300009174 | Ga0105241_10006658 | Ga0105241_100066585 | 267 |
| 319 | 3300009177 | Ga0105248_10043719 | Ga0105248_100437196 | 267 |
| 320 | 3300011119 | Ga0105246_10236687 | Ga0105246_102366872 | 267 |
| 321 | 3300013306 | Ga0163162_10006123 | Ga0163162_100061235 | 267 |
| 322 | 3300013306 | Ga0163162_10039944 | Ga0163162_100399445 | 267 |
| 323 | 3300014325 | Ga0163163_10009086 | Ga0163163_100090862 | 267 |
| 324 | 3300014325 | Ga0163163_10025012 | Ga0163163_100250126 | 267 |
| 325 | 3300014325 | Ga0163163_10429462 | Ga0163163_104294622 | 267 |
| 326 | 3300014969 | Ga0157376_10036976 | Ga0157376_100369763 | 267 |
| 327 | 3300025910 | Ga0207684_10049257 | Ga0207684_100492571 | 267 |
| 328 | 3300025911 | Ga0207654_10002697 | Ga0207654_100026973 | 267 |
| 329 | 3300025918 | Ga0207662_10163408 | Ga0207662_101634082 | 267 |
| 330 | 3300025927 | Ga0207687_10016926 | Ga0207687_100169265 | 267 |
| 331 | 3300025938 | Ga0207704_10277564 | Ga0207704_102775641 | 267 |
| 332 | 3300025942 | Ga0207689_10004054 | Ga0207689_100040548 | 267 |
| 333 | 3300025942 | Ga0207689_10014345 | Ga0207689_100143456 | 267 |
| 334 | 3300025949 | Ga0207667_10012816 | Ga0207667_100128167 | 267 |
| 335 | 3300025960 | Ga0207651_10448739 | Ga0207651_104487392 | 267 |
| 336 | 3300026035 | Ga0207703_10040489 | Ga0207703_100404892 | 267 |
| 337 | 3300026088 | Ga0207641_10173337 | Ga0207641_101733372 | 267 |
| 338 | 3300026095 | Ga0207676_10002507 | Ga0207676_1000250711 | 267 |
| 339 | 3300028381 | Ga0268264_10004034 | Ga0268264_100040345 | 267 |
| 340 | 3300028381 | Ga0268264_10206756 | Ga0268264_102067561 | 267 |
| 341 | 3300031456 | Ga0307513_10135603 | Ga0307513_101356031 | 267 |
| 342 | 3300037471 | Ga0395905_0135095 | Ga0395905_0135095_1320_2222 | 267 |
| 343 | 3300042876 | Ga0451577_0004291 | Ga0451577_0004291_13919_14797 | 267 |
| 344 | 3300045051 | Ga0451576_0047981 | Ga0451576_0047981_33_911 | 267 |
| 345 | 3300045051 | Ga0451576_0510312 | Ga0451576_0510312_15_941 | 267 |
| 346 | 3300046539 | Ga0495621_0014785 | Ga0495621_0014785_316_1200 | 267 |
| 347 | 3300050511 | nmdc:mga08y16_427976_c1 | nmdc:mga08y16_427976_c1_461_1336 | 267 |
| 348 | 3300005338 | Ga0068868_100055109 | Ga0068868_1000551092 | 268 |
| 349 | 3300005340 | Ga0070689_100021935 | Ga0070689_1000219354 | 268 |
| 350 | 3300005347 | Ga0070668_100016062 | Ga0070668_1000160624 | 268 |
| 351 | 3300005353 | Ga0070669_100005130 | Ga0070669_1000051302 | 268 |
| 352 | 3300005445 | Ga0070708_100309654 | Ga0070708_1003096542 | 268 |
| 353 | 3300005468 | Ga0070707_100077531 | Ga0070707_1000775312 | 268 |
| 354 | 3300005471 | Ga0070698_100012448 | Ga0070698_10001244811 | 268 |
| 355 | 3300005536 | Ga0070697_100000434 | Ga0070697_1000004349 | 268 |
| 356 | 3300005617 | Ga0068859_100392189 | Ga0068859_1003921892 | 268 |
| 357 | 3300006173 | Ga0070716_100294463 | Ga0070716_1002944632 | 268 |
| 358 | 3300006852 | Ga0075433_10053355 | Ga0075433_100533552 | 268 |
| 359 | 3300006852 | Ga0075433_10080661 | Ga0075433_100806612 | 268 |
| 360 | 3300006871 | Ga0075434_100075295 | Ga0075434_1000752952 | 268 |
| 361 | 3300006931 | Ga0097620_100392207 | Ga0097620_1003922072 | 268 |
| 362 | 3300007076 | Ga0075435_100492164 | Ga0075435_1004921642 | 268 |
| 363 | 3300009147 | Ga0114129_10257617 | Ga0114129_102576173 | 268 |
| 364 | 3300009148 | Ga0105243_10000344 | Ga0105243_100003442 | 268 |
| 365 | 3300009553 | Ga0105249_10000028 | Ga0105249_10000028159 | 268 |
| 366 | 3300009553 | Ga0105249_10010884 | Ga0105249_100108845 | 268 |
| 367 | 3300010375 | Ga0105239_10028211 | Ga0105239_100282112 | 268 |
| 368 | 3300013297 | Ga0157378_10000019 | Ga0157378_1000001919 | 268 |
| 369 | 3300013297 | Ga0157378_10073043 | Ga0157378_100730432 | 268 |
| 370 | 3300013306 | Ga0163162_10000019 | Ga0163162_1000001956 | 268 |
| 371 | 3300013308 | Ga0157375_10006370 | Ga0157375_1000637010 | 268 |
| 372 | 3300021384 | Ga0213876_10000179 | Ga0213876_1000017935 | 268 |
| 373 | 3300021384 | Ga0213876_10000326 | Ga0213876_1000032640 | 268 |
| 374 | 3300025922 | Ga0207646_10126429 | Ga0207646_101264292 | 268 |
| 375 | 3300025923 | Ga0207681_10000869 | Ga0207681_1000086913 | 268 |
| 376 | 3300025925 | Ga0207650_10009105 | Ga0207650_100091055 | 268 |
| 377 | 3300025935 | Ga0207709_10000498 | Ga0207709_1000049815 | 268 |
| 378 | 3300025936 | Ga0207670_10025949 | Ga0207670_100259493 | 268 |
| 379 | 3300025940 | Ga0207691_10297011 | Ga0207691_102970111 | 268 |
| 380 | 3300025961 | Ga0207712_10000068 | Ga0207712_1000006847 | 268 |
| 381 | 3300025972 | Ga0207668_10010416 | Ga0207668_100104164 | 268 |
| 382 | 3300026023 | Ga0207677_10054394 | Ga0207677_100543942 | 268 |
| 383 | 3300026088 | Ga0207641_10101447 | Ga0207641_101014472 | 268 |
| 384 | 3300026118 | Ga0207675_100002039 | Ga0207675_10000203919 | 268 |
| 385 | 3300026142 | Ga0207698_10158473 | Ga0207698_101584732 | 268 |
| 386 | 3300028380 | Ga0268265_10361295 | Ga0268265_103612952 | 268 |
| 387 | 3300031649 | Ga0307514_10136217 | Ga0307514_101362172 | 268 |
| 388 | 3300031727 | Ga0316576_10003780 | Ga0316576_100037803 | 268 |
| 389 | 3300031728 | Ga0316578_10001642 | Ga0316578_100016424 | 268 |
| 390 | 3300035083 | Ga0373926_0008228 | Ga0373926_0008228_1181_2065 | 268 |
| 391 | 3300035086 | Ga0373934_0039508 | Ga0373934_0039508_482_1366 | 268 |
| 392 | 3300035170 | Ga0373943_0021970 | Ga0373943_0021970_691_1575 | 268 |
| 393 | 3300035695 | Ga0373927_0025437 | Ga0373927_0025437_1179_2063 | 268 |
| 394 | 3300035724 | Ga0373933_0061395 | Ga0373933_0061395_776_1660 | 268 |
| 395 | 3300035725 | Ga0373947_0032854 | Ga0373947_0032854_713_1597 | 268 |
| 396 | 3300036401 | Ga0373937_0177187 | Ga0373937_0177187_92_976 | 268 |
| 397 | 3300037068 | Ga0373925_0117130 | Ga0373925_0117130_979_1863 | 268 |
| 398 | 3300042435 | Ga0439434_0029046 | Ga0439434_0029046_432_1316 | 268 |
| 399 | 3300044673 | Ga0453683_0010074 | Ga0453683_0010074_688_1572 | 268 |
| 400 | 3300044712 | Ga0453684_0258707 | Ga0453684_0258707_342_1226 | 268 |
| 401 | 3300050507 | nmdc:mga05p37_309777_c1 | nmdc:mga05p37_309777_c1_706_1590 | 268 |
| 402 | 3300050512 | nmdc:mga0n895_31225_c1 | nmdc:mga0n895_31225_c1_121_1005 | 268 |
| 403 | 3300050515 | nmdc:mga0a205_58416_c1 | nmdc:mga0a205_58416_c1_2631_3515 | 268 |
| 404 | 3300050515 | nmdc:mga0a205_65592_c1 | nmdc:mga0a205_65592_c1_1570_2454 | 268 |
| 405 | 3300005365 | Ga0070688_100064482 | Ga0070688_1000644823 | 269 |
| 406 | 3300005937 | Ga0081455_10032755 | Ga0081455_100327554 | 269 |
| 407 | 3300006195 | Ga0075366_10075139 | Ga0075366_100751392 | 269 |
| 408 | 3300006871 | Ga0075434_100542006 | Ga0075434_1005420062 | 269 |
| 409 | 3300028556 | Ga0265337_1003995 | Ga0265337_10039951 | 269 |
| 410 | 3300028577 | Ga0265318_10004680 | Ga0265318_100046804 | 269 |
| 411 | 3300031240 | Ga0265320_10001253 | Ga0265320_1000125312 | 269 |
| 412 | 3300035111 | Ga0373923_0026065 | Ga0373923_0026065_724_1611 | 269 |
| 413 | 3300035118 | Ga0373954_0026976 | Ga0373954_0026976_1208_2095 | 269 |
| 414 | 3300035692 | Ga0373935_0090812 | Ga0373935_0090812_447_1334 | 269 |
| 415 | 3300035695 | Ga0373927_0017296 | Ga0373927_0017296_2171_3058 | 269 |
| 416 | 3300035724 | Ga0373933_0025859 | Ga0373933_0025859_944_1831 | 269 |
| 417 | 3300036401 | Ga0373937_0065710 | Ga0373937_0065710_808_1695 | 269 |
| 418 | 3300036401 | Ga0373937_0335685 | Ga0373937_0335685_484_1371 | 269 |
| 419 | 3300047320 | Ga0495672_0190656 | Ga0495672_0190656_104_988 | 269 |
| 420 | 3300050493 | nmdc:mga0k408_52632_c1 | nmdc:mga0k408_52632_c1_1247_2140 | 269 |
| 421 | 3300054114 | Ga0501084_0153393 | Ga0501084_0153393_103_975 | 269 |
| 422 | 3300005435 | Ga0070714_100379687 | Ga0070714_1003796871 | 270 |
| 423 | 3300005471 | Ga0070698_100171560 | Ga0070698_1001715602 | 270 |
| 424 | 3300009094 | Ga0111539_10008045 | Ga0111539_100080453 | 270 |
| 425 | 3300009551 | Ga0105238_10211430 | Ga0105238_102114302 | 270 |
| 426 | 3300025924 | Ga0207694_10338743 | Ga0207694_103387432 | 270 |
| 427 | 3300025929 | Ga0207664_10315818 | Ga0207664_103158181 | 270 |
| 428 | 3300025936 | Ga0207670_10000001 | Ga0207670_10000001415 | 270 |
| 429 | 3300027907 | Ga0207428_10094881 | Ga0207428_100948812 | 270 |
| 430 | 3300028577 | Ga0265318_10000008 | Ga0265318_10000008105 | 270 |
| 431 | 3300028577 | Ga0265318_10000180 | Ga0265318_100001803 | 270 |
| 432 | 3300028577 | Ga0265318_10002167 | Ga0265318_1000216711 | 270 |
| 433 | 3300028800 | Ga0265338_10083512 | Ga0265338_100835123 | 270 |
| 434 | 3300028800 | Ga0265338_10163280 | Ga0265338_101632803 | 270 |
| 435 | 3300031235 | Ga0265330_10001004 | Ga0265330_1000100412 | 270 |
| 436 | 3300031235 | Ga0265330_10052710 | Ga0265330_100527103 | 270 |
| 437 | 3300031238 | Ga0265332_10000359 | Ga0265332_100003595 | 270 |
| 438 | 3300031238 | Ga0265332_10006786 | Ga0265332_100067863 | 270 |
| 439 | 3300031239 | Ga0265328_10006299 | Ga0265328_100062994 | 270 |
| 440 | 3300031240 | Ga0265320_10000132 | Ga0265320_1000013230 | 270 |
| 441 | 3300031240 | Ga0265320_10005602 | Ga0265320_100056026 | 270 |
| 442 | 3300031241 | Ga0265325_10001876 | Ga0265325_100018766 | 270 |
| 443 | 3300031242 | Ga0265329_10000642 | Ga0265329_1000064215 | 270 |
| 444 | 3300031242 | Ga0265329_10011713 | Ga0265329_100117133 | 270 |
| 445 | 3300031247 | Ga0265340_10008907 | Ga0265340_100089075 | 270 |
| 446 | 3300031250 | Ga0265331_10000004 | Ga0265331_10000004105 | 270 |
| 447 | 3300031250 | Ga0265331_10003038 | Ga0265331_100030389 | 270 |
| 448 | 3300031344 | Ga0265316_10003795 | Ga0265316_100037953 | 270 |
| 449 | 3300031344 | Ga0265316_10033762 | Ga0265316_100337623 | 270 |
| 450 | 3300031344 | Ga0265316_10066087 | Ga0265316_100660872 | 270 |
| 451 | 3300031595 | Ga0265313_10000005 | Ga0265313_1000000551 | 270 |
| 452 | 3300031595 | Ga0265313_10008560 | Ga0265313_100085606 | 270 |
| 453 | 3300031595 | Ga0265313_10025639 | Ga0265313_100256392 | 270 |
| 454 | 3300031595 | Ga0265313_10029971 | Ga0265313_100299712 | 270 |
| 455 | 3300031595 | Ga0265313_10059262 | Ga0265313_100592623 | 270 |
| 456 | 3300031711 | Ga0265314_10000014 | Ga0265314_10000014322 | 270 |
| 457 | 3300031711 | Ga0265314_10014645 | Ga0265314_100146455 | 270 |
| 458 | 3300031712 | Ga0265342_10002890 | Ga0265342_1000289014 | 270 |
| 459 | 3300031712 | Ga0265342_10014365 | Ga0265342_100143655 | 270 |
| 460 | 3300044712 | Ga0453684_0224507 | Ga0453684_0224507_902_1792 | 270 |
| 461 | 3300046683 | Ga0495658_0122049 | Ga0495658_0122049_460_1353 | 270 |
| 462 | 3300049589 | Ga0501073_0120872 | Ga0501073_0120872_236_1129 | 270 |
| 463 | 3300049592 | Ga0501076_0295909 | Ga0501076_0295909_339_1232 | 270 |
| 464 | 3300049593 | Ga0501077_0115271 | Ga0501077_0115271_757_1653 | 270 |
| 465 | 3300049665 | Ga0501227_043102 | Ga0501227_043102_137_1021 | 270 |
| 466 | 3300050511 | nmdc:mga08y16_49197_c1 | nmdc:mga08y16_49197_c1_3395_4288 | 270 |
| 467 | 3300003320 | rootH2_10071534 | rootH2_1007153410 | 271 |
| 468 | 3300005337 | Ga0070682_100000587 | Ga0070682_10000058718 | 271 |
| 469 | 3300005338 | Ga0068868_100343380 | Ga0068868_1003433801 | 271 |
| 470 | 3300005440 | Ga0070705_100102927 | Ga0070705_1001029273 | 271 |
| 471 | 3300005441 | Ga0070700_100178679 | Ga0070700_1001786792 | 271 |
| 472 | 3300005445 | Ga0070708_100108813 | Ga0070708_1001088132 | 271 |
| 473 | 3300005455 | Ga0070663_100010247 | Ga0070663_1000102475 | 271 |
| 474 | 3300005545 | Ga0070695_100089194 | Ga0070695_1000891942 | 271 |
| 475 | 3300005841 | Ga0068863_100147631 | Ga0068863_1001476313 | 271 |
| 476 | 3300014325 | Ga0163163_10221479 | Ga0163163_102214792 | 271 |
| 477 | 3300026023 | Ga0207677_10314959 | Ga0207677_103149591 | 271 |
| 478 | 3300026067 | Ga0207678_10021083 | Ga0207678_100210835 | 271 |
| 479 | 3300026075 | Ga0207708_10196029 | Ga0207708_101960292 | 271 |
| 480 | 3300026118 | Ga0207675_100294967 | Ga0207675_1002949672 | 271 |
| 481 | 3300039093 | Ga0400489_45403 | Ga0400489_45403_380_1288 | 271 |
| 482 | 3300044712 | Ga0453684_0297024 | Ga0453684_0297024_233_1117 | 271 |
| 483 | 3300028573 | Ga0265334_10001475 | Ga0265334_100014759 | 272 |
| 484 | 3300031250 | Ga0265331_10060813 | Ga0265331_100608132 | 272 |
| 485 | 3300049571 | Ga0501034_0132934 | Ga0501034_0132934_1159_2058 | 272 |
| 486 | 3300049583 | Ga0501067_0029041 | Ga0501067_0029041_20_922 | 273 |
| 487 | 3300025939 | Ga0207665_10363270 | Ga0207665_103632702 | 274 |
| 488 | 3300046616 | Ga0495668_0063726 | Ga0495668_0063726_17_892 | 274 |
| 489 | 3300005530 | Ga0070679_100011324 | Ga0070679_1000113244 | 275 |
| 490 | 3300005563 | Ga0068855_100246781 | Ga0068855_1002467811 | 275 |
| 491 | 3300005617 | Ga0068859_100267383 | Ga0068859_1002673832 | 275 |
| 492 | 3300006931 | Ga0097620_100267377 | Ga0097620_1002673772 | 275 |
| 493 | 3300025921 | Ga0207652_10019300 | Ga0207652_100193002 | 275 |
| 494 | 3300026041 | Ga0207639_10002838 | Ga0207639_100028384 | 275 |
| 495 | 3300026078 | Ga0207702_10131695 | Ga0207702_101316952 | 275 |
| 496 | 3300026118 | Ga0207675_100451145 | Ga0207675_1004511451 | 275 |
| 497 | 3300026142 | Ga0207698_10125377 | Ga0207698_101253772 | 275 |
| 498 | 3300029957 | Ga0265324_10002968 | Ga0265324_100029682 | 276 |
| 499 | 3300031239 | Ga0265328_10014019 | Ga0265328_100140192 | 276 |
| 500 | 3300031250 | Ga0265331_10000107 | Ga0265331_1000010752 | 276 |
| 501 | 3300031616 | Ga0307508_10015699 | Ga0307508_100156997 | 276 |
| 502 | 3300039093 | Ga0400489_56002 | Ga0400489_56002_1173_2045 | 277 |
| 503 | 3300044712 | Ga0453684_0000020 | Ga0453684_0000020_64940_65815 | 277 |
| 504 | 3300036712 | Ga0316584_0317498 | Ga0316584_0317498_188_1060 | 279 |
| 505 | 3300038735 | Ga0400485_18933 | Ga0400485_18933_1220_2089 | 280 |
| 506 | 3300038741 | Ga0400488_45668 | Ga0400488_45668_3207_4076 | 280 |
| 507 | 3300038742 | Ga0400486_27561 | Ga0400486_27561_85777_86646 | 280 |
| 508 | 3300039110 | Ga0400487_07588 | Ga0400487_07588_923_1795 | 280 |
| 509 | 3300039110 | Ga0400487_44815 | Ga0400487_44815_1165_2034 | 280 |
| 510 | 3300003791 | Ga0055530_10015453 | Ga0055530_100154532 | 281 |
| 511 | 3300025298 | Ga0209050_1000297 | Ga0209050_100029711 | 281 |
| 512 | 3300005340 | Ga0070689_100009616 | Ga0070689_1000096162 | 282 |
| 513 | 3300005354 | Ga0070675_100044859 | Ga0070675_1000448595 | 282 |
| 514 | 3300025315 | Ga0207697_10030323 | Ga0207697_100303231 | 282 |
| 515 | 3300025912 | Ga0207707_10539476 | Ga0207707_105394761 | 282 |
| 516 | 3300025936 | Ga0207670_10031775 | Ga0207670_100317752 | 282 |
| 517 | 3300031727 | Ga0316576_10050002 | Ga0316576_100500024 | 282 |
| 518 | 3300037471 | Ga0395905_0374596 | Ga0395905_0374596_286_1170 | 282 |
| 519 | 3300045051 | Ga0451576_0794048 | Ga0451576_0794048_97_981 | 282 |
| 520 | 3300049581 | Ga0501047_0107839 | Ga0501047_0107839_1407_2282 | 282 |
| 521 | 3300005347 | Ga0070668_100093761 | Ga0070668_1000937613 | 283 |
| 522 | 3300005354 | Ga0070675_100113725 | Ga0070675_1001137252 | 283 |
| 523 | 3300005295 | Ga0065707_10102852 | Ga0065707_101028522 | 284 |
| 524 | 3300005548 | Ga0070665_100099176 | Ga0070665_1000991764 | 284 |
| 525 | 3300005563 | Ga0068855_100620805 | Ga0068855_1006208052 | 284 |
| 526 | 3300028379 | Ga0268266_10043315 | Ga0268266_100433153 | 284 |
| 527 | 3300006844 | Ga0075428_100439281 | Ga0075428_1004392812 | 285 |
| 528 | 3300031727 | Ga0316576_10001523 | Ga0316576_100015234 | 285 |
| 529 | 3300031728 | Ga0316578_10011873 | Ga0316578_100118733 | 285 |
| 530 | 3300031733 | Ga0316577_10006633 | Ga0316577_100066336 | 285 |
| 531 | 3300033541 | Ga0316596_1007623 | Ga0316596_10076232 | 285 |
| 532 | 3300036712 | Ga0316584_0010384 | Ga0316584_0010384_2794_3693 | 285 |
| 533 | 3300042876 | Ga0451577_0000062 | Ga0451577_0000062_78240_79109 | 285 |
| 534 | 3300042876 | Ga0451577_0001729 | Ga0451577_0001729_960_1832 | 285 |
| 535 | 3300042876 | Ga0451577_0007527 | Ga0451577_0007527_4484_5356 | 285 |
| 536 | 3300044712 | Ga0453684_0000258 | Ga0453684_0000258_15813_16685 | 285 |
| 537 | 3300044712 | Ga0453684_0000877 | Ga0453684_0000877_21475_22344 | 285 |
| 538 | 3300045051 | Ga0451576_0004827 | Ga0451576_0004827_13613_14485 | 285 |
| 539 | 3300045051 | Ga0451576_0255481 | Ga0451576_0255481_578_1450 | 285 |
| 540 | iso_pu_bacteria | 2786546517 | 2787436936 | 285 |
| 541 | 3300025918 | Ga0207662_10051473 | Ga0207662_100514733 | 286 |
| 542 | 3300025922 | Ga0207646_10133720 | Ga0207646_101337202 | 286 |
| 543 | 3300026023 | Ga0207677_10240669 | Ga0207677_102406692 | 286 |
| 544 | 3300026078 | Ga0207702_10353794 | Ga0207702_103537942 | 286 |
| 545 | 3300031889 | Ga0326468_10003958 | Ga0326468_100039582 | 286 |
| 546 | 3300042876 | Ga0451577_0001358 | Ga0451577_0001358_6927_7805 | 286 |
| 547 | 3300044673 | Ga0453683_0000571 | Ga0453683_0000571_17086_17967 | 286 |
| 548 | 3300044673 | Ga0453683_0002186 | Ga0453683_0002186_1148_2023 | 286 |
| 549 | 3300044673 | Ga0453683_0140089 | Ga0453683_0140089_340_1212 | 286 |
| 550 | 3300044712 | Ga0453684_0000749 | Ga0453684_0000749_95882_96760 | 286 |
| 551 | 3300045051 | Ga0451576_0051337 | Ga0451576_0051337_1191_2069 | 286 |
| 552 | 3300048912 | Ga0496109_0417315 | Ga0496109_0417315_339_1250 | 286 |
| 553 | 3300048913 | Ga0496110_0449973 | Ga0496110_0449973_68_979 | 286 |
| 554 | iso_pu_bacteria | 2706794495 | 2707099817 | 286 |
| 555 | iso_pu_bacteria | 2791354903 | 2791923225 | 286 |
| 556 | iso_pu_bacteria | 2854601825 | 2854604562 | 286 |
| 557 | 3300005340 | Ga0070689_100092466 | Ga0070689_1000924662 | 287 |
| 558 | 3300005468 | Ga0070707_100342260 | Ga0070707_1003422602 | 287 |
| 559 | 3300005844 | Ga0068862_100040100 | Ga0068862_1000401005 | 287 |
| 560 | 3300009545 | Ga0105237_10134185 | Ga0105237_101341852 | 287 |
| 561 | 3300025914 | Ga0207671_10055990 | Ga0207671_100559902 | 287 |
| 562 | 3300028380 | Ga0268265_10076684 | Ga0268265_100766842 | 287 |
| 563 | 3300037068 | Ga0373925_0362394 | Ga0373925_0362394_185_1057 | 287 |
| 564 | 3300050508 | nmdc:mga09592_282174_c1 | nmdc:mga09592_282174_c1_91_966 | 287 |
| 565 | 3300026118 | Ga0207675_100090879 | Ga0207675_1000908793 | 288 |
| 566 | 3300042876 | Ga0451577_0513264 | Ga0451577_0513264_125_997 | 288 |
| 567 | 3300044712 | Ga0453684_0703623 | Ga0453684_0703623_159_1031 | 288 |
| 568 | 3300050489 | nmdc:mga03683_2331_c1 | nmdc:mga03683_2331_c1_4910_5776 | 288 |
| 569 | 3300050490 | nmdc:mga03n38_66521_c1 | nmdc:mga03n38_66521_c1_256_1122 | 288 |
| 570 | 3300050493 | nmdc:mga0k408_2689_c1 | nmdc:mga0k408_2689_c1_4161_5027 | 288 |
| 571 | 3300050496 | nmdc:mga07m45_552_c1 | nmdc:mga07m45_552_c1_5245_6111 | 288 |
| 572 | 3300053086 | Ga0500578_0177322 | Ga0500578_0177322_339_1205 | 288 |
| 573 | 3300053103 | Ga0500555_000321 | Ga0500555_000321_6175_7041 | 288 |
| 574 | 3300053104 | Ga0500556_0000370 | Ga0500556_0000370_8754_9620 | 288 |
| 575 | 3300053130 | Ga0500642_0006150 | Ga0500642_0006150_1749_2615 | 288 |
| 576 | 3300005445 | Ga0070708_100002874 | Ga0070708_1000028746 | 289 |
| 577 | 3300005445 | Ga0070708_100609100 | Ga0070708_1006091001 | 289 |
| 578 | 3300005458 | Ga0070681_10106650 | Ga0070681_101066502 | 289 |
| 579 | 3300005467 | Ga0070706_100195373 | Ga0070706_1001953732 | 289 |
| 580 | 3300005468 | Ga0070707_100012475 | Ga0070707_1000124756 | 289 |
| 581 | 3300005468 | Ga0070707_100197402 | Ga0070707_1001974022 | 289 |
| 582 | 3300005471 | Ga0070698_100122724 | Ga0070698_1001227243 | 289 |
| 583 | 3300009011 | Ga0105251_10014266 | Ga0105251_100142663 | 289 |
| 584 | 3300009036 | Ga0105244_10005357 | Ga0105244_100053573 | 289 |
| 585 | 3300009092 | Ga0105250_10000409 | Ga0105250_100004093 | 289 |
| 586 | 3300009094 | Ga0111539_10005064 | Ga0111539_1000506412 | 289 |
| 587 | 3300009148 | Ga0105243_10034846 | Ga0105243_100348462 | 289 |
| 588 | 3300025711 | Ga0207696_1000059 | Ga0207696_100005927 | 289 |
| 589 | 3300025728 | Ga0207655_1004852 | Ga0207655_10048522 | 289 |
| 590 | 3300025735 | Ga0207713_1000005 | Ga0207713_1000005134 | 289 |
| 591 | 3300025922 | Ga0207646_10491209 | Ga0207646_104912091 | 289 |
| 592 | 3300025935 | Ga0207709_10012460 | Ga0207709_100124602 | 289 |
| 593 | 3300027907 | Ga0207428_10004079 | Ga0207428_1000407912 | 289 |
| 594 | 3300031691 | Ga0316579_10052553 | Ga0316579_100525532 | 289 |
| 595 | 3300031727 | Ga0316576_10009486 | Ga0316576_100094868 | 289 |
| 596 | 3300031728 | Ga0316578_10034042 | Ga0316578_100340422 | 289 |
| 597 | 3300032133 | Ga0316583_10009740 | Ga0316583_100097402 | 289 |
| 598 | 3300035398 | Ga0316574_0000893 | Ga0316574_0000893_9851_10720 | 289 |
| 599 | 3300035398 | Ga0316574_0003767 | Ga0316574_0003767_5386_6258 | 289 |
| 600 | 3300035398 | Ga0316574_0013618 | Ga0316574_0013618_1657_2526 | 289 |
| 601 | 3300035398 | Ga0316574_0174634 | Ga0316574_0174634_69_938 | 289 |
| 602 | 3300036647 | Ga0316582_0049380 | Ga0316582_0049380_641_1510 | 289 |
| 603 | 3300036647 | Ga0316582_0049512 | Ga0316582_0049512_472_1341 | 289 |
| 604 | 3300036712 | Ga0316584_0149609 | Ga0316584_0149609_506_1375 | 289 |
| 605 | 3300036712 | Ga0316584_0169645 | Ga0316584_0169645_358_1230 | 289 |
| 606 | 3300038726 | Ga0400490_39170 | Ga0400490_39170_12344_13219 | 289 |
| 607 | 3300049571 | Ga0501034_0033027 | Ga0501034_0033027_3048_3917 | 289 |
| 608 | 3300049574 | Ga0501038_0073618 | Ga0501038_0073618_1939_2808 | 289 |
| 609 | 3300050511 | nmdc:mga08y16_2819_c1 | nmdc:mga08y16_2819_c1_7282_8163 | 289 |
| 610 | 3300050512 | nmdc:mga0n895_176338_c1 | nmdc:mga0n895_176338_c1_241_1122 | 289 |
| 611 | 3300005439 | Ga0070711_100000573 | Ga0070711_10000057320 | 290 |
| 612 | 3300005841 | Ga0068863_100030593 | Ga0068863_1000305933 | 290 |
| 613 | 3300006358 | Ga0068871_100034330 | Ga0068871_1000343305 | 290 |
| 614 | 3300006844 | Ga0075428_100000046 | Ga0075428_10000004679 | 290 |
| 615 | 3300006880 | Ga0075429_100041851 | Ga0075429_1000418515 | 290 |
| 616 | 3300006880 | Ga0075429_100111008 | Ga0075429_1001110082 | 290 |
| 617 | 3300009098 | Ga0105245_10793981 | Ga0105245_107939811 | 290 |
| 618 | 3300025936 | Ga0207670_10311049 | Ga0207670_103110492 | 290 |
| 619 | 3300028556 | Ga0265337_1035432 | Ga0265337_10354321 | 290 |
| 620 | 3300028800 | Ga0265338_10011598 | Ga0265338_1001159810 | 290 |
| 621 | 3300031456 | Ga0307513_10072931 | Ga0307513_100729312 | 290 |
| 622 | 3300031665 | Ga0316575_10015656 | Ga0316575_100156562 | 290 |
| 623 | 3300031665 | Ga0316575_10039769 | Ga0316575_100397692 | 290 |
| 624 | 3300031727 | Ga0316576_10005532 | Ga0316576_100055323 | 290 |
| 625 | 3300031727 | Ga0316576_10037418 | Ga0316576_100374184 | 290 |
| 626 | 3300031727 | Ga0316576_10111352 | Ga0316576_101113521 | 290 |
| 627 | 3300031727 | Ga0316576_10124977 | Ga0316576_101249772 | 290 |
| 628 | 3300031728 | Ga0316578_10000298 | Ga0316578_1000029813 | 290 |
| 629 | 3300031728 | Ga0316578_10003723 | Ga0316578_100037236 | 290 |
| 630 | 3300031728 | Ga0316578_10003753 | Ga0316578_100037534 | 290 |
| 631 | 3300031728 | Ga0316578_10061058 | Ga0316578_100610582 | 290 |
| 632 | 3300031733 | Ga0316577_10003314 | Ga0316577_100033147 | 290 |
| 633 | 3300031733 | Ga0316577_10052834 | Ga0316577_100528342 | 290 |
| 634 | 3300032133 | Ga0316583_10000505 | Ga0316583_100005054 | 290 |
| 635 | 3300032137 | Ga0316585_10045646 | Ga0316585_100456462 | 290 |
| 636 | 3300032139 | Ga0316580_10000153 | Ga0316580_100001535 | 290 |
| 637 | 3300032168 | Ga0316593_10000959 | Ga0316593_100009596 | 290 |
| 638 | 3300032168 | Ga0316593_10003375 | Ga0316593_100033752 | 290 |
| 639 | 3300033524 | Ga0316592_1000668 | Ga0316592_10006685 | 290 |
| 640 | 3300033524 | Ga0316592_1000957 | Ga0316592_10009572 | 290 |
| 641 | 3300033528 | Ga0316588_1000091 | Ga0316588_10000913 | 290 |
| 642 | 3300033528 | Ga0316588_1000365 | Ga0316588_10003653 | 290 |
| 643 | 3300033529 | Ga0316587_1004347 | Ga0316587_10043471 | 290 |
| 644 | 3300033541 | Ga0316596_1000506 | Ga0316596_10005062 | 290 |
| 645 | 3300035398 | Ga0316574_0004153 | Ga0316574_0004153_4877_5749 | 290 |
| 646 | 3300035398 | Ga0316574_0005203 | Ga0316574_0005203_5842_6714 | 290 |
| 647 | 3300035398 | Ga0316574_0054821 | Ga0316574_0054821_424_1296 | 290 |
| 648 | 3300035398 | Ga0316574_0060801 | Ga0316574_0060801_131_1003 | 290 |
| 649 | 3300035398 | Ga0316574_0078769 | Ga0316574_0078769_1170_2045 | 290 |
| 650 | 3300036647 | Ga0316582_0001897 | Ga0316582_0001897_3254_4126 | 290 |
| 651 | 3300036647 | Ga0316582_0014120 | Ga0316582_0014120_2490_3362 | 290 |
| 652 | 3300036647 | Ga0316582_0076514 | Ga0316582_0076514_1085_1960 | 290 |
| 653 | 3300036712 | Ga0316584_0001074 | Ga0316584_0001074_11450_12322 | 290 |
| 654 | 3300036712 | Ga0316584_0006706 | Ga0316584_0006706_5281_6153 | 290 |
| 655 | 3300038741 | Ga0400488_52774 | Ga0400488_52774_302_1174 | 290 |
| 656 | 3300039437 | Ga0436365_1447325 | Ga0436365_1447325_1529_2437 | 290 |
| 657 | 3300042876 | Ga0451577_0024870 | Ga0451577_0024870_1032_1904 | 290 |
| 658 | 3300042876 | Ga0451577_0124316 | Ga0451577_0124316_242_1114 | 290 |
| 659 | 3300044712 | Ga0453684_0137697 | Ga0453684_0137697_1544_2419 | 290 |
| 660 | 3300044712 | Ga0453684_0252304 | Ga0453684_0252304_944_1816 | 290 |
| 661 | 3300046683 | Ga0495658_0093790 | Ga0495658_0093790_290_1165 | 290 |
| 662 | 3300050508 | nmdc:mga09592_49210_c1 | nmdc:mga09592_49210_c1_2417_3301 | 290 |
| 663 | 3300050508 | nmdc:mga09592_516992_c1 | nmdc:mga09592_516992_c1_44_919 | 290 |
| 664 | 3300050508 | nmdc:mga09592_7872_c1 | nmdc:mga09592_7872_c1_892_1776 | 290 |
| 665 | 3300050508 | nmdc:mga09592_82183_c1 | nmdc:mga09592_82183_c1_417_1301 | 290 |
| 666 | 3300053103 | Ga0500555_000025 | Ga0500555_000025_80870_81742 | 290 |
| 667 | 3300053153 | Ga0500616_0005952 | Ga0500616_0005952_6293_7165 | 290 |
| 668 | 3300003203 | JGI25406J46586_10017169 | JGI25406J46586_100171694 | 291 |
| 669 | 3300005340 | Ga0070689_100169064 | Ga0070689_1001690641 | 291 |
| 670 | 3300005366 | Ga0070659_100515195 | Ga0070659_1005151951 | 291 |
| 671 | 3300005435 | Ga0070714_100162250 | Ga0070714_1001622503 | 291 |
| 672 | 3300005445 | Ga0070708_100131073 | Ga0070708_1001310732 | 291 |
| 673 | 3300005445 | Ga0070708_100143829 | Ga0070708_1001438291 | 291 |
| 674 | 3300005459 | Ga0068867_100377956 | Ga0068867_1003779561 | 291 |
| 675 | 3300005467 | Ga0070706_100000324 | Ga0070706_10000032455 | 291 |
| 676 | 3300005467 | Ga0070706_100045174 | Ga0070706_1000451744 | 291 |
| 677 | 3300005467 | Ga0070706_100112232 | Ga0070706_1001122321 | 291 |
| 678 | 3300005467 | Ga0070706_100216245 | Ga0070706_1002162453 | 291 |
| 679 | 3300005468 | Ga0070707_100000410 | Ga0070707_10000041029 | 291 |
| 680 | 3300005468 | Ga0070707_100010272 | Ga0070707_1000102728 | 291 |
| 681 | 3300005471 | Ga0070698_100010399 | Ga0070698_1000103998 | 291 |
| 682 | 3300005471 | Ga0070698_100048959 | Ga0070698_1000489593 | 291 |
| 683 | 3300005471 | Ga0070698_100085466 | Ga0070698_1000854664 | 291 |
| 684 | 3300005518 | Ga0070699_100136302 | Ga0070699_1001363023 | 291 |
| 685 | 3300005536 | Ga0070697_100009541 | Ga0070697_1000095412 | 291 |
| 686 | 3300005536 | Ga0070697_100022676 | Ga0070697_1000226764 | 291 |
| 687 | 3300005543 | Ga0070672_100080599 | Ga0070672_1000805992 | 291 |
| 688 | 3300005546 | Ga0070696_100422675 | Ga0070696_1004226752 | 291 |
| 689 | 3300005548 | Ga0070665_100072418 | Ga0070665_1000724183 | 291 |
| 690 | 3300005548 | Ga0070665_100228242 | Ga0070665_1002282422 | 291 |
| 691 | 3300005578 | Ga0068854_100189738 | Ga0068854_1001897382 | 291 |
| 692 | 3300005985 | Ga0081539_10002025 | Ga0081539_1000202522 | 291 |
| 693 | 3300005985 | Ga0081539_10068826 | Ga0081539_100688264 | 291 |
| 694 | 3300006028 | Ga0070717_10018213 | Ga0070717_100182133 | 291 |
| 695 | 3300006028 | Ga0070717_10292274 | Ga0070717_102922742 | 291 |
| 696 | 3300006177 | Ga0075362_10000964 | Ga0075362_100009648 | 291 |
| 697 | 3300006195 | Ga0075366_10008847 | Ga0075366_100088472 | 291 |
| 698 | 3300006353 | Ga0075370_10000297 | Ga0075370_1000029720 | 291 |
| 699 | 3300009098 | Ga0105245_10025480 | Ga0105245_100254804 | 291 |
| 700 | 3300013297 | Ga0157378_10429427 | Ga0157378_104294272 | 291 |
| 701 | 3300017792 | Ga0163161_10005272 | Ga0163161_100052724 | 291 |
| 702 | 3300021384 | Ga0213876_10000705 | Ga0213876_100007056 | 291 |
| 703 | 3300025315 | Ga0207697_10000183 | Ga0207697_1000018323 | 291 |
| 704 | 3300025901 | Ga0207688_10000989 | Ga0207688_100009898 | 291 |
| 705 | 3300025907 | Ga0207645_10003527 | Ga0207645_100035278 | 291 |
| 706 | 3300025910 | Ga0207684_10000390 | Ga0207684_100003908 | 291 |
| 707 | 3300025910 | Ga0207684_10043327 | Ga0207684_100433272 | 291 |
| 708 | 3300025910 | Ga0207684_10333597 | Ga0207684_103335972 | 291 |
| 709 | 3300025915 | Ga0207693_10073155 | Ga0207693_100731553 | 291 |
| 710 | 3300025919 | Ga0207657_10175648 | Ga0207657_101756482 | 291 |
| 711 | 3300025922 | Ga0207646_10000108 | Ga0207646_1000010848 | 291 |
| 712 | 3300025922 | Ga0207646_10001029 | Ga0207646_1000102930 | 291 |
| 713 | 3300025922 | Ga0207646_10378417 | Ga0207646_103784172 | 291 |
| 714 | 3300025922 | Ga0207646_10517696 | Ga0207646_105176961 | 291 |
| 715 | 3300025928 | Ga0207700_10175861 | Ga0207700_101758611 | 291 |
| 716 | 3300025929 | Ga0207664_10141640 | Ga0207664_101416403 | 291 |
| 717 | 3300025931 | Ga0207644_10074328 | Ga0207644_100743282 | 291 |
| 718 | 3300025933 | Ga0207706_10038016 | Ga0207706_100380163 | 291 |
| 719 | 3300025937 | Ga0207669_10036787 | Ga0207669_100367875 | 291 |
| 720 | 3300025940 | Ga0207691_10045704 | Ga0207691_100457043 | 291 |
| 721 | 3300026089 | Ga0207648_10033690 | Ga0207648_100336902 | 291 |
| 722 | 3300027717 | Ga0209998_10007442 | Ga0209998_100074422 | 291 |
| 723 | 3300028379 | Ga0268266_10072831 | Ga0268266_100728313 | 291 |
| 724 | 3300028379 | Ga0268266_10121817 | Ga0268266_101218173 | 291 |
| 725 | 3300031344 | Ga0265316_10068740 | Ga0265316_100687402 | 291 |
| 726 | 3300031665 | Ga0316575_10024897 | Ga0316575_100248972 | 291 |
| 727 | 3300031691 | Ga0316579_10005547 | Ga0316579_100055475 | 291 |
| 728 | 3300031733 | Ga0316577_10074495 | Ga0316577_100744952 | 291 |
| 729 | 3300032139 | Ga0316580_10004207 | Ga0316580_100042072 | 291 |
| 730 | 3300032139 | Ga0316580_10044053 | Ga0316580_100440532 | 291 |
| 731 | 3300035170 | Ga0373943_0164165 | Ga0373943_0164165_304_1179 | 291 |
| 732 | 3300035398 | Ga0316574_0138411 | Ga0316574_0138411_259_1134 | 291 |
| 733 | 3300036647 | Ga0316582_0012384 | Ga0316582_0012384_1918_2793 | 291 |
| 734 | 3300037588 | Ga0316581_0012938 | Ga0316581_0012938_1254_2129 | 291 |
| 735 | 3300039437 | Ga0436365_0655171 | Ga0436365_0655171_13903_14778 | 291 |
| 736 | 3300039437 | Ga0436365_0832581 | Ga0436365_0832581_207_1082 | 291 |
| 737 | 3300039453 | Ga0436362_0838041 | Ga0436362_0838041_70_945 | 291 |
| 738 | 3300042876 | Ga0451577_0001080 | Ga0451577_0001080_33020_33898 | 291 |
| 739 | 3300048905 | Ga0496102_0020269 | Ga0496102_0020269_31_906 | 291 |
| 740 | 3300048906 | Ga0496103_0065336 | Ga0496103_0065336_1209_2138 | 291 |
| 741 | 3300048909 | Ga0496106_0323222 | Ga0496106_0323222_160_1035 | 291 |
| 742 | 3300048911 | Ga0496108_0159356 | Ga0496108_0159356_778_1707 | 291 |
| 743 | 3300048913 | Ga0496110_0250574 | Ga0496110_0250574_532_1461 | 291 |
| 744 | 3300049589 | Ga0501073_0219710 | Ga0501073_0219710_54_965 | 291 |
| 745 | 3300050493 | nmdc:mga0k408_297_c1 | nmdc:mga0k408_297_c1_9219_10094 | 291 |
| 746 | 3300050514 | nmdc:mga08x19_39022_c1 | nmdc:mga08x19_39022_c1_950_1948 | 291 |
| 747 | 3300005330 | Ga0070690_100043845 | Ga0070690_1000438452 | 292 |
| 748 | 3300005338 | Ga0068868_100030702 | Ga0068868_1000307024 | 292 |
| 749 | 3300005338 | Ga0068868_100237746 | Ga0068868_1002377462 | 292 |
| 750 | 3300005339 | Ga0070660_100186000 | Ga0070660_1001860002 | 292 |
| 751 | 3300005340 | Ga0070689_100173684 | Ga0070689_1001736841 | 292 |
| 752 | 3300005353 | Ga0070669_100071535 | Ga0070669_1000715353 | 292 |
| 753 | 3300005353 | Ga0070669_100150138 | Ga0070669_1001501381 | 292 |
| 754 | 3300005354 | Ga0070675_100027122 | Ga0070675_1000271225 | 292 |
| 755 | 3300005354 | Ga0070675_100153054 | Ga0070675_1001530542 | 292 |
| 756 | 3300005355 | Ga0070671_100183767 | Ga0070671_1001837672 | 292 |
| 757 | 3300005356 | Ga0070674_100046801 | Ga0070674_1000468012 | 292 |
| 758 | 3300005406 | Ga0070703_10013403 | Ga0070703_100134032 | 292 |
| 759 | 3300005438 | Ga0070701_10014396 | Ga0070701_100143962 | 292 |
| 760 | 3300005439 | Ga0070711_100011584 | Ga0070711_1000115841 | 292 |
| 761 | 3300005441 | Ga0070700_100327379 | Ga0070700_1003273791 | 292 |
| 762 | 3300005456 | Ga0070678_100230187 | Ga0070678_1002301872 | 292 |
| 763 | 3300005467 | Ga0070706_100005770 | Ga0070706_10000577010 | 292 |
| 764 | 3300005467 | Ga0070706_100047206 | Ga0070706_1000472061 | 292 |
| 765 | 3300005468 | Ga0070707_100043311 | Ga0070707_1000433112 | 292 |
| 766 | 3300005535 | Ga0070684_100106316 | Ga0070684_1001063162 | 292 |
| 767 | 3300005543 | Ga0070672_100065252 | Ga0070672_1000652523 | 292 |
| 768 | 3300005544 | Ga0070686_100036953 | Ga0070686_1000369533 | 292 |
| 769 | 3300005545 | Ga0070695_100073291 | Ga0070695_1000732912 | 292 |
| 770 | 3300005546 | Ga0070696_100034477 | Ga0070696_1000344774 | 292 |
| 771 | 3300005547 | Ga0070693_100032890 | Ga0070693_1000328903 | 292 |
| 772 | 3300005614 | Ga0068856_100148366 | Ga0068856_1001483662 | 292 |
| 773 | 3300005615 | Ga0070702_100036426 | Ga0070702_1000364261 | 292 |
| 774 | 3300005618 | Ga0068864_100017314 | Ga0068864_1000173145 | 292 |
| 775 | 3300005718 | Ga0068866_10031102 | Ga0068866_100311022 | 292 |
| 776 | 3300005719 | Ga0068861_100158919 | Ga0068861_1001589192 | 292 |
| 777 | 3300005840 | Ga0068870_10035367 | Ga0068870_100353672 | 292 |
| 778 | 3300005841 | Ga0068863_100146048 | Ga0068863_1001460482 | 292 |
| 779 | 3300005842 | Ga0068858_100062964 | Ga0068858_1000629642 | 292 |
| 780 | 3300005844 | Ga0068862_100478769 | Ga0068862_1004787691 | 292 |
| 781 | 3300005937 | Ga0081455_10031049 | Ga0081455_100310494 | 292 |
| 782 | 3300006163 | Ga0070715_10000601 | Ga0070715_100006015 | 292 |
| 783 | 3300006173 | Ga0070716_100240270 | Ga0070716_1002402701 | 292 |
| 784 | 3300006237 | Ga0097621_100030540 | Ga0097621_1000305404 | 292 |
| 785 | 3300006358 | Ga0068871_100012233 | Ga0068871_1000122334 | 292 |
| 786 | 3300006844 | Ga0075428_100087688 | Ga0075428_1000876882 | 292 |
| 787 | 3300006880 | Ga0075429_100134230 | Ga0075429_1001342302 | 292 |
| 788 | 3300006881 | Ga0068865_100202506 | Ga0068865_1002025061 | 292 |
| 789 | 3300006881 | Ga0068865_100442236 | Ga0068865_1004422361 | 292 |
| 790 | 3300009094 | Ga0111539_10585435 | Ga0111539_105854352 | 292 |
| 791 | 3300009098 | Ga0105245_10149933 | Ga0105245_101499332 | 292 |
| 792 | 3300009098 | Ga0105245_10376039 | Ga0105245_103760392 | 292 |
| 793 | 3300009098 | Ga0105245_10509986 | Ga0105245_105099862 | 292 |
| 794 | 3300009148 | Ga0105243_10014385 | Ga0105243_100143854 | 292 |
| 795 | 3300009176 | Ga0105242_10004323 | Ga0105242_100043238 | 292 |
| 796 | 3300009177 | Ga0105248_10046511 | Ga0105248_100465112 | 292 |
| 797 | 3300013296 | Ga0157374_10010403 | Ga0157374_100104032 | 292 |
| 798 | 3300013297 | Ga0157378_10005123 | Ga0157378_100051235 | 292 |
| 799 | 3300013307 | Ga0157372_10031112 | Ga0157372_100311125 | 292 |
| 800 | 3300013307 | Ga0157372_10779115 | Ga0157372_107791151 | 292 |
| 801 | 3300013308 | Ga0157375_10016243 | Ga0157375_100162435 | 292 |
| 802 | 3300014325 | Ga0163163_10161349 | Ga0163163_101613492 | 292 |
| 803 | 3300014968 | Ga0157379_10025219 | Ga0157379_100252194 | 292 |
| 804 | 3300014969 | Ga0157376_10228058 | Ga0157376_102280582 | 292 |
| 805 | 3300025885 | Ga0207653_10004697 | Ga0207653_100046972 | 292 |
| 806 | 3300025898 | Ga0207692_10128404 | Ga0207692_101284041 | 292 |
| 807 | 3300025901 | Ga0207688_10009622 | Ga0207688_100096222 | 292 |
| 808 | 3300025905 | Ga0207685_10008319 | Ga0207685_100083193 | 292 |
| 809 | 3300025907 | Ga0207645_10012070 | Ga0207645_100120704 | 292 |
| 810 | 3300025907 | Ga0207645_10145131 | Ga0207645_101451313 | 292 |
| 811 | 3300025908 | Ga0207643_10025758 | Ga0207643_100257582 | 292 |
| 812 | 3300025910 | Ga0207684_10031901 | Ga0207684_100319014 | 292 |
| 813 | 3300025910 | Ga0207684_10226564 | Ga0207684_102265642 | 292 |
| 814 | 3300025915 | Ga0207693_10000233 | Ga0207693_1000023324 | 292 |
| 815 | 3300025916 | Ga0207663_10007610 | Ga0207663_100076102 | 292 |
| 816 | 3300025918 | Ga0207662_10006099 | Ga0207662_100060995 | 292 |
| 817 | 3300025918 | Ga0207662_10193636 | Ga0207662_101936362 | 292 |
| 818 | 3300025919 | Ga0207657_10202437 | Ga0207657_102024372 | 292 |
| 819 | 3300025922 | Ga0207646_10099621 | Ga0207646_100996213 | 292 |
| 820 | 3300025923 | Ga0207681_10252861 | Ga0207681_102528611 | 292 |
| 821 | 3300025927 | Ga0207687_10068428 | Ga0207687_100684282 | 292 |
| 822 | 3300025931 | Ga0207644_10054681 | Ga0207644_100546812 | 292 |
| 823 | 3300025932 | Ga0207690_10165910 | Ga0207690_101659102 | 292 |
| 824 | 3300025933 | Ga0207706_10049764 | Ga0207706_100497642 | 292 |
| 825 | 3300025933 | Ga0207706_10075973 | Ga0207706_100759734 | 292 |
| 826 | 3300025934 | Ga0207686_10074687 | Ga0207686_100746872 | 292 |
| 827 | 3300025935 | Ga0207709_10097564 | Ga0207709_100975642 | 292 |
| 828 | 3300025937 | Ga0207669_10024183 | Ga0207669_100241833 | 292 |
| 829 | 3300025938 | Ga0207704_10036901 | Ga0207704_100369011 | 292 |
| 830 | 3300025939 | Ga0207665_10124202 | Ga0207665_101242021 | 292 |
| 831 | 3300025940 | Ga0207691_10048715 | Ga0207691_100487152 | 292 |
| 832 | 3300025941 | Ga0207711_10005862 | Ga0207711_100058624 | 292 |
| 833 | 3300025942 | Ga0207689_10088601 | Ga0207689_100886013 | 292 |
| 834 | 3300025972 | Ga0207668_10233407 | Ga0207668_102334073 | 292 |
| 835 | 3300025981 | Ga0207640_10101151 | Ga0207640_101011512 | 292 |
| 836 | 3300026023 | Ga0207677_10019794 | Ga0207677_100197944 | 292 |
| 837 | 3300026035 | Ga0207703_10048763 | Ga0207703_100487633 | 292 |
| 838 | 3300026075 | Ga0207708_10011859 | Ga0207708_100118594 | 292 |
| 839 | 3300026075 | Ga0207708_10022189 | Ga0207708_100221892 | 292 |
| 840 | 3300026075 | Ga0207708_10111039 | Ga0207708_101110392 | 292 |
| 841 | 3300026088 | Ga0207641_10160793 | Ga0207641_101607932 | 292 |
| 842 | 3300026089 | Ga0207648_10069294 | Ga0207648_100692942 | 292 |
| 843 | 3300026095 | Ga0207676_10093014 | Ga0207676_100930142 | 292 |
| 844 | 3300026118 | Ga0207675_100007403 | Ga0207675_1000074033 | 292 |
| 845 | 3300026121 | Ga0207683_10031317 | Ga0207683_100313172 | 292 |
| 846 | 3300028380 | Ga0268265_10173869 | Ga0268265_101738692 | 292 |
| 847 | 3300028380 | Ga0268265_10202348 | Ga0268265_102023482 | 292 |
| 848 | 3300031240 | Ga0265320_10066480 | Ga0265320_100664802 | 292 |
| 849 | 3300031595 | Ga0265313_10075513 | Ga0265313_100755132 | 292 |
| 850 | 3300035083 | Ga0373926_0003662 | Ga0373926_0003662_818_1717 | 292 |
| 851 | 3300035089 | Ga0373944_0000300 | Ga0373944_0000300_1741_2640 | 292 |
| 852 | 3300035111 | Ga0373923_0007689 | Ga0373923_0007689_2882_3781 | 292 |
| 853 | 3300035113 | Ga0373936_0001801 | Ga0373936_0001801_3496_4395 | 292 |
| 854 | 3300035116 | Ga0373945_0001062 | Ga0373945_0001062_3638_4537 | 292 |
| 855 | 3300035170 | Ga0373943_0009602 | Ga0373943_0009602_2297_3196 | 292 |
| 856 | 3300035171 | Ga0373946_0004684 | Ga0373946_0004684_2111_3010 | 292 |
| 857 | 3300035695 | Ga0373927_0072817 | Ga0373927_0072817_1142_2041 | 292 |
| 858 | 3300042876 | Ga0451577_0010592 | Ga0451577_0010592_3082_3963 | 292 |
| 859 | 3300042876 | Ga0451577_0043273 | Ga0451577_0043273_1415_2302 | 292 |
| 860 | 3300042876 | Ga0451577_0095906 | Ga0451577_0095906_1331_2221 | 292 |
| 861 | 3300044712 | Ga0453684_0006977 | Ga0453684_0006977_9028_9915 | 292 |
| 862 | 3300045051 | Ga0451576_0038233 | Ga0451576_0038233_1277_2164 | 292 |
| 863 | 3300045051 | Ga0451576_0633530 | Ga0451576_0633530_99_989 | 292 |
| 864 | 3300046455 | Ga0495603_0015230 | Ga0495603_0015230_1816_2715 | 292 |
| 865 | 3300046459 | Ga0495629_0036726 | Ga0495629_0036726_2425_3324 | 292 |
| 866 | 3300046461 | Ga0495641_0026565 | Ga0495641_0026565_1832_2731 | 292 |
| 867 | 3300046473 | Ga0495582_0010834 | Ga0495582_0010834_1699_2598 | 292 |
| 868 | 3300046475 | Ga0495639_0001643 | Ga0495639_0001643_5529_6428 | 292 |
| 869 | 3300046475 | Ga0495639_0019588 | Ga0495639_0019588_215_1114 | 292 |
| 870 | 3300046476 | Ga0495662_0006174 | Ga0495662_0006174_3950_4849 | 292 |
| 871 | 3300046492 | Ga0495585_0010471 | Ga0495585_0010471_1020_1919 | 292 |
| 872 | 3300046517 | Ga0495630_0004915 | Ga0495630_0004915_2177_3076 | 292 |
| 873 | 3300046522 | Ga0495643_0000208 | Ga0495643_0000208_8820_9734 | 292 |
| 874 | 3300046526 | Ga0495666_0009535 | Ga0495666_0009535_817_1716 | 292 |
| 875 | 3300046531 | Ga0495665_0007185 | Ga0495665_0007185_290_1189 | 292 |
| 876 | 3300046531 | Ga0495665_0010876 | Ga0495665_0010876_1846_2745 | 292 |
| 877 | 3300046533 | Ga0495640_0014561 | Ga0495640_0014561_2211_3110 | 292 |
| 878 | 3300046535 | Ga0495586_0003922 | Ga0495586_0003922_6912_7811 | 292 |
| 879 | 3300046559 | Ga0495667_0094114 | Ga0495667_0094114_289_1188 | 292 |
| 880 | 3300046615 | Ga0495656_0002008 | Ga0495656_0002008_4709_5608 | 292 |
| 881 | 3300046615 | Ga0495656_0036890 | Ga0495656_0036890_263_1168 | 292 |
| 882 | 3300046663 | Ga0495635_0004445 | Ga0495635_0004445_3820_4719 | 292 |
| 883 | 3300046674 | Ga0495588_0000461 | Ga0495588_0000461_16631_17530 | 292 |
| 884 | 3300046681 | Ga0495647_0007010 | Ga0495647_0007010_560_1459 | 292 |
| 885 | 3300046683 | Ga0495658_0000868 | Ga0495658_0000868_132_1031 | 292 |
| 886 | 3300046683 | Ga0495658_0315602 | Ga0495658_0315602_24_923 | 292 |
| 887 | 3300046689 | Ga0495613_0007750 | Ga0495613_0007750_132_1031 | 292 |
| 888 | 3300046689 | Ga0495613_0143610 | Ga0495613_0143610_43_942 | 292 |
| 889 | 3300046690 | Ga0495624_0006404 | Ga0495624_0006404_5637_6536 | 292 |
| 890 | 3300046691 | Ga0495670_0017881 | Ga0495670_0017881_1957_2856 | 292 |
| 891 | 3300046809 | Ga0495600_0276939 | Ga0495600_0276939_142_1041 | 292 |
| 892 | 3300047315 | Ga0495581_0002010 | Ga0495581_0002010_6306_7205 | 292 |
| 893 | 3300047315 | Ga0495581_0032140 | Ga0495581_0032140_1301_2200 | 292 |
| 894 | 3300047319 | Ga0495674_0011893 | Ga0495674_0011893_5747_6646 | 292 |
| 895 | 3300047322 | Ga0495680_0010498 | Ga0495680_0010498_2425_3324 | 292 |
| 896 | 3300048903 | Ga0496100_0010082 | Ga0496100_0010082_1323_2222 | 292 |
| 897 | 3300048904 | Ga0496101_0011665 | Ga0496101_0011665_3839_4738 | 292 |
| 898 | 3300048906 | Ga0496103_0022958 | Ga0496103_0022958_2209_3108 | 292 |
| 899 | 3300048907 | Ga0496104_0185538 | Ga0496104_0185538_320_1219 | 292 |
| 900 | 3300048909 | Ga0496106_0024207 | Ga0496106_0024207_2797_3696 | 292 |
| 901 | 3300048910 | Ga0496107_0004978 | Ga0496107_0004978_5504_6403 | 292 |
| 902 | 3300048911 | Ga0496108_0013859 | Ga0496108_0013859_3207_4106 | 292 |
| 903 | 3300048912 | Ga0496109_0007664 | Ga0496109_0007664_1180_2079 | 292 |
| 904 | 3300048912 | Ga0496109_0022989 | Ga0496109_0022989_2904_3803 | 292 |
| 905 | 3300048913 | Ga0496110_0003658 | Ga0496110_0003658_1379_2278 | 292 |
| 906 | 3300048914 | Ga0496111_0004083 | Ga0496111_0004083_7066_7965 | 292 |
| 907 | 3300048915 | Ga0496112_0122475 | Ga0496112_0122475_1134_2033 | 292 |
| 908 | 3300048916 | Ga0496113_0039232 | Ga0496113_0039232_2079_2978 | 292 |
| 909 | 3300048917 | Ga0496114_0031652 | Ga0496114_0031652_2268_3167 | 292 |
| 910 | 3300049570 | Ga0501033_0087604 | Ga0501033_0087604_618_1568 | 292 |
| 911 | 3300049572 | Ga0501036_0003125 | Ga0501036_0003125_6897_7847 | 292 |
| 912 | 3300049572 | Ga0501036_0051739 | Ga0501036_0051739_1243_2193 | 292 |
| 913 | 3300049573 | Ga0501037_0072433 | Ga0501037_0072433_1076_2026 | 292 |
| 914 | 3300049575 | Ga0501039_0049609 | Ga0501039_0049609_194_1144 | 292 |
| 915 | 3300049576 | Ga0501040_0049075 | Ga0501040_0049075_326_1276 | 292 |
| 916 | 3300049577 | Ga0501041_0129563 | Ga0501041_0129563_295_1275 | 292 |
| 917 | 3300049578 | Ga0501042_0035799 | Ga0501042_0035799_799_1749 | 292 |
| 918 | 3300049580 | Ga0501046_0030490 | Ga0501046_0030490_2573_3523 | 292 |
| 919 | 3300049582 | Ga0501048_0006833 | Ga0501048_0006833_187_1137 | 292 |
| 920 | 3300049587 | Ga0501071_0006225 | Ga0501071_0006225_309_1259 | 292 |
| 921 | 3300049588 | Ga0501072_0019250 | Ga0501072_0019250_3066_4016 | 292 |
| 922 | 3300049590 | Ga0501074_0067954 | Ga0501074_0067954_1193_2143 | 292 |
| 923 | 3300049591 | Ga0501075_0007763 | Ga0501075_0007763_5655_6605 | 292 |
| 924 | 3300049593 | Ga0501077_0067672 | Ga0501077_0067672_1005_1955 | 292 |
| 925 | 3300049741 | Ga0501079_0022783 | Ga0501079_0022783_1140_2090 | 292 |
| 926 | 3300049822 | Ga0501035_0080250 | Ga0501035_0080250_172_1122 | 292 |
| 927 | 3300049824 | Ga0501045_0000203 | Ga0501045_0000203_208_1158 | 292 |
| 928 | 3300050511 | nmdc:mga08y16_117863_c1 | nmdc:mga08y16_117863_c1_86_1111 | 292 |
| 929 | 3300050511 | nmdc:mga08y16_21619_c1 | nmdc:mga08y16_21619_c1_1081_2010 | 292 |
| 930 | 3300053085 | Ga0495619_0004035 | Ga0495619_0004035_8370_9269 | 292 |
| 931 | 3300053156 | Ga0500622_0001124 | Ga0500622_0001124_2471_3994 | 292 |
| 932 | 3300061734 | Ga0530510_0020650 | Ga0530510_0020650_2367_3317 | 292 |
| 933 | 3300002126 | JGI24035J26624_1001291 | JGI24035J26624_10012913 | 293 |
| 934 | 3300003911 | JGI25405J52794_10005555 | JGI25405J52794_100055552 | 293 |
| 935 | 3300005290 | Ga0065712_10005682 | Ga0065712_100056822 | 293 |
| 936 | 3300005290 | Ga0065712_10005725 | Ga0065712_100057252 | 293 |
| 937 | 3300005293 | Ga0065715_10000207 | Ga0065715_100002078 | 293 |
| 938 | 3300005293 | Ga0065715_10018423 | Ga0065715_100184233 | 293 |
| 939 | 3300005293 | Ga0065715_10027319 | Ga0065715_100273193 | 293 |
| 940 | 3300005293 | Ga0065715_10095093 | Ga0065715_100950932 | 293 |
| 941 | 3300005293 | Ga0065715_10274696 | Ga0065715_102746961 | 293 |
| 942 | 3300005328 | Ga0070676_10009128 | Ga0070676_100091288 | 293 |
| 943 | 3300005328 | Ga0070676_10067588 | Ga0070676_100675883 | 293 |
| 944 | 3300005328 | Ga0070676_10093831 | Ga0070676_100938312 | 293 |
| 945 | 3300005329 | Ga0070683_100043281 | Ga0070683_1000432815 | 293 |
| 946 | 3300005329 | Ga0070683_100062437 | Ga0070683_1000624373 | 293 |
| 947 | 3300005330 | Ga0070690_100014700 | Ga0070690_1000147004 | 293 |
| 948 | 3300005331 | Ga0070670_100001583 | Ga0070670_10000158320 | 293 |
| 949 | 3300005331 | Ga0070670_100017743 | Ga0070670_1000177434 | 293 |
| 950 | 3300005331 | Ga0070670_100123738 | Ga0070670_1001237382 | 293 |
| 951 | 3300005331 | Ga0070670_100245730 | Ga0070670_1002457302 | 293 |
| 952 | 3300005335 | Ga0070666_10002748 | Ga0070666_100027483 | 293 |
| 953 | 3300005335 | Ga0070666_10007841 | Ga0070666_100078418 | 293 |
| 954 | 3300005336 | Ga0070680_100040932 | Ga0070680_1000409323 | 293 |
| 955 | 3300005338 | Ga0068868_100095734 | Ga0068868_1000957342 | 293 |
| 956 | 3300005339 | Ga0070660_100029344 | Ga0070660_1000293442 | 293 |
| 957 | 3300005339 | Ga0070660_100097669 | Ga0070660_1000976692 | 293 |
| 958 | 3300005340 | Ga0070689_100012040 | Ga0070689_1000120403 | 293 |
| 959 | 3300005340 | Ga0070689_100031202 | Ga0070689_1000312022 | 293 |
| 960 | 3300005340 | Ga0070689_100190356 | Ga0070689_1001903561 | 293 |
| 961 | 3300005343 | Ga0070687_100018304 | Ga0070687_1000183043 | 293 |
| 962 | 3300005344 | Ga0070661_100031848 | Ga0070661_1000318481 | 293 |
| 963 | 3300005344 | Ga0070661_100178510 | Ga0070661_1001785102 | 293 |
| 964 | 3300005347 | Ga0070668_100006277 | Ga0070668_1000062773 | 293 |
| 965 | 3300005347 | Ga0070668_100165700 | Ga0070668_1001657002 | 293 |
| 966 | 3300005353 | Ga0070669_100001219 | Ga0070669_10000121921 | 293 |
| 967 | 3300005353 | Ga0070669_100070552 | Ga0070669_1000705522 | 293 |
| 968 | 3300005353 | Ga0070669_100097198 | Ga0070669_1000971982 | 293 |
| 969 | 3300005353 | Ga0070669_100347753 | Ga0070669_1003477531 | 293 |
| 970 | 3300005354 | Ga0070675_100001835 | Ga0070675_10000183514 | 293 |
| 971 | 3300005354 | Ga0070675_100014335 | Ga0070675_1000143355 | 293 |
| 972 | 3300005354 | Ga0070675_100258828 | Ga0070675_1002588281 | 293 |
| 973 | 3300005355 | Ga0070671_100003791 | Ga0070671_10000379114 | 293 |
| 974 | 3300005355 | Ga0070671_100014619 | Ga0070671_1000146198 | 293 |
| 975 | 3300005356 | Ga0070674_100003718 | Ga0070674_1000037186 | 293 |
| 976 | 3300005356 | Ga0070674_100012161 | Ga0070674_1000121616 | 293 |
| 977 | 3300005364 | Ga0070673_100006575 | Ga0070673_10000657510 | 293 |
| 978 | 3300005364 | Ga0070673_100035044 | Ga0070673_1000350443 | 293 |
| 979 | 3300005364 | Ga0070673_100079801 | Ga0070673_1000798011 | 293 |
| 980 | 3300005365 | Ga0070688_100010755 | Ga0070688_1000107558 | 293 |
| 981 | 3300005366 | Ga0070659_100018586 | Ga0070659_1000185863 | 293 |
| 982 | 3300005367 | Ga0070667_100002725 | Ga0070667_1000027252 | 293 |
| 983 | 3300005435 | Ga0070714_100199567 | Ga0070714_1001995672 | 293 |
| 984 | 3300005435 | Ga0070714_100228246 | Ga0070714_1002282463 | 293 |
| 985 | 3300005436 | Ga0070713_100199704 | Ga0070713_1001997043 | 293 |
| 986 | 3300005445 | Ga0070708_100007162 | Ga0070708_1000071628 | 293 |
| 987 | 3300005445 | Ga0070708_100187614 | Ga0070708_1001876141 | 293 |
| 988 | 3300005456 | Ga0070678_100002470 | Ga0070678_10000247011 | 293 |
| 989 | 3300005456 | Ga0070678_100022270 | Ga0070678_1000222703 | 293 |
| 990 | 3300005456 | Ga0070678_100073268 | Ga0070678_1000732682 | 293 |
| 991 | 3300005457 | Ga0070662_100251226 | Ga0070662_1002512262 | 293 |
| 992 | 3300005459 | Ga0068867_100103857 | Ga0068867_1001038572 | 293 |
| 993 | 3300005466 | Ga0070685_10011484 | Ga0070685_100114846 | 293 |
| 994 | 3300005467 | Ga0070706_100010526 | Ga0070706_1000105266 | 293 |
| 995 | 3300005467 | Ga0070706_100098289 | Ga0070706_1000982893 | 293 |
| 996 | 3300005467 | Ga0070706_100327815 | Ga0070706_1003278151 | 293 |
| 997 | 3300005468 | Ga0070707_100041760 | Ga0070707_1000417605 | 293 |
| 998 | 3300005468 | Ga0070707_100073922 | Ga0070707_1000739222 | 293 |
| 999 | 3300005468 | Ga0070707_100125636 | Ga0070707_1001256362 | 293 |
| 1000 | 3300005468 | Ga0070707_100246452 | Ga0070707_1002464521 | 293 |
| 1001 | 3300005471 | Ga0070698_100069732 | Ga0070698_1000697322 | 293 |
| 1002 | 3300005530 | Ga0070679_100046538 | Ga0070679_1000465385 | 293 |
| 1003 | 3300005535 | Ga0070684_100000767 | Ga0070684_10000076716 | 293 |
| 1004 | 3300005535 | Ga0070684_100070238 | Ga0070684_1000702383 | 293 |
| 1005 | 3300005536 | Ga0070697_100010698 | Ga0070697_1000106987 | 293 |
| 1006 | 3300005536 | Ga0070697_100055191 | Ga0070697_1000551912 | 293 |
| 1007 | 3300005543 | Ga0070672_100020621 | Ga0070672_1000206215 | 293 |
| 1008 | 3300005543 | Ga0070672_100617106 | Ga0070672_1006171061 | 293 |
| 1009 | 3300005548 | Ga0070665_100015168 | Ga0070665_10001516810 | 293 |
| 1010 | 3300005548 | Ga0070665_100015437 | Ga0070665_1000154374 | 293 |
| 1011 | 3300005548 | Ga0070665_100045184 | Ga0070665_1000451844 | 293 |
| 1012 | 3300005548 | Ga0070665_100118414 | Ga0070665_1001184143 | 293 |
| 1013 | 3300005549 | Ga0070704_100006310 | Ga0070704_1000063106 | 293 |
| 1014 | 3300005614 | Ga0068856_100047226 | Ga0068856_1000472264 | 293 |
| 1015 | 3300005615 | Ga0070702_100136457 | Ga0070702_1001364572 | 293 |
| 1016 | 3300005616 | Ga0068852_100716771 | Ga0068852_1007167711 | 293 |
| 1017 | 3300005617 | Ga0068859_100120098 | Ga0068859_1001200982 | 293 |
| 1018 | 3300005618 | Ga0068864_100024947 | Ga0068864_1000249475 | 293 |
| 1019 | 3300005841 | Ga0068863_100036293 | Ga0068863_1000362934 | 293 |
| 1020 | 3300005841 | Ga0068863_100773500 | Ga0068863_1007735001 | 293 |
| 1021 | 3300005842 | Ga0068858_100150457 | Ga0068858_1001504574 | 293 |
| 1022 | 3300005843 | Ga0068860_100041635 | Ga0068860_1000416352 | 293 |
| 1023 | 3300005843 | Ga0068860_100324855 | Ga0068860_1003248552 | 293 |
| 1024 | 3300005937 | Ga0081455_10001854 | Ga0081455_100018545 | 293 |
| 1025 | 3300005937 | Ga0081455_10004819 | Ga0081455_1000481910 | 293 |
| 1026 | 3300005937 | Ga0081455_10022064 | Ga0081455_100220645 | 293 |
| 1027 | 3300005937 | Ga0081455_10035616 | Ga0081455_100356162 | 293 |
| 1028 | 3300005937 | Ga0081455_10161693 | Ga0081455_101616932 | 293 |
| 1029 | 3300005983 | Ga0081540_1000127 | Ga0081540_100012770 | 293 |
| 1030 | 3300005983 | Ga0081540_1012719 | Ga0081540_10127192 | 293 |
| 1031 | 3300005985 | Ga0081539_10000138 | Ga0081539_1000013883 | 293 |
| 1032 | 3300006028 | Ga0070717_10043237 | Ga0070717_100432372 | 293 |
| 1033 | 3300006163 | Ga0070715_10025869 | Ga0070715_100258693 | 293 |
| 1034 | 3300006175 | Ga0070712_100397421 | Ga0070712_1003974211 | 293 |
| 1035 | 3300006358 | Ga0068871_100032982 | Ga0068871_1000329826 | 293 |
| 1036 | 3300006358 | Ga0068871_100058797 | Ga0068871_1000587974 | 293 |
| 1037 | 3300006358 | Ga0068871_100081325 | Ga0068871_1000813252 | 293 |
| 1038 | 3300006358 | Ga0068871_100226258 | Ga0068871_1002262582 | 293 |
| 1039 | 3300006844 | Ga0075428_100095554 | Ga0075428_1000955542 | 293 |
| 1040 | 3300006914 | Ga0075436_100038914 | Ga0075436_1000389144 | 293 |
| 1041 | 3300006931 | Ga0097620_100120101 | Ga0097620_1001201013 | 293 |
| 1042 | 3300007788 | Ga0099795_10028348 | Ga0099795_100283483 | 293 |
| 1043 | 3300009147 | Ga0114129_10066910 | Ga0114129_100669103 | 293 |
| 1044 | 3300009147 | Ga0114129_10159056 | Ga0114129_101590562 | 293 |
| 1045 | 3300009147 | Ga0114129_10576563 | Ga0114129_105765632 | 293 |
| 1046 | 3300009553 | Ga0105249_10008154 | Ga0105249_1000815411 | 293 |
| 1047 | 3300010159 | Ga0099796_10029044 | Ga0099796_100290442 | 293 |
| 1048 | 3300013296 | Ga0157374_10003663 | Ga0157374_100036632 | 293 |
| 1049 | 3300013296 | Ga0157374_10013259 | Ga0157374_100132596 | 293 |
| 1050 | 3300013296 | Ga0157374_10056057 | Ga0157374_100560571 | 293 |
| 1051 | 3300013296 | Ga0157374_10089726 | Ga0157374_100897263 | 293 |
| 1052 | 3300013296 | Ga0157374_10105063 | Ga0157374_101050632 | 293 |
| 1053 | 3300013296 | Ga0157374_10294866 | Ga0157374_102948662 | 293 |
| 1054 | 3300013297 | Ga0157378_10300211 | Ga0157378_103002112 | 293 |
| 1055 | 3300013297 | Ga0157378_10436697 | Ga0157378_104366972 | 293 |
| 1056 | 3300013306 | Ga0163162_10010329 | Ga0163162_100103294 | 293 |
| 1057 | 3300013306 | Ga0163162_10012362 | Ga0163162_100123625 | 293 |
| 1058 | 3300013306 | Ga0163162_10176119 | Ga0163162_101761192 | 293 |
| 1059 | 3300013306 | Ga0163162_10256493 | Ga0163162_102564932 | 293 |
| 1060 | 3300013307 | Ga0157372_10099993 | Ga0157372_100999933 | 293 |
| 1061 | 3300013308 | Ga0157375_10002221 | Ga0157375_1000222110 | 293 |
| 1062 | 3300013308 | Ga0157375_10023125 | Ga0157375_100231253 | 293 |
| 1063 | 3300013308 | Ga0157375_10071072 | Ga0157375_100710723 | 293 |
| 1064 | 3300013308 | Ga0157375_10257587 | Ga0157375_102575874 | 293 |
| 1065 | 3300014497 | Ga0182008_10020630 | Ga0182008_100206303 | 293 |
| 1066 | 3300014745 | Ga0157377_10047051 | Ga0157377_100470513 | 293 |
| 1067 | 3300014968 | Ga0157379_10018618 | Ga0157379_100186186 | 293 |
| 1068 | 3300014969 | Ga0157376_10005905 | Ga0157376_100059053 | 293 |
| 1069 | 3300014969 | Ga0157376_10073085 | Ga0157376_100730852 | 293 |
| 1070 | 3300014969 | Ga0157376_10421000 | Ga0157376_104210001 | 293 |
| 1071 | 3300015261 | Ga0182006_1045418 | Ga0182006_10454181 | 293 |
| 1072 | 3300025271 | Ga0207666_1000205 | Ga0207666_100020510 | 293 |
| 1073 | 3300025271 | Ga0207666_1002921 | Ga0207666_10029213 | 293 |
| 1074 | 3300025290 | Ga0207673_1000664 | Ga0207673_10006645 | 293 |
| 1075 | 3300025315 | Ga0207697_10000468 | Ga0207697_1000046823 | 293 |
| 1076 | 3300025315 | Ga0207697_10003009 | Ga0207697_100030095 | 293 |
| 1077 | 3300025315 | Ga0207697_10003924 | Ga0207697_100039249 | 293 |
| 1078 | 3300025315 | Ga0207697_10005410 | Ga0207697_100054103 | 293 |
| 1079 | 3300025901 | Ga0207688_10001969 | Ga0207688_100019693 | 293 |
| 1080 | 3300025903 | Ga0207680_10008920 | Ga0207680_100089204 | 293 |
| 1081 | 3300025904 | Ga0207647_10021846 | Ga0207647_100218465 | 293 |
| 1082 | 3300025907 | Ga0207645_10007764 | Ga0207645_1000776411 | 293 |
| 1083 | 3300025907 | Ga0207645_10019772 | Ga0207645_100197724 | 293 |
| 1084 | 3300025907 | Ga0207645_10201941 | Ga0207645_102019411 | 293 |
| 1085 | 3300025909 | Ga0207705_10341054 | Ga0207705_103410541 | 293 |
| 1086 | 3300025910 | Ga0207684_10008914 | Ga0207684_1000891410 | 293 |
| 1087 | 3300025910 | Ga0207684_10009462 | Ga0207684_100094626 | 293 |
| 1088 | 3300025910 | Ga0207684_10026662 | Ga0207684_100266624 | 293 |
| 1089 | 3300025910 | Ga0207684_10103316 | Ga0207684_101033163 | 293 |
| 1090 | 3300025915 | Ga0207693_10076038 | Ga0207693_100760382 | 293 |
| 1091 | 3300025916 | Ga0207663_10208959 | Ga0207663_102089591 | 293 |
| 1092 | 3300025916 | Ga0207663_10421228 | Ga0207663_104212282 | 293 |
| 1093 | 3300025918 | Ga0207662_10032169 | Ga0207662_100321694 | 293 |
| 1094 | 3300025919 | Ga0207657_10023660 | Ga0207657_100236603 | 293 |
| 1095 | 3300025919 | Ga0207657_10062380 | Ga0207657_100623803 | 293 |
| 1096 | 3300025919 | Ga0207657_10269173 | Ga0207657_102691731 | 293 |
| 1097 | 3300025920 | Ga0207649_10024833 | Ga0207649_100248333 | 293 |
| 1098 | 3300025920 | Ga0207649_10126762 | Ga0207649_101267623 | 293 |
| 1099 | 3300025921 | Ga0207652_10027904 | Ga0207652_100279043 | 293 |
| 1100 | 3300025922 | Ga0207646_10048732 | Ga0207646_100487323 | 293 |
| 1101 | 3300025922 | Ga0207646_10055462 | Ga0207646_100554623 | 293 |
| 1102 | 3300025922 | Ga0207646_10143444 | Ga0207646_101434443 | 293 |
| 1103 | 3300025922 | Ga0207646_10438620 | Ga0207646_104386202 | 293 |
| 1104 | 3300025923 | Ga0207681_10041805 | Ga0207681_100418051 | 293 |
| 1105 | 3300025923 | Ga0207681_10056585 | Ga0207681_100565852 | 293 |
| 1106 | 3300025923 | Ga0207681_10153879 | Ga0207681_101538792 | 293 |
| 1107 | 3300025925 | Ga0207650_10012767 | Ga0207650_100127675 | 293 |
| 1108 | 3300025925 | Ga0207650_10364940 | Ga0207650_103649402 | 293 |
| 1109 | 3300025926 | Ga0207659_10026962 | Ga0207659_100269623 | 293 |
| 1110 | 3300025928 | Ga0207700_10010114 | Ga0207700_100101149 | 293 |
| 1111 | 3300025929 | Ga0207664_10217954 | Ga0207664_102179541 | 293 |
| 1112 | 3300025931 | Ga0207644_10001481 | Ga0207644_100014816 | 293 |
| 1113 | 3300025931 | Ga0207644_10023417 | Ga0207644_100234172 | 293 |
| 1114 | 3300025931 | Ga0207644_10043868 | Ga0207644_100438684 | 293 |
| 1115 | 3300025931 | Ga0207644_10071671 | Ga0207644_100716712 | 293 |
| 1116 | 3300025932 | Ga0207690_10019982 | Ga0207690_100199825 | 293 |
| 1117 | 3300025933 | Ga0207706_10290429 | Ga0207706_102904292 | 293 |
| 1118 | 3300025936 | Ga0207670_10023971 | Ga0207670_100239714 | 293 |
| 1119 | 3300025936 | Ga0207670_10146826 | Ga0207670_101468262 | 293 |
| 1120 | 3300025937 | Ga0207669_10067652 | Ga0207669_100676523 | 293 |
| 1121 | 3300025939 | Ga0207665_10006742 | Ga0207665_100067427 | 293 |
| 1122 | 3300025940 | Ga0207691_10000800 | Ga0207691_100008007 | 293 |
| 1123 | 3300025940 | Ga0207691_10062659 | Ga0207691_100626591 | 293 |
| 1124 | 3300025944 | Ga0207661_10027814 | Ga0207661_100278143 | 293 |
| 1125 | 3300025944 | Ga0207661_10102383 | Ga0207661_101023832 | 293 |
| 1126 | 3300025945 | Ga0207679_10074216 | Ga0207679_100742164 | 293 |
| 1127 | 3300025945 | Ga0207679_10106264 | Ga0207679_101062644 | 293 |
| 1128 | 3300025960 | Ga0207651_10013490 | Ga0207651_100134904 | 293 |
| 1129 | 3300025960 | Ga0207651_10028454 | Ga0207651_100284543 | 293 |
| 1130 | 3300025972 | Ga0207668_10033927 | Ga0207668_100339272 | 293 |
| 1131 | 3300025972 | Ga0207668_10141608 | Ga0207668_101416083 | 293 |
| 1132 | 3300025972 | Ga0207668_10225407 | Ga0207668_102254072 | 293 |
| 1133 | 3300025972 | Ga0207668_10288317 | Ga0207668_102883172 | 293 |
| 1134 | 3300026035 | Ga0207703_10184384 | Ga0207703_101843844 | 293 |
| 1135 | 3300026067 | Ga0207678_10008966 | Ga0207678_1000896610 | 293 |
| 1136 | 3300026088 | Ga0207641_10028499 | Ga0207641_100284993 | 293 |
| 1137 | 3300026088 | Ga0207641_10368646 | Ga0207641_103686462 | 293 |
| 1138 | 3300026089 | Ga0207648_10053356 | Ga0207648_100533563 | 293 |
| 1139 | 3300026095 | Ga0207676_10124786 | Ga0207676_101247863 | 293 |
| 1140 | 3300026121 | Ga0207683_10003536 | Ga0207683_1000353610 | 293 |
| 1141 | 3300026121 | Ga0207683_10020785 | Ga0207683_100207853 | 293 |
| 1142 | 3300026121 | Ga0207683_10050855 | Ga0207683_100508551 | 293 |
| 1143 | 3300027876 | Ga0209974_10011412 | Ga0209974_100114123 | 293 |
| 1144 | 3300028379 | Ga0268266_10004452 | Ga0268266_100044528 | 293 |
| 1145 | 3300028379 | Ga0268266_10018440 | Ga0268266_100184403 | 293 |
| 1146 | 3300028379 | Ga0268266_10126509 | Ga0268266_101265094 | 293 |
| 1147 | 3300028379 | Ga0268266_10463418 | Ga0268266_104634181 | 293 |
| 1148 | 3300028381 | Ga0268264_10019083 | Ga0268264_100190837 | 293 |
| 1149 | 3300035118 | Ga0373954_0015706 | Ga0373954_0015706_282_1226 | 293 |
| 1150 | 3300035170 | Ga0373943_0033948 | Ga0373943_0033948_62_946 | 293 |
| 1151 | 3300035170 | Ga0373943_0107302 | Ga0373943_0107302_543_1424 | 293 |
| 1152 | 3300035692 | Ga0373935_0012338 | Ga0373935_0012338_4029_4910 | 293 |
| 1153 | 3300035724 | Ga0373933_0313419 | Ga0373933_0313419_21_965 | 293 |
| 1154 | 3300037418 | Ga0395900_0011095 | Ga0395900_0011095_7106_7987 | 293 |
| 1155 | 3300037466 | Ga0395898_0003987 | Ga0395898_0003987_7334_8215 | 293 |
| 1156 | 3300037471 | Ga0395905_0049970 | Ga0395905_0049970_365_1246 | 293 |
| 1157 | 3300037471 | Ga0395905_0285311 | Ga0395905_0285311_493_1374 | 293 |
| 1158 | 3300038443 | Ga0395901_0011017 | Ga0395901_0011017_3674_4555 | 293 |
| 1159 | 3300038443 | Ga0395901_0444269 | Ga0395901_0444269_159_1040 | 293 |
| 1160 | 3300042012 | Ga0439455_0022535 | Ga0439455_0022535_575_1456 | 293 |
| 1161 | 3300045976 | Ga0466967_0116300 | Ga0466967_0116300_55_936 | 293 |
| 1162 | 3300046454 | Ga0495592_0131917 | Ga0495592_0131917_762_1643 | 293 |
| 1163 | 3300046454 | Ga0495592_0146646 | Ga0495592_0146646_360_1304 | 293 |
| 1164 | 3300046462 | Ga0495651_0063110 | Ga0495651_0063110_1418_2299 | 293 |
| 1165 | 3300046514 | Ga0495618_0229209 | Ga0495618_0229209_197_1078 | 293 |
| 1166 | 3300046516 | Ga0495628_0003533 | Ga0495628_0003533_12486_13430 | 293 |
| 1167 | 3300046517 | Ga0495630_0078942 | Ga0495630_0078942_1237_2118 | 293 |
| 1168 | 3300046517 | Ga0495630_0191155 | Ga0495630_0191155_210_1091 | 293 |
| 1169 | 3300046529 | Ga0495652_0070216 | Ga0495652_0070216_435_1316 | 293 |
| 1170 | 3300046529 | Ga0495652_0262995 | Ga0495652_0262995_228_1172 | 293 |
| 1171 | 3300046535 | Ga0495586_0045644 | Ga0495586_0045644_380_1261 | 293 |
| 1172 | 3300046543 | Ga0495645_0095555 | Ga0495645_0095555_601_1545 | 293 |
| 1173 | 3300046642 | Ga0495634_0031361 | Ga0495634_0031361_1227_2108 | 293 |
| 1174 | 3300046664 | Ga0495659_0084201 | Ga0495659_0084201_58_939 | 293 |
| 1175 | 3300046679 | Ga0495623_0103376 | Ga0495623_0103376_478_1422 | 293 |
| 1176 | 3300046683 | Ga0495658_0047056 | Ga0495658_0047056_334_1215 | 293 |
| 1177 | 3300046683 | Ga0495658_0193414 | Ga0495658_0193414_192_1073 | 293 |
| 1178 | 3300046690 | Ga0495624_0115269 | Ga0495624_0115269_719_1600 | 293 |
| 1179 | 3300047319 | Ga0495674_0179775 | Ga0495674_0179775_524_1405 | 293 |
| 1180 | 3300047471 | Ga0495684_0022126 | Ga0495684_0022126_345_1226 | 293 |
| 1181 | 3300047471 | Ga0495684_0181472 | Ga0495684_0181472_554_1435 | 293 |
| 1182 | 3300048088 | Ga0495602_0073348 | Ga0495602_0073348_1216_2160 | 293 |
| 1183 | 3300048904 | Ga0496101_0142129 | Ga0496101_0142129_828_1709 | 293 |
| 1184 | 3300048905 | Ga0496102_0075339 | Ga0496102_0075339_192_1073 | 293 |
| 1185 | 3300048908 | Ga0496105_0045143 | Ga0496105_0045143_2478_3359 | 293 |
| 1186 | 3300048908 | Ga0496105_0168048 | Ga0496105_0168048_27_908 | 293 |
| 1187 | 3300048909 | Ga0496106_0361660 | Ga0496106_0361660_191_1072 | 293 |
| 1188 | 3300048910 | Ga0496107_0149136 | Ga0496107_0149136_316_1197 | 293 |
| 1189 | 3300048911 | Ga0496108_0107889 | Ga0496108_0107889_130_1011 | 293 |
| 1190 | 3300048913 | Ga0496110_0371110 | Ga0496110_0371110_174_1055 | 293 |
| 1191 | 3300048915 | Ga0496112_0067619 | Ga0496112_0067619_1264_2145 | 293 |
| 1192 | 3300048915 | Ga0496112_0077789 | Ga0496112_0077789_337_1218 | 293 |
| 1193 | 3300048917 | Ga0496114_0050987 | Ga0496114_0050987_2415_3296 | 293 |
| 1194 | 3300048917 | Ga0496114_0435025 | Ga0496114_0435025_160_1041 | 293 |
| 1195 | 3300048918 | Ga0496115_0018253 | Ga0496115_0018253_2481_3362 | 293 |
| 1196 | 3300048918 | Ga0496115_0235859 | Ga0496115_0235859_344_1225 | 293 |
| 1197 | 3300050507 | nmdc:mga05p37_430460_c1 | nmdc:mga05p37_430460_c1_467_1348 | 293 |
| 1198 | 3300050512 | nmdc:mga0n895_240011_c1 | nmdc:mga0n895_240011_c1_37_918 | 293 |
| 1199 | 3300050512 | nmdc:mga0n895_280369_c1 | nmdc:mga0n895_280369_c1_510_1391 | 293 |
| 1200 | 3300053085 | Ga0495619_0137318 | Ga0495619_0137318_150_1031 | 293 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1oi7-assembly1.cif.gz_A | the crystal structure of succinyl-coa synthetase alpha subunit from thermus thermophilus | 0.9796 | 3 | 289 |
| 2nu9-assembly1.cif.gz_A | c123at mutant of e. coli succinyl-coa synthetase orthorhombic crystal form | 0.9791 | 2 | 287 |
| 2nu6-assembly1.cif.gz_A | c123aa mutant of e. coli succinyl-coa synthetase | 0.9789 | 2 | 287 |
| 2scu-assembly1.cif.gz_A | a detailed description of the structure of succinyl-coa synthetase from escherichia coli | 0.9785 | 2 | 287 |
| 1jkj-assembly1.cif.gz_A | e. coli scs | 0.978 | 2 | 288 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6EZI1_156_262_3.40.50.261 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains | 1 | 122 | 205 | 3.40.50.261 |
| 1jllA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9778 | 2 | 124 | 3.40.50.720 |
| 1jllA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.97 | 2 | 124 | 3.40.50.720 |
| 2yv2A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9623 | 4 | 124 | 3.40.50.720 |
| af_Q8IIR8_149_327_3.40.50.261 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains | 0.959 | 122 | 293 | 3.40.50.261 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5V883-F1-model_v4 | Succinate--CoA ligase subunit alpha | 1.006 | 1 | 90 |
GO:0004775
GO:0004776 GO:0006099 GO:0009361 |
| AF-X0ZAR5-F1-model_v4 | CoA-binding domain-containing protein | 1.006 | 1 | 91 |
GO:0004775
GO:0004776 GO:0006099 GO:0009361 |
| AF-A0A2V6AGJ6-F1-model_v4 | Succinate--CoA ligase subunit alpha | 1.004 | 5 | 125 |
GO:0004775
GO:0004776 GO:0006099 GO:0009361 |
| AF-A0A2V5JAH0-F1-model_v4 | Succinate--CoA ligase subunit alpha | 1.004 | 1 | 121 |
GO:0004775
GO:0004776 GO:0006099 GO:0009361 |
| AF-A0A2V6EDW8-F1-model_v4 | Succinate--CoA ligase subunit alpha | 1.002 | 1 | 207 |
GO:0000166
GO:0004775 GO:0004776 GO:0006099 GO:0009361 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar