F491585

General Info

Members Datasets Scaffolds Average Seq Length
1200 405 1196 283

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_39022_c1|nmdc:mga08x19_39022_c1_950_1948
Length 332
Sequence VIRTETNSSFIKERRNESGKQENRRNFQIGFFSCVPAFLIFMSVLVDKNTRLLVQGITGSAGAFHTRQCIEYGTNVVAGVTPGKGGQKFDDKIPVFDTVWEAKQKTNCNVSMIFVPAAFAADSILEAVDADIDLVVCITEGIPVMDMIRVKAMMRGKRTRLIGPNCPGIITPGACKIGIMPGYIHKEGNVGVISRSGTLTYEAVWQLTSRGYGQSTCIGIGGDPIGGLSHLDAVKLFNDDKNTDAVILIGEIGGSAEEEAAAWIKDNCKKPVAAFIAGITAPPGRRMGHAGAIVSGGKGTAAGKIEALKAAGIAVAETPATIADTLIAQLKR

Samples

Sample ID Description Type Environment
1 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
2 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
3 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
4 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
217 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
218 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
219 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
220 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
221 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
222 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
223 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
224 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
225 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
226 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
227 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
228 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
232 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
233 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
234 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
235 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
238 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
239 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
240 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
241 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
242 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
243 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
244 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
245 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
251 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
252 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
253 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
256 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
257 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
258 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
259 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
260 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
262 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
263 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
266 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
274 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
275 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
276 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
277 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
278 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
279 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
280 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
281 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
282 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
283 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
284 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
285 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
288 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
297 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
298 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
303 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
304 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
305 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
306 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
307 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
310 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
311 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
312 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
313 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
314 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
319 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
334 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
343 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
344 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
345 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
346 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
347 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
348 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
349 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
351 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
352 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
353 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
366 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
367 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
368 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
369 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
370 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
371 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
372 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
373 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
374 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
375 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
376 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
377 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
378 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
379 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
386 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
387 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
399 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
400 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
401 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
402 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
403 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
404 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
405 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0.83
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0
Rhizoplane 3.5
Rhizosphere 92.83
Stem 0
Stem Tuber 0.08
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24035J26624_1001291 3300002126 Unclassified 2375
2 JGI24751J29686_10000050 3300002459 Bacteria 68540
3 JGI25406J46586_10001426 3300003203 Bacteria 11273
4 JGI25406J46586_10017169 3300003203 Bacteria 2997
5 JGI25406J46586_10037474 3300003203 Bacteria 1747
6 rootH2_10071534 3300003320 Bacteria 9121
7 Ga0055530_10015453 3300003791 Bacteria 2491
8 JGI25405J52794_10005555 3300003911 Bacteria 2277
9 Ga0065714_10002297 3300005288 Bacteria 27065
10 Ga0065704_10111650 3300005289 Bacteria 1952
11 Ga0065712_10005682 3300005290 Bacteria 3064
12 Ga0065712_10005725 3300005290 Bacteria 4138
13 Ga0065712_10074234 3300005290 Bacteria 4148
14 Ga0065715_10000207 3300005293 Bacteria 34609
15 Ga0065715_10002046 3300005293 Bacteria 6097
16 Ga0065715_10018359 3300005293 Bacteria 1760
17 Ga0065715_10018423 3300005293 Bacteria 2092
18 Ga0065715_10027319 3300005293 Bacteria 2161
19 Ga0065715_10091684 3300005293 Bacteria 5619
20 Ga0065715_10095093 3300005293 Bacteria 4166
21 Ga0065715_10137580 3300005293 Bacteria 1905
22 Ga0065715_10274696 3300005293 Unclassified 1102
23 Ga0065707_10005149 3300005295 Bacteria 3363
24 Ga0065707_10086298 3300005295 Bacteria 5543
25 Ga0065707_10098125 3300005295 Bacteria 3111
26 Ga0065707_10102852 3300005295 Bacteria 2782
27 Ga0065707_10106880 3300005295 Bacteria 2578
28 Ga0065707_10203563 3300005295 Bacteria 1299
29 Ga0070676_10009128 3300005328 Bacteria 5365
30 Ga0070676_10067588 3300005328 Bacteria 2137
31 Ga0070676_10093831 3300005328 Bacteria 1843
32 Ga0070683_100043281 3300005329 Bacteria 4150
33 Ga0070683_100062437 3300005329 Bacteria 3464
34 Ga0070690_100008756 3300005330 Bacteria 5843
35 Ga0070690_100014700 3300005330 Bacteria 4648
36 Ga0070690_100043845 3300005330 Bacteria 2838
37 Ga0070690_100291490 3300005330 Bacteria 1167
38 Ga0070670_100000439 3300005331 Bacteria 33957
39 Ga0070670_100001583 3300005331 Bacteria 18353
40 Ga0070670_100017743 3300005331 Bacteria 6107
41 Ga0070670_100123738 3300005331 Bacteria 2232
42 Ga0070670_100245730 3300005331 Bacteria 1558
43 Ga0068869_100001716 3300005334 Bacteria 13080
44 Ga0068869_100009103 3300005334 Bacteria 6433
45 Ga0068869_100192053 3300005334 Bacteria 1606
46 Ga0070666_10002748 3300005335 Bacteria 10625
47 Ga0070666_10007841 3300005335 Bacteria 6595
48 Ga0070680_100000797 3300005336 Bacteria 22198
49 Ga0070680_100040932 3300005336 Bacteria 3755
50 Ga0070680_100091242 3300005336 Bacteria 2522
51 Ga0070680_100213387 3300005336 Bacteria 1629
52 Ga0070682_100000167 3300005337 Bacteria 50701
53 Ga0070682_100000587 3300005337 Bacteria 22186
54 Ga0070682_100003960 3300005337 Bacteria 8223
55 Ga0070682_100024319 3300005337 Bacteria 3603
56 Ga0068868_100024117 3300005338 Bacteria 4611
57 Ga0068868_100030702 3300005338 Bacteria 4121
58 Ga0068868_100055109 3300005338 Bacteria 3136
59 Ga0068868_100095734 3300005338 Bacteria 2397
60 Ga0068868_100237746 3300005338 Bacteria 1529
61 Ga0068868_100343380 3300005338 Bacteria 1277
62 Ga0070660_100026636 3300005339 Bacteria 4307
63 Ga0070660_100029344 3300005339 Bacteria 4122
64 Ga0070660_100097669 3300005339 Bacteria 2324
65 Ga0070660_100186000 3300005339 Bacteria 1682
66 Ga0070689_100009616 3300005340 Bacteria 6863
67 Ga0070689_100012040 3300005340 Bacteria 6218
68 Ga0070689_100016838 3300005340 Bacteria 5358
69 Ga0070689_100021935 3300005340 Bacteria 4761
70 Ga0070689_100031202 3300005340 Bacteria 4049
71 Ga0070689_100092466 3300005340 Bacteria 2386
72 Ga0070689_100169064 3300005340 Bacteria 1771
73 Ga0070689_100173684 3300005340 Bacteria 1747
74 Ga0070689_100190356 3300005340 Bacteria 1671
75 Ga0070689_100471764 3300005340 Bacteria 1071
76 Ga0070687_100018304 3300005343 Bacteria 3238
77 Ga0070687_100029620 3300005343 Bacteria 2667
78 Ga0070661_100031848 3300005344 Bacteria 3814
79 Ga0070661_100178510 3300005344 Bacteria 1615
80 Ga0070692_10027516 3300005345 Unclassified 2819
81 Ga0070668_100006277 3300005347 Bacteria 8799
82 Ga0070668_100016062 3300005347 Bacteria 5601
83 Ga0070668_100093761 3300005347 Bacteria 2370
84 Ga0070668_100165700 3300005347 Unclassified 1796
85 Ga0070669_100001219 3300005353 Bacteria 18671
86 Ga0070669_100005130 3300005353 Bacteria 9474
87 Ga0070669_100005514 3300005353 Bacteria 9133
88 Ga0070669_100070552 3300005353 Bacteria 2583
89 Ga0070669_100071535 3300005353 Bacteria 2566
90 Ga0070669_100084848 3300005353 Bacteria 2364
91 Ga0070669_100097198 3300005353 Bacteria 2216
92 Ga0070669_100150138 3300005353 Bacteria 1803
93 Ga0070669_100347753 3300005353 Bacteria 1203
94 Ga0070669_100507479 3300005353 Bacteria 1001
95 Ga0070675_100001835 3300005354 Bacteria 15705
96 Ga0070675_100014335 3300005354 Bacteria 6249
97 Ga0070675_100027122 3300005354 Bacteria 4601
98 Ga0070675_100044859 3300005354 Bacteria 3616
99 Ga0070675_100113725 3300005354 Bacteria 2293
100 Ga0070675_100153054 3300005354 Bacteria 1978
101 Ga0070675_100258828 3300005354 Bacteria 1524
102 Ga0070671_100003791 3300005355 Bacteria 11859
103 Ga0070671_100011256 3300005355 Bacteria 7186
104 Ga0070671_100014619 3300005355 Bacteria 6346
105 Ga0070671_100183767 3300005355 Bacteria 1771
106 Ga0070674_100003718 3300005356 Bacteria 8601
107 Ga0070674_100012161 3300005356 Bacteria 5277
108 Ga0070674_100046801 3300005356 Bacteria 2961
109 Ga0070673_100006575 3300005364 Bacteria 7565
110 Ga0070673_100035044 3300005364 Bacteria 3803
111 Ga0070673_100079801 3300005364 Bacteria 2651
112 Ga0070673_100188280 3300005364 Bacteria 1771
113 Ga0070688_100010755 3300005365 Bacteria 5057
114 Ga0070688_100064482 3300005365 Bacteria 2325
115 Ga0070688_100349085 3300005365 Bacteria 1083
116 Ga0070659_100006504 3300005366 Bacteria 8435
117 Ga0070659_100018586 3300005366 Bacteria 5246
118 Ga0070659_100515195 3300005366 Bacteria 1021
119 Ga0070667_100002725 3300005367 Bacteria 15294
120 Ga0070703_10013403 3300005406 Bacteria 2328
121 Ga0070714_100162250 3300005435 Bacteria 2023
122 Ga0070714_100199567 3300005435 Bacteria 1829
123 Ga0070714_100228246 3300005435 Bacteria 1714
124 Ga0070714_100379687 3300005435 Bacteria 1332
125 Ga0070713_100199704 3300005436 Bacteria 1805
126 Ga0070701_10006009 3300005438 Bacteria 5074
127 Ga0070701_10014396 3300005438 Bacteria 3626
128 Ga0070711_100000573 3300005439 Bacteria 19204
129 Ga0070711_100011584 3300005439 Bacteria 5482
130 Ga0070705_100102927 3300005440 Bacteria 1807
131 Ga0070705_100118379 3300005440 Bacteria 1706
132 Ga0070700_100000873 3300005441 Bacteria 14847
133 Ga0070700_100010778 3300005441 Bacteria 5052
134 Ga0070700_100140713 3300005441 Bacteria 1639
135 Ga0070700_100178679 3300005441 Bacteria 1475
136 Ga0070700_100185414 3300005441 Bacteria 1451
137 Ga0070700_100327379 3300005441 Bacteria 1128
138 Ga0070694_100007979 3300005444 Bacteria 6471
139 Ga0070694_100016139 3300005444 Bacteria 4701
140 Ga0070694_100020354 3300005444 Bacteria 4229
141 Ga0070694_100121480 3300005444 Bacteria 1875
142 Ga0070694_100200345 3300005444 Bacteria 1488
143 Ga0070708_100002874 3300005445 Bacteria 13363
144 Ga0070708_100007162 3300005445 Bacteria 8902
145 Ga0070708_100108813 3300005445 Bacteria 2546
146 Ga0070708_100131073 3300005445 Bacteria 2320
147 Ga0070708_100143829 3300005445 Bacteria 2213
148 Ga0070708_100187614 3300005445 Bacteria 1934
149 Ga0070708_100222381 3300005445 Bacteria 1771
150 Ga0070708_100309654 3300005445 Bacteria 1487
151 Ga0070708_100571710 3300005445 Bacteria 1066
152 Ga0070708_100609100 3300005445 Bacteria 1030
153 Ga0070663_100010247 3300005455 Bacteria 5838
154 Ga0070678_100002470 3300005456 Bacteria 10128
155 Ga0070678_100022270 3300005456 Bacteria 4194
156 Ga0070678_100073268 3300005456 Bacteria 2570
157 Ga0070678_100230187 3300005456 Bacteria 1545
158 Ga0070662_100042004 3300005457 Bacteria 3265
159 Ga0070662_100251226 3300005457 Unclassified 1422
160 Ga0070662_100254346 3300005457 Bacteria 1413
161 Ga0070681_10004276 3300005458 Bacteria 13556
162 Ga0070681_10032172 3300005458 Bacteria 5264
163 Ga0070681_10106650 3300005458 Bacteria 2743
164 Ga0068867_100103857 3300005459 Bacteria 2174
165 Ga0068867_100186133 3300005459 Bacteria 1654
166 Ga0068867_100377956 3300005459 Bacteria 1189
167 Ga0068867_100506244 3300005459 Bacteria 1039
168 Ga0070685_10011484 3300005466 Bacteria 4636
169 Ga0070706_100000300 3300005467 Bacteria 60347
170 Ga0070706_100000324 3300005467 Bacteria 58179
171 Ga0070706_100002853 3300005467 Bacteria 17254
172 Ga0070706_100005770 3300005467 Bacteria 11760
173 Ga0070706_100010526 3300005467 Bacteria 8585
174 Ga0070706_100037208 3300005467 Bacteria 4495
175 Ga0070706_100045174 3300005467 Bacteria 4069
176 Ga0070706_100047206 3300005467 Bacteria 3973
177 Ga0070706_100061000 3300005467 Bacteria 3482
178 Ga0070706_100098289 3300005467 Bacteria 2720
179 Ga0070706_100112232 3300005467 Bacteria 2537
180 Ga0070706_100130000 3300005467 Unclassified 2350
181 Ga0070706_100195373 3300005467 Bacteria 1890
182 Ga0070706_100210458 3300005467 Bacteria 1816
183 Ga0070706_100216245 3300005467 Bacteria 1789
184 Ga0070706_100327815 3300005467 Bacteria 1428
185 Ga0070707_100000134 3300005468 Bacteria 69611
186 Ga0070707_100000410 3300005468 Bacteria 42459
187 Ga0070707_100010272 3300005468 Bacteria 8719
188 Ga0070707_100012475 3300005468 Bacteria 7937
189 Ga0070707_100041760 3300005468 Bacteria 4390
190 Ga0070707_100043311 3300005468 Bacteria 4309
191 Ga0070707_100073922 3300005468 Bacteria 3286
192 Ga0070707_100077531 3300005468 Bacteria 3207
193 Ga0070707_100125636 3300005468 Bacteria 2492
194 Ga0070707_100190623 3300005468 Bacteria 1999
195 Ga0070707_100197402 3300005468 Bacteria 1961
196 Ga0070707_100246452 3300005468 Bacteria 1739
197 Ga0070707_100342260 3300005468 Bacteria 1453
198 Ga0070707_100371939 3300005468 Bacteria 1388
199 Ga0070698_100005364 3300005471 Bacteria 14023
200 Ga0070698_100006202 3300005471 Bacteria 13017
201 Ga0070698_100010399 3300005471 Bacteria 9938
202 Ga0070698_100012448 3300005471 Bacteria 9003
203 Ga0070698_100048959 3300005471 Bacteria 4317
204 Ga0070698_100052816 3300005471 Bacteria 4132
205 Ga0070698_100069732 3300005471 Bacteria 3528
206 Ga0070698_100085466 3300005471 Bacteria 3142
207 Ga0070698_100122724 3300005471 Bacteria 2556
208 Ga0070698_100171560 3300005471 Bacteria 2110
209 Ga0070698_100244272 3300005471 Bacteria 1728
210 Ga0070698_100343149 3300005471 Bacteria 1425
211 Ga0070699_100002048 3300005518 Bacteria 18222
212 Ga0070699_100136302 3300005518 Bacteria 2166
213 Ga0070679_100000855 3300005530 Bacteria 26483
214 Ga0070679_100011324 3300005530 Bacteria 8503
215 Ga0070679_100046538 3300005530 Bacteria 4323
216 Ga0070679_100081100 3300005530 Bacteria 3234
217 Ga0070679_100218388 3300005530 Bacteria 1868
218 Ga0070684_100000767 3300005535 Bacteria 22255
219 Ga0070684_100070238 3300005535 Bacteria 3081
220 Ga0070684_100106316 3300005535 Bacteria 2512
221 Ga0070697_100000073 3300005536 Bacteria 79804
222 Ga0070697_100000434 3300005536 Bacteria 32091
223 Ga0070697_100009541 3300005536 Bacteria 7581
224 Ga0070697_100010698 3300005536 Bacteria 7162
225 Ga0070697_100022676 3300005536 Bacteria 4987
226 Ga0070697_100055191 3300005536 Bacteria 3230
227 Ga0070697_100152914 3300005536 Bacteria 1946
228 Ga0068853_100091746 3300005539 Bacteria 2672
229 Ga0068853_100478669 3300005539 Bacteria 1173
230 Ga0070672_100020621 3300005543 Bacteria 4811
231 Ga0070672_100050713 3300005543 Bacteria 3234
232 Ga0070672_100065252 3300005543 Bacteria 2879
233 Ga0070672_100080599 3300005543 Bacteria 2608
234 Ga0070672_100390418 3300005543 Bacteria 1192
235 Ga0070672_100617106 3300005543 Bacteria 945
236 Ga0070686_100001814 3300005544 Bacteria 11907
237 Ga0070686_100005111 3300005544 Bacteria 7243
238 Ga0070686_100036953 3300005544 Bacteria 3027
239 Ga0070695_100073291 3300005545 Bacteria 2247
240 Ga0070695_100089194 3300005545 Bacteria 2055
241 Ga0070695_100297090 3300005545 Bacteria 1192
242 Ga0070695_100315487 3300005545 Bacteria 1160
243 Ga0070695_100428682 3300005545 Bacteria 1009
244 Ga0070696_100034477 3300005546 Bacteria 3482
245 Ga0070696_100068312 3300005546 Bacteria 2495
246 Ga0070696_100422675 3300005546 Bacteria 1047
247 Ga0070693_100012304 3300005547 Bacteria 4328
248 Ga0070693_100032890 3300005547 Bacteria 2857
249 Ga0070693_100164552 3300005547 Bacteria 1416
250 Ga0070665_100015168 3300005548 Bacteria 7737
251 Ga0070665_100015437 3300005548 Bacteria 7670
252 Ga0070665_100045184 3300005548 Bacteria 4423
253 Ga0070665_100072418 3300005548 Bacteria 3454
254 Ga0070665_100099176 3300005548 Bacteria 2917
255 Ga0070665_100118414 3300005548 Bacteria 2650
256 Ga0070665_100228242 3300005548 Bacteria 1862
257 Ga0070665_100561529 3300005548 Bacteria 1154
258 Ga0070704_100006310 3300005549 Bacteria 6985
259 Ga0070704_100065911 3300005549 Bacteria 2609
260 Ga0070704_100196946 3300005549 Bacteria 1624
261 Ga0070704_100246759 3300005549 Bacteria 1464
262 Ga0070704_100365696 3300005549 Bacteria 1222
263 Ga0068855_100000317 3300005563 Bacteria 60056
264 Ga0068855_100016293 3300005563 Bacteria 8939
265 Ga0068855_100246781 3300005563 Bacteria 1993
266 Ga0068855_100620805 3300005563 Bacteria 1164
267 Ga0070664_100001757 3300005564 Bacteria 17353
268 Ga0068857_100018683 3300005577 Bacteria 6085
269 Ga0068857_100085810 3300005577 Bacteria 2814
270 Ga0068857_100601794 3300005577 Bacteria 1039
271 Ga0068854_100042948 3300005578 Bacteria 3202
272 Ga0068854_100189738 3300005578 Bacteria 1610
273 Ga0068854_100230753 3300005578 Bacteria 1469
274 Ga0068856_100047226 3300005614 Bacteria 4241
275 Ga0068856_100091023 3300005614 Bacteria 3035
276 Ga0068856_100148366 3300005614 Bacteria 2353
277 Ga0070702_100006879 3300005615 Bacteria 5414
278 Ga0070702_100036426 3300005615 Bacteria 2725
279 Ga0070702_100136457 3300005615 Unclassified 1557
280 Ga0070702_100156106 3300005615 Bacteria 1470
281 Ga0068852_100716771 3300005616 Bacteria 1011
282 Ga0068859_100027035 3300005617 Bacteria 5755
283 Ga0068859_100093076 3300005617 Bacteria 3066
284 Ga0068859_100120098 3300005617 Unclassified 2695
285 Ga0068859_100232342 3300005617 Bacteria 1932
286 Ga0068859_100267383 3300005617 Bacteria 1802
287 Ga0068859_100392189 3300005617 Bacteria 1484
288 Ga0068864_100002273 3300005618 Bacteria 15887
289 Ga0068864_100017314 3300005618 Bacteria 6008
290 Ga0068864_100024947 3300005618 Bacteria 5031
291 Ga0068864_100186109 3300005618 Bacteria 1901
292 Ga0068864_100606335 3300005618 Bacteria 1063
293 Ga0068864_100934592 3300005618 Bacteria 857
294 Ga0068866_10001025 3300005718 Bacteria 12288
295 Ga0068866_10031102 3300005718 Bacteria 2568
296 Ga0068861_100070068 3300005719 Bacteria 2715
297 Ga0068861_100118413 3300005719 Bacteria 2133
298 Ga0068861_100158919 3300005719 Bacteria 1862
299 Ga0068851_10009338 3300005834 Bacteria 4556
300 Ga0068870_10029737 3300005840 Bacteria 2754
301 Ga0068870_10035367 3300005840 Bacteria 2563
302 Ga0068863_100030593 3300005841 Bacteria 5140
303 Ga0068863_100036293 3300005841 Bacteria 4695
304 Ga0068863_100120637 3300005841 Bacteria 2500
305 Ga0068863_100146048 3300005841 Bacteria 2262
306 Ga0068863_100147631 3300005841 Bacteria 2250
307 Ga0068863_100773500 3300005841 Bacteria 957
308 Ga0068858_100025999 3300005842 Bacteria 5444
309 Ga0068858_100062964 3300005842 Bacteria 3431
310 Ga0068858_100096659 3300005842 Bacteria 2753
311 Ga0068858_100150457 3300005842 Bacteria 2188
312 Ga0068858_100251953 3300005842 Bacteria 1677
313 Ga0068858_100313982 3300005842 Bacteria 1497
314 Ga0068860_100009989 3300005843 Bacteria 9407
315 Ga0068860_100012441 3300005843 Bacteria 8380
316 Ga0068860_100041635 3300005843 Unclassified 4388
317 Ga0068860_100119954 3300005843 Bacteria 2518
318 Ga0068860_100234084 3300005843 Bacteria 1785
319 Ga0068860_100324855 3300005843 Bacteria 1510
320 Ga0068862_100017359 3300005844 Bacteria 5992
321 Ga0068862_100040100 3300005844 Bacteria 3980
322 Ga0068862_100128165 3300005844 Bacteria 2242
323 Ga0068862_100478769 3300005844 Bacteria 1178
324 Ga0081455_10001854 3300005937 Bacteria 25440
325 Ga0081455_10004819 3300005937 Bacteria 14992
326 Ga0081455_10022064 3300005937 Bacteria 5959
327 Ga0081455_10031049 3300005937 Bacteria 4841
328 Ga0081455_10032755 3300005937 Bacteria 4679
329 Ga0081455_10035616 3300005937 Bacteria 4445
330 Ga0081455_10161693 3300005937 Bacteria 1715
331 Ga0081540_1000127 3300005983 Bacteria 80551
332 Ga0081540_1012719 3300005983 Bacteria 5516
333 Ga0081539_10000138 3300005985 Bacteria 170633
334 Ga0081539_10000990 3300005985 Bacteria 52811
335 Ga0081539_10001905 3300005985 Bacteria 32324
336 Ga0081539_10002025 3300005985 Bacteria 30560
337 Ga0081539_10068826 3300005985 Bacteria 1908
338 Ga0081539_10088408 3300005985 Bacteria 1607
339 Ga0070717_10018213 3300006028 Bacteria 5481
340 Ga0070717_10043237 3300006028 Bacteria 3676
341 Ga0070717_10292274 3300006028 Bacteria 1447
342 Ga0070715_10000279 3300006163 Bacteria 12439
343 Ga0070715_10000601 3300006163 Bacteria 9503
344 Ga0070715_10025869 3300006163 Bacteria 2329
345 Ga0070716_100240270 3300006173 Bacteria 1228
346 Ga0070716_100294463 3300006173 Bacteria 1126
347 Ga0070712_100397421 3300006175 Bacteria 1138
348 Ga0075362_10000964 3300006177 Bacteria 8805
349 Ga0075366_10008847 3300006195 Bacteria 5609
350 Ga0075366_10075139 3300006195 Bacteria 2016
351 Ga0097621_100009963 3300006237 Bacteria 6926
352 Ga0097621_100030540 3300006237 Bacteria 4267
353 Ga0097621_100067046 3300006237 Bacteria 2957
354 Ga0097621_100373227 3300006237 Bacteria 1273
355 Ga0075370_10000297 3300006353 Bacteria 17823
356 Ga0068871_100001915 3300006358 Bacteria 14079
357 Ga0068871_100012233 3300006358 Bacteria 6318
358 Ga0068871_100028997 3300006358 Bacteria 4344
359 Ga0068871_100032982 3300006358 Bacteria 4095
360 Ga0068871_100034330 3300006358 Bacteria 4025
361 Ga0068871_100058797 3300006358 Bacteria 3131
362 Ga0068871_100081325 3300006358 Bacteria 2684
363 Ga0068871_100226258 3300006358 Bacteria 1622
364 Ga0075428_100000046 3300006844 Bacteria 96992
365 Ga0075428_100087688 3300006844 Bacteria 3394
366 Ga0075428_100095554 3300006844 Bacteria 3240
367 Ga0075428_100439281 3300006844 Bacteria 1398
368 Ga0075431_100056921 3300006847 Bacteria 4032
369 Ga0075433_10053355 3300006852 Bacteria 3524
370 Ga0075433_10080661 3300006852 Bacteria 2869
371 Ga0075434_100075295 3300006871 Bacteria 3368
372 Ga0075434_100092275 3300006871 Bacteria 3030
373 Ga0075434_100103542 3300006871 Bacteria 2855
374 Ga0075434_100127995 3300006871 Bacteria 2557
375 Ga0075434_100312698 3300006871 Bacteria 1591
376 Ga0075434_100412573 3300006871 Bacteria 1371
377 Ga0075434_100542006 3300006871 Bacteria 1183
378 Ga0075429_100041851 3300006880 Bacteria 3988
379 Ga0075429_100111008 3300006880 Bacteria 2397
380 Ga0075429_100134230 3300006880 Bacteria 2165
381 Ga0075429_100224920 3300006880 Bacteria 1644
382 Ga0068865_100202506 3300006881 Bacteria 1542
383 Ga0068865_100251390 3300006881 Bacteria 1395
384 Ga0068865_100442236 3300006881 Bacteria 1073
385 Ga0075436_100038914 3300006914 Bacteria 3282
386 Ga0075436_100073735 3300006914 Bacteria 2363
387 Ga0097620_100027036 3300006931 Bacteria 5755
388 Ga0097620_100093077 3300006931 Bacteria 3066
389 Ga0097620_100120101 3300006931 Unclassified 2695
390 Ga0097620_100232352 3300006931 Bacteria 1932
391 Ga0097620_100267377 3300006931 Bacteria 1802
392 Ga0097620_100392207 3300006931 Bacteria 1484
393 Ga0075435_100371439 3300007076 Bacteria 1228
394 Ga0075435_100492164 3300007076 Bacteria 1060
395 Ga0099795_10028348 3300007788 Bacteria 1903
396 Ga0105251_10014266 3300009011 Bacteria 4405
397 Ga0105244_10005357 3300009036 Bacteria 8541
398 Ga0105250_10000409 3300009092 Bacteria 31536
399 Ga0105240_10335846 3300009093 Bacteria 1718
400 Ga0105240_10428430 3300009093 Bacteria 1485
401 Ga0111539_10003012 3300009094 Bacteria 22343
402 Ga0111539_10005064 3300009094 Bacteria 17116
403 Ga0111539_10008045 3300009094 Bacteria 13445
404 Ga0111539_10018805 3300009094 Bacteria 8549
405 Ga0111539_10037428 3300009094 Bacteria 5859
406 Ga0111539_10055294 3300009094 Bacteria 4718
407 Ga0111539_10169136 3300009094 Bacteria 2554
408 Ga0111539_10585435 3300009094 Bacteria 1299
409 Ga0105245_10025480 3300009098 Bacteria 5201
410 Ga0105245_10030189 3300009098 Bacteria 4792
411 Ga0105245_10149933 3300009098 Bacteria 2204
412 Ga0105245_10376039 3300009098 Bacteria 1414
413 Ga0105245_10509986 3300009098 Bacteria 1220
414 Ga0105245_10793981 3300009098 Bacteria 984
415 Ga0105247_10000816 3300009101 Bacteria 23727
416 Ga0105247_10002962 3300009101 Bacteria 11267
417 Ga0114129_10020897 3300009147 Bacteria 9300
418 Ga0114129_10066910 3300009147 Bacteria 5010
419 Ga0114129_10074687 3300009147 Bacteria 4722
420 Ga0114129_10101431 3300009147 Bacteria 3982
421 Ga0114129_10159056 3300009147 Bacteria 3088
422 Ga0114129_10247622 3300009147 Bacteria 2393
423 Ga0114129_10257617 3300009147 Bacteria 2340
424 Ga0114129_10285856 3300009147 Bacteria 2202
425 Ga0114129_10312165 3300009147 Bacteria 2092
426 Ga0114129_10576563 3300009147 Bacteria 1460
427 Ga0114129_11034620 3300009147 Bacteria 1032
428 Ga0105243_10000344 3300009148 Bacteria 50059
429 Ga0105243_10014385 3300009148 Bacteria 5989
430 Ga0105243_10034846 3300009148 Bacteria 3900
431 Ga0105241_10006658 3300009174 Bacteria 8504
432 Ga0105241_10014564 3300009174 Bacteria 5759
433 Ga0105241_10446249 3300009174 Bacteria 1144
434 Ga0105242_10004323 3300009176 Bacteria 11064
435 Ga0105248_10012309 3300009177 Bacteria 9434
436 Ga0105248_10043719 3300009177 Bacteria 5024
437 Ga0105248_10046511 3300009177 Bacteria 4864
438 Ga0105237_10134185 3300009545 Bacteria 2470
439 Ga0105238_10019792 3300009551 Bacteria 6851
440 Ga0105238_10211430 3300009551 Bacteria 1916
441 Ga0105238_10250766 3300009551 Bacteria 1748
442 Ga0105249_10000028 3300009553 Bacteria 230039
443 Ga0105249_10008154 3300009553 Bacteria 9131
444 Ga0105249_10010884 3300009553 Bacteria 7994
445 Ga0105249_10044336 3300009553 Bacteria 4045
446 Ga0099796_10029044 3300010159 Bacteria 1780
447 Ga0105239_10028211 3300010375 Bacteria 6174
448 Ga0105239_10069721 3300010375 Bacteria 3862
449 Ga0105239_10283105 3300010375 Bacteria 1867
450 Ga0105246_10236687 3300011119 Bacteria 1441
451 Ga0105246_10302929 3300011119 Bacteria 1291
452 Ga0105246_10321207 3300011119 Bacteria 1258
453 Ga0157374_10003663 3300013296 Bacteria 12919
454 Ga0157374_10010403 3300013296 Bacteria 7999
455 Ga0157374_10013259 3300013296 Bacteria 7191
456 Ga0157374_10056057 3300013296 Bacteria 3679
457 Ga0157374_10089726 3300013296 Bacteria 2929
458 Ga0157374_10105063 3300013296 Bacteria 2712
459 Ga0157374_10294866 3300013296 Bacteria 1604
460 Ga0157378_10000019 3300013297 Bacteria 132704
461 Ga0157378_10002954 3300013297 Bacteria 15117
462 Ga0157378_10005123 3300013297 Bacteria 11506
463 Ga0157378_10005155 3300013297 Bacteria 11472
464 Ga0157378_10023819 3300013297 Bacteria 5386
465 Ga0157378_10073043 3300013297 Bacteria 3083
466 Ga0157378_10222625 3300013297 Bacteria 1794
467 Ga0157378_10300211 3300013297 Bacteria 1554
468 Ga0157378_10429427 3300013297 Bacteria 1307
469 Ga0157378_10436697 3300013297 Unclassified 1297
470 Ga0163162_10000019 3300013306 Bacteria 220603
471 Ga0163162_10006123 3300013306 Bacteria 11647
472 Ga0163162_10008619 3300013306 Bacteria 9937
473 Ga0163162_10010329 3300013306 Bacteria 9074
474 Ga0163162_10012362 3300013306 Bacteria 8335
475 Ga0163162_10039944 3300013306 Bacteria 4690
476 Ga0163162_10176119 3300013306 Unclassified 2264
477 Ga0163162_10256493 3300013306 Bacteria 1880
478 Ga0157372_10031112 3300013307 Bacteria 5843
479 Ga0157372_10042615 3300013307 Bacteria 5021
480 Ga0157372_10099993 3300013307 Bacteria 3309
481 Ga0157372_10779115 3300013307 Bacteria 1112
482 Ga0157375_10002221 3300013308 Bacteria 16802
483 Ga0157375_10006370 3300013308 Bacteria 10290
484 Ga0157375_10016243 3300013308 Bacteria 6679
485 Ga0157375_10023125 3300013308 Bacteria 5730
486 Ga0157375_10071072 3300013308 Bacteria 3492
487 Ga0157375_10236130 3300013308 Bacteria 1987
488 Ga0157375_10257587 3300013308 Bacteria 1906
489 Ga0157375_10915424 3300013308 Bacteria 1020
490 Ga0163163_10000993 3300014325 Bacteria 23985
491 Ga0163163_10009086 3300014325 Bacteria 8856
492 Ga0163163_10009099 3300014325 Bacteria 8849
493 Ga0163163_10009309 3300014325 Bacteria 8762
494 Ga0163163_10025012 3300014325 Bacteria 5688
495 Ga0163163_10161349 3300014325 Bacteria 2287
496 Ga0163163_10221479 3300014325 Bacteria 1941
497 Ga0163163_10429462 3300014325 Bacteria 1380
498 Ga0157380_10004065 3300014326 Bacteria 10092
499 Ga0157380_10144961 3300014326 Bacteria 2045
500 Ga0182008_10020630 3300014497 Bacteria 3390
501 Ga0157377_10047051 3300014745 Unclassified 2415
502 Ga0157377_10206795 3300014745 Bacteria 1249
503 Ga0157379_10018618 3300014968 Bacteria 6123
504 Ga0157379_10025219 3300014968 Bacteria 5279
505 Ga0157379_10082707 3300014968 Bacteria 2877
506 Ga0157376_10002237 3300014969 Bacteria 13041
507 Ga0157376_10005905 3300014969 Bacteria 8595
508 Ga0157376_10036976 3300014969 Bacteria 3959
509 Ga0157376_10073085 3300014969 Bacteria 2919
510 Ga0157376_10228058 3300014969 Bacteria 1729
511 Ga0157376_10421000 3300014969 Bacteria 1296
512 Ga0182006_1045418 3300015261 Bacteria 1709
513 Ga0163161_10005272 3300017792 Bacteria 8999
514 Ga0163161_10444623 3300017792 Bacteria 1047
515 Ga0213876_10000179 3300021384 Bacteria 65505
516 Ga0213876_10000326 3300021384 Bacteria 41743
517 Ga0213876_10000705 3300021384 Bacteria 23431
518 Ga0207666_1000205 3300025271 Bacteria 8841
519 Ga0207666_1002921 3300025271 Bacteria 2080
520 Ga0207673_1000664 3300025290 Bacteria 3651
521 Ga0209050_1000297 3300025298 Bacteria 104630
522 Ga0207697_10000183 3300025315 Bacteria 32539
523 Ga0207697_10000468 3300025315 Bacteria 22811
524 Ga0207697_10003009 3300025315 Bacteria 8483
525 Ga0207697_10003924 3300025315 Bacteria 7243
526 Ga0207697_10005410 3300025315 Bacteria 5936
527 Ga0207697_10030323 3300025315 Bacteria 2213
528 Ga0207696_1000059 3300025711 Bacteria 245763
529 Ga0207655_1004852 3300025728 Bacteria 9342
530 Ga0207713_1000005 3300025735 Bacteria 649958
531 Ga0207653_10001165 3300025885 Bacteria 8590
532 Ga0207653_10004697 3300025885 Bacteria 4282
533 Ga0207682_10035079 3300025893 Bacteria 2025
534 Ga0207692_10128404 3300025898 Bacteria 1428
535 Ga0207642_10000626 3300025899 Bacteria 10844
536 Ga0207642_10063774 3300025899 Bacteria 1725
537 Ga0207710_10000753 3300025900 Bacteria 17806
538 Ga0207710_10001106 3300025900 Bacteria 13825
539 Ga0207688_10000989 3300025901 Bacteria 14498
540 Ga0207688_10001969 3300025901 Bacteria 11005
541 Ga0207688_10009622 3300025901 Bacteria 5264
542 Ga0207680_10008920 3300025903 Bacteria 4946
543 Ga0207647_10005868 3300025904 Bacteria 8952
544 Ga0207647_10021846 3300025904 Unclassified 4261
545 Ga0207685_10000221 3300025905 Bacteria 8803
546 Ga0207685_10008319 3300025905 Bacteria 2949
547 Ga0207645_10003527 3300025907 Bacteria 11839
548 Ga0207645_10007764 3300025907 Bacteria 7550
549 Ga0207645_10012070 3300025907 Bacteria 5874
550 Ga0207645_10019772 3300025907 Bacteria 4411
551 Ga0207645_10145131 3300025907 Bacteria 1547
552 Ga0207645_10201941 3300025907 Bacteria 1308
553 Ga0207643_10011379 3300025908 Bacteria 4804
554 Ga0207643_10025758 3300025908 Bacteria 3253
555 Ga0207705_10341054 3300025909 Bacteria 1153
556 Ga0207684_10000367 3300025910 Bacteria 60978
557 Ga0207684_10000390 3300025910 Bacteria 58658
558 Ga0207684_10002571 3300025910 Bacteria 18213
559 Ga0207684_10008914 3300025910 Bacteria 8904
560 Ga0207684_10009462 3300025910 Bacteria 8604
561 Ga0207684_10026662 3300025910 Bacteria 4926
562 Ga0207684_10031901 3300025910 Bacteria 4483
563 Ga0207684_10043327 3300025910 Bacteria 3815
564 Ga0207684_10049257 3300025910 Bacteria 3574
565 Ga0207684_10070004 3300025910 Unclassified 2981
566 Ga0207684_10103316 3300025910 Bacteria 2436
567 Ga0207684_10138232 3300025910 Unclassified 2093
568 Ga0207684_10173629 3300025910 Bacteria 1858
569 Ga0207684_10226564 3300025910 Bacteria 1613
570 Ga0207684_10333597 3300025910 Bacteria 1306
571 Ga0207654_10002697 3300025911 Bacteria 9015
572 Ga0207654_10012881 3300025911 Bacteria 4290
573 Ga0207707_10000031 3300025912 Bacteria 159505
574 Ga0207707_10014487 3300025912 Bacteria 6867
575 Ga0207707_10539476 3300025912 Bacteria 992
576 Ga0207671_10055990 3300025914 Bacteria 2921
577 Ga0207671_10311148 3300025914 Bacteria 1245
578 Ga0207693_10000233 3300025915 Bacteria 51090
579 Ga0207693_10073155 3300025915 Bacteria 2683
580 Ga0207693_10076038 3300025915 Bacteria 2630
581 Ga0207663_10007610 3300025916 Bacteria 5626
582 Ga0207663_10208959 3300025916 Bacteria 1413
583 Ga0207663_10421228 3300025916 Bacteria 1025
584 Ga0207660_10002124 3300025917 Bacteria 13138
585 Ga0207660_10151888 3300025917 Bacteria 1780
586 Ga0207662_10006099 3300025918 Bacteria 6483
587 Ga0207662_10032169 3300025918 Unclassified 3052
588 Ga0207662_10032390 3300025918 Bacteria 3043
589 Ga0207662_10051473 3300025918 Bacteria 2450
590 Ga0207662_10066910 3300025918 Bacteria 2166
591 Ga0207662_10163408 3300025918 Bacteria 1424
592 Ga0207662_10193636 3300025918 Bacteria 1313
593 Ga0207657_10023660 3300025919 Bacteria 5714
594 Ga0207657_10062380 3300025919 Bacteria 3192
595 Ga0207657_10175648 3300025919 Bacteria 1733
596 Ga0207657_10202437 3300025919 Bacteria 1596
597 Ga0207657_10269173 3300025919 Bacteria 1354
598 Ga0207649_10024833 3300025920 Bacteria 3487
599 Ga0207649_10126762 3300025920 Bacteria 1729
600 Ga0207649_10176896 3300025920 Bacteria 1491
601 Ga0207652_10000087 3300025921 Bacteria 99945
602 Ga0207652_10019300 3300025921 Bacteria 5606
603 Ga0207652_10027904 3300025921 Bacteria 4708
604 Ga0207652_10068152 3300025921 Bacteria 3086
605 Ga0207652_10184733 3300025921 Bacteria 1875
606 Ga0207646_10000108 3300025922 Bacteria 112950
607 Ga0207646_10001029 3300025922 Bacteria 35628
608 Ga0207646_10048732 3300025922 Bacteria 3796
609 Ga0207646_10055462 3300025922 Bacteria 3542
610 Ga0207646_10099621 3300025922 Bacteria 2604
611 Ga0207646_10101696 3300025922 Bacteria 2577
612 Ga0207646_10115218 3300025922 Bacteria 2414
613 Ga0207646_10126429 3300025922 Bacteria 2299
614 Ga0207646_10133720 3300025922 Bacteria 2233
615 Ga0207646_10143444 3300025922 Bacteria 2151
616 Ga0207646_10378417 3300025922 Bacteria 1279
617 Ga0207646_10438620 3300025922 Bacteria 1178
618 Ga0207646_10491209 3300025922 Bacteria 1106
619 Ga0207646_10517696 3300025922 Bacteria 1074
620 Ga0207681_10000869 3300025923 Bacteria 19867
621 Ga0207681_10003720 3300025923 Bacteria 9484
622 Ga0207681_10023886 3300025923 Bacteria 3916
623 Ga0207681_10041805 3300025923 Bacteria 3058
624 Ga0207681_10056585 3300025923 Bacteria 2676
625 Ga0207681_10153879 3300025923 Bacteria 1726
626 Ga0207681_10252861 3300025923 Bacteria 1376
627 Ga0207694_10007178 3300025924 Bacteria 8458
628 Ga0207694_10203543 3300025924 Bacteria 1611
629 Ga0207694_10338743 3300025924 Bacteria 1243
630 Ga0207650_10000022 3300025925 Bacteria 318878
631 Ga0207650_10009105 3300025925 Bacteria 6785
632 Ga0207650_10012767 3300025925 Bacteria 5804
633 Ga0207650_10364940 3300025925 Bacteria 1190
634 Ga0207659_10026962 3300025926 Bacteria 3884
635 Ga0207687_10016926 3300025927 Bacteria 4792
636 Ga0207687_10068428 3300025927 Bacteria 2530
637 Ga0207700_10010114 3300025928 Bacteria 5932
638 Ga0207700_10175861 3300025928 Bacteria 1789
639 Ga0207664_10141640 3300025929 Bacteria 2035
640 Ga0207664_10217954 3300025929 Bacteria 1654
641 Ga0207664_10315818 3300025929 Bacteria 1378
642 Ga0207644_10001481 3300025931 Bacteria 15096
643 Ga0207644_10010974 3300025931 Bacteria 5984
644 Ga0207644_10023417 3300025931 Bacteria 4229
645 Ga0207644_10043868 3300025931 Bacteria 3175
646 Ga0207644_10054681 3300025931 Bacteria 2876
647 Ga0207644_10071671 3300025931 Bacteria 2535
648 Ga0207644_10074328 3300025931 Bacteria 2494
649 Ga0207690_10019982 3300025932 Bacteria 4131
650 Ga0207690_10040599 3300025932 Bacteria 3043
651 Ga0207690_10165910 3300025932 Bacteria 1650
652 Ga0207706_10038016 3300025933 Bacteria 4271
653 Ga0207706_10049764 3300025933 Bacteria 3703
654 Ga0207706_10075973 3300025933 Bacteria 2955
655 Ga0207706_10086661 3300025933 Bacteria 2753
656 Ga0207706_10290429 3300025933 Unclassified 1426
657 Ga0207686_10074687 3300025934 Bacteria 2191
658 Ga0207709_10000498 3300025935 Bacteria 35179
659 Ga0207709_10012460 3300025935 Bacteria 4683
660 Ga0207709_10097564 3300025935 Bacteria 1936
661 Ga0207670_10000001 3300025936 Bacteria 949312
662 Ga0207670_10023971 3300025936 Unclassified 3807
663 Ga0207670_10025296 3300025936 Bacteria 3724
664 Ga0207670_10025949 3300025936 Bacteria 3687
665 Ga0207670_10031775 3300025936 Bacteria 3388
666 Ga0207670_10146826 3300025936 Bacteria 1745
667 Ga0207670_10311049 3300025936 Bacteria 1237
668 Ga0207669_10024183 3300025937 Bacteria 3261
669 Ga0207669_10036787 3300025937 Bacteria 2801
670 Ga0207669_10067652 3300025937 Bacteria 2227
671 Ga0207704_10036901 3300025938 Bacteria 2817
672 Ga0207704_10252483 3300025938 Bacteria 1325
673 Ga0207704_10277564 3300025938 Bacteria 1272
674 Ga0207665_10006742 3300025939 Bacteria 7612
675 Ga0207665_10124202 3300025939 Bacteria 1826
676 Ga0207665_10363270 3300025939 Bacteria 1095
677 Ga0207691_10000800 3300025940 Bacteria 31245
678 Ga0207691_10045704 3300025940 Bacteria 4024
679 Ga0207691_10048715 3300025940 Bacteria 3883
680 Ga0207691_10062659 3300025940 Bacteria 3373
681 Ga0207691_10197067 3300025940 Bacteria 1754
682 Ga0207691_10297011 3300025940 Bacteria 1388
683 Ga0207691_10299500 3300025940 Bacteria 1382
684 Ga0207711_10005862 3300025941 Bacteria 10374
685 Ga0207711_10026290 3300025941 Bacteria 4884
686 Ga0207711_10037446 3300025941 Bacteria 4120
687 Ga0207689_10004054 3300025942 Bacteria 13306
688 Ga0207689_10014345 3300025942 Bacteria 6742
689 Ga0207689_10088601 3300025942 Bacteria 2542
690 Ga0207689_10089750 3300025942 Bacteria 2525
691 Ga0207689_10315462 3300025942 Bacteria 1297
692 Ga0207661_10027814 3300025944 Bacteria 4324
693 Ga0207661_10102383 3300025944 Bacteria 2407
694 Ga0207679_10013997 3300025945 Bacteria 5262
695 Ga0207679_10074216 3300025945 Bacteria 2577
696 Ga0207679_10106264 3300025945 Bacteria 2206
697 Ga0207679_10252866 3300025945 Bacteria 1499
698 Ga0207667_10002080 3300025949 Bacteria 25078
699 Ga0207667_10012816 3300025949 Bacteria 9632
700 Ga0207651_10013490 3300025960 Bacteria 4678
701 Ga0207651_10028454 3300025960 Bacteria 3526
702 Ga0207651_10448739 3300025960 Bacteria 1106
703 Ga0207712_10000068 3300025961 Bacteria 130032
704 Ga0207712_10065705 3300025961 Bacteria 2590
705 Ga0207668_10010416 3300025972 Bacteria 5615
706 Ga0207668_10033927 3300025972 Bacteria 3384
707 Ga0207668_10141608 3300025972 Unclassified 1850
708 Ga0207668_10225407 3300025972 Bacteria 1508
709 Ga0207668_10233407 3300025972 Bacteria 1484
710 Ga0207668_10288317 3300025972 Bacteria 1349
711 Ga0207640_10101151 3300025981 Bacteria 2021
712 Ga0207640_10224572 3300025981 Bacteria 1440
713 Ga0207677_10019794 3300026023 Bacteria 4073
714 Ga0207677_10054394 3300026023 Bacteria 2731
715 Ga0207677_10240669 3300026023 Bacteria 1464
716 Ga0207677_10314959 3300026023 Bacteria 1298
717 Ga0207703_10040489 3300026035 Bacteria 3729
718 Ga0207703_10048763 3300026035 Bacteria 3420
719 Ga0207703_10090630 3300026035 Bacteria 2570
720 Ga0207703_10184384 3300026035 Bacteria 1844
721 Ga0207639_10002838 3300026041 Bacteria 11623
722 Ga0207639_10068554 3300026041 Bacteria 2765
723 Ga0207639_10583505 3300026041 Bacteria 1029
724 Ga0207678_10008966 3300026067 Bacteria 8804
725 Ga0207678_10021083 3300026067 Bacteria 5712
726 Ga0207708_10000340 3300026075 Bacteria 36852
727 Ga0207708_10011859 3300026075 Bacteria 6490
728 Ga0207708_10020250 3300026075 Bacteria 5017
729 Ga0207708_10021633 3300026075 Bacteria 4851
730 Ga0207708_10022189 3300026075 Bacteria 4794
731 Ga0207708_10045653 3300026075 Bacteria 3338
732 Ga0207708_10111039 3300026075 Bacteria 2128
733 Ga0207708_10196029 3300026075 Bacteria 1609
734 Ga0207702_10131695 3300026078 Bacteria 2251
735 Ga0207702_10353794 3300026078 Bacteria 1406
736 Ga0207641_10028499 3300026088 Bacteria 4615
737 Ga0207641_10101447 3300026088 Bacteria 2536
738 Ga0207641_10160793 3300026088 Bacteria 2042
739 Ga0207641_10173337 3300026088 Bacteria 1971
740 Ga0207641_10368646 3300026088 Bacteria 1373
741 Ga0207648_10033690 3300026089 Bacteria 4517
742 Ga0207648_10043816 3300026089 Bacteria 3928
743 Ga0207648_10053356 3300026089 Bacteria 3534
744 Ga0207648_10069294 3300026089 Bacteria 3073
745 Ga0207648_10250541 3300026089 Bacteria 1579
746 Ga0207676_10002507 3300026095 Bacteria 13082
747 Ga0207676_10093014 3300026095 Bacteria 2481
748 Ga0207676_10110041 3300026095 Bacteria 2304
749 Ga0207676_10124786 3300026095 Bacteria 2178
750 Ga0207674_10001039 3300026116 Bacteria 36064
751 Ga0207674_10075746 3300026116 Bacteria 3374
752 Ga0207675_100002039 3300026118 Bacteria 20154
753 Ga0207675_100007403 3300026118 Bacteria 10375
754 Ga0207675_100027424 3300026118 Bacteria 5305
755 Ga0207675_100090879 3300026118 Bacteria 2870
756 Ga0207675_100294967 3300026118 Bacteria 1578
757 Ga0207675_100451145 3300026118 Bacteria 1274
758 Ga0207683_10003536 3300026121 Bacteria 13627
759 Ga0207683_10020785 3300026121 Bacteria 5616
760 Ga0207683_10031317 3300026121 Bacteria 4616
761 Ga0207683_10050855 3300026121 Bacteria 3630
762 Ga0207698_10125377 3300026142 Bacteria 2183
763 Ga0207698_10158473 3300026142 Bacteria 1976
764 Ga0207698_10202074 3300026142 Bacteria 1780
765 Ga0207698_10560889 3300026142 Bacteria 1121
766 Ga0209998_10007442 3300027717 Bacteria 2271
767 Ga0209974_10011412 3300027876 Bacteria 2983
768 Ga0207428_10004079 3300027907 Bacteria 13992
769 Ga0207428_10008809 3300027907 Bacteria 9100
770 Ga0207428_10094881 3300027907 Bacteria 2311
771 Ga0268266_10004452 3300028379 Bacteria 13400
772 Ga0268266_10018440 3300028379 Bacteria 5946
773 Ga0268266_10043315 3300028379 Bacteria 3846
774 Ga0268266_10072831 3300028379 Bacteria 2980
775 Ga0268266_10121817 3300028379 Bacteria 2322
776 Ga0268266_10126509 3300028379 Bacteria 2281
777 Ga0268266_10463418 3300028379 Unclassified 1206
778 Ga0268265_10019938 3300028380 Bacteria 4671
779 Ga0268265_10076684 3300028380 Bacteria 2623
780 Ga0268265_10173869 3300028380 Bacteria 1844
781 Ga0268265_10202348 3300028380 Bacteria 1724
782 Ga0268265_10361295 3300028380 Bacteria 1329
783 Ga0268264_10004034 3300028381 Bacteria 12574
784 Ga0268264_10019083 3300028381 Bacteria 5606
785 Ga0268264_10206756 3300028381 Bacteria 1799
786 Ga0265337_1003995 3300028556 Bacteria 6240
787 Ga0265337_1035432 3300028556 Bacteria 1462
788 Ga0265334_10001475 3300028573 Bacteria 11338
789 Ga0265318_10000008 3300028577 Bacteria 279221
790 Ga0265318_10000180 3300028577 Bacteria 55904
791 Ga0265318_10002167 3300028577 Bacteria 10646
792 Ga0265318_10004680 3300028577 Bacteria 6572
793 Ga0265338_10011598 3300028800 Bacteria 10158
794 Ga0265338_10083512 3300028800 Bacteria 2671
795 Ga0265338_10163280 3300028800 Bacteria 1718
796 Ga0265324_10002968 3300029957 Bacteria 8299
797 Ga0265330_10001004 3300031235 Bacteria 17173
798 Ga0265330_10052710 3300031235 Bacteria 1781
799 Ga0265332_10000359 3300031238 Bacteria 33943
800 Ga0265332_10006786 3300031238 Bacteria 5188
801 Ga0265328_10006299 3300031239 Bacteria 5038
802 Ga0265328_10014019 3300031239 Bacteria 3163
803 Ga0265320_10000132 3300031240 Bacteria 64612
804 Ga0265320_10001253 3300031240 Bacteria 18635
805 Ga0265320_10005602 3300031240 Bacteria 8028
806 Ga0265320_10066480 3300031240 Bacteria 1708
807 Ga0265325_10001876 3300031241 Bacteria 14502
808 Ga0265329_10000642 3300031242 Bacteria 17841
809 Ga0265329_10011713 3300031242 Bacteria 3179
810 Ga0265340_10008907 3300031247 Bacteria 5407
811 Ga0265331_10000004 3300031250 Bacteria 476985
812 Ga0265331_10000107 3300031250 Bacteria 112221
813 Ga0265331_10003038 3300031250 Bacteria 11011
814 Ga0265331_10060813 3300031250 Bacteria 1784
815 Ga0265316_10003795 3300031344 Bacteria 15187
816 Ga0265316_10033762 3300031344 Bacteria 4162
817 Ga0265316_10066087 3300031344 Bacteria 2799
818 Ga0265316_10068740 3300031344 Bacteria 2735
819 Ga0307513_10072931 3300031456 Bacteria 3576
820 Ga0307513_10135603 3300031456 Bacteria 2398
821 Ga0265313_10000005 3300031595 Bacteria 187978
822 Ga0265313_10008560 3300031595 Bacteria 6775
823 Ga0265313_10025639 3300031595 Bacteria 3118
824 Ga0265313_10029971 3300031595 Bacteria 2807
825 Ga0265313_10059262 3300031595 Bacteria 1801
826 Ga0265313_10075513 3300031595 Bacteria 1542
827 Ga0307508_10001711 3300031616 Bacteria 24345
828 Ga0307508_10015699 3300031616 Bacteria 6901
829 Ga0307514_10136217 3300031649 Bacteria 1680
830 Ga0316575_10015656 3300031665 Bacteria 2860
831 Ga0316575_10024897 3300031665 Bacteria 2319
832 Ga0316575_10039769 3300031665 Bacteria 1857
833 Ga0316579_10005547 3300031691 Bacteria 5103
834 Ga0316579_10052553 3300031691 Bacteria 1908
835 Ga0265314_10000014 3300031711 Bacteria 400363
836 Ga0265314_10014645 3300031711 Bacteria 6259
837 Ga0265342_10002890 3300031712 Bacteria 14484
838 Ga0265342_10014365 3300031712 Bacteria 5258
839 Ga0316576_10001523 3300031727 Bacteria 12541
840 Ga0316576_10003780 3300031727 Bacteria 8948
841 Ga0316576_10005532 3300031727 Bacteria 7734
842 Ga0316576_10009486 3300031727 Bacteria 6284
843 Ga0316576_10037418 3300031727 Bacteria 3474
844 Ga0316576_10050002 3300031727 Bacteria 3038
845 Ga0316576_10111352 3300031727 Bacteria 2052
846 Ga0316576_10124977 3300031727 Bacteria 1933
847 Ga0316578_10000298 3300031728 Bacteria 15146
848 Ga0316578_10001642 3300031728 Bacteria 9286
849 Ga0316578_10003723 3300031728 Bacteria 7045
850 Ga0316578_10003753 3300031728 Bacteria 7025
851 Ga0316578_10011873 3300031728 Bacteria 4574
852 Ga0316578_10034042 3300031728 Bacteria 2923
853 Ga0316578_10061058 3300031728 Bacteria 2220
854 Ga0316577_10003314 3300031733 Bacteria 8115
855 Ga0316577_10006633 3300031733 Bacteria 6128
856 Ga0316577_10052834 3300031733 Bacteria 2267
857 Ga0316577_10074495 3300031733 Bacteria 1895
858 Ga0326468_10003958 3300031889 Bacteria 1277
859 Ga0316583_10000505 3300032133 Bacteria 11690
860 Ga0316583_10009740 3300032133 Bacteria 3462
861 Ga0316585_10045646 3300032137 Bacteria 1402
862 Ga0316580_10000153 3300032139 Bacteria 13473
863 Ga0316580_10004207 3300032139 Bacteria 4156
864 Ga0316580_10044053 3300032139 Bacteria 1377
865 Ga0316593_10000959 3300032168 Bacteria 5951
866 Ga0316593_10003375 3300032168 Bacteria 3955
867 Ga0316592_1000668 3300033524 Bacteria 5017
868 Ga0316592_1000957 3300033524 Bacteria 4436
869 Ga0316588_1000091 3300033528 Bacteria 8336
870 Ga0316588_1000365 3300033528 Bacteria 5871
871 Ga0316587_1004347 3300033529 Bacteria 2058
872 Ga0316596_1000506 3300033541 Bacteria 6646
873 Ga0316596_1007623 3300033541 Bacteria 2562
874 Ga0373926_0003662 3300035083 Bacteria 4992
875 Ga0373926_0008228 3300035083 Bacteria 3472
876 Ga0373934_0039508 3300035086 Bacteria 1861
877 Ga0373944_0000300 3300035089 Bacteria 11008
878 Ga0373923_0007689 3300035111 Bacteria 3804
879 Ga0373923_0026065 3300035111 Bacteria 2323
880 Ga0373936_0001801 3300035113 Bacteria 7878
881 Ga0373945_0001062 3300035116 Bacteria 8257
882 Ga0373954_0015706 3300035118 Bacteria 3387
883 Ga0373954_0026976 3300035118 Bacteria 2635
884 Ga0373943_0009602 3300035170 Bacteria 4337
885 Ga0373943_0021970 3300035170 Bacteria 2951
886 Ga0373943_0033948 3300035170 Bacteria 2433
887 Ga0373943_0107302 3300035170 Bacteria 1468
888 Ga0373943_0164165 3300035170 Bacteria 1211
889 Ga0373946_0004684 3300035171 Bacteria 4912
890 Ga0316574_0000893 3300035398 Bacteria 13204
891 Ga0316574_0003767 3300035398 Bacteria 7856
892 Ga0316574_0004153 3300035398 Bacteria 7545
893 Ga0316574_0005203 3300035398 Bacteria 6917
894 Ga0316574_0013618 3300035398 Bacteria 4680
895 Ga0316574_0054821 3300035398 Bacteria 2491
896 Ga0316574_0060801 3300035398 Bacteria 2372
897 Ga0316574_0078769 3300035398 Bacteria 2089
898 Ga0316574_0138411 3300035398 Bacteria 1568
899 Ga0316574_0174634 3300035398 Bacteria 1383
900 Ga0373935_0012338 3300035692 Bacteria 5142
901 Ga0373935_0090812 3300035692 Bacteria 2000
902 Ga0373927_0017296 3300035695 Bacteria 4747
903 Ga0373927_0025437 3300035695 Bacteria 3870
904 Ga0373927_0072817 3300035695 Bacteria 2224
905 Ga0373933_0025859 3300035724 Bacteria 3368
906 Ga0373933_0061395 3300035724 Bacteria 2268
907 Ga0373933_0313419 3300035724 Bacteria 1017
908 Ga0373947_0032854 3300035725 Bacteria 3060
909 Ga0373937_0065710 3300036401 Bacteria 3339
910 Ga0373937_0177187 3300036401 Bacteria 2001
911 Ga0373937_0335685 3300036401 Bacteria 1431
912 Ga0316582_0001897 3300036647 Bacteria 9508
913 Ga0316582_0012384 3300036647 Bacteria 4757
914 Ga0316582_0014120 3300036647 Bacteria 4522
915 Ga0316582_0049380 3300036647 Bacteria 2661
916 Ga0316582_0049512 3300036647 Bacteria 2658
917 Ga0316582_0076514 3300036647 Bacteria 2177
918 Ga0316584_0001074 3300036712 Bacteria 15985
919 Ga0316584_0006706 3300036712 Bacteria 7808
920 Ga0316584_0010384 3300036712 Bacteria 6503
921 Ga0316584_0149609 3300036712 Bacteria 1738
922 Ga0316584_0169645 3300036712 Bacteria 1619
923 Ga0316584_0317498 3300036712 Bacteria 1125
924 Ga0373925_0117130 3300037068 Bacteria 2064
925 Ga0373925_0362394 3300037068 Bacteria 1178
926 Ga0395900_0011095 3300037418 Bacteria 9210
927 Ga0395898_0003987 3300037466 Bacteria 16251
928 Ga0395898_0331115 3300037466 Bacteria 1452
929 Ga0395905_0049970 3300037471 Bacteria 3919
930 Ga0395905_0135095 3300037471 Bacteria 2320
931 Ga0395905_0285311 3300037471 Bacteria 1538
932 Ga0395905_0374596 3300037471 Bacteria 1317
933 Ga0316581_0012938 3300037588 Bacteria 2358
934 Ga0395901_0011017 3300038443 Bacteria 9159
935 Ga0395901_0361882 3300038443 Bacteria 1496
936 Ga0395901_0444269 3300038443 Bacteria 1327
937 Ga0400490_39170 3300038726 Bacteria 18291
938 Ga0400485_18933 3300038735 Bacteria 34504
939 Ga0400488_45668 3300038741 Bacteria 7510
940 Ga0400488_52774 3300038741 Bacteria 1939
941 Ga0400486_27561 3300038742 Bacteria 87898
942 Ga0400489_45403 3300039093 Bacteria 1334
943 Ga0400489_56002 3300039093 Bacteria 3238
944 Ga0400487_07588 3300039110 Bacteria 2978
945 Ga0400487_44815 3300039110 Bacteria 38740
946 Ga0436365_0655171 3300039437 Bacteria 48662
947 Ga0436365_0832581 3300039437 Bacteria 2300
948 Ga0436365_1013692 3300039437 Bacteria 2077
949 Ga0436365_1447325 3300039437 Bacteria 4349
950 Ga0436362_0838041 3300039453 Bacteria 1316
951 Ga0451804_0616426 3300041463 Bacteria 1562
952 Ga0439455_0022535 3300042012 Unclassified 1510
953 Ga0439434_0029046 3300042435 Bacteria 1676
954 Ga0451577_0000062 3300042876 Bacteria 267945
955 Ga0451577_0001080 3300042876 Bacteria 39089
956 Ga0451577_0001358 3300042876 Bacteria 33020
957 Ga0451577_0001729 3300042876 Bacteria 28147
958 Ga0451577_0004291 3300042876 Bacteria 15138
959 Ga0451577_0007527 3300042876 Bacteria 10694
960 Ga0451577_0010592 3300042876 Bacteria 8794
961 Ga0451577_0024870 3300042876 Bacteria 5440
962 Ga0451577_0043273 3300042876 Bacteria 4034
963 Ga0451577_0095906 3300042876 Bacteria 2648
964 Ga0451577_0124316 3300042876 Bacteria 2311
965 Ga0451577_0513264 3300042876 Bacteria 1088
966 Ga0453683_0000571 3300044673 Bacteria 40713
967 Ga0453683_0002186 3300044673 Bacteria 15557
968 Ga0453683_0010074 3300044673 Bacteria 6281
969 Ga0453683_0140089 3300044673 Bacteria 1526
970 Ga0466965_0085186 3300044683 Bacteria 1602
971 Ga0453684_0000020 3300044712 Bacteria 879938
972 Ga0453684_0000258 3300044712 Bacteria 228312
973 Ga0453684_0000749 3300044712 Bacteria 113060
974 Ga0453684_0000877 3300044712 Bacteria 100674
975 Ga0453684_0006977 3300044712 Bacteria 21144
976 Ga0453684_0137697 3300044712 Bacteria 2920
977 Ga0453684_0224507 3300044712 Bacteria 2173
978 Ga0453684_0252304 3300044712 Bacteria 2025
979 Ga0453684_0258707 3300044712 Bacteria 1995
980 Ga0453684_0297024 3300044712 Bacteria 1837
981 Ga0453684_0703623 3300044712 Bacteria 1098
982 Ga0451576_0004827 3300045051 Bacteria 17259
983 Ga0451576_0038233 3300045051 Bacteria 5079
984 Ga0451576_0047981 3300045051 Bacteria 4488
985 Ga0451576_0051337 3300045051 Bacteria 4324
986 Ga0451576_0255481 3300045051 Bacteria 1831
987 Ga0451576_0357240 3300045051 Bacteria 1530
988 Ga0451576_0510312 3300045051 Bacteria 1263
989 Ga0451576_0633530 3300045051 Unclassified 1123
990 Ga0451576_0794048 3300045051 Bacteria 994
991 Ga0466967_0116300 3300045976 Bacteria 2464
992 Ga0495592_0131917 3300046454 Bacteria 1747
993 Ga0495592_0146646 3300046454 Bacteria 1635
994 Ga0495603_0015230 3300046455 Bacteria 4653
995 Ga0495629_0036726 3300046459 Bacteria 3456
996 Ga0495641_0026565 3300046461 Bacteria 2823
997 Ga0495651_0063110 3300046462 Bacteria 2833
998 Ga0495582_0010834 3300046473 Bacteria 5018
999 Ga0495639_0001643 3300046475 Bacteria 9957
1000 Ga0495639_0019588 3300046475 Bacteria 2955
1001 Ga0495639_0093535 3300046475 Bacteria 1413
1002 Ga0495662_0006174 3300046476 Bacteria 5990
1003 Ga0495585_0010471 3300046492 Bacteria 5515
1004 Ga0495618_0229209 3300046514 Bacteria 1170
1005 Ga0495628_0003533 3300046516 Bacteria 13997
1006 Ga0495630_0004915 3300046517 Bacteria 9394
1007 Ga0495630_0078942 3300046517 Bacteria 2482
1008 Ga0495630_0191155 3300046517 Bacteria 1562
1009 Ga0495632_0063816 3300046519 Bacteria 1783
1010 Ga0495643_0000208 3300046522 Bacteria 90476
1011 Ga0495663_0003270 3300046525 Bacteria 4708
1012 Ga0495666_0009535 3300046526 Bacteria 4850
1013 Ga0495652_0070216 3300046529 Bacteria 2929
1014 Ga0495652_0262995 3300046529 Bacteria 1272
1015 Ga0495665_0007185 3300046531 Bacteria 6010
1016 Ga0495665_0010876 3300046531 Bacteria 4923
1017 Ga0495640_0014561 3300046533 Bacteria 5947
1018 Ga0495586_0003922 3300046535 Bacteria 7979
1019 Ga0495586_0045644 3300046535 Bacteria 2361
1020 Ga0495598_0000613 3300046537 Bacteria 6748
1021 Ga0495621_0000644 3300046539 Bacteria 8780
1022 Ga0495621_0014785 3300046539 Bacteria 2478
1023 Ga0495645_0095555 3300046543 Bacteria 2118
1024 Ga0495667_0094114 3300046559 Bacteria 1940
1025 Ga0495656_0002008 3300046615 Bacteria 6699
1026 Ga0495656_0036890 3300046615 Bacteria 2016
1027 Ga0495668_0063726 3300046616 Bacteria 2030
1028 Ga0495634_0031361 3300046642 Bacteria 3662
1029 Ga0495635_0004445 3300046663 Bacteria 9714
1030 Ga0495659_0084201 3300046664 Bacteria 1212
1031 Ga0495588_0000461 3300046674 Bacteria 20406
1032 Ga0495623_0103376 3300046679 Bacteria 1733
1033 Ga0495647_0007010 3300046681 Bacteria 3755
1034 Ga0495658_0000868 3300046683 Bacteria 16237
1035 Ga0495658_0047056 3300046683 Bacteria 2427
1036 Ga0495658_0093790 3300046683 Bacteria 1782
1037 Ga0495658_0122049 3300046683 Bacteria 1577
1038 Ga0495658_0155627 3300046683 Bacteria 1407
1039 Ga0495658_0193414 3300046683 Bacteria 1266
1040 Ga0495658_0315602 3300046683 Bacteria 990
1041 Ga0495613_0007750 3300046689 Bacteria 7990
1042 Ga0495613_0143610 3300046689 Bacteria 1704
1043 Ga0495624_0006404 3300046690 Bacteria 8351
1044 Ga0495624_0115269 3300046690 Bacteria 1652
1045 Ga0495670_0017881 3300046691 Bacteria 3491
1046 Ga0495600_0276939 3300046809 Bacteria 1063
1047 Ga0495581_0002010 3300047315 Bacteria 11424
1048 Ga0495581_0032140 3300047315 Bacteria 3039
1049 Ga0495674_0011893 3300047319 Bacteria 8204
1050 Ga0495674_0179775 3300047319 Bacteria 1762
1051 Ga0495672_0168785 3300047320 Bacteria 1118
1052 Ga0495672_0190656 3300047320 Bacteria 1031
1053 Ga0495680_0010498 3300047322 Bacteria 8264
1054 Ga0495684_0022126 3300047471 Bacteria 4895
1055 Ga0495684_0181472 3300047471 Unclassified 1560
1056 Ga0495602_0073348 3300048088 Bacteria 2914
1057 Ga0496100_0010082 3300048903 Bacteria 5337
1058 Ga0496101_0011665 3300048904 Bacteria 5838
1059 Ga0496101_0142129 3300048904 Bacteria 1830
1060 Ga0496102_0020269 3300048905 Bacteria 5875
1061 Ga0496102_0063143 3300048905 Bacteria 3391
1062 Ga0496102_0075339 3300048905 Bacteria 3102
1063 Ga0496103_0022958 3300048906 Bacteria 3760
1064 Ga0496103_0065336 3300048906 Bacteria 2269
1065 Ga0496104_0185538 3300048907 Bacteria 1991
1066 Ga0496105_0045143 3300048908 Bacteria 3636
1067 Ga0496105_0168048 3300048908 Bacteria 1799
1068 Ga0496106_0024207 3300048909 Bacteria 4512
1069 Ga0496106_0208113 3300048909 Bacteria 1558
1070 Ga0496106_0323222 3300048909 Bacteria 1238
1071 Ga0496106_0361660 3300048909 Bacteria 1166
1072 Ga0496107_0004978 3300048910 Bacteria 9043
1073 Ga0496107_0149136 3300048910 Bacteria 1730
1074 Ga0496108_0013859 3300048911 Bacteria 6575
1075 Ga0496108_0107889 3300048911 Bacteria 2378
1076 Ga0496108_0159356 3300048911 Bacteria 1950
1077 Ga0496109_0007664 3300048912 Bacteria 9152
1078 Ga0496109_0022989 3300048912 Bacteria 5528
1079 Ga0496109_0417315 3300048912 Bacteria 1268
1080 Ga0496109_0427052 3300048912 Bacteria 1252
1081 Ga0496110_0003658 3300048913 Bacteria 11829
1082 Ga0496110_0250574 3300048913 Bacteria 1612
1083 Ga0496110_0371110 3300048913 Bacteria 1304
1084 Ga0496110_0449973 3300048913 Bacteria 1174
1085 Ga0496111_0004083 3300048914 Bacteria 9169
1086 Ga0496112_0067619 3300048915 Bacteria 3527
1087 Ga0496112_0077789 3300048915 Bacteria 3281
1088 Ga0496112_0122475 3300048915 Bacteria 2571
1089 Ga0496112_0412433 3300048915 Bacteria 1290
1090 Ga0496112_0454355 3300048915 Bacteria 1219
1091 Ga0496113_0039232 3300048916 Bacteria 3485
1092 Ga0496114_0031652 3300048917 Bacteria 4351
1093 Ga0496114_0050987 3300048917 Bacteria 3445
1094 Ga0496114_0435025 3300048917 Bacteria 1162
1095 Ga0496115_0018253 3300048918 Bacteria 5382
1096 Ga0496115_0235859 3300048918 Bacteria 1508
1097 Ga0501309_012284 3300049129 Bacteria 1126
1098 Ga0501292_002995 3300049515 Bacteria 2223
1099 Ga0501297_004268 3300049520 Bacteria 1454
1100 Ga0501298_034083 3300049521 Bacteria 1011
1101 Ga0501033_0087604 3300049570 Bacteria 2279
1102 Ga0501034_0033027 3300049571 Bacteria 5255
1103 Ga0501034_0132934 3300049571 Bacteria 2471
1104 Ga0501036_0003125 3300049572 Bacteria 13213
1105 Ga0501036_0051739 3300049572 Bacteria 3478
1106 Ga0501037_0072433 3300049573 Bacteria 2506
1107 Ga0501038_0073618 3300049574 Bacteria 2892
1108 Ga0501039_0049609 3300049575 Bacteria 3245
1109 Ga0501040_0049075 3300049576 Bacteria 2885
1110 Ga0501041_0129563 3300049577 Bacteria 1571
1111 Ga0501042_0035799 3300049578 Bacteria 3522
1112 Ga0501046_0030490 3300049580 Bacteria 4377
1113 Ga0501047_0107839 3300049581 Bacteria 2667
1114 Ga0501048_0006833 3300049582 Bacteria 8669
1115 Ga0501067_0029041 3300049583 Bacteria 3066
1116 Ga0501071_0006225 3300049587 Bacteria 7742
1117 Ga0501071_0233292 3300049587 Bacteria 1387
1118 Ga0501072_0019250 3300049588 Bacteria 5274
1119 Ga0501073_0120872 3300049589 Bacteria 1815
1120 Ga0501073_0136708 3300049589 Bacteria 1698
1121 Ga0501073_0219710 3300049589 Bacteria 1313
1122 Ga0501074_0067954 3300049590 Bacteria 2562
1123 Ga0501075_0007763 3300049591 Bacteria 7445
1124 Ga0501076_0295909 3300049592 Bacteria 1326
1125 Ga0501077_0067672 3300049593 Bacteria 2264
1126 Ga0501077_0115271 3300049593 Bacteria 1703
1127 Ga0501202_003940 3300049652 Bacteria 2570
1128 Ga0501216_003400 3300049660 Bacteria 2316
1129 Ga0501217_023498 3300049661 Bacteria 1469
1130 Ga0501227_002619 3300049665 Bacteria 3946
1131 Ga0501227_043102 3300049665 Bacteria 1120
1132 Ga0501233_055554 3300049668 Bacteria 970
1133 Ga0501249_012831 3300049679 Bacteria 1775
1134 Ga0501234_004398 3300049707 Bacteria 2215
1135 Ga0501079_0022783 3300049741 Bacteria 4807
1136 Ga0501080_0020421 3300049742 Bacteria 6130
1137 Ga0501080_0190316 3300049742 Bacteria 1886
1138 Ga0501083_0001562 3300049744 Bacteria 15658
1139 Ga0501083_0004579 3300049744 Bacteria 9768
1140 Ga0501035_0080250 3300049822 Bacteria 2881
1141 Ga0501045_0000203 3300049824 Bacteria 33847
1142 nmdc:mga03683_2331_c1 3300050489 Bacteria 5874
1143 nmdc:mga03n38_66521_c1 3300050490 Bacteria 1656
1144 nmdc:mga0k408_2689_c1 3300050493 Bacteria 9422
1145 nmdc:mga0k408_297_c1 3300050493 Bacteria 26903
1146 nmdc:mga0k408_52632_c1 3300050493 Bacteria 2360
1147 nmdc:mga07m45_552_c1 3300050496 Bacteria 8215
1148 nmdc:mga05p37_264819_c1 3300050507 Bacteria 2055
1149 nmdc:mga05p37_309777_c1 3300050507 Bacteria 1872
1150 nmdc:mga05p37_430460_c1 3300050507 Bacteria 1533
1151 nmdc:mga05p37_562304_c1 3300050507 Bacteria 1296
1152 nmdc:mga05p37_660079_c1 3300050507 Bacteria 1169
1153 nmdc:mga09592_282174_c1 3300050508 Bacteria 1440
1154 nmdc:mga09592_49210_c1 3300050508 Bacteria 3554
1155 nmdc:mga09592_516992_c1 3300050508 Bacteria 1027
1156 nmdc:mga09592_7872_c1 3300050508 Bacteria 8662
1157 nmdc:mga09592_82183_c1 3300050508 Bacteria 2745
1158 nmdc:mga0qj67_258266_c1 3300050509 Bacteria 1413
1159 nmdc:mga08y16_100123_c1 3300050511 Bacteria 3017
1160 nmdc:mga08y16_117863_c1 3300050511 Bacteria 2763
1161 nmdc:mga08y16_128204_c1 3300050511 Bacteria 2639
1162 nmdc:mga08y16_212372_c1 3300050511 Bacteria 2004
1163 nmdc:mga08y16_21619_c1 3300050511 Bacteria 6794
1164 nmdc:mga08y16_21782_c1 3300050511 Bacteria 6763
1165 nmdc:mga08y16_2819_c1 3300050511 Bacteria 17855
1166 nmdc:mga08y16_427976_c1 3300050511 Bacteria 1352
1167 nmdc:mga08y16_49197_c1 3300050511 Bacteria 4412
1168 nmdc:mga08y16_59840_c1 3300050511 Bacteria 3979
1169 nmdc:mga0n895_176338_c1 3300050512 Bacteria 2168
1170 nmdc:mga0n895_240011_c1 3300050512 Bacteria 1839
1171 nmdc:mga0n895_280369_c1 3300050512 Bacteria 1690
1172 nmdc:mga0n895_31225_c1 3300050512 Bacteria 5098
1173 nmdc:mga0n895_363596_c1 3300050512 Bacteria 1465
1174 nmdc:mga0n895_388763_c1 3300050512 Bacteria 1411
1175 nmdc:mga0rr50_106249_c1 3300050513 Bacteria 2215
1176 nmdc:mga0rr50_376847_c1 3300050513 Bacteria 1196
1177 nmdc:mga08x19_2748_c1 3300050514 Bacteria 10628
1178 nmdc:mga08x19_39022_c1 3300050514 Bacteria 3018
1179 nmdc:mga0a205_17518_c1 3300050515 Bacteria 6718
1180 nmdc:mga0a205_58416_c1 3300050515 Bacteria 3726
1181 nmdc:mga0a205_65592_c1 3300050515 Bacteria 3508
1182 nmdc:mga0a205_80281_c1 3300050515 Bacteria 3152
1183 nmdc:mga0a205_86837_c1 3300050515 Bacteria 3022
1184 Ga0495619_0004035 3300053085 Bacteria 9401
1185 Ga0495619_0137318 3300053085 Bacteria 1682
1186 Ga0500578_0177322 3300053086 Bacteria 1315
1187 Ga0500555_000025 3300053103 Bacteria 119960
1188 Ga0500555_000321 3300053103 Bacteria 20635
1189 Ga0500556_0000370 3300053104 Bacteria 32830
1190 Ga0500642_0006150 3300053130 Bacteria 3932
1191 Ga0500616_0005952 3300053153 Bacteria 8136
1192 Ga0500622_0001124 3300053156 Bacteria 22305
1193 Ga0501084_0003199 3300054114 Bacteria 13258
1194 Ga0501084_0018958 3300054114 Bacteria 5728
1195 Ga0501084_0153393 3300054114 Bacteria 1942
1196 Ga0530510_0020650 3300061734 Bacteria 4682

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100186133 Ga0068867_1001861332 237
2 3300005578 Ga0068854_100230753 Ga0068854_1002307533 237
3 3300006847 Ga0075431_100056921 Ga0075431_1000569216 237
4 3300009147 Ga0114129_11034620 Ga0114129_110346201 237
5 3300009174 Ga0105241_10446249 Ga0105241_104462491 237
6 3300013308 Ga0157375_10915424 Ga0157375_109154241 237
7 3300050512 nmdc:mga0n895_388763_c1 nmdc:mga0n895_388763_c1_591_1382 238
8 3300005618 Ga0068864_100934592 Ga0068864_1009345921 239
9 3300046475 Ga0495639_0093535 Ga0495639_0093535_582_1376 239
10 3300046683 Ga0495658_0155627 Ga0495658_0155627_29_823 239
11 3300005577 Ga0068857_100085810 Ga0068857_1000858103 242
12 3300048912 Ga0496109_0427052 Ga0496109_0427052_160_1020 242
13 3300005618 Ga0068864_100606335 Ga0068864_1006063351 244
14 3300026089 Ga0207648_10043816 Ga0207648_100438163 244
15 3300025924 Ga0207694_10007178 Ga0207694_100071782 246
16 3300009147 Ga0114129_10101431 Ga0114129_101014317 248
17 3300028380 Ga0268265_10019938 Ga0268265_100199384 248
18 3300002459 JGI24751J29686_10000050 JGI24751J29686_1000005043 252
19 3300003203 JGI25406J46586_10001426 JGI25406J46586_100014265 252
20 3300003203 JGI25406J46586_10037474 JGI25406J46586_100374743 252
21 3300005288 Ga0065714_10002297 Ga0065714_100022976 252
22 3300005289 Ga0065704_10111650 Ga0065704_101116503 252
23 3300005293 Ga0065715_10018359 Ga0065715_100183591 252
24 3300005295 Ga0065707_10005149 Ga0065707_100051494 252
25 3300005295 Ga0065707_10203563 Ga0065707_102035631 252
26 3300005331 Ga0070670_100000439 Ga0070670_10000043923 252
27 3300005337 Ga0070682_100003960 Ga0070682_1000039607 252
28 3300005337 Ga0070682_100024319 Ga0070682_1000243191 252
29 3300005345 Ga0070692_10027516 Ga0070692_100275162 252
30 3300005353 Ga0070669_100084848 Ga0070669_1000848482 252
31 3300005440 Ga0070705_100118379 Ga0070705_1001183791 252
32 3300005441 Ga0070700_100010778 Ga0070700_1000107782 252
33 3300005467 Ga0070706_100061000 Ga0070706_1000610002 252
34 3300005471 Ga0070698_100005364 Ga0070698_1000053647 252
35 3300005543 Ga0070672_100390418 Ga0070672_1003904182 252
36 3300005578 Ga0068854_100042948 Ga0068854_1000429482 252
37 3300005615 Ga0070702_100006879 Ga0070702_1000068792 252
38 3300005834 Ga0068851_10009338 Ga0068851_100093383 252
39 3300005842 Ga0068858_100096659 Ga0068858_1000966592 252
40 3300005842 Ga0068858_100313982 Ga0068858_1003139822 252
41 3300005843 Ga0068860_100009989 Ga0068860_1000099896 252
42 3300006237 Ga0097621_100067046 Ga0097621_1000670462 252
43 3300006237 Ga0097621_100373227 Ga0097621_1003732272 252
44 3300006871 Ga0075434_100412573 Ga0075434_1004125731 252
45 3300006914 Ga0075436_100073735 Ga0075436_1000737352 252
46 3300009093 Ga0105240_10335846 Ga0105240_103358461 252
47 3300009094 Ga0111539_10003012 Ga0111539_1000301219 252
48 3300009101 Ga0105247_10000816 Ga0105247_100008169 252
49 3300009551 Ga0105238_10019792 Ga0105238_100197928 252
50 3300009551 Ga0105238_10250766 Ga0105238_102507662 252
51 3300009553 Ga0105249_10044336 Ga0105249_100443364 252
52 3300014325 Ga0163163_10000993 Ga0163163_1000099324 252
53 3300014969 Ga0157376_10002237 Ga0157376_1000223714 252
54 3300025885 Ga0207653_10001165 Ga0207653_100011658 252
55 3300025914 Ga0207671_10311148 Ga0207671_103111481 252
56 3300025924 Ga0207694_10203543 Ga0207694_102035431 252
57 3300025933 Ga0207706_10086661 Ga0207706_100866614 252
58 3300025940 Ga0207691_10197067 Ga0207691_101970672 252
59 3300025940 Ga0207691_10299500 Ga0207691_102995002 252
60 3300025941 Ga0207711_10037446 Ga0207711_100374465 252
61 3300025945 Ga0207679_10252866 Ga0207679_102528662 252
62 3300025981 Ga0207640_10224572 Ga0207640_102245722 252
63 3300026041 Ga0207639_10583505 Ga0207639_105835051 252
64 3300026075 Ga0207708_10020250 Ga0207708_100202502 252
65 3300026142 Ga0207698_10202074 Ga0207698_102020742 252
66 3300049515 Ga0501292_002995 Ga0501292_002995_314_1144 252
67 3300049520 Ga0501297_004268 Ga0501297_004268_109_939 252
68 3300049587 Ga0501071_0233292 Ga0501071_0233292_501_1331 252
69 3300050511 nmdc:mga08y16_21782_c1 nmdc:mga08y16_21782_c1_3969_4799 252
70 3300050515 nmdc:mga0a205_80281_c1 nmdc:mga0a205_80281_c1_2074_2904 252
71 3300005444 Ga0070694_100121480 Ga0070694_1001214801 253
72 3300005467 Ga0070706_100210458 Ga0070706_1002104582 253
73 3300005471 Ga0070698_100052816 Ga0070698_1000528164 253
74 3300005530 Ga0070679_100218388 Ga0070679_1002183882 253
75 3300009094 Ga0111539_10037428 Ga0111539_100374286 253
76 3300009147 Ga0114129_10074687 Ga0114129_100746873 253
77 3300013306 Ga0163162_10008619 Ga0163162_100086193 253
78 3300014968 Ga0157379_10082707 Ga0157379_100827072 253
79 3300025910 Ga0207684_10173629 Ga0207684_101736292 253
80 3300049521 Ga0501298_034083 Ga0501298_034083_75_908 253
81 3300049652 Ga0501202_003940 Ga0501202_003940_730_1563 253
82 3300049660 Ga0501216_003400 Ga0501216_003400_1305_2138 253
83 3300049661 Ga0501217_023498 Ga0501217_023498_527_1357 253
84 3300049665 Ga0501227_002619 Ga0501227_002619_1205_2038 253
85 3300049668 Ga0501233_055554 Ga0501233_055554_57_890 253
86 3300049679 Ga0501249_012831 Ga0501249_012831_472_1305 253
87 3300050509 nmdc:mga0qj67_258266_c1 nmdc:mga0qj67_258266_c1_564_1397 253
88 3300005330 Ga0070690_100008756 Ga0070690_1000087566 254
89 3300005985 Ga0081539_10001905 Ga0081539_1000190528 256
90 3300005445 Ga0070708_100222381 Ga0070708_1002223812 257
91 3300005536 Ga0070697_100152914 Ga0070697_1001529141 257
92 3300010375 Ga0105239_10283105 Ga0105239_102831052 260
93 3300014325 Ga0163163_10009099 Ga0163163_100090996 261
94 3300005336 Ga0070680_100091242 Ga0070680_1000912422 262
95 3300005340 Ga0070689_100471764 Ga0070689_1004717641 262
96 3300005364 Ga0070673_100188280 Ga0070673_1001882802 262
97 3300005441 Ga0070700_100185414 Ga0070700_1001854142 262
98 3300005615 Ga0070702_100156106 Ga0070702_1001561062 262
99 3300009094 Ga0111539_10018805 Ga0111539_1001880512 262
100 3300009147 Ga0114129_10285856 Ga0114129_102858561 262
101 3300009147 Ga0114129_10312165 Ga0114129_103121652 262
102 3300009177 Ga0105248_10012309 Ga0105248_100123093 262
103 3300026089 Ga0207648_10250541 Ga0207648_102505412 262
104 3300005467 Ga0070706_100130000 Ga0070706_1001300003 263
105 3300005545 Ga0070695_100315487 Ga0070695_1003154872 263
106 3300006163 Ga0070715_10000279 Ga0070715_100002798 263
107 3300009147 Ga0114129_10247622 Ga0114129_102476222 263
108 3300025905 Ga0207685_10000221 Ga0207685_100002215 263
109 3300025910 Ga0207684_10138232 Ga0207684_101382322 263
110 3300046519 Ga0495632_0063816 Ga0495632_0063816_509_1384 263
111 3300050513 nmdc:mga0rr50_106249_c1 nmdc:mga0rr50_106249_c1_487_1353 263
112 3300005290 Ga0065712_10074234 Ga0065712_100742344 264
113 3300005293 Ga0065715_10002046 Ga0065715_100020466 264
114 3300005293 Ga0065715_10091684 Ga0065715_100916841 264
115 3300005330 Ga0070690_100291490 Ga0070690_1002914901 264
116 3300005334 Ga0068869_100192053 Ga0068869_1001920532 264
117 3300005336 Ga0070680_100213387 Ga0070680_1002133871 264
118 3300005339 Ga0070660_100026636 Ga0070660_1000266366 264
119 3300005340 Ga0070689_100016838 Ga0070689_1000168385 264
120 3300005343 Ga0070687_100029620 Ga0070687_1000296202 264
121 3300005353 Ga0070669_100507479 Ga0070669_1005074791 264
122 3300005365 Ga0070688_100349085 Ga0070688_1003490851 264
123 3300005366 Ga0070659_100006504 Ga0070659_1000065047 264
124 3300005444 Ga0070694_100016139 Ga0070694_1000161392 264
125 3300005444 Ga0070694_100200345 Ga0070694_1002003452 264
126 3300005457 Ga0070662_100042004 Ga0070662_1000420042 264
127 3300005457 Ga0070662_100254346 Ga0070662_1002543461 264
128 3300005458 Ga0070681_10004276 Ga0070681_100042763 264
129 3300005459 Ga0068867_100506244 Ga0068867_1005062441 264
130 3300005467 Ga0070706_100000300 Ga0070706_1000003005 264
131 3300005518 Ga0070699_100002048 Ga0070699_10000204813 264
132 3300005530 Ga0070679_100081100 Ga0070679_1000811001 264
133 3300005539 Ga0068853_100478669 Ga0068853_1004786691 264
134 3300005544 Ga0070686_100005111 Ga0070686_1000051116 264
135 3300005545 Ga0070695_100297090 Ga0070695_1002970901 264
136 3300005547 Ga0070693_100012304 Ga0070693_1000123045 264
137 3300005549 Ga0070704_100196946 Ga0070704_1001969462 264
138 3300005549 Ga0070704_100365696 Ga0070704_1003656962 264
139 3300005563 Ga0068855_100000317 Ga0068855_10000031719 264
140 3300005564 Ga0070664_100001757 Ga0070664_10000175713 264
141 3300005577 Ga0068857_100018683 Ga0068857_1000186837 264
142 3300005617 Ga0068859_100027035 Ga0068859_1000270358 264
143 3300005617 Ga0068859_100093076 Ga0068859_1000930762 264
144 3300005617 Ga0068859_100232342 Ga0068859_1002323422 264
145 3300005718 Ga0068866_10001025 Ga0068866_100010254 264
146 3300005719 Ga0068861_100070068 Ga0068861_1000700684 264
147 3300005840 Ga0068870_10029737 Ga0068870_100297373 264
148 3300005842 Ga0068858_100251953 Ga0068858_1002519532 264
149 3300005843 Ga0068860_100119954 Ga0068860_1001199544 264
150 3300005985 Ga0081539_10000990 Ga0081539_1000099015 264
151 3300005985 Ga0081539_10088408 Ga0081539_100884082 264
152 3300006358 Ga0068871_100001915 Ga0068871_1000019156 264
153 3300006871 Ga0075434_100127995 Ga0075434_1001279952 264
154 3300006880 Ga0075429_100224920 Ga0075429_1002249202 264
155 3300006931 Ga0097620_100027036 Ga0097620_1000270361 264
156 3300006931 Ga0097620_100093077 Ga0097620_1000930772 264
157 3300006931 Ga0097620_100232352 Ga0097620_1002323522 264
158 3300009101 Ga0105247_10002962 Ga0105247_100029627 264
159 3300009174 Ga0105241_10014564 Ga0105241_100145646 264
160 3300011119 Ga0105246_10302929 Ga0105246_103029292 264
161 3300011119 Ga0105246_10321207 Ga0105246_103212071 264
162 3300013297 Ga0157378_10002954 Ga0157378_1000295415 264
163 3300013297 Ga0157378_10023819 Ga0157378_100238194 264
164 3300014325 Ga0163163_10009309 Ga0163163_100093099 264
165 3300014326 Ga0157380_10144961 Ga0157380_101449612 264
166 3300014745 Ga0157377_10206795 Ga0157377_102067952 264
167 3300025899 Ga0207642_10000626 Ga0207642_100006262 264
168 3300025899 Ga0207642_10063774 Ga0207642_100637742 264
169 3300025900 Ga0207710_10000753 Ga0207710_1000075315 264
170 3300025900 Ga0207710_10001106 Ga0207710_100011067 264
171 3300025904 Ga0207647_10005868 Ga0207647_100058686 264
172 3300025908 Ga0207643_10011379 Ga0207643_100113792 264
173 3300025910 Ga0207684_10000367 Ga0207684_100003675 264
174 3300025911 Ga0207654_10012881 Ga0207654_100128815 264
175 3300025912 Ga0207707_10014487 Ga0207707_100144873 264
176 3300025917 Ga0207660_10151888 Ga0207660_101518882 264
177 3300025918 Ga0207662_10032390 Ga0207662_100323902 264
178 3300025920 Ga0207649_10176896 Ga0207649_101768962 264
179 3300025921 Ga0207652_10068152 Ga0207652_100681521 264
180 3300025923 Ga0207681_10003720 Ga0207681_100037204 264
181 3300025925 Ga0207650_10000022 Ga0207650_1000002257 264
182 3300025932 Ga0207690_10040599 Ga0207690_100405993 264
183 3300025936 Ga0207670_10025296 Ga0207670_100252962 264
184 3300025941 Ga0207711_10026290 Ga0207711_100262905 264
185 3300025942 Ga0207689_10089750 Ga0207689_100897502 264
186 3300025942 Ga0207689_10315462 Ga0207689_103154621 264
187 3300025945 Ga0207679_10013997 Ga0207679_100139974 264
188 3300025949 Ga0207667_10002080 Ga0207667_1000208019 264
189 3300026035 Ga0207703_10090630 Ga0207703_100906302 264
190 3300026075 Ga0207708_10021633 Ga0207708_100216336 264
191 3300026095 Ga0207676_10110041 Ga0207676_101100412 264
192 3300026116 Ga0207674_10001039 Ga0207674_1000103920 264
193 3300026142 Ga0207698_10560889 Ga0207698_105608892 264
194 3300027907 Ga0207428_10008809 Ga0207428_100088094 264
195 3300031616 Ga0307508_10001711 Ga0307508_1000171117 264
196 3300037466 Ga0395898_0331115 Ga0395898_0331115_58_924 264
197 3300038443 Ga0395901_0361882 Ga0395901_0361882_384_1250 264
198 3300041463 Ga0451804_0616426 Ga0451804_0616426_532_1425 264
199 3300044683 Ga0466965_0085186 Ga0466965_0085186_470_1363 264
200 3300045051 Ga0451576_0357240 Ga0451576_0357240_353_1219 264
201 3300046525 Ga0495663_0003270 Ga0495663_0003270_3002_3958 264
202 3300046537 Ga0495598_0000613 Ga0495598_0000613_2654_3523 264
203 3300046539 Ga0495621_0000644 Ga0495621_0000644_7692_8561 264
204 3300047320 Ga0495672_0168785 Ga0495672_0168785_139_1032 264
205 3300048915 Ga0496112_0412433 Ga0496112_0412433_202_1068 264
206 3300049707 Ga0501234_004398 Ga0501234_004398_1041_1907 264
207 3300049742 Ga0501080_0190316 Ga0501080_0190316_492_1385 264
208 3300050507 nmdc:mga05p37_264819_c1 nmdc:mga05p37_264819_c1_339_1205 264
209 3300050507 nmdc:mga05p37_660079_c1 nmdc:mga05p37_660079_c1_59_925 264
210 3300050511 nmdc:mga08y16_100123_c1 nmdc:mga08y16_100123_c1_1553_2419 264
211 3300050511 nmdc:mga08y16_212372_c1 nmdc:mga08y16_212372_c1_856_1722 264
212 3300050512 nmdc:mga0n895_363596_c1 nmdc:mga0n895_363596_c1_377_1243 264
213 3300050514 nmdc:mga08x19_2748_c1 nmdc:mga08x19_2748_c1_9119_9985 264
214 3300050515 nmdc:mga0a205_86837_c1 nmdc:mga0a205_86837_c1_699_1565 264
215 3300005295 Ga0065707_10098125 Ga0065707_100981252 265
216 3300005336 Ga0070680_100000797 Ga0070680_10000079712 265
217 3300005353 Ga0070669_100005514 Ga0070669_1000055149 265
218 3300005355 Ga0070671_100011256 Ga0070671_1000112566 265
219 3300005441 Ga0070700_100000873 Ga0070700_1000008737 265
220 3300005444 Ga0070694_100020354 Ga0070694_1000203545 265
221 3300005458 Ga0070681_10032172 Ga0070681_100321723 265
222 3300005468 Ga0070707_100000134 Ga0070707_10000013437 265
223 3300005468 Ga0070707_100371939 Ga0070707_1003719391 265
224 3300005471 Ga0070698_100006202 Ga0070698_10000620211 265
225 3300005471 Ga0070698_100343149 Ga0070698_1003431492 265
226 3300005530 Ga0070679_100000855 Ga0070679_10000085512 265
227 3300005539 Ga0068853_100091746 Ga0068853_1000917461 265
228 3300005546 Ga0070696_100068312 Ga0070696_1000683122 265
229 3300005547 Ga0070693_100164552 Ga0070693_1001645522 265
230 3300005549 Ga0070704_100065911 Ga0070704_1000659113 265
231 3300005577 Ga0068857_100601794 Ga0068857_1006017941 265
232 3300005719 Ga0068861_100118413 Ga0068861_1001184133 265
233 3300005844 Ga0068862_100017359 Ga0068862_1000173593 265
234 3300006871 Ga0075434_100092275 Ga0075434_1000922753 265
235 3300006871 Ga0075434_100103542 Ga0075434_1001035421 265
236 3300007076 Ga0075435_100371439 Ga0075435_1003714392 265
237 3300009093 Ga0105240_10428430 Ga0105240_104284302 265
238 3300009094 Ga0111539_10055294 Ga0111539_100552946 265
239 3300009094 Ga0111539_10169136 Ga0111539_101691362 265
240 3300009147 Ga0114129_10020897 Ga0114129_100208972 265
241 3300010375 Ga0105239_10069721 Ga0105239_100697215 265
242 3300013297 Ga0157378_10222625 Ga0157378_102226252 265
243 3300013307 Ga0157372_10042615 Ga0157372_100426155 265
244 3300014326 Ga0157380_10004065 Ga0157380_100040657 265
245 3300025912 Ga0207707_10000031 Ga0207707_1000003195 265
246 3300025917 Ga0207660_10002124 Ga0207660_1000212416 265
247 3300025921 Ga0207652_10000087 Ga0207652_1000008735 265
248 3300025921 Ga0207652_10184733 Ga0207652_101847332 265
249 3300025922 Ga0207646_10101696 Ga0207646_101016961 265
250 3300025922 Ga0207646_10115218 Ga0207646_101152182 265
251 3300025923 Ga0207681_10023886 Ga0207681_100238864 265
252 3300025931 Ga0207644_10010974 Ga0207644_100109743 265
253 3300025961 Ga0207712_10065705 Ga0207712_100657052 265
254 3300026041 Ga0207639_10068554 Ga0207639_100685542 265
255 3300026075 Ga0207708_10000340 Ga0207708_1000034018 265
256 3300026118 Ga0207675_100027424 Ga0207675_1000274245 265
257 3300048905 Ga0496102_0063143 Ga0496102_0063143_775_1644 265
258 3300048909 Ga0496106_0208113 Ga0496106_0208113_487_1356 265
259 3300049129 Ga0501309_012284 Ga0501309_012284_161_1054 265
260 3300050507 nmdc:mga05p37_562304_c1 nmdc:mga05p37_562304_c1_106_975 265
261 3300050511 nmdc:mga08y16_128204_c1 nmdc:mga08y16_128204_c1_306_1181 265
262 3300050511 nmdc:mga08y16_59840_c1 nmdc:mga08y16_59840_c1_2831_3700 265
263 3300050513 nmdc:mga0rr50_376847_c1 nmdc:mga0rr50_376847_c1_245_1114 265
264 3300050515 nmdc:mga0a205_17518_c1 nmdc:mga0a205_17518_c1_5409_6278 265
265 3300005295 Ga0065707_10086298 Ga0065707_100862983 266
266 3300005337 Ga0070682_100000167 Ga0070682_10000016725 266
267 3300005438 Ga0070701_10006009 Ga0070701_100060095 266
268 3300005441 Ga0070700_100140713 Ga0070700_1001407131 266
269 3300005444 Ga0070694_100007979 Ga0070694_1000079796 266
270 3300005467 Ga0070706_100002853 Ga0070706_1000028533 266
271 3300005544 Ga0070686_100001814 Ga0070686_10000181410 266
272 3300005545 Ga0070695_100428682 Ga0070695_1004286821 266
273 3300005618 Ga0068864_100186109 Ga0068864_1001861092 266
274 3300013297 Ga0157378_10005155 Ga0157378_1000515513 266
275 3300013308 Ga0157375_10236130 Ga0157375_102361302 266
276 3300017792 Ga0163161_10444623 Ga0163161_104446231 266
277 3300025893 Ga0207682_10035079 Ga0207682_100350792 266
278 3300025910 Ga0207684_10002571 Ga0207684_1000257111 266
279 3300025910 Ga0207684_10070004 Ga0207684_100700043 266
280 3300025918 Ga0207662_10066910 Ga0207662_100669102 266
281 3300025938 Ga0207704_10252483 Ga0207704_102524831 266
282 3300026075 Ga0207708_10045653 Ga0207708_100456532 266
283 3300026116 Ga0207674_10075746 Ga0207674_100757464 266
284 3300039437 Ga0436365_1013692 Ga0436365_1013692_414_1295 266
285 3300048915 Ga0496112_0454355 Ga0496112_0454355_25_897 266
286 3300049589 Ga0501073_0136708 Ga0501073_0136708_423_1316 266
287 3300049742 Ga0501080_0020421 Ga0501080_0020421_3904_4797 266
288 3300049744 Ga0501083_0001562 Ga0501083_0001562_589_1482 266
289 3300049744 Ga0501083_0004579 Ga0501083_0004579_2972_3865 266
290 3300054114 Ga0501084_0003199 Ga0501084_0003199_9380_10273 266
291 3300054114 Ga0501084_0018958 Ga0501084_0018958_4230_5123 266
292 3300005293 Ga0065715_10137580 Ga0065715_101375801 267
293 3300005295 Ga0065707_10106880 Ga0065707_101068801 267
294 3300005334 Ga0068869_100001716 Ga0068869_1000017168 267
295 3300005334 Ga0068869_100009103 Ga0068869_1000091033 267
296 3300005338 Ga0068868_100024117 Ga0068868_1000241173 267
297 3300005445 Ga0070708_100571710 Ga0070708_1005717101 267
298 3300005467 Ga0070706_100037208 Ga0070706_1000372083 267
299 3300005468 Ga0070707_100190623 Ga0070707_1001906232 267
300 3300005471 Ga0070698_100244272 Ga0070698_1002442722 267
301 3300005536 Ga0070697_100000073 Ga0070697_10000007327 267
302 3300005543 Ga0070672_100050713 Ga0070672_1000507134 267
303 3300005548 Ga0070665_100561529 Ga0070665_1005615292 267
304 3300005549 Ga0070704_100246759 Ga0070704_1002467591 267
305 3300005563 Ga0068855_100016293 Ga0068855_1000162938 267
306 3300005614 Ga0068856_100091023 Ga0068856_1000910232 267
307 3300005618 Ga0068864_100002273 Ga0068864_10000227316 267
308 3300005841 Ga0068863_100120637 Ga0068863_1001206371 267
309 3300005842 Ga0068858_100025999 Ga0068858_1000259995 267
310 3300005843 Ga0068860_100012441 Ga0068860_1000124412 267
311 3300005843 Ga0068860_100234084 Ga0068860_1002340842 267
312 3300005844 Ga0068862_100128165 Ga0068862_1001281651 267
313 3300006237 Ga0097621_100009963 Ga0097621_1000099635 267
314 3300006358 Ga0068871_100028997 Ga0068871_1000289973 267
315 3300006871 Ga0075434_100312698 Ga0075434_1003126982 267
316 3300006881 Ga0068865_100251390 Ga0068865_1002513901 267
317 3300009098 Ga0105245_10030189 Ga0105245_100301895 267
318 3300009174 Ga0105241_10006658 Ga0105241_100066585 267
319 3300009177 Ga0105248_10043719 Ga0105248_100437196 267
320 3300011119 Ga0105246_10236687 Ga0105246_102366872 267
321 3300013306 Ga0163162_10006123 Ga0163162_100061235 267
322 3300013306 Ga0163162_10039944 Ga0163162_100399445 267
323 3300014325 Ga0163163_10009086 Ga0163163_100090862 267
324 3300014325 Ga0163163_10025012 Ga0163163_100250126 267
325 3300014325 Ga0163163_10429462 Ga0163163_104294622 267
326 3300014969 Ga0157376_10036976 Ga0157376_100369763 267
327 3300025910 Ga0207684_10049257 Ga0207684_100492571 267
328 3300025911 Ga0207654_10002697 Ga0207654_100026973 267
329 3300025918 Ga0207662_10163408 Ga0207662_101634082 267
330 3300025927 Ga0207687_10016926 Ga0207687_100169265 267
331 3300025938 Ga0207704_10277564 Ga0207704_102775641 267
332 3300025942 Ga0207689_10004054 Ga0207689_100040548 267
333 3300025942 Ga0207689_10014345 Ga0207689_100143456 267
334 3300025949 Ga0207667_10012816 Ga0207667_100128167 267
335 3300025960 Ga0207651_10448739 Ga0207651_104487392 267
336 3300026035 Ga0207703_10040489 Ga0207703_100404892 267
337 3300026088 Ga0207641_10173337 Ga0207641_101733372 267
338 3300026095 Ga0207676_10002507 Ga0207676_1000250711 267
339 3300028381 Ga0268264_10004034 Ga0268264_100040345 267
340 3300028381 Ga0268264_10206756 Ga0268264_102067561 267
341 3300031456 Ga0307513_10135603 Ga0307513_101356031 267
342 3300037471 Ga0395905_0135095 Ga0395905_0135095_1320_2222 267
343 3300042876 Ga0451577_0004291 Ga0451577_0004291_13919_14797 267
344 3300045051 Ga0451576_0047981 Ga0451576_0047981_33_911 267
345 3300045051 Ga0451576_0510312 Ga0451576_0510312_15_941 267
346 3300046539 Ga0495621_0014785 Ga0495621_0014785_316_1200 267
347 3300050511 nmdc:mga08y16_427976_c1 nmdc:mga08y16_427976_c1_461_1336 267
348 3300005338 Ga0068868_100055109 Ga0068868_1000551092 268
349 3300005340 Ga0070689_100021935 Ga0070689_1000219354 268
350 3300005347 Ga0070668_100016062 Ga0070668_1000160624 268
351 3300005353 Ga0070669_100005130 Ga0070669_1000051302 268
352 3300005445 Ga0070708_100309654 Ga0070708_1003096542 268
353 3300005468 Ga0070707_100077531 Ga0070707_1000775312 268
354 3300005471 Ga0070698_100012448 Ga0070698_10001244811 268
355 3300005536 Ga0070697_100000434 Ga0070697_1000004349 268
356 3300005617 Ga0068859_100392189 Ga0068859_1003921892 268
357 3300006173 Ga0070716_100294463 Ga0070716_1002944632 268
358 3300006852 Ga0075433_10053355 Ga0075433_100533552 268
359 3300006852 Ga0075433_10080661 Ga0075433_100806612 268
360 3300006871 Ga0075434_100075295 Ga0075434_1000752952 268
361 3300006931 Ga0097620_100392207 Ga0097620_1003922072 268
362 3300007076 Ga0075435_100492164 Ga0075435_1004921642 268
363 3300009147 Ga0114129_10257617 Ga0114129_102576173 268
364 3300009148 Ga0105243_10000344 Ga0105243_100003442 268
365 3300009553 Ga0105249_10000028 Ga0105249_10000028159 268
366 3300009553 Ga0105249_10010884 Ga0105249_100108845 268
367 3300010375 Ga0105239_10028211 Ga0105239_100282112 268
368 3300013297 Ga0157378_10000019 Ga0157378_1000001919 268
369 3300013297 Ga0157378_10073043 Ga0157378_100730432 268
370 3300013306 Ga0163162_10000019 Ga0163162_1000001956 268
371 3300013308 Ga0157375_10006370 Ga0157375_1000637010 268
372 3300021384 Ga0213876_10000179 Ga0213876_1000017935 268
373 3300021384 Ga0213876_10000326 Ga0213876_1000032640 268
374 3300025922 Ga0207646_10126429 Ga0207646_101264292 268
375 3300025923 Ga0207681_10000869 Ga0207681_1000086913 268
376 3300025925 Ga0207650_10009105 Ga0207650_100091055 268
377 3300025935 Ga0207709_10000498 Ga0207709_1000049815 268
378 3300025936 Ga0207670_10025949 Ga0207670_100259493 268
379 3300025940 Ga0207691_10297011 Ga0207691_102970111 268
380 3300025961 Ga0207712_10000068 Ga0207712_1000006847 268
381 3300025972 Ga0207668_10010416 Ga0207668_100104164 268
382 3300026023 Ga0207677_10054394 Ga0207677_100543942 268
383 3300026088 Ga0207641_10101447 Ga0207641_101014472 268
384 3300026118 Ga0207675_100002039 Ga0207675_10000203919 268
385 3300026142 Ga0207698_10158473 Ga0207698_101584732 268
386 3300028380 Ga0268265_10361295 Ga0268265_103612952 268
387 3300031649 Ga0307514_10136217 Ga0307514_101362172 268
388 3300031727 Ga0316576_10003780 Ga0316576_100037803 268
389 3300031728 Ga0316578_10001642 Ga0316578_100016424 268
390 3300035083 Ga0373926_0008228 Ga0373926_0008228_1181_2065 268
391 3300035086 Ga0373934_0039508 Ga0373934_0039508_482_1366 268
392 3300035170 Ga0373943_0021970 Ga0373943_0021970_691_1575 268
393 3300035695 Ga0373927_0025437 Ga0373927_0025437_1179_2063 268
394 3300035724 Ga0373933_0061395 Ga0373933_0061395_776_1660 268
395 3300035725 Ga0373947_0032854 Ga0373947_0032854_713_1597 268
396 3300036401 Ga0373937_0177187 Ga0373937_0177187_92_976 268
397 3300037068 Ga0373925_0117130 Ga0373925_0117130_979_1863 268
398 3300042435 Ga0439434_0029046 Ga0439434_0029046_432_1316 268
399 3300044673 Ga0453683_0010074 Ga0453683_0010074_688_1572 268
400 3300044712 Ga0453684_0258707 Ga0453684_0258707_342_1226 268
401 3300050507 nmdc:mga05p37_309777_c1 nmdc:mga05p37_309777_c1_706_1590 268
402 3300050512 nmdc:mga0n895_31225_c1 nmdc:mga0n895_31225_c1_121_1005 268
403 3300050515 nmdc:mga0a205_58416_c1 nmdc:mga0a205_58416_c1_2631_3515 268
404 3300050515 nmdc:mga0a205_65592_c1 nmdc:mga0a205_65592_c1_1570_2454 268
405 3300005365 Ga0070688_100064482 Ga0070688_1000644823 269
406 3300005937 Ga0081455_10032755 Ga0081455_100327554 269
407 3300006195 Ga0075366_10075139 Ga0075366_100751392 269
408 3300006871 Ga0075434_100542006 Ga0075434_1005420062 269
409 3300028556 Ga0265337_1003995 Ga0265337_10039951 269
410 3300028577 Ga0265318_10004680 Ga0265318_100046804 269
411 3300031240 Ga0265320_10001253 Ga0265320_1000125312 269
412 3300035111 Ga0373923_0026065 Ga0373923_0026065_724_1611 269
413 3300035118 Ga0373954_0026976 Ga0373954_0026976_1208_2095 269
414 3300035692 Ga0373935_0090812 Ga0373935_0090812_447_1334 269
415 3300035695 Ga0373927_0017296 Ga0373927_0017296_2171_3058 269
416 3300035724 Ga0373933_0025859 Ga0373933_0025859_944_1831 269
417 3300036401 Ga0373937_0065710 Ga0373937_0065710_808_1695 269
418 3300036401 Ga0373937_0335685 Ga0373937_0335685_484_1371 269
419 3300047320 Ga0495672_0190656 Ga0495672_0190656_104_988 269
420 3300050493 nmdc:mga0k408_52632_c1 nmdc:mga0k408_52632_c1_1247_2140 269
421 3300054114 Ga0501084_0153393 Ga0501084_0153393_103_975 269
422 3300005435 Ga0070714_100379687 Ga0070714_1003796871 270
423 3300005471 Ga0070698_100171560 Ga0070698_1001715602 270
424 3300009094 Ga0111539_10008045 Ga0111539_100080453 270
425 3300009551 Ga0105238_10211430 Ga0105238_102114302 270
426 3300025924 Ga0207694_10338743 Ga0207694_103387432 270
427 3300025929 Ga0207664_10315818 Ga0207664_103158181 270
428 3300025936 Ga0207670_10000001 Ga0207670_10000001415 270
429 3300027907 Ga0207428_10094881 Ga0207428_100948812 270
430 3300028577 Ga0265318_10000008 Ga0265318_10000008105 270
431 3300028577 Ga0265318_10000180 Ga0265318_100001803 270
432 3300028577 Ga0265318_10002167 Ga0265318_1000216711 270
433 3300028800 Ga0265338_10083512 Ga0265338_100835123 270
434 3300028800 Ga0265338_10163280 Ga0265338_101632803 270
435 3300031235 Ga0265330_10001004 Ga0265330_1000100412 270
436 3300031235 Ga0265330_10052710 Ga0265330_100527103 270
437 3300031238 Ga0265332_10000359 Ga0265332_100003595 270
438 3300031238 Ga0265332_10006786 Ga0265332_100067863 270
439 3300031239 Ga0265328_10006299 Ga0265328_100062994 270
440 3300031240 Ga0265320_10000132 Ga0265320_1000013230 270
441 3300031240 Ga0265320_10005602 Ga0265320_100056026 270
442 3300031241 Ga0265325_10001876 Ga0265325_100018766 270
443 3300031242 Ga0265329_10000642 Ga0265329_1000064215 270
444 3300031242 Ga0265329_10011713 Ga0265329_100117133 270
445 3300031247 Ga0265340_10008907 Ga0265340_100089075 270
446 3300031250 Ga0265331_10000004 Ga0265331_10000004105 270
447 3300031250 Ga0265331_10003038 Ga0265331_100030389 270
448 3300031344 Ga0265316_10003795 Ga0265316_100037953 270
449 3300031344 Ga0265316_10033762 Ga0265316_100337623 270
450 3300031344 Ga0265316_10066087 Ga0265316_100660872 270
451 3300031595 Ga0265313_10000005 Ga0265313_1000000551 270
452 3300031595 Ga0265313_10008560 Ga0265313_100085606 270
453 3300031595 Ga0265313_10025639 Ga0265313_100256392 270
454 3300031595 Ga0265313_10029971 Ga0265313_100299712 270
455 3300031595 Ga0265313_10059262 Ga0265313_100592623 270
456 3300031711 Ga0265314_10000014 Ga0265314_10000014322 270
457 3300031711 Ga0265314_10014645 Ga0265314_100146455 270
458 3300031712 Ga0265342_10002890 Ga0265342_1000289014 270
459 3300031712 Ga0265342_10014365 Ga0265342_100143655 270
460 3300044712 Ga0453684_0224507 Ga0453684_0224507_902_1792 270
461 3300046683 Ga0495658_0122049 Ga0495658_0122049_460_1353 270
462 3300049589 Ga0501073_0120872 Ga0501073_0120872_236_1129 270
463 3300049592 Ga0501076_0295909 Ga0501076_0295909_339_1232 270
464 3300049593 Ga0501077_0115271 Ga0501077_0115271_757_1653 270
465 3300049665 Ga0501227_043102 Ga0501227_043102_137_1021 270
466 3300050511 nmdc:mga08y16_49197_c1 nmdc:mga08y16_49197_c1_3395_4288 270
467 3300003320 rootH2_10071534 rootH2_1007153410 271
468 3300005337 Ga0070682_100000587 Ga0070682_10000058718 271
469 3300005338 Ga0068868_100343380 Ga0068868_1003433801 271
470 3300005440 Ga0070705_100102927 Ga0070705_1001029273 271
471 3300005441 Ga0070700_100178679 Ga0070700_1001786792 271
472 3300005445 Ga0070708_100108813 Ga0070708_1001088132 271
473 3300005455 Ga0070663_100010247 Ga0070663_1000102475 271
474 3300005545 Ga0070695_100089194 Ga0070695_1000891942 271
475 3300005841 Ga0068863_100147631 Ga0068863_1001476313 271
476 3300014325 Ga0163163_10221479 Ga0163163_102214792 271
477 3300026023 Ga0207677_10314959 Ga0207677_103149591 271
478 3300026067 Ga0207678_10021083 Ga0207678_100210835 271
479 3300026075 Ga0207708_10196029 Ga0207708_101960292 271
480 3300026118 Ga0207675_100294967 Ga0207675_1002949672 271
481 3300039093 Ga0400489_45403 Ga0400489_45403_380_1288 271
482 3300044712 Ga0453684_0297024 Ga0453684_0297024_233_1117 271
483 3300028573 Ga0265334_10001475 Ga0265334_100014759 272
484 3300031250 Ga0265331_10060813 Ga0265331_100608132 272
485 3300049571 Ga0501034_0132934 Ga0501034_0132934_1159_2058 272
486 3300049583 Ga0501067_0029041 Ga0501067_0029041_20_922 273
487 3300025939 Ga0207665_10363270 Ga0207665_103632702 274
488 3300046616 Ga0495668_0063726 Ga0495668_0063726_17_892 274
489 3300005530 Ga0070679_100011324 Ga0070679_1000113244 275
490 3300005563 Ga0068855_100246781 Ga0068855_1002467811 275
491 3300005617 Ga0068859_100267383 Ga0068859_1002673832 275
492 3300006931 Ga0097620_100267377 Ga0097620_1002673772 275
493 3300025921 Ga0207652_10019300 Ga0207652_100193002 275
494 3300026041 Ga0207639_10002838 Ga0207639_100028384 275
495 3300026078 Ga0207702_10131695 Ga0207702_101316952 275
496 3300026118 Ga0207675_100451145 Ga0207675_1004511451 275
497 3300026142 Ga0207698_10125377 Ga0207698_101253772 275
498 3300029957 Ga0265324_10002968 Ga0265324_100029682 276
499 3300031239 Ga0265328_10014019 Ga0265328_100140192 276
500 3300031250 Ga0265331_10000107 Ga0265331_1000010752 276
501 3300031616 Ga0307508_10015699 Ga0307508_100156997 276
502 3300039093 Ga0400489_56002 Ga0400489_56002_1173_2045 277
503 3300044712 Ga0453684_0000020 Ga0453684_0000020_64940_65815 277
504 3300036712 Ga0316584_0317498 Ga0316584_0317498_188_1060 279
505 3300038735 Ga0400485_18933 Ga0400485_18933_1220_2089 280
506 3300038741 Ga0400488_45668 Ga0400488_45668_3207_4076 280
507 3300038742 Ga0400486_27561 Ga0400486_27561_85777_86646 280
508 3300039110 Ga0400487_07588 Ga0400487_07588_923_1795 280
509 3300039110 Ga0400487_44815 Ga0400487_44815_1165_2034 280
510 3300003791 Ga0055530_10015453 Ga0055530_100154532 281
511 3300025298 Ga0209050_1000297 Ga0209050_100029711 281
512 3300005340 Ga0070689_100009616 Ga0070689_1000096162 282
513 3300005354 Ga0070675_100044859 Ga0070675_1000448595 282
514 3300025315 Ga0207697_10030323 Ga0207697_100303231 282
515 3300025912 Ga0207707_10539476 Ga0207707_105394761 282
516 3300025936 Ga0207670_10031775 Ga0207670_100317752 282
517 3300031727 Ga0316576_10050002 Ga0316576_100500024 282
518 3300037471 Ga0395905_0374596 Ga0395905_0374596_286_1170 282
519 3300045051 Ga0451576_0794048 Ga0451576_0794048_97_981 282
520 3300049581 Ga0501047_0107839 Ga0501047_0107839_1407_2282 282
521 3300005347 Ga0070668_100093761 Ga0070668_1000937613 283
522 3300005354 Ga0070675_100113725 Ga0070675_1001137252 283
523 3300005295 Ga0065707_10102852 Ga0065707_101028522 284
524 3300005548 Ga0070665_100099176 Ga0070665_1000991764 284
525 3300005563 Ga0068855_100620805 Ga0068855_1006208052 284
526 3300028379 Ga0268266_10043315 Ga0268266_100433153 284
527 3300006844 Ga0075428_100439281 Ga0075428_1004392812 285
528 3300031727 Ga0316576_10001523 Ga0316576_100015234 285
529 3300031728 Ga0316578_10011873 Ga0316578_100118733 285
530 3300031733 Ga0316577_10006633 Ga0316577_100066336 285
531 3300033541 Ga0316596_1007623 Ga0316596_10076232 285
532 3300036712 Ga0316584_0010384 Ga0316584_0010384_2794_3693 285
533 3300042876 Ga0451577_0000062 Ga0451577_0000062_78240_79109 285
534 3300042876 Ga0451577_0001729 Ga0451577_0001729_960_1832 285
535 3300042876 Ga0451577_0007527 Ga0451577_0007527_4484_5356 285
536 3300044712 Ga0453684_0000258 Ga0453684_0000258_15813_16685 285
537 3300044712 Ga0453684_0000877 Ga0453684_0000877_21475_22344 285
538 3300045051 Ga0451576_0004827 Ga0451576_0004827_13613_14485 285
539 3300045051 Ga0451576_0255481 Ga0451576_0255481_578_1450 285
540 iso_pu_bacteria 2786546517 2787436936 285
541 3300025918 Ga0207662_10051473 Ga0207662_100514733 286
542 3300025922 Ga0207646_10133720 Ga0207646_101337202 286
543 3300026023 Ga0207677_10240669 Ga0207677_102406692 286
544 3300026078 Ga0207702_10353794 Ga0207702_103537942 286
545 3300031889 Ga0326468_10003958 Ga0326468_100039582 286
546 3300042876 Ga0451577_0001358 Ga0451577_0001358_6927_7805 286
547 3300044673 Ga0453683_0000571 Ga0453683_0000571_17086_17967 286
548 3300044673 Ga0453683_0002186 Ga0453683_0002186_1148_2023 286
549 3300044673 Ga0453683_0140089 Ga0453683_0140089_340_1212 286
550 3300044712 Ga0453684_0000749 Ga0453684_0000749_95882_96760 286
551 3300045051 Ga0451576_0051337 Ga0451576_0051337_1191_2069 286
552 3300048912 Ga0496109_0417315 Ga0496109_0417315_339_1250 286
553 3300048913 Ga0496110_0449973 Ga0496110_0449973_68_979 286
554 iso_pu_bacteria 2706794495 2707099817 286
555 iso_pu_bacteria 2791354903 2791923225 286
556 iso_pu_bacteria 2854601825 2854604562 286
557 3300005340 Ga0070689_100092466 Ga0070689_1000924662 287
558 3300005468 Ga0070707_100342260 Ga0070707_1003422602 287
559 3300005844 Ga0068862_100040100 Ga0068862_1000401005 287
560 3300009545 Ga0105237_10134185 Ga0105237_101341852 287
561 3300025914 Ga0207671_10055990 Ga0207671_100559902 287
562 3300028380 Ga0268265_10076684 Ga0268265_100766842 287
563 3300037068 Ga0373925_0362394 Ga0373925_0362394_185_1057 287
564 3300050508 nmdc:mga09592_282174_c1 nmdc:mga09592_282174_c1_91_966 287
565 3300026118 Ga0207675_100090879 Ga0207675_1000908793 288
566 3300042876 Ga0451577_0513264 Ga0451577_0513264_125_997 288
567 3300044712 Ga0453684_0703623 Ga0453684_0703623_159_1031 288
568 3300050489 nmdc:mga03683_2331_c1 nmdc:mga03683_2331_c1_4910_5776 288
569 3300050490 nmdc:mga03n38_66521_c1 nmdc:mga03n38_66521_c1_256_1122 288
570 3300050493 nmdc:mga0k408_2689_c1 nmdc:mga0k408_2689_c1_4161_5027 288
571 3300050496 nmdc:mga07m45_552_c1 nmdc:mga07m45_552_c1_5245_6111 288
572 3300053086 Ga0500578_0177322 Ga0500578_0177322_339_1205 288
573 3300053103 Ga0500555_000321 Ga0500555_000321_6175_7041 288
574 3300053104 Ga0500556_0000370 Ga0500556_0000370_8754_9620 288
575 3300053130 Ga0500642_0006150 Ga0500642_0006150_1749_2615 288
576 3300005445 Ga0070708_100002874 Ga0070708_1000028746 289
577 3300005445 Ga0070708_100609100 Ga0070708_1006091001 289
578 3300005458 Ga0070681_10106650 Ga0070681_101066502 289
579 3300005467 Ga0070706_100195373 Ga0070706_1001953732 289
580 3300005468 Ga0070707_100012475 Ga0070707_1000124756 289
581 3300005468 Ga0070707_100197402 Ga0070707_1001974022 289
582 3300005471 Ga0070698_100122724 Ga0070698_1001227243 289
583 3300009011 Ga0105251_10014266 Ga0105251_100142663 289
584 3300009036 Ga0105244_10005357 Ga0105244_100053573 289
585 3300009092 Ga0105250_10000409 Ga0105250_100004093 289
586 3300009094 Ga0111539_10005064 Ga0111539_1000506412 289
587 3300009148 Ga0105243_10034846 Ga0105243_100348462 289
588 3300025711 Ga0207696_1000059 Ga0207696_100005927 289
589 3300025728 Ga0207655_1004852 Ga0207655_10048522 289
590 3300025735 Ga0207713_1000005 Ga0207713_1000005134 289
591 3300025922 Ga0207646_10491209 Ga0207646_104912091 289
592 3300025935 Ga0207709_10012460 Ga0207709_100124602 289
593 3300027907 Ga0207428_10004079 Ga0207428_1000407912 289
594 3300031691 Ga0316579_10052553 Ga0316579_100525532 289
595 3300031727 Ga0316576_10009486 Ga0316576_100094868 289
596 3300031728 Ga0316578_10034042 Ga0316578_100340422 289
597 3300032133 Ga0316583_10009740 Ga0316583_100097402 289
598 3300035398 Ga0316574_0000893 Ga0316574_0000893_9851_10720 289
599 3300035398 Ga0316574_0003767 Ga0316574_0003767_5386_6258 289
600 3300035398 Ga0316574_0013618 Ga0316574_0013618_1657_2526 289
601 3300035398 Ga0316574_0174634 Ga0316574_0174634_69_938 289
602 3300036647 Ga0316582_0049380 Ga0316582_0049380_641_1510 289
603 3300036647 Ga0316582_0049512 Ga0316582_0049512_472_1341 289
604 3300036712 Ga0316584_0149609 Ga0316584_0149609_506_1375 289
605 3300036712 Ga0316584_0169645 Ga0316584_0169645_358_1230 289
606 3300038726 Ga0400490_39170 Ga0400490_39170_12344_13219 289
607 3300049571 Ga0501034_0033027 Ga0501034_0033027_3048_3917 289
608 3300049574 Ga0501038_0073618 Ga0501038_0073618_1939_2808 289
609 3300050511 nmdc:mga08y16_2819_c1 nmdc:mga08y16_2819_c1_7282_8163 289
610 3300050512 nmdc:mga0n895_176338_c1 nmdc:mga0n895_176338_c1_241_1122 289
611 3300005439 Ga0070711_100000573 Ga0070711_10000057320 290
612 3300005841 Ga0068863_100030593 Ga0068863_1000305933 290
613 3300006358 Ga0068871_100034330 Ga0068871_1000343305 290
614 3300006844 Ga0075428_100000046 Ga0075428_10000004679 290
615 3300006880 Ga0075429_100041851 Ga0075429_1000418515 290
616 3300006880 Ga0075429_100111008 Ga0075429_1001110082 290
617 3300009098 Ga0105245_10793981 Ga0105245_107939811 290
618 3300025936 Ga0207670_10311049 Ga0207670_103110492 290
619 3300028556 Ga0265337_1035432 Ga0265337_10354321 290
620 3300028800 Ga0265338_10011598 Ga0265338_1001159810 290
621 3300031456 Ga0307513_10072931 Ga0307513_100729312 290
622 3300031665 Ga0316575_10015656 Ga0316575_100156562 290
623 3300031665 Ga0316575_10039769 Ga0316575_100397692 290
624 3300031727 Ga0316576_10005532 Ga0316576_100055323 290
625 3300031727 Ga0316576_10037418 Ga0316576_100374184 290
626 3300031727 Ga0316576_10111352 Ga0316576_101113521 290
627 3300031727 Ga0316576_10124977 Ga0316576_101249772 290
628 3300031728 Ga0316578_10000298 Ga0316578_1000029813 290
629 3300031728 Ga0316578_10003723 Ga0316578_100037236 290
630 3300031728 Ga0316578_10003753 Ga0316578_100037534 290
631 3300031728 Ga0316578_10061058 Ga0316578_100610582 290
632 3300031733 Ga0316577_10003314 Ga0316577_100033147 290
633 3300031733 Ga0316577_10052834 Ga0316577_100528342 290
634 3300032133 Ga0316583_10000505 Ga0316583_100005054 290
635 3300032137 Ga0316585_10045646 Ga0316585_100456462 290
636 3300032139 Ga0316580_10000153 Ga0316580_100001535 290
637 3300032168 Ga0316593_10000959 Ga0316593_100009596 290
638 3300032168 Ga0316593_10003375 Ga0316593_100033752 290
639 3300033524 Ga0316592_1000668 Ga0316592_10006685 290
640 3300033524 Ga0316592_1000957 Ga0316592_10009572 290
641 3300033528 Ga0316588_1000091 Ga0316588_10000913 290
642 3300033528 Ga0316588_1000365 Ga0316588_10003653 290
643 3300033529 Ga0316587_1004347 Ga0316587_10043471 290
644 3300033541 Ga0316596_1000506 Ga0316596_10005062 290
645 3300035398 Ga0316574_0004153 Ga0316574_0004153_4877_5749 290
646 3300035398 Ga0316574_0005203 Ga0316574_0005203_5842_6714 290
647 3300035398 Ga0316574_0054821 Ga0316574_0054821_424_1296 290
648 3300035398 Ga0316574_0060801 Ga0316574_0060801_131_1003 290
649 3300035398 Ga0316574_0078769 Ga0316574_0078769_1170_2045 290
650 3300036647 Ga0316582_0001897 Ga0316582_0001897_3254_4126 290
651 3300036647 Ga0316582_0014120 Ga0316582_0014120_2490_3362 290
652 3300036647 Ga0316582_0076514 Ga0316582_0076514_1085_1960 290
653 3300036712 Ga0316584_0001074 Ga0316584_0001074_11450_12322 290
654 3300036712 Ga0316584_0006706 Ga0316584_0006706_5281_6153 290
655 3300038741 Ga0400488_52774 Ga0400488_52774_302_1174 290
656 3300039437 Ga0436365_1447325 Ga0436365_1447325_1529_2437 290
657 3300042876 Ga0451577_0024870 Ga0451577_0024870_1032_1904 290
658 3300042876 Ga0451577_0124316 Ga0451577_0124316_242_1114 290
659 3300044712 Ga0453684_0137697 Ga0453684_0137697_1544_2419 290
660 3300044712 Ga0453684_0252304 Ga0453684_0252304_944_1816 290
661 3300046683 Ga0495658_0093790 Ga0495658_0093790_290_1165 290
662 3300050508 nmdc:mga09592_49210_c1 nmdc:mga09592_49210_c1_2417_3301 290
663 3300050508 nmdc:mga09592_516992_c1 nmdc:mga09592_516992_c1_44_919 290
664 3300050508 nmdc:mga09592_7872_c1 nmdc:mga09592_7872_c1_892_1776 290
665 3300050508 nmdc:mga09592_82183_c1 nmdc:mga09592_82183_c1_417_1301 290
666 3300053103 Ga0500555_000025 Ga0500555_000025_80870_81742 290
667 3300053153 Ga0500616_0005952 Ga0500616_0005952_6293_7165 290
668 3300003203 JGI25406J46586_10017169 JGI25406J46586_100171694 291
669 3300005340 Ga0070689_100169064 Ga0070689_1001690641 291
670 3300005366 Ga0070659_100515195 Ga0070659_1005151951 291
671 3300005435 Ga0070714_100162250 Ga0070714_1001622503 291
672 3300005445 Ga0070708_100131073 Ga0070708_1001310732 291
673 3300005445 Ga0070708_100143829 Ga0070708_1001438291 291
674 3300005459 Ga0068867_100377956 Ga0068867_1003779561 291
675 3300005467 Ga0070706_100000324 Ga0070706_10000032455 291
676 3300005467 Ga0070706_100045174 Ga0070706_1000451744 291
677 3300005467 Ga0070706_100112232 Ga0070706_1001122321 291
678 3300005467 Ga0070706_100216245 Ga0070706_1002162453 291
679 3300005468 Ga0070707_100000410 Ga0070707_10000041029 291
680 3300005468 Ga0070707_100010272 Ga0070707_1000102728 291
681 3300005471 Ga0070698_100010399 Ga0070698_1000103998 291
682 3300005471 Ga0070698_100048959 Ga0070698_1000489593 291
683 3300005471 Ga0070698_100085466 Ga0070698_1000854664 291
684 3300005518 Ga0070699_100136302 Ga0070699_1001363023 291
685 3300005536 Ga0070697_100009541 Ga0070697_1000095412 291
686 3300005536 Ga0070697_100022676 Ga0070697_1000226764 291
687 3300005543 Ga0070672_100080599 Ga0070672_1000805992 291
688 3300005546 Ga0070696_100422675 Ga0070696_1004226752 291
689 3300005548 Ga0070665_100072418 Ga0070665_1000724183 291
690 3300005548 Ga0070665_100228242 Ga0070665_1002282422 291
691 3300005578 Ga0068854_100189738 Ga0068854_1001897382 291
692 3300005985 Ga0081539_10002025 Ga0081539_1000202522 291
693 3300005985 Ga0081539_10068826 Ga0081539_100688264 291
694 3300006028 Ga0070717_10018213 Ga0070717_100182133 291
695 3300006028 Ga0070717_10292274 Ga0070717_102922742 291
696 3300006177 Ga0075362_10000964 Ga0075362_100009648 291
697 3300006195 Ga0075366_10008847 Ga0075366_100088472 291
698 3300006353 Ga0075370_10000297 Ga0075370_1000029720 291
699 3300009098 Ga0105245_10025480 Ga0105245_100254804 291
700 3300013297 Ga0157378_10429427 Ga0157378_104294272 291
701 3300017792 Ga0163161_10005272 Ga0163161_100052724 291
702 3300021384 Ga0213876_10000705 Ga0213876_100007056 291
703 3300025315 Ga0207697_10000183 Ga0207697_1000018323 291
704 3300025901 Ga0207688_10000989 Ga0207688_100009898 291
705 3300025907 Ga0207645_10003527 Ga0207645_100035278 291
706 3300025910 Ga0207684_10000390 Ga0207684_100003908 291
707 3300025910 Ga0207684_10043327 Ga0207684_100433272 291
708 3300025910 Ga0207684_10333597 Ga0207684_103335972 291
709 3300025915 Ga0207693_10073155 Ga0207693_100731553 291
710 3300025919 Ga0207657_10175648 Ga0207657_101756482 291
711 3300025922 Ga0207646_10000108 Ga0207646_1000010848 291
712 3300025922 Ga0207646_10001029 Ga0207646_1000102930 291
713 3300025922 Ga0207646_10378417 Ga0207646_103784172 291
714 3300025922 Ga0207646_10517696 Ga0207646_105176961 291
715 3300025928 Ga0207700_10175861 Ga0207700_101758611 291
716 3300025929 Ga0207664_10141640 Ga0207664_101416403 291
717 3300025931 Ga0207644_10074328 Ga0207644_100743282 291
718 3300025933 Ga0207706_10038016 Ga0207706_100380163 291
719 3300025937 Ga0207669_10036787 Ga0207669_100367875 291
720 3300025940 Ga0207691_10045704 Ga0207691_100457043 291
721 3300026089 Ga0207648_10033690 Ga0207648_100336902 291
722 3300027717 Ga0209998_10007442 Ga0209998_100074422 291
723 3300028379 Ga0268266_10072831 Ga0268266_100728313 291
724 3300028379 Ga0268266_10121817 Ga0268266_101218173 291
725 3300031344 Ga0265316_10068740 Ga0265316_100687402 291
726 3300031665 Ga0316575_10024897 Ga0316575_100248972 291
727 3300031691 Ga0316579_10005547 Ga0316579_100055475 291
728 3300031733 Ga0316577_10074495 Ga0316577_100744952 291
729 3300032139 Ga0316580_10004207 Ga0316580_100042072 291
730 3300032139 Ga0316580_10044053 Ga0316580_100440532 291
731 3300035170 Ga0373943_0164165 Ga0373943_0164165_304_1179 291
732 3300035398 Ga0316574_0138411 Ga0316574_0138411_259_1134 291
733 3300036647 Ga0316582_0012384 Ga0316582_0012384_1918_2793 291
734 3300037588 Ga0316581_0012938 Ga0316581_0012938_1254_2129 291
735 3300039437 Ga0436365_0655171 Ga0436365_0655171_13903_14778 291
736 3300039437 Ga0436365_0832581 Ga0436365_0832581_207_1082 291
737 3300039453 Ga0436362_0838041 Ga0436362_0838041_70_945 291
738 3300042876 Ga0451577_0001080 Ga0451577_0001080_33020_33898 291
739 3300048905 Ga0496102_0020269 Ga0496102_0020269_31_906 291
740 3300048906 Ga0496103_0065336 Ga0496103_0065336_1209_2138 291
741 3300048909 Ga0496106_0323222 Ga0496106_0323222_160_1035 291
742 3300048911 Ga0496108_0159356 Ga0496108_0159356_778_1707 291
743 3300048913 Ga0496110_0250574 Ga0496110_0250574_532_1461 291
744 3300049589 Ga0501073_0219710 Ga0501073_0219710_54_965 291
745 3300050493 nmdc:mga0k408_297_c1 nmdc:mga0k408_297_c1_9219_10094 291
746 3300050514 nmdc:mga08x19_39022_c1 nmdc:mga08x19_39022_c1_950_1948 291
747 3300005330 Ga0070690_100043845 Ga0070690_1000438452 292
748 3300005338 Ga0068868_100030702 Ga0068868_1000307024 292
749 3300005338 Ga0068868_100237746 Ga0068868_1002377462 292
750 3300005339 Ga0070660_100186000 Ga0070660_1001860002 292
751 3300005340 Ga0070689_100173684 Ga0070689_1001736841 292
752 3300005353 Ga0070669_100071535 Ga0070669_1000715353 292
753 3300005353 Ga0070669_100150138 Ga0070669_1001501381 292
754 3300005354 Ga0070675_100027122 Ga0070675_1000271225 292
755 3300005354 Ga0070675_100153054 Ga0070675_1001530542 292
756 3300005355 Ga0070671_100183767 Ga0070671_1001837672 292
757 3300005356 Ga0070674_100046801 Ga0070674_1000468012 292
758 3300005406 Ga0070703_10013403 Ga0070703_100134032 292
759 3300005438 Ga0070701_10014396 Ga0070701_100143962 292
760 3300005439 Ga0070711_100011584 Ga0070711_1000115841 292
761 3300005441 Ga0070700_100327379 Ga0070700_1003273791 292
762 3300005456 Ga0070678_100230187 Ga0070678_1002301872 292
763 3300005467 Ga0070706_100005770 Ga0070706_10000577010 292
764 3300005467 Ga0070706_100047206 Ga0070706_1000472061 292
765 3300005468 Ga0070707_100043311 Ga0070707_1000433112 292
766 3300005535 Ga0070684_100106316 Ga0070684_1001063162 292
767 3300005543 Ga0070672_100065252 Ga0070672_1000652523 292
768 3300005544 Ga0070686_100036953 Ga0070686_1000369533 292
769 3300005545 Ga0070695_100073291 Ga0070695_1000732912 292
770 3300005546 Ga0070696_100034477 Ga0070696_1000344774 292
771 3300005547 Ga0070693_100032890 Ga0070693_1000328903 292
772 3300005614 Ga0068856_100148366 Ga0068856_1001483662 292
773 3300005615 Ga0070702_100036426 Ga0070702_1000364261 292
774 3300005618 Ga0068864_100017314 Ga0068864_1000173145 292
775 3300005718 Ga0068866_10031102 Ga0068866_100311022 292
776 3300005719 Ga0068861_100158919 Ga0068861_1001589192 292
777 3300005840 Ga0068870_10035367 Ga0068870_100353672 292
778 3300005841 Ga0068863_100146048 Ga0068863_1001460482 292
779 3300005842 Ga0068858_100062964 Ga0068858_1000629642 292
780 3300005844 Ga0068862_100478769 Ga0068862_1004787691 292
781 3300005937 Ga0081455_10031049 Ga0081455_100310494 292
782 3300006163 Ga0070715_10000601 Ga0070715_100006015 292
783 3300006173 Ga0070716_100240270 Ga0070716_1002402701 292
784 3300006237 Ga0097621_100030540 Ga0097621_1000305404 292
785 3300006358 Ga0068871_100012233 Ga0068871_1000122334 292
786 3300006844 Ga0075428_100087688 Ga0075428_1000876882 292
787 3300006880 Ga0075429_100134230 Ga0075429_1001342302 292
788 3300006881 Ga0068865_100202506 Ga0068865_1002025061 292
789 3300006881 Ga0068865_100442236 Ga0068865_1004422361 292
790 3300009094 Ga0111539_10585435 Ga0111539_105854352 292
791 3300009098 Ga0105245_10149933 Ga0105245_101499332 292
792 3300009098 Ga0105245_10376039 Ga0105245_103760392 292
793 3300009098 Ga0105245_10509986 Ga0105245_105099862 292
794 3300009148 Ga0105243_10014385 Ga0105243_100143854 292
795 3300009176 Ga0105242_10004323 Ga0105242_100043238 292
796 3300009177 Ga0105248_10046511 Ga0105248_100465112 292
797 3300013296 Ga0157374_10010403 Ga0157374_100104032 292
798 3300013297 Ga0157378_10005123 Ga0157378_100051235 292
799 3300013307 Ga0157372_10031112 Ga0157372_100311125 292
800 3300013307 Ga0157372_10779115 Ga0157372_107791151 292
801 3300013308 Ga0157375_10016243 Ga0157375_100162435 292
802 3300014325 Ga0163163_10161349 Ga0163163_101613492 292
803 3300014968 Ga0157379_10025219 Ga0157379_100252194 292
804 3300014969 Ga0157376_10228058 Ga0157376_102280582 292
805 3300025885 Ga0207653_10004697 Ga0207653_100046972 292
806 3300025898 Ga0207692_10128404 Ga0207692_101284041 292
807 3300025901 Ga0207688_10009622 Ga0207688_100096222 292
808 3300025905 Ga0207685_10008319 Ga0207685_100083193 292
809 3300025907 Ga0207645_10012070 Ga0207645_100120704 292
810 3300025907 Ga0207645_10145131 Ga0207645_101451313 292
811 3300025908 Ga0207643_10025758 Ga0207643_100257582 292
812 3300025910 Ga0207684_10031901 Ga0207684_100319014 292
813 3300025910 Ga0207684_10226564 Ga0207684_102265642 292
814 3300025915 Ga0207693_10000233 Ga0207693_1000023324 292
815 3300025916 Ga0207663_10007610 Ga0207663_100076102 292
816 3300025918 Ga0207662_10006099 Ga0207662_100060995 292
817 3300025918 Ga0207662_10193636 Ga0207662_101936362 292
818 3300025919 Ga0207657_10202437 Ga0207657_102024372 292
819 3300025922 Ga0207646_10099621 Ga0207646_100996213 292
820 3300025923 Ga0207681_10252861 Ga0207681_102528611 292
821 3300025927 Ga0207687_10068428 Ga0207687_100684282 292
822 3300025931 Ga0207644_10054681 Ga0207644_100546812 292
823 3300025932 Ga0207690_10165910 Ga0207690_101659102 292
824 3300025933 Ga0207706_10049764 Ga0207706_100497642 292
825 3300025933 Ga0207706_10075973 Ga0207706_100759734 292
826 3300025934 Ga0207686_10074687 Ga0207686_100746872 292
827 3300025935 Ga0207709_10097564 Ga0207709_100975642 292
828 3300025937 Ga0207669_10024183 Ga0207669_100241833 292
829 3300025938 Ga0207704_10036901 Ga0207704_100369011 292
830 3300025939 Ga0207665_10124202 Ga0207665_101242021 292
831 3300025940 Ga0207691_10048715 Ga0207691_100487152 292
832 3300025941 Ga0207711_10005862 Ga0207711_100058624 292
833 3300025942 Ga0207689_10088601 Ga0207689_100886013 292
834 3300025972 Ga0207668_10233407 Ga0207668_102334073 292
835 3300025981 Ga0207640_10101151 Ga0207640_101011512 292
836 3300026023 Ga0207677_10019794 Ga0207677_100197944 292
837 3300026035 Ga0207703_10048763 Ga0207703_100487633 292
838 3300026075 Ga0207708_10011859 Ga0207708_100118594 292
839 3300026075 Ga0207708_10022189 Ga0207708_100221892 292
840 3300026075 Ga0207708_10111039 Ga0207708_101110392 292
841 3300026088 Ga0207641_10160793 Ga0207641_101607932 292
842 3300026089 Ga0207648_10069294 Ga0207648_100692942 292
843 3300026095 Ga0207676_10093014 Ga0207676_100930142 292
844 3300026118 Ga0207675_100007403 Ga0207675_1000074033 292
845 3300026121 Ga0207683_10031317 Ga0207683_100313172 292
846 3300028380 Ga0268265_10173869 Ga0268265_101738692 292
847 3300028380 Ga0268265_10202348 Ga0268265_102023482 292
848 3300031240 Ga0265320_10066480 Ga0265320_100664802 292
849 3300031595 Ga0265313_10075513 Ga0265313_100755132 292
850 3300035083 Ga0373926_0003662 Ga0373926_0003662_818_1717 292
851 3300035089 Ga0373944_0000300 Ga0373944_0000300_1741_2640 292
852 3300035111 Ga0373923_0007689 Ga0373923_0007689_2882_3781 292
853 3300035113 Ga0373936_0001801 Ga0373936_0001801_3496_4395 292
854 3300035116 Ga0373945_0001062 Ga0373945_0001062_3638_4537 292
855 3300035170 Ga0373943_0009602 Ga0373943_0009602_2297_3196 292
856 3300035171 Ga0373946_0004684 Ga0373946_0004684_2111_3010 292
857 3300035695 Ga0373927_0072817 Ga0373927_0072817_1142_2041 292
858 3300042876 Ga0451577_0010592 Ga0451577_0010592_3082_3963 292
859 3300042876 Ga0451577_0043273 Ga0451577_0043273_1415_2302 292
860 3300042876 Ga0451577_0095906 Ga0451577_0095906_1331_2221 292
861 3300044712 Ga0453684_0006977 Ga0453684_0006977_9028_9915 292
862 3300045051 Ga0451576_0038233 Ga0451576_0038233_1277_2164 292
863 3300045051 Ga0451576_0633530 Ga0451576_0633530_99_989 292
864 3300046455 Ga0495603_0015230 Ga0495603_0015230_1816_2715 292
865 3300046459 Ga0495629_0036726 Ga0495629_0036726_2425_3324 292
866 3300046461 Ga0495641_0026565 Ga0495641_0026565_1832_2731 292
867 3300046473 Ga0495582_0010834 Ga0495582_0010834_1699_2598 292
868 3300046475 Ga0495639_0001643 Ga0495639_0001643_5529_6428 292
869 3300046475 Ga0495639_0019588 Ga0495639_0019588_215_1114 292
870 3300046476 Ga0495662_0006174 Ga0495662_0006174_3950_4849 292
871 3300046492 Ga0495585_0010471 Ga0495585_0010471_1020_1919 292
872 3300046517 Ga0495630_0004915 Ga0495630_0004915_2177_3076 292
873 3300046522 Ga0495643_0000208 Ga0495643_0000208_8820_9734 292
874 3300046526 Ga0495666_0009535 Ga0495666_0009535_817_1716 292
875 3300046531 Ga0495665_0007185 Ga0495665_0007185_290_1189 292
876 3300046531 Ga0495665_0010876 Ga0495665_0010876_1846_2745 292
877 3300046533 Ga0495640_0014561 Ga0495640_0014561_2211_3110 292
878 3300046535 Ga0495586_0003922 Ga0495586_0003922_6912_7811 292
879 3300046559 Ga0495667_0094114 Ga0495667_0094114_289_1188 292
880 3300046615 Ga0495656_0002008 Ga0495656_0002008_4709_5608 292
881 3300046615 Ga0495656_0036890 Ga0495656_0036890_263_1168 292
882 3300046663 Ga0495635_0004445 Ga0495635_0004445_3820_4719 292
883 3300046674 Ga0495588_0000461 Ga0495588_0000461_16631_17530 292
884 3300046681 Ga0495647_0007010 Ga0495647_0007010_560_1459 292
885 3300046683 Ga0495658_0000868 Ga0495658_0000868_132_1031 292
886 3300046683 Ga0495658_0315602 Ga0495658_0315602_24_923 292
887 3300046689 Ga0495613_0007750 Ga0495613_0007750_132_1031 292
888 3300046689 Ga0495613_0143610 Ga0495613_0143610_43_942 292
889 3300046690 Ga0495624_0006404 Ga0495624_0006404_5637_6536 292
890 3300046691 Ga0495670_0017881 Ga0495670_0017881_1957_2856 292
891 3300046809 Ga0495600_0276939 Ga0495600_0276939_142_1041 292
892 3300047315 Ga0495581_0002010 Ga0495581_0002010_6306_7205 292
893 3300047315 Ga0495581_0032140 Ga0495581_0032140_1301_2200 292
894 3300047319 Ga0495674_0011893 Ga0495674_0011893_5747_6646 292
895 3300047322 Ga0495680_0010498 Ga0495680_0010498_2425_3324 292
896 3300048903 Ga0496100_0010082 Ga0496100_0010082_1323_2222 292
897 3300048904 Ga0496101_0011665 Ga0496101_0011665_3839_4738 292
898 3300048906 Ga0496103_0022958 Ga0496103_0022958_2209_3108 292
899 3300048907 Ga0496104_0185538 Ga0496104_0185538_320_1219 292
900 3300048909 Ga0496106_0024207 Ga0496106_0024207_2797_3696 292
901 3300048910 Ga0496107_0004978 Ga0496107_0004978_5504_6403 292
902 3300048911 Ga0496108_0013859 Ga0496108_0013859_3207_4106 292
903 3300048912 Ga0496109_0007664 Ga0496109_0007664_1180_2079 292
904 3300048912 Ga0496109_0022989 Ga0496109_0022989_2904_3803 292
905 3300048913 Ga0496110_0003658 Ga0496110_0003658_1379_2278 292
906 3300048914 Ga0496111_0004083 Ga0496111_0004083_7066_7965 292
907 3300048915 Ga0496112_0122475 Ga0496112_0122475_1134_2033 292
908 3300048916 Ga0496113_0039232 Ga0496113_0039232_2079_2978 292
909 3300048917 Ga0496114_0031652 Ga0496114_0031652_2268_3167 292
910 3300049570 Ga0501033_0087604 Ga0501033_0087604_618_1568 292
911 3300049572 Ga0501036_0003125 Ga0501036_0003125_6897_7847 292
912 3300049572 Ga0501036_0051739 Ga0501036_0051739_1243_2193 292
913 3300049573 Ga0501037_0072433 Ga0501037_0072433_1076_2026 292
914 3300049575 Ga0501039_0049609 Ga0501039_0049609_194_1144 292
915 3300049576 Ga0501040_0049075 Ga0501040_0049075_326_1276 292
916 3300049577 Ga0501041_0129563 Ga0501041_0129563_295_1275 292
917 3300049578 Ga0501042_0035799 Ga0501042_0035799_799_1749 292
918 3300049580 Ga0501046_0030490 Ga0501046_0030490_2573_3523 292
919 3300049582 Ga0501048_0006833 Ga0501048_0006833_187_1137 292
920 3300049587 Ga0501071_0006225 Ga0501071_0006225_309_1259 292
921 3300049588 Ga0501072_0019250 Ga0501072_0019250_3066_4016 292
922 3300049590 Ga0501074_0067954 Ga0501074_0067954_1193_2143 292
923 3300049591 Ga0501075_0007763 Ga0501075_0007763_5655_6605 292
924 3300049593 Ga0501077_0067672 Ga0501077_0067672_1005_1955 292
925 3300049741 Ga0501079_0022783 Ga0501079_0022783_1140_2090 292
926 3300049822 Ga0501035_0080250 Ga0501035_0080250_172_1122 292
927 3300049824 Ga0501045_0000203 Ga0501045_0000203_208_1158 292
928 3300050511 nmdc:mga08y16_117863_c1 nmdc:mga08y16_117863_c1_86_1111 292
929 3300050511 nmdc:mga08y16_21619_c1 nmdc:mga08y16_21619_c1_1081_2010 292
930 3300053085 Ga0495619_0004035 Ga0495619_0004035_8370_9269 292
931 3300053156 Ga0500622_0001124 Ga0500622_0001124_2471_3994 292
932 3300061734 Ga0530510_0020650 Ga0530510_0020650_2367_3317 292
933 3300002126 JGI24035J26624_1001291 JGI24035J26624_10012913 293
934 3300003911 JGI25405J52794_10005555 JGI25405J52794_100055552 293
935 3300005290 Ga0065712_10005682 Ga0065712_100056822 293
936 3300005290 Ga0065712_10005725 Ga0065712_100057252 293
937 3300005293 Ga0065715_10000207 Ga0065715_100002078 293
938 3300005293 Ga0065715_10018423 Ga0065715_100184233 293
939 3300005293 Ga0065715_10027319 Ga0065715_100273193 293
940 3300005293 Ga0065715_10095093 Ga0065715_100950932 293
941 3300005293 Ga0065715_10274696 Ga0065715_102746961 293
942 3300005328 Ga0070676_10009128 Ga0070676_100091288 293
943 3300005328 Ga0070676_10067588 Ga0070676_100675883 293
944 3300005328 Ga0070676_10093831 Ga0070676_100938312 293
945 3300005329 Ga0070683_100043281 Ga0070683_1000432815 293
946 3300005329 Ga0070683_100062437 Ga0070683_1000624373 293
947 3300005330 Ga0070690_100014700 Ga0070690_1000147004 293
948 3300005331 Ga0070670_100001583 Ga0070670_10000158320 293
949 3300005331 Ga0070670_100017743 Ga0070670_1000177434 293
950 3300005331 Ga0070670_100123738 Ga0070670_1001237382 293
951 3300005331 Ga0070670_100245730 Ga0070670_1002457302 293
952 3300005335 Ga0070666_10002748 Ga0070666_100027483 293
953 3300005335 Ga0070666_10007841 Ga0070666_100078418 293
954 3300005336 Ga0070680_100040932 Ga0070680_1000409323 293
955 3300005338 Ga0068868_100095734 Ga0068868_1000957342 293
956 3300005339 Ga0070660_100029344 Ga0070660_1000293442 293
957 3300005339 Ga0070660_100097669 Ga0070660_1000976692 293
958 3300005340 Ga0070689_100012040 Ga0070689_1000120403 293
959 3300005340 Ga0070689_100031202 Ga0070689_1000312022 293
960 3300005340 Ga0070689_100190356 Ga0070689_1001903561 293
961 3300005343 Ga0070687_100018304 Ga0070687_1000183043 293
962 3300005344 Ga0070661_100031848 Ga0070661_1000318481 293
963 3300005344 Ga0070661_100178510 Ga0070661_1001785102 293
964 3300005347 Ga0070668_100006277 Ga0070668_1000062773 293
965 3300005347 Ga0070668_100165700 Ga0070668_1001657002 293
966 3300005353 Ga0070669_100001219 Ga0070669_10000121921 293
967 3300005353 Ga0070669_100070552 Ga0070669_1000705522 293
968 3300005353 Ga0070669_100097198 Ga0070669_1000971982 293
969 3300005353 Ga0070669_100347753 Ga0070669_1003477531 293
970 3300005354 Ga0070675_100001835 Ga0070675_10000183514 293
971 3300005354 Ga0070675_100014335 Ga0070675_1000143355 293
972 3300005354 Ga0070675_100258828 Ga0070675_1002588281 293
973 3300005355 Ga0070671_100003791 Ga0070671_10000379114 293
974 3300005355 Ga0070671_100014619 Ga0070671_1000146198 293
975 3300005356 Ga0070674_100003718 Ga0070674_1000037186 293
976 3300005356 Ga0070674_100012161 Ga0070674_1000121616 293
977 3300005364 Ga0070673_100006575 Ga0070673_10000657510 293
978 3300005364 Ga0070673_100035044 Ga0070673_1000350443 293
979 3300005364 Ga0070673_100079801 Ga0070673_1000798011 293
980 3300005365 Ga0070688_100010755 Ga0070688_1000107558 293
981 3300005366 Ga0070659_100018586 Ga0070659_1000185863 293
982 3300005367 Ga0070667_100002725 Ga0070667_1000027252 293
983 3300005435 Ga0070714_100199567 Ga0070714_1001995672 293
984 3300005435 Ga0070714_100228246 Ga0070714_1002282463 293
985 3300005436 Ga0070713_100199704 Ga0070713_1001997043 293
986 3300005445 Ga0070708_100007162 Ga0070708_1000071628 293
987 3300005445 Ga0070708_100187614 Ga0070708_1001876141 293
988 3300005456 Ga0070678_100002470 Ga0070678_10000247011 293
989 3300005456 Ga0070678_100022270 Ga0070678_1000222703 293
990 3300005456 Ga0070678_100073268 Ga0070678_1000732682 293
991 3300005457 Ga0070662_100251226 Ga0070662_1002512262 293
992 3300005459 Ga0068867_100103857 Ga0068867_1001038572 293
993 3300005466 Ga0070685_10011484 Ga0070685_100114846 293
994 3300005467 Ga0070706_100010526 Ga0070706_1000105266 293
995 3300005467 Ga0070706_100098289 Ga0070706_1000982893 293
996 3300005467 Ga0070706_100327815 Ga0070706_1003278151 293
997 3300005468 Ga0070707_100041760 Ga0070707_1000417605 293
998 3300005468 Ga0070707_100073922 Ga0070707_1000739222 293
999 3300005468 Ga0070707_100125636 Ga0070707_1001256362 293
1000 3300005468 Ga0070707_100246452 Ga0070707_1002464521 293
1001 3300005471 Ga0070698_100069732 Ga0070698_1000697322 293
1002 3300005530 Ga0070679_100046538 Ga0070679_1000465385 293
1003 3300005535 Ga0070684_100000767 Ga0070684_10000076716 293
1004 3300005535 Ga0070684_100070238 Ga0070684_1000702383 293
1005 3300005536 Ga0070697_100010698 Ga0070697_1000106987 293
1006 3300005536 Ga0070697_100055191 Ga0070697_1000551912 293
1007 3300005543 Ga0070672_100020621 Ga0070672_1000206215 293
1008 3300005543 Ga0070672_100617106 Ga0070672_1006171061 293
1009 3300005548 Ga0070665_100015168 Ga0070665_10001516810 293
1010 3300005548 Ga0070665_100015437 Ga0070665_1000154374 293
1011 3300005548 Ga0070665_100045184 Ga0070665_1000451844 293
1012 3300005548 Ga0070665_100118414 Ga0070665_1001184143 293
1013 3300005549 Ga0070704_100006310 Ga0070704_1000063106 293
1014 3300005614 Ga0068856_100047226 Ga0068856_1000472264 293
1015 3300005615 Ga0070702_100136457 Ga0070702_1001364572 293
1016 3300005616 Ga0068852_100716771 Ga0068852_1007167711 293
1017 3300005617 Ga0068859_100120098 Ga0068859_1001200982 293
1018 3300005618 Ga0068864_100024947 Ga0068864_1000249475 293
1019 3300005841 Ga0068863_100036293 Ga0068863_1000362934 293
1020 3300005841 Ga0068863_100773500 Ga0068863_1007735001 293
1021 3300005842 Ga0068858_100150457 Ga0068858_1001504574 293
1022 3300005843 Ga0068860_100041635 Ga0068860_1000416352 293
1023 3300005843 Ga0068860_100324855 Ga0068860_1003248552 293
1024 3300005937 Ga0081455_10001854 Ga0081455_100018545 293
1025 3300005937 Ga0081455_10004819 Ga0081455_1000481910 293
1026 3300005937 Ga0081455_10022064 Ga0081455_100220645 293
1027 3300005937 Ga0081455_10035616 Ga0081455_100356162 293
1028 3300005937 Ga0081455_10161693 Ga0081455_101616932 293
1029 3300005983 Ga0081540_1000127 Ga0081540_100012770 293
1030 3300005983 Ga0081540_1012719 Ga0081540_10127192 293
1031 3300005985 Ga0081539_10000138 Ga0081539_1000013883 293
1032 3300006028 Ga0070717_10043237 Ga0070717_100432372 293
1033 3300006163 Ga0070715_10025869 Ga0070715_100258693 293
1034 3300006175 Ga0070712_100397421 Ga0070712_1003974211 293
1035 3300006358 Ga0068871_100032982 Ga0068871_1000329826 293
1036 3300006358 Ga0068871_100058797 Ga0068871_1000587974 293
1037 3300006358 Ga0068871_100081325 Ga0068871_1000813252 293
1038 3300006358 Ga0068871_100226258 Ga0068871_1002262582 293
1039 3300006844 Ga0075428_100095554 Ga0075428_1000955542 293
1040 3300006914 Ga0075436_100038914 Ga0075436_1000389144 293
1041 3300006931 Ga0097620_100120101 Ga0097620_1001201013 293
1042 3300007788 Ga0099795_10028348 Ga0099795_100283483 293
1043 3300009147 Ga0114129_10066910 Ga0114129_100669103 293
1044 3300009147 Ga0114129_10159056 Ga0114129_101590562 293
1045 3300009147 Ga0114129_10576563 Ga0114129_105765632 293
1046 3300009553 Ga0105249_10008154 Ga0105249_1000815411 293
1047 3300010159 Ga0099796_10029044 Ga0099796_100290442 293
1048 3300013296 Ga0157374_10003663 Ga0157374_100036632 293
1049 3300013296 Ga0157374_10013259 Ga0157374_100132596 293
1050 3300013296 Ga0157374_10056057 Ga0157374_100560571 293
1051 3300013296 Ga0157374_10089726 Ga0157374_100897263 293
1052 3300013296 Ga0157374_10105063 Ga0157374_101050632 293
1053 3300013296 Ga0157374_10294866 Ga0157374_102948662 293
1054 3300013297 Ga0157378_10300211 Ga0157378_103002112 293
1055 3300013297 Ga0157378_10436697 Ga0157378_104366972 293
1056 3300013306 Ga0163162_10010329 Ga0163162_100103294 293
1057 3300013306 Ga0163162_10012362 Ga0163162_100123625 293
1058 3300013306 Ga0163162_10176119 Ga0163162_101761192 293
1059 3300013306 Ga0163162_10256493 Ga0163162_102564932 293
1060 3300013307 Ga0157372_10099993 Ga0157372_100999933 293
1061 3300013308 Ga0157375_10002221 Ga0157375_1000222110 293
1062 3300013308 Ga0157375_10023125 Ga0157375_100231253 293
1063 3300013308 Ga0157375_10071072 Ga0157375_100710723 293
1064 3300013308 Ga0157375_10257587 Ga0157375_102575874 293
1065 3300014497 Ga0182008_10020630 Ga0182008_100206303 293
1066 3300014745 Ga0157377_10047051 Ga0157377_100470513 293
1067 3300014968 Ga0157379_10018618 Ga0157379_100186186 293
1068 3300014969 Ga0157376_10005905 Ga0157376_100059053 293
1069 3300014969 Ga0157376_10073085 Ga0157376_100730852 293
1070 3300014969 Ga0157376_10421000 Ga0157376_104210001 293
1071 3300015261 Ga0182006_1045418 Ga0182006_10454181 293
1072 3300025271 Ga0207666_1000205 Ga0207666_100020510 293
1073 3300025271 Ga0207666_1002921 Ga0207666_10029213 293
1074 3300025290 Ga0207673_1000664 Ga0207673_10006645 293
1075 3300025315 Ga0207697_10000468 Ga0207697_1000046823 293
1076 3300025315 Ga0207697_10003009 Ga0207697_100030095 293
1077 3300025315 Ga0207697_10003924 Ga0207697_100039249 293
1078 3300025315 Ga0207697_10005410 Ga0207697_100054103 293
1079 3300025901 Ga0207688_10001969 Ga0207688_100019693 293
1080 3300025903 Ga0207680_10008920 Ga0207680_100089204 293
1081 3300025904 Ga0207647_10021846 Ga0207647_100218465 293
1082 3300025907 Ga0207645_10007764 Ga0207645_1000776411 293
1083 3300025907 Ga0207645_10019772 Ga0207645_100197724 293
1084 3300025907 Ga0207645_10201941 Ga0207645_102019411 293
1085 3300025909 Ga0207705_10341054 Ga0207705_103410541 293
1086 3300025910 Ga0207684_10008914 Ga0207684_1000891410 293
1087 3300025910 Ga0207684_10009462 Ga0207684_100094626 293
1088 3300025910 Ga0207684_10026662 Ga0207684_100266624 293
1089 3300025910 Ga0207684_10103316 Ga0207684_101033163 293
1090 3300025915 Ga0207693_10076038 Ga0207693_100760382 293
1091 3300025916 Ga0207663_10208959 Ga0207663_102089591 293
1092 3300025916 Ga0207663_10421228 Ga0207663_104212282 293
1093 3300025918 Ga0207662_10032169 Ga0207662_100321694 293
1094 3300025919 Ga0207657_10023660 Ga0207657_100236603 293
1095 3300025919 Ga0207657_10062380 Ga0207657_100623803 293
1096 3300025919 Ga0207657_10269173 Ga0207657_102691731 293
1097 3300025920 Ga0207649_10024833 Ga0207649_100248333 293
1098 3300025920 Ga0207649_10126762 Ga0207649_101267623 293
1099 3300025921 Ga0207652_10027904 Ga0207652_100279043 293
1100 3300025922 Ga0207646_10048732 Ga0207646_100487323 293
1101 3300025922 Ga0207646_10055462 Ga0207646_100554623 293
1102 3300025922 Ga0207646_10143444 Ga0207646_101434443 293
1103 3300025922 Ga0207646_10438620 Ga0207646_104386202 293
1104 3300025923 Ga0207681_10041805 Ga0207681_100418051 293
1105 3300025923 Ga0207681_10056585 Ga0207681_100565852 293
1106 3300025923 Ga0207681_10153879 Ga0207681_101538792 293
1107 3300025925 Ga0207650_10012767 Ga0207650_100127675 293
1108 3300025925 Ga0207650_10364940 Ga0207650_103649402 293
1109 3300025926 Ga0207659_10026962 Ga0207659_100269623 293
1110 3300025928 Ga0207700_10010114 Ga0207700_100101149 293
1111 3300025929 Ga0207664_10217954 Ga0207664_102179541 293
1112 3300025931 Ga0207644_10001481 Ga0207644_100014816 293
1113 3300025931 Ga0207644_10023417 Ga0207644_100234172 293
1114 3300025931 Ga0207644_10043868 Ga0207644_100438684 293
1115 3300025931 Ga0207644_10071671 Ga0207644_100716712 293
1116 3300025932 Ga0207690_10019982 Ga0207690_100199825 293
1117 3300025933 Ga0207706_10290429 Ga0207706_102904292 293
1118 3300025936 Ga0207670_10023971 Ga0207670_100239714 293
1119 3300025936 Ga0207670_10146826 Ga0207670_101468262 293
1120 3300025937 Ga0207669_10067652 Ga0207669_100676523 293
1121 3300025939 Ga0207665_10006742 Ga0207665_100067427 293
1122 3300025940 Ga0207691_10000800 Ga0207691_100008007 293
1123 3300025940 Ga0207691_10062659 Ga0207691_100626591 293
1124 3300025944 Ga0207661_10027814 Ga0207661_100278143 293
1125 3300025944 Ga0207661_10102383 Ga0207661_101023832 293
1126 3300025945 Ga0207679_10074216 Ga0207679_100742164 293
1127 3300025945 Ga0207679_10106264 Ga0207679_101062644 293
1128 3300025960 Ga0207651_10013490 Ga0207651_100134904 293
1129 3300025960 Ga0207651_10028454 Ga0207651_100284543 293
1130 3300025972 Ga0207668_10033927 Ga0207668_100339272 293
1131 3300025972 Ga0207668_10141608 Ga0207668_101416083 293
1132 3300025972 Ga0207668_10225407 Ga0207668_102254072 293
1133 3300025972 Ga0207668_10288317 Ga0207668_102883172 293
1134 3300026035 Ga0207703_10184384 Ga0207703_101843844 293
1135 3300026067 Ga0207678_10008966 Ga0207678_1000896610 293
1136 3300026088 Ga0207641_10028499 Ga0207641_100284993 293
1137 3300026088 Ga0207641_10368646 Ga0207641_103686462 293
1138 3300026089 Ga0207648_10053356 Ga0207648_100533563 293
1139 3300026095 Ga0207676_10124786 Ga0207676_101247863 293
1140 3300026121 Ga0207683_10003536 Ga0207683_1000353610 293
1141 3300026121 Ga0207683_10020785 Ga0207683_100207853 293
1142 3300026121 Ga0207683_10050855 Ga0207683_100508551 293
1143 3300027876 Ga0209974_10011412 Ga0209974_100114123 293
1144 3300028379 Ga0268266_10004452 Ga0268266_100044528 293
1145 3300028379 Ga0268266_10018440 Ga0268266_100184403 293
1146 3300028379 Ga0268266_10126509 Ga0268266_101265094 293
1147 3300028379 Ga0268266_10463418 Ga0268266_104634181 293
1148 3300028381 Ga0268264_10019083 Ga0268264_100190837 293
1149 3300035118 Ga0373954_0015706 Ga0373954_0015706_282_1226 293
1150 3300035170 Ga0373943_0033948 Ga0373943_0033948_62_946 293
1151 3300035170 Ga0373943_0107302 Ga0373943_0107302_543_1424 293
1152 3300035692 Ga0373935_0012338 Ga0373935_0012338_4029_4910 293
1153 3300035724 Ga0373933_0313419 Ga0373933_0313419_21_965 293
1154 3300037418 Ga0395900_0011095 Ga0395900_0011095_7106_7987 293
1155 3300037466 Ga0395898_0003987 Ga0395898_0003987_7334_8215 293
1156 3300037471 Ga0395905_0049970 Ga0395905_0049970_365_1246 293
1157 3300037471 Ga0395905_0285311 Ga0395905_0285311_493_1374 293
1158 3300038443 Ga0395901_0011017 Ga0395901_0011017_3674_4555 293
1159 3300038443 Ga0395901_0444269 Ga0395901_0444269_159_1040 293
1160 3300042012 Ga0439455_0022535 Ga0439455_0022535_575_1456 293
1161 3300045976 Ga0466967_0116300 Ga0466967_0116300_55_936 293
1162 3300046454 Ga0495592_0131917 Ga0495592_0131917_762_1643 293
1163 3300046454 Ga0495592_0146646 Ga0495592_0146646_360_1304 293
1164 3300046462 Ga0495651_0063110 Ga0495651_0063110_1418_2299 293
1165 3300046514 Ga0495618_0229209 Ga0495618_0229209_197_1078 293
1166 3300046516 Ga0495628_0003533 Ga0495628_0003533_12486_13430 293
1167 3300046517 Ga0495630_0078942 Ga0495630_0078942_1237_2118 293
1168 3300046517 Ga0495630_0191155 Ga0495630_0191155_210_1091 293
1169 3300046529 Ga0495652_0070216 Ga0495652_0070216_435_1316 293
1170 3300046529 Ga0495652_0262995 Ga0495652_0262995_228_1172 293
1171 3300046535 Ga0495586_0045644 Ga0495586_0045644_380_1261 293
1172 3300046543 Ga0495645_0095555 Ga0495645_0095555_601_1545 293
1173 3300046642 Ga0495634_0031361 Ga0495634_0031361_1227_2108 293
1174 3300046664 Ga0495659_0084201 Ga0495659_0084201_58_939 293
1175 3300046679 Ga0495623_0103376 Ga0495623_0103376_478_1422 293
1176 3300046683 Ga0495658_0047056 Ga0495658_0047056_334_1215 293
1177 3300046683 Ga0495658_0193414 Ga0495658_0193414_192_1073 293
1178 3300046690 Ga0495624_0115269 Ga0495624_0115269_719_1600 293
1179 3300047319 Ga0495674_0179775 Ga0495674_0179775_524_1405 293
1180 3300047471 Ga0495684_0022126 Ga0495684_0022126_345_1226 293
1181 3300047471 Ga0495684_0181472 Ga0495684_0181472_554_1435 293
1182 3300048088 Ga0495602_0073348 Ga0495602_0073348_1216_2160 293
1183 3300048904 Ga0496101_0142129 Ga0496101_0142129_828_1709 293
1184 3300048905 Ga0496102_0075339 Ga0496102_0075339_192_1073 293
1185 3300048908 Ga0496105_0045143 Ga0496105_0045143_2478_3359 293
1186 3300048908 Ga0496105_0168048 Ga0496105_0168048_27_908 293
1187 3300048909 Ga0496106_0361660 Ga0496106_0361660_191_1072 293
1188 3300048910 Ga0496107_0149136 Ga0496107_0149136_316_1197 293
1189 3300048911 Ga0496108_0107889 Ga0496108_0107889_130_1011 293
1190 3300048913 Ga0496110_0371110 Ga0496110_0371110_174_1055 293
1191 3300048915 Ga0496112_0067619 Ga0496112_0067619_1264_2145 293
1192 3300048915 Ga0496112_0077789 Ga0496112_0077789_337_1218 293
1193 3300048917 Ga0496114_0050987 Ga0496114_0050987_2415_3296 293
1194 3300048917 Ga0496114_0435025 Ga0496114_0435025_160_1041 293
1195 3300048918 Ga0496115_0018253 Ga0496115_0018253_2481_3362 293
1196 3300048918 Ga0496115_0235859 Ga0496115_0235859_344_1225 293
1197 3300050507 nmdc:mga05p37_430460_c1 nmdc:mga05p37_430460_c1_467_1348 293
1198 3300050512 nmdc:mga0n895_240011_c1 nmdc:mga0n895_240011_c1_37_918 293
1199 3300050512 nmdc:mga0n895_280369_c1 nmdc:mga0n895_280369_c1_510_1391 293
1200 3300053085 Ga0495619_0137318 Ga0495619_0137318_150_1031 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02629

CoA_binding

CoA binding domain

47

141

0.97

PF00549

Ligase_CoA

CoA-ligase

193

314

0.96

PF13607

Succ_CoA_lig

Succinyl-CoA ligase like flavodoxin domain

187

328

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oi7-assembly1.cif.gz_A the crystal structure of succinyl-coa synthetase alpha subunit from thermus thermophilus 0.9796 3 289
2nu9-assembly1.cif.gz_A c123at mutant of e. coli succinyl-coa synthetase orthorhombic crystal form 0.9791 2 287
2nu6-assembly1.cif.gz_A c123aa mutant of e. coli succinyl-coa synthetase 0.9789 2 287
2scu-assembly1.cif.gz_A a detailed description of the structure of succinyl-coa synthetase from escherichia coli 0.9785 2 287
1jkj-assembly1.cif.gz_A e. coli scs 0.978 2 288
ID Description Score Start End Superfamily
af_A0A1D6EZI1_156_262_3.40.50.261 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 1 122 205 3.40.50.261
1jllA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9778 2 124 3.40.50.720
1jllA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.97 2 124 3.40.50.720
2yv2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9623 4 124 3.40.50.720
af_Q8IIR8_149_327_3.40.50.261 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 0.959 122 293 3.40.50.261
ID Description Score Start End GO Terms
AF-A0A2V5V883-F1-model_v4 Succinate--CoA ligase subunit alpha 1.006 1 90 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-X0ZAR5-F1-model_v4 CoA-binding domain-containing protein 1.006 1 91 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-A0A2V6AGJ6-F1-model_v4 Succinate--CoA ligase subunit alpha 1.004 5 125 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-A0A2V5JAH0-F1-model_v4 Succinate--CoA ligase subunit alpha 1.004 1 121 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-A0A2V6EDW8-F1-model_v4 Succinate--CoA ligase subunit alpha 1.002 1 207 GO:0000166
GO:0004775
GO:0004776
GO:0006099
GO:0009361

Feature Viewer

pLDDT pTM Quality
92.8 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map