F491461

General Info

Members Datasets Scaffolds Average Seq Length
1191 359 1162 524

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10000202|Ga0157370_1000020240
Length 570
Sequence MTINQSGWRPEAPLANGAGEQPTFTGNRALMLEEPLLFEIGSTDRTGVDFESPSPQGGEGWGEGERGEAERPHSWWDTLTQPSPQGERANRLGGLERTNINLAGLSEPETVRHYTRLSRQNYAIDLGVFPLGSCTMKHNPRLNERVARLPGFADVHPLQPISTIQGALGVIHELAIWLIKLTGMYGVAMAPKAGAHGELCGILCIRAALDARGETNRRVLLVPESAHGTNPATAAFAGYSVENIPATAEGRVDLAALERRLGPDIAGVMITNPNTCGLFERDMKAISDAVHAAGGYVYCDGANFNAIVGRVRPGDLGIDAMHINLHKTFSTPHGGGGPGSGPVVLSEALAPYGPLPFVAKYPDGSFKLIEEASFEEEHPGTFGRMTAFHGQMGMFTRALTYILSHGADGLRQVSGDAVLNANYILRSLENVLDAPFGSSGPCMHEALFSDDGLAHGFSTLDIAKGLIDEGFHPMTVYFPLVVHGAMLVEPTETESKAGLDQFIGALRSVAERAKAGDESLKSAPHFAPRRRLDETAAARTPVLAQRYLADRHTSSRGHPHPTLSLKREGF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
6 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
7 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
8 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
9 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
10 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
11 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
12 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
13 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
14 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
15 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
16 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
17 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
18 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
19 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
20 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
21 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
22 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
23 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
24 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
25 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
26 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
27 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
28 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
29 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
30 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
36 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
40 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
55 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
56 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
70 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
141 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
205 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
211 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
212 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
217 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
243 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
244 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
245 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
260 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
263 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
264 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
265 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
269 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
280 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
285 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
302 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
303 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
306 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
307 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
308 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
324 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
325 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
326 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
327 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
328 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
329 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
330 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
335 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
341 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
342 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
343 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
344 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
345 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
346 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
347 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
348 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
349 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
350 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
351 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
352 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
353 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
354 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
355 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
356 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
357 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
358 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
359 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0.08
Isolates 2.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.29
Nodule 0
Rhizoplane 4.87
Rhizosphere 84.63
Stem 0
Stem Tuber 0.08
Unclassified 5.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_154827 2162886007 Bacteria 44309
2 JGI24736J21556_1000403 3300001904 Bacteria 8130
3 JGI24740J21852_10012975 3300001979 Bacteria 3126
4 JGI24740J21852_10020525 3300001979 Bacteria 2302
5 JGI24739J22299_10016411 3300001989 Bacteria 2680
6 JGI24737J22298_10000221 3300001990 Bacteria 18699
7 JGI24737J22298_10000290 3300001990 Bacteria 16658
8 JGI24737J22298_10000900 3300001990 Bacteria 10567
9 JGI24737J22298_10001215 3300001990 Bacteria 9088
10 JGI24737J22298_10002168 3300001990 Bacteria 6998
11 JGI24737J22298_10004757 3300001990 Bacteria 4714
12 JGI24737J22298_10019419 3300001990 Bacteria 2173
13 JGI24735J21928_10001752 3300002067 Bacteria 7650
14 JGI24735J21928_10017711 3300002067 Bacteria 2201
15 JGI24738J21930_10000677 3300002075 Bacteria 9844
16 JGI25150J39212_1000096 3300002774 Bacteria 50476
17 JGI25165J46597_1000179 3300003214 Bacteria 97445
18 JGI25153J46596_10000021 3300003215 Bacteria 252651
19 Ga0055525_1000070 3300003759 Bacteria 183047
20 Ga0055529_1000136 3300003763 Bacteria 104102
21 Ga0055526_1005868 3300003771 Bacteria 6887
22 Ga0055536_1000505 3300003781 Bacteria 26955
23 Ga0055536_1013547 3300003781 Bacteria 2929
24 Ga0055530_10000082 3300003791 Bacteria 81812
25 Ga0055530_10000137 3300003791 Bacteria 64770
26 Ga0065165_1001234 3300005262 Bacteria 29249
27 Ga0065704_10070230 3300005289 Bacteria 55750
28 Ga0065704_10086462 3300005289 Bacteria 3118
29 Ga0065715_10119835 3300005293 Bacteria 2268
30 Ga0070658_10000183 3300005327 Bacteria 54970
31 Ga0070658_10000611 3300005327 Bacteria 30913
32 Ga0070658_10001051 3300005327 Bacteria 23600
33 Ga0070658_10001203 3300005327 Bacteria 22172
34 Ga0070658_10002340 3300005327 Bacteria 15909
35 Ga0070658_10003277 3300005327 Bacteria 13361
36 Ga0070658_10021435 3300005327 Bacteria 5179
37 Ga0070658_10053938 3300005327 Bacteria 3264
38 Ga0070658_10066077 3300005327 Bacteria 2954
39 Ga0070658_10098617 3300005327 Bacteria 2413
40 Ga0070658_10132174 3300005327 Bacteria 2080
41 Ga0070676_10001868 3300005328 Bacteria 10722
42 Ga0070676_10004536 3300005328 Bacteria 7315
43 Ga0070683_100001584 3300005329 Bacteria 17600
44 Ga0070683_100006972 3300005329 Bacteria 9504
45 Ga0070683_100012444 3300005329 Bacteria 7395
46 Ga0070683_100035661 3300005329 Bacteria 4547
47 Ga0070690_100007063 3300005330 Bacteria 6408
48 Ga0070670_100005076 3300005331 Bacteria 11073
49 Ga0070670_100009603 3300005331 Bacteria 8257
50 Ga0070670_100011909 3300005331 Bacteria 7436
51 Ga0070670_100022358 3300005331 Bacteria 5443
52 Ga0070670_100057432 3300005331 Bacteria 3341
53 Ga0070670_100077995 3300005331 Bacteria 2846
54 Ga0070677_10000990 3300005333 Bacteria 9189
55 Ga0068869_100000662 3300005334 Bacteria 19510
56 Ga0068869_100031072 3300005334 Bacteria 3756
57 Ga0070666_10006666 3300005335 Bacteria 7102
58 Ga0070666_10011303 3300005335 Bacteria 5602
59 Ga0070666_10018749 3300005335 Bacteria 4455
60 Ga0070666_10028034 3300005335 Bacteria 3693
61 Ga0070666_10042216 3300005335 Bacteria 3050
62 Ga0070666_10075796 3300005335 Bacteria 2294
63 Ga0070680_100000385 3300005336 Bacteria 29938
64 Ga0070680_100002482 3300005336 Bacteria 13669
65 Ga0070680_100008094 3300005336 Bacteria 8024
66 Ga0070680_100010796 3300005336 Bacteria 7051
67 Ga0070682_100027748 3300005337 Bacteria 3399
68 Ga0070682_100045355 3300005337 Bacteria 2725
69 Ga0068868_100000281 3300005338 Bacteria 34228
70 Ga0068868_100001134 3300005338 Bacteria 18218
71 Ga0068868_100001411 3300005338 Bacteria 16565
72 Ga0068868_100007382 3300005338 Bacteria 7830
73 Ga0070660_100000061 3300005339 Bacteria 63766
74 Ga0070660_100000355 3300005339 Bacteria 30584
75 Ga0070660_100001286 3300005339 Bacteria 17106
76 Ga0070660_100003337 3300005339 Bacteria 11034
77 Ga0070660_100003754 3300005339 Bacteria 10498
78 Ga0070660_100005037 3300005339 Bacteria 9132
79 Ga0070660_100006157 3300005339 Bacteria 8301
80 Ga0070660_100018438 3300005339 Bacteria 5099
81 Ga0070660_100021225 3300005339 Bacteria 4786
82 Ga0070660_100021489 3300005339 Bacteria 4761
83 Ga0070660_100028990 3300005339 Bacteria 4145
84 Ga0070660_100036771 3300005339 Bacteria 3710
85 Ga0070661_100000485 3300005344 Bacteria 30409
86 Ga0070661_100004629 3300005344 Bacteria 9467
87 Ga0070661_100006539 3300005344 Bacteria 8041
88 Ga0070661_100041772 3300005344 Bacteria 3346
89 Ga0070692_10000457 3300005345 Bacteria 12459
90 Ga0070692_10022598 3300005345 Bacteria 3073
91 Ga0070692_10038631 3300005345 Bacteria 2434
92 Ga0070668_100000027 3300005347 Bacteria 89913
93 Ga0070668_100000886 3300005347 Bacteria 20822
94 Ga0070668_100003267 3300005347 Bacteria 11949
95 Ga0070668_100009416 3300005347 Bacteria 7246
96 Ga0070668_100010966 3300005347 Bacteria 6745
97 Ga0070668_100019912 3300005347 Bacteria 5057
98 Ga0070669_100002708 3300005353 Bacteria 12782
99 Ga0070669_100004379 3300005353 Bacteria 10184
100 Ga0070669_100008152 3300005353 Bacteria 7482
101 Ga0070669_100020434 3300005353 Bacteria 4729
102 Ga0070669_100056901 3300005353 Bacteria 2867
103 Ga0070669_100093968 3300005353 Bacteria 2253
104 Ga0070669_100113616 3300005353 Bacteria 2058
105 Ga0070675_100004996 3300005354 Bacteria 10127
106 Ga0070675_100006226 3300005354 Bacteria 9154
107 Ga0070675_100008675 3300005354 Bacteria 7895
108 Ga0070671_100000066 3300005355 Bacteria 70998
109 Ga0070671_100000937 3300005355 Bacteria 21358
110 Ga0070671_100001855 3300005355 Bacteria 16117
111 Ga0070671_100002394 3300005355 Bacteria 14496
112 Ga0070671_100004231 3300005355 Bacteria 11359
113 Ga0070671_100016717 3300005355 Bacteria 5932
114 Ga0070671_100034647 3300005355 Bacteria 4180
115 Ga0070671_100047744 3300005355 Bacteria 3559
116 Ga0070671_100068223 3300005355 Bacteria 2966
117 Ga0070674_100009563 3300005356 Bacteria 5807
118 Ga0070673_100000005 3300005364 Bacteria 193513
119 Ga0070673_100000146 3300005364 Bacteria 33612
120 Ga0070673_100009612 3300005364 Bacteria 6501
121 Ga0070673_100012846 3300005364 Bacteria 5765
122 Ga0070673_100023545 3300005364 Bacteria 4500
123 Ga0070673_100035871 3300005364 Bacteria 3764
124 Ga0070673_100037600 3300005364 Bacteria 3689
125 Ga0070673_100055387 3300005364 Bacteria 3124
126 Ga0070673_100127490 3300005364 Bacteria 2131
127 Ga0070659_100000643 3300005366 Bacteria 25509
128 Ga0070659_100000952 3300005366 Bacteria 21291
129 Ga0070659_100021046 3300005366 Bacteria 4961
130 Ga0070659_100032163 3300005366 Bacteria 4067
131 Ga0070659_100057882 3300005366 Bacteria 3057
132 Ga0070659_100076703 3300005366 Bacteria 2665
133 Ga0070659_100083732 3300005366 Bacteria 2550
134 Ga0070667_100000017 3300005367 Bacteria 230531
135 Ga0070667_100000024 3300005367 Bacteria 191216
136 Ga0070667_100000776 3300005367 Bacteria 30243
137 Ga0070667_100005752 3300005367 Bacteria 10362
138 Ga0070667_100007443 3300005367 Bacteria 9091
139 Ga0070667_100017989 3300005367 Bacteria 5858
140 Ga0070667_100019601 3300005367 Bacteria 5612
141 Ga0070667_100036299 3300005367 Bacteria 4132
142 Ga0070667_100049202 3300005367 Bacteria 3549
143 Ga0070667_100075918 3300005367 Bacteria 2869
144 Ga0070667_100146701 3300005367 Bacteria 2070
145 Ga0070714_100035760 3300005435 Bacteria 4163
146 Ga0070714_100074858 3300005435 Bacteria 2937
147 Ga0070713_100004550 3300005436 Bacteria 9345
148 Ga0070713_100114859 3300005436 Bacteria 2352
149 Ga0070663_100008636 3300005455 Bacteria 6280
150 Ga0070663_100021227 3300005455 Bacteria 4315
151 Ga0070678_100001327 3300005456 Bacteria 13134
152 Ga0070678_100011404 3300005456 Bacteria 5482
153 Ga0070662_100000793 3300005457 Bacteria 19387
154 Ga0070662_100013191 3300005457 Bacteria 5493
155 Ga0070662_100026029 3300005457 Bacteria 4047
156 Ga0070662_100047480 3300005457 Bacteria 3089
157 Ga0070662_100064070 3300005457 Bacteria 2690
158 Ga0070662_100087512 3300005457 Bacteria 2332
159 Ga0070681_10016123 3300005458 Bacteria 7449
160 Ga0070681_10016464 3300005458 Bacteria 7382
161 Ga0070681_10018913 3300005458 Bacteria 6893
162 Ga0070681_10078737 3300005458 Bacteria 3253
163 Ga0070681_10084458 3300005458 Bacteria 3127
164 Ga0068867_100000060 3300005459 Bacteria 67750
165 Ga0068867_100002761 3300005459 Bacteria 12378
166 Ga0068867_100007573 3300005459 Bacteria 7684
167 Ga0068867_100055922 3300005459 Bacteria 2918
168 Ga0070698_100099003 3300005471 Bacteria 2889
169 Ga0070679_100003093 3300005530 Bacteria 15204
170 Ga0070679_100004981 3300005530 Bacteria 12260
171 Ga0070679_100012704 3300005530 Bacteria 8055
172 Ga0070679_100201885 3300005530 Bacteria 1954
173 Ga0070679_100206393 3300005530 Bacteria 1929
174 Ga0068853_100000848 3300005539 Bacteria 21352
175 Ga0068853_100010006 3300005539 Bacteria 7658
176 Ga0068853_100032362 3300005539 Bacteria 4429
177 Ga0068853_100045638 3300005539 Bacteria 3754
178 Ga0068853_100085896 3300005539 Bacteria 2759
179 Ga0068853_100174435 3300005539 Bacteria 1947
180 Ga0070672_100006694 3300005543 Bacteria 7767
181 Ga0070672_100043774 3300005543 Bacteria 3455
182 Ga0070672_100061631 3300005543 Bacteria 2958
183 Ga0070696_100006123 3300005546 Bacteria 8035
184 Ga0070696_100092585 3300005546 Bacteria 2154
185 Ga0070693_100000320 3300005547 Bacteria 22053
186 Ga0070665_100002034 3300005548 Bacteria 22762
187 Ga0070665_100004295 3300005548 Bacteria 14978
188 Ga0070665_100005394 3300005548 Bacteria 13196
189 Ga0070665_100016938 3300005548 Bacteria 7307
190 Ga0070665_100042630 3300005548 Bacteria 4561
191 Ga0070665_100060432 3300005548 Bacteria 3798
192 Ga0070665_100067025 3300005548 Bacteria 3600
193 Ga0070665_100111910 3300005548 Bacteria 2733
194 Ga0068855_100000263 3300005563 Bacteria 65449
195 Ga0068855_100000318 3300005563 Bacteria 60020
196 Ga0068855_100001622 3300005563 Bacteria 28214
197 Ga0068855_100004908 3300005563 Bacteria 16325
198 Ga0068855_100019513 3300005563 Bacteria 8147
199 Ga0068855_100021268 3300005563 Bacteria 7779
200 Ga0068855_100023625 3300005563 Bacteria 7364
201 Ga0068855_100028425 3300005563 Bacteria 6689
202 Ga0068855_100035028 3300005563 Bacteria 5981
203 Ga0068855_100047979 3300005563 Bacteria 5043
204 Ga0068855_100236322 3300005563 Bacteria 2044
205 Ga0068855_100239239 3300005563 Bacteria 2029
206 Ga0070664_100000066 3300005564 Bacteria 65204
207 Ga0070664_100002424 3300005564 Bacteria 14994
208 Ga0070664_100014088 3300005564 Bacteria 6522
209 Ga0070664_100065118 3300005564 Bacteria 3109
210 Ga0070664_100086935 3300005564 Bacteria 2701
211 Ga0070664_100097991 3300005564 Bacteria 2546
212 Ga0070664_100111928 3300005564 Bacteria 2383
213 Ga0070664_100147615 3300005564 Bacteria 2075
214 Ga0068857_100000692 3300005577 Bacteria 25055
215 Ga0068857_100003820 3300005577 Bacteria 12676
216 Ga0068857_100029415 3300005577 Bacteria 4848
217 Ga0068857_100048849 3300005577 Bacteria 3754
218 Ga0068857_100112097 3300005577 Bacteria 2452
219 Ga0068857_100161742 3300005577 Bacteria 2032
220 Ga0068854_100000257 3300005578 Bacteria 36219
221 Ga0068854_100001058 3300005578 Bacteria 16545
222 Ga0068854_100003369 3300005578 Bacteria 9958
223 Ga0068854_100005628 3300005578 Bacteria 7916
224 Ga0068854_100016766 3300005578 Bacteria 4889
225 Ga0068854_100041423 3300005578 Bacteria 3254
226 Ga0068854_100043606 3300005578 Bacteria 3180
227 Ga0068854_100095096 3300005578 Bacteria 2223
228 Ga0068856_100000213 3300005614 Bacteria 62582
229 Ga0068856_100007071 3300005614 Bacteria 10959
230 Ga0068856_100008544 3300005614 Bacteria 9953
231 Ga0068856_100012456 3300005614 Bacteria 8233
232 Ga0068856_100014514 3300005614 Bacteria 7610
233 Ga0068856_100140928 3300005614 Bacteria 2418
234 Ga0068852_100000205 3300005616 Bacteria 40110
235 Ga0068852_100001507 3300005616 Bacteria 15764
236 Ga0068852_100001658 3300005616 Bacteria 15178
237 Ga0068852_100004169 3300005616 Bacteria 10185
238 Ga0068852_100008088 3300005616 Bacteria 7717
239 Ga0068852_100011209 3300005616 Bacteria 6736
240 Ga0068852_100012469 3300005616 Bacteria 6457
241 Ga0068852_100013457 3300005616 Bacteria 6264
242 Ga0068852_100026871 3300005616 Bacteria 4684
243 Ga0068852_100028319 3300005616 Bacteria 4583
244 Ga0068852_100091859 3300005616 Bacteria 2717
245 Ga0068852_100101246 3300005616 Bacteria 2601
246 Ga0068852_100135197 3300005616 Bacteria 2276
247 Ga0068852_100149447 3300005616 Bacteria 2171
248 Ga0068859_100001405 3300005617 Bacteria 24449
249 Ga0068859_100013337 3300005617 Bacteria 8243
250 Ga0068859_100015173 3300005617 Bacteria 7733
251 Ga0068859_100030683 3300005617 Bacteria 5394
252 Ga0068859_100037605 3300005617 Bacteria 4857
253 Ga0068864_100000287 3300005618 Bacteria 44806
254 Ga0068864_100000748 3300005618 Bacteria 27277
255 Ga0068864_100000894 3300005618 Bacteria 25097
256 Ga0068864_100001115 3300005618 Bacteria 22458
257 Ga0068864_100003968 3300005618 Bacteria 12178
258 Ga0068864_100016570 3300005618 Bacteria 6135
259 Ga0068864_100033016 3300005618 Bacteria 4399
260 Ga0068864_100033504 3300005618 Bacteria 4367
261 Ga0068851_10016075 3300005834 Bacteria 3576
262 Ga0068863_100000082 3300005841 Bacteria 105688
263 Ga0068863_100005172 3300005841 Bacteria 12867
264 Ga0068863_100005364 3300005841 Bacteria 12643
265 Ga0068863_100006521 3300005841 Bacteria 11451
266 Ga0068863_100010902 3300005841 Bacteria 8814
267 Ga0068863_100028414 3300005841 Bacteria 5340
268 Ga0068863_100036472 3300005841 Bacteria 4683
269 Ga0068863_100118312 3300005841 Bacteria 2525
270 Ga0068858_100000103 3300005842 Bacteria 88754
271 Ga0068858_100000579 3300005842 Bacteria 38345
272 Ga0068858_100019553 3300005842 Bacteria 6333
273 Ga0068858_100023025 3300005842 Bacteria 5809
274 Ga0068858_100028177 3300005842 Bacteria 5219
275 Ga0068858_100057107 3300005842 Bacteria 3607
276 Ga0068858_100203654 3300005842 Bacteria 1872
277 Ga0068858_100211646 3300005842 Bacteria 1835
278 Ga0068860_100000056 3300005843 Bacteria 202751
279 Ga0068860_100004159 3300005843 Bacteria 14831
280 Ga0068860_100008281 3300005843 Bacteria 10349
281 Ga0068860_100008890 3300005843 Bacteria 10006
282 Ga0068860_100016018 3300005843 Bacteria 7313
283 Ga0068860_100067699 3300005843 Bacteria 3392
284 Ga0068860_100099456 3300005843 Bacteria 2774
285 Ga0068860_100126868 3300005843 Bacteria 2446
286 Ga0068860_100151570 3300005843 Bacteria 2233
287 Ga0068862_100000520 3300005844 Bacteria 40702
288 Ga0068862_100002736 3300005844 Bacteria 15475
289 Ga0068862_100004678 3300005844 Bacteria 11525
290 Ga0068862_100004894 3300005844 Bacteria 11282
291 Ga0068862_100012869 3300005844 Bacteria 6921
292 Ga0068862_100050802 3300005844 Bacteria 3544
293 Ga0068862_100133797 3300005844 Bacteria 2195
294 Ga0081539_10011926 3300005985 Bacteria 6781
295 Ga0070717_10002807 3300006028 Bacteria 12326
296 Ga0070717_10021346 3300006028 Bacteria 5102
297 Ga0075368_10000063 3300006042 Bacteria 25834
298 Ga0075363_100004586 3300006048 Bacteria 6063
299 Ga0070716_100042866 3300006173 Bacteria 2528
300 Ga0075362_10000023 3300006177 Bacteria 60275
301 Ga0075362_10000649 3300006177 Bacteria 10222
302 Ga0075362_10039299 3300006177 Bacteria 2080
303 Ga0075367_10001443 3300006178 Bacteria 10222
304 Ga0075369_10005681 3300006186 Bacteria 4676
305 Ga0075366_10000034 3300006195 Bacteria 47623
306 Ga0097621_100051812 3300006237 Bacteria 3341
307 Ga0097621_100079021 3300006237 Bacteria 2734
308 Ga0097621_100191152 3300006237 Bacteria 1773
309 Ga0075370_10000077 3300006353 Bacteria 29637
310 Ga0068871_100220644 3300006358 Bacteria 1642
311 Ga0068865_100000027 3300006881 Bacteria 92272
312 Ga0068865_100003386 3300006881 Bacteria 9547
313 Ga0068865_100004453 3300006881 Bacteria 8451
314 Ga0068865_100040849 3300006881 Bacteria 3154
315 Ga0097620_100001405 3300006931 Bacteria 24449
316 Ga0097620_100013336 3300006931 Bacteria 8243
317 Ga0097620_100015173 3300006931 Bacteria 7733
318 Ga0097620_100030685 3300006931 Bacteria 5394
319 Ga0097620_100037606 3300006931 Bacteria 4857
320 Ga0105250_10015557 3300009092 Bacteria 3115
321 Ga0105240_10005402 3300009093 Bacteria 19049
322 Ga0105240_10009782 3300009093 Bacteria 13538
323 Ga0105240_10037918 3300009093 Bacteria 6188
324 Ga0105240_10092759 3300009093 Bacteria 3686
325 Ga0105240_10168642 3300009093 Bacteria 2595
326 Ga0105240_10195974 3300009093 Bacteria 2372
327 Ga0111539_10001101 3300009094 Bacteria 35675
328 Ga0105245_10005839 3300009098 Bacteria 10806
329 Ga0105245_10024391 3300009098 Bacteria 5310
330 Ga0105243_10000406 3300009148 Bacteria 45265
331 Ga0105243_10005280 3300009148 Bacteria 10102
332 Ga0105243_10029516 3300009148 Bacteria 4218
333 Ga0105241_10005328 3300009174 Bacteria 9503
334 Ga0105242_10000077 3300009176 Bacteria 67726
335 Ga0105248_10000552 3300009177 Bacteria 42448
336 Ga0105248_10001298 3300009177 Bacteria 27820
337 Ga0105248_10001574 3300009177 Bacteria 25393
338 Ga0105248_10013326 3300009177 Bacteria 9049
339 Ga0105248_10031916 3300009177 Bacteria 5885
340 Ga0105248_10047959 3300009177 Bacteria 4790
341 Ga0105248_10055668 3300009177 Bacteria 4438
342 Ga0105248_10145905 3300009177 Bacteria 2670
343 Ga0105248_10217493 3300009177 Bacteria 2152
344 Ga0105248_10262841 3300009177 Bacteria 1943
345 Ga0105237_10010455 3300009545 Bacteria 9867
346 Ga0105237_10100907 3300009545 Bacteria 2878
347 Ga0105237_10152748 3300009545 Bacteria 2305
348 Ga0105238_10000713 3300009551 Bacteria 34757
349 Ga0105238_10002513 3300009551 Bacteria 18352
350 Ga0105238_10008543 3300009551 Bacteria 10246
351 Ga0105238_10045733 3300009551 Bacteria 4422
352 Ga0105238_10064919 3300009551 Bacteria 3651
353 Ga0105238_10084833 3300009551 Bacteria 3157
354 Ga0105249_10008517 3300009553 Bacteria 8942
355 Ga0105249_10051385 3300009553 Bacteria 3760
356 Ga0105239_10316328 3300010375 Bacteria 1760
357 Ga0157373_10001899 3300013100 Bacteria 15862
358 Ga0157373_10002987 3300013100 Bacteria 12790
359 Ga0157373_10012237 3300013100 Bacteria 6308
360 Ga0157373_10033778 3300013100 Bacteria 3677
361 Ga0157371_10000066 3300013102 Bacteria 168406
362 Ga0157371_10000616 3300013102 Bacteria 42353
363 Ga0157371_10003299 3300013102 Bacteria 14770
364 Ga0157371_10037984 3300013102 Bacteria 3445
365 Ga0157371_10127530 3300013102 Bacteria 1810
366 Ga0157370_10000202 3300013104 Bacteria 75313
367 Ga0157370_10000244 3300013104 Bacteria 69583
368 Ga0157370_10004958 3300013104 Bacteria 15066
369 Ga0157370_10004994 3300013104 Bacteria 15007
370 Ga0157370_10030530 3300013104 Bacteria 5280
371 Ga0157369_10001746 3300013105 Bacteria 26366
372 Ga0157369_10008794 3300013105 Bacteria 11571
373 Ga0157369_10026544 3300013105 Bacteria 6424
374 Ga0157374_10017303 3300013296 Bacteria 6343
375 Ga0157374_10134390 3300013296 Bacteria 2396
376 Ga0157378_10013819 3300013297 Bacteria 7059
377 Ga0157378_10014990 3300013297 Bacteria 6787
378 Ga0157378_10018768 3300013297 Bacteria 6079
379 Ga0163162_10007111 3300013306 Bacteria 10859
380 Ga0163162_10017313 3300013306 Bacteria 7051
381 Ga0163162_10067401 3300013306 Bacteria 3630
382 Ga0163162_10146596 3300013306 Bacteria 2477
383 Ga0157372_10009766 3300013307 Bacteria 10204
384 Ga0157372_10172741 3300013307 Bacteria 2500
385 Ga0157375_10000592 3300013308 Bacteria 32209
386 Ga0157375_10060795 3300013308 Bacteria 3748
387 Ga0157375_10109615 3300013308 Bacteria 2857
388 Ga0157375_10194923 3300013308 Bacteria 2181
389 Ga0163163_10000178 3300014325 Bacteria 65511
390 Ga0163163_10000390 3300014325 Bacteria 41759
391 Ga0163163_10024544 3300014325 Bacteria 5738
392 Ga0163163_10124213 3300014325 Bacteria 2617
393 Ga0163163_10216683 3300014325 Bacteria 1963
394 Ga0157380_10005888 3300014326 Bacteria 8577
395 Ga0157379_10026180 3300014968 Bacteria 5190
396 Ga0157379_10057487 3300014968 Bacteria 3476
397 Ga0157379_10173609 3300014968 Bacteria 1946
398 Ga0157376_10000095 3300014969 Bacteria 66245
399 Ga0157376_10026624 3300014969 Bacteria 4573
400 Ga0183363_1007 3300015690 Bacteria 315687
401 Ga0163161_10014022 3300017792 Bacteria 5581
402 Ga0163161_10132252 3300017792 Bacteria 1883
403 Ga0206353_10511878 3300020082 Bacteria 9374
404 Ga0213872_10021252 3300021361 Bacteria 2989
405 Ga0213876_10025782 3300021384 Bacteria 3099
406 Ga0213875_10002449 3300021388 Bacteria 11079
407 Ga0209147_100409 3300025229 Bacteria 29074
408 Ga0209563_100053 3300025230 Bacteria 332370
409 Ga0207427_100691 3300025231 Bacteria 15950
410 Ga0209148_1000159 3300025254 Bacteria 139560
411 Ga0209233_1000041 3300025261 Bacteria 515463
412 Ga0209455_1000045 3300025272 Bacteria 383329
413 Ga0209455_1000712 3300025272 Bacteria 19282
414 Ga0209676_1000045 3300025292 Bacteria 412331
415 Ga0209758_1000023 3300025297 Bacteria 612453
416 Ga0209050_1001213 3300025298 Bacteria 30197
417 Ga0207426_1023666 3300025302 Bacteria 2094
418 Ga0209257_1003077 3300025304 Bacteria 15026
419 Ga0207697_10000567 3300025315 Bacteria 20961
420 Ga0207697_10001832 3300025315 Bacteria 11393
421 Ga0207656_10007244 3300025321 Bacteria 4030
422 Ga0207682_10000223 3300025893 Bacteria 25597
423 Ga0207682_10000484 3300025893 Bacteria 18426
424 Ga0207680_10000519 3300025903 Bacteria 18402
425 Ga0207680_10000835 3300025903 Bacteria 14534
426 Ga0207680_10025100 3300025903 Bacteria 3283
427 Ga0207647_10000642 3300025904 Bacteria 27297
428 Ga0207647_10000721 3300025904 Bacteria 25921
429 Ga0207647_10002263 3300025904 Bacteria 14665
430 Ga0207647_10002940 3300025904 Bacteria 12822
431 Ga0207647_10010247 3300025904 Bacteria 6621
432 Ga0207647_10013639 3300025904 Bacteria 5627
433 Ga0207647_10018313 3300025904 Bacteria 4740
434 Ga0207647_10050501 3300025904 Bacteria 2574
435 Ga0207645_10001759 3300025907 Bacteria 17570
436 Ga0207645_10022807 3300025907 Bacteria 4070
437 Ga0207705_10000004 3300025909 Bacteria 705756
438 Ga0207705_10000022 3300025909 Bacteria 302232
439 Ga0207705_10000234 3300025909 Bacteria 55024
440 Ga0207705_10000358 3300025909 Bacteria 41389
441 Ga0207705_10000523 3300025909 Bacteria 32624
442 Ga0207705_10000591 3300025909 Bacteria 30449
443 Ga0207705_10002008 3300025909 Bacteria 15825
444 Ga0207705_10003948 3300025909 Bacteria 11276
445 Ga0207705_10009577 3300025909 Bacteria 7047
446 Ga0207705_10016189 3300025909 Bacteria 5350
447 Ga0207705_10016795 3300025909 Bacteria 5241
448 Ga0207705_10020620 3300025909 Bacteria 4706
449 Ga0207705_10026921 3300025909 Bacteria 4098
450 Ga0207705_10039446 3300025909 Bacteria 3385
451 Ga0207705_10060369 3300025909 Bacteria 2739
452 Ga0207705_10070763 3300025909 Bacteria 2528
453 Ga0207705_10170086 3300025909 Bacteria 1640
454 Ga0207654_10002580 3300025911 Bacteria 9198
455 Ga0207707_10022651 3300025912 Bacteria 5493
456 Ga0207707_10028574 3300025912 Bacteria 4874
457 Ga0207707_10041846 3300025912 Bacteria 4000
458 Ga0207695_10054257 3300025913 Bacteria 4187
459 Ga0207695_10088014 3300025913 Bacteria 3127
460 Ga0207695_10129274 3300025913 Bacteria 2484
461 Ga0207671_10013247 3300025914 Bacteria 6577
462 Ga0207671_10015467 3300025914 Bacteria 5971
463 Ga0207671_10089601 3300025914 Bacteria 2315
464 Ga0207660_10001191 3300025917 Bacteria 17454
465 Ga0207660_10001495 3300025917 Bacteria 15741
466 Ga0207660_10016467 3300025917 Bacteria 4894
467 Ga0207660_10068975 3300025917 Bacteria 2566
468 Ga0207660_10151805 3300025917 Bacteria 1780
469 Ga0207657_10000181 3300025919 Bacteria 65099
470 Ga0207657_10000598 3300025919 Bacteria 38277
471 Ga0207657_10000811 3300025919 Bacteria 33015
472 Ga0207657_10001262 3300025919 Bacteria 27027
473 Ga0207657_10001292 3300025919 Bacteria 26597
474 Ga0207657_10002661 3300025919 Bacteria 19282
475 Ga0207657_10002867 3300025919 Bacteria 18531
476 Ga0207657_10003476 3300025919 Bacteria 16805
477 Ga0207657_10004059 3300025919 Bacteria 15547
478 Ga0207657_10005880 3300025919 Bacteria 12781
479 Ga0207657_10009578 3300025919 Bacteria 9725
480 Ga0207657_10011947 3300025919 Bacteria 8594
481 Ga0207657_10014121 3300025919 Bacteria 7814
482 Ga0207657_10038490 3300025919 Bacteria 4257
483 Ga0207657_10050098 3300025919 Bacteria 3635
484 Ga0207657_10177204 3300025919 Bacteria 1725
485 Ga0207649_10000069 3300025920 Bacteria 91425
486 Ga0207649_10000159 3300025920 Bacteria 54703
487 Ga0207649_10052931 3300025920 Bacteria 2520
488 Ga0207649_10110120 3300025920 Bacteria 1838
489 Ga0207652_10005250 3300025921 Bacteria 10526
490 Ga0207652_10009331 3300025921 Bacteria 7890
491 Ga0207652_10056143 3300025921 Bacteria 3389
492 Ga0207652_10059174 3300025921 Bacteria 3302
493 Ga0207652_10163445 3300025921 Bacteria 1996
494 Ga0207681_10001149 3300025923 Bacteria 17095
495 Ga0207681_10002585 3300025923 Bacteria 11464
496 Ga0207681_10007424 3300025923 Bacteria 6713
497 Ga0207681_10040085 3300025923 Bacteria 3114
498 Ga0207681_10073226 3300025923 Bacteria 2395
499 Ga0207694_10001011 3300025924 Bacteria 24528
500 Ga0207694_10001930 3300025924 Bacteria 17169
501 Ga0207694_10005213 3300025924 Bacteria 10037
502 Ga0207694_10032229 3300025924 Bacteria 4010
503 Ga0207694_10060948 3300025924 Bacteria 2936
504 Ga0207694_10063155 3300025924 Bacteria 2885
505 Ga0207694_10093960 3300025924 Bacteria 2369
506 Ga0207650_10006425 3300025925 Bacteria 8010
507 Ga0207650_10006445 3300025925 Bacteria 7993
508 Ga0207650_10014607 3300025925 Bacteria 5454
509 Ga0207650_10017798 3300025925 Bacteria 4978
510 Ga0207650_10058972 3300025925 Bacteria 2859
511 Ga0207650_10060923 3300025925 Bacteria 2816
512 Ga0207650_10071147 3300025925 Bacteria 2616
513 Ga0207650_10083293 3300025925 Bacteria 2429
514 Ga0207659_10001202 3300025926 Bacteria 15453
515 Ga0207659_10012945 3300025926 Bacteria 5328
516 Ga0207659_10028342 3300025926 Bacteria 3805
517 Ga0207659_10054608 3300025926 Bacteria 2854
518 Ga0207687_10006208 3300025927 Bacteria 7914
519 Ga0207700_10101582 3300025928 Bacteria 2294
520 Ga0207664_10057109 3300025929 Bacteria 3102
521 Ga0207664_10097703 3300025929 Bacteria 2420
522 Ga0207644_10000066 3300025931 Bacteria 76450
523 Ga0207644_10000087 3300025931 Bacteria 67315
524 Ga0207644_10005675 3300025931 Bacteria 8126
525 Ga0207644_10009915 3300025931 Bacteria 6267
526 Ga0207644_10017158 3300025931 Bacteria 4883
527 Ga0207644_10022018 3300025931 Bacteria 4348
528 Ga0207644_10022504 3300025931 Bacteria 4306
529 Ga0207644_10053854 3300025931 Bacteria 2896
530 Ga0207644_10060416 3300025931 Bacteria 2742
531 Ga0207644_10062029 3300025931 Bacteria 2709
532 Ga0207644_10086162 3300025931 Bacteria 2332
533 Ga0207644_10118441 3300025931 Bacteria 2012
534 Ga0207690_10000120 3300025932 Bacteria 65338
535 Ga0207690_10001891 3300025932 Bacteria 12848
536 Ga0207690_10006698 3300025932 Bacteria 6826
537 Ga0207690_10010570 3300025932 Bacteria 5492
538 Ga0207690_10011907 3300025932 Bacteria 5201
539 Ga0207690_10023425 3300025932 Bacteria 3852
540 Ga0207690_10024809 3300025932 Bacteria 3759
541 Ga0207690_10068793 3300025932 Bacteria 2434
542 Ga0207706_10000143 3300025933 Bacteria 77680
543 Ga0207706_10000200 3300025933 Bacteria 65947
544 Ga0207706_10000869 3300025933 Bacteria 31117
545 Ga0207706_10001211 3300025933 Bacteria 26067
546 Ga0207706_10001924 3300025933 Bacteria 20398
547 Ga0207706_10002133 3300025933 Bacteria 19359
548 Ga0207706_10005314 3300025933 Bacteria 12007
549 Ga0207706_10007955 3300025933 Bacteria 9789
550 Ga0207706_10013128 3300025933 Bacteria 7536
551 Ga0207706_10019863 3300025933 Bacteria 6039
552 Ga0207706_10119958 3300025933 Bacteria 2312
553 Ga0207686_10000866 3300025934 Bacteria 18334
554 Ga0207709_10000047 3300025935 Bacteria 238649
555 Ga0207709_10000260 3300025935 Bacteria 62960
556 Ga0207709_10040064 3300025935 Bacteria 2803
557 Ga0207669_10000339 3300025937 Bacteria 21278
558 Ga0207669_10017220 3300025937 Bacteria 3700
559 Ga0207669_10028398 3300025937 Bacteria 3078
560 Ga0207669_10046968 3300025937 Bacteria 2554
561 Ga0207669_10153730 3300025937 Bacteria 1615
562 Ga0207704_10000064 3300025938 Bacteria 73788
563 Ga0207704_10017903 3300025938 Bacteria 3685
564 Ga0207691_10000901 3300025940 Bacteria 29470
565 Ga0207691_10002141 3300025940 Bacteria 19336
566 Ga0207691_10004966 3300025940 Bacteria 12835
567 Ga0207691_10015708 3300025940 Bacteria 7197
568 Ga0207691_10079142 3300025940 Bacteria 2958
569 Ga0207711_10000046 3300025941 Bacteria 153238
570 Ga0207711_10000180 3300025941 Bacteria 68214
571 Ga0207711_10005431 3300025941 Bacteria 10778
572 Ga0207711_10006337 3300025941 Bacteria 9978
573 Ga0207711_10012014 3300025941 Bacteria 7197
574 Ga0207711_10013118 3300025941 Bacteria 6881
575 Ga0207711_10031455 3300025941 Bacteria 4480
576 Ga0207711_10062080 3300025941 Bacteria 3223
577 Ga0207711_10086302 3300025941 Bacteria 2751
578 Ga0207711_10146526 3300025941 Bacteria 2128
579 Ga0207711_10192261 3300025941 Bacteria 1860
580 Ga0207711_10200489 3300025941 Bacteria 1821
581 Ga0207689_10000372 3300025942 Bacteria 42301
582 Ga0207661_10001732 3300025944 Bacteria 14921
583 Ga0207661_10023997 3300025944 Bacteria 4615
584 Ga0207661_10048583 3300025944 Bacteria 3373
585 Ga0207679_10000150 3300025945 Bacteria 57426
586 Ga0207679_10002410 3300025945 Bacteria 11527
587 Ga0207679_10020613 3300025945 Bacteria 4451
588 Ga0207679_10029125 3300025945 Bacteria 3841
589 Ga0207679_10112589 3300025945 Bacteria 2151
590 Ga0207679_10143643 3300025945 Bacteria 1932
591 Ga0207679_10176627 3300025945 Bacteria 1763
592 Ga0207679_10195950 3300025945 Bacteria 1684
593 Ga0207667_10000001 3300025949 Bacteria 1178522
594 Ga0207667_10000282 3300025949 Bacteria 69790
595 Ga0207667_10000443 3300025949 Bacteria 55591
596 Ga0207667_10002141 3300025949 Bacteria 24761
597 Ga0207667_10003333 3300025949 Bacteria 19825
598 Ga0207667_10016430 3300025949 Bacteria 8364
599 Ga0207667_10018675 3300025949 Bacteria 7768
600 Ga0207667_10028728 3300025949 Bacteria 6038
601 Ga0207667_10030274 3300025949 Bacteria 5858
602 Ga0207667_10039888 3300025949 Bacteria 5001
603 Ga0207667_10058747 3300025949 Bacteria 4032
604 Ga0207667_10167085 3300025949 Bacteria 2262
605 Ga0207651_10000010 3300025960 Bacteria 193754
606 Ga0207651_10001795 3300025960 Bacteria 9972
607 Ga0207651_10002905 3300025960 Bacteria 8275
608 Ga0207651_10005501 3300025960 Bacteria 6514
609 Ga0207651_10047111 3300025960 Bacteria 2904
610 Ga0207651_10055131 3300025960 Bacteria 2728
611 Ga0207651_10085909 3300025960 Bacteria 2284
612 Ga0207712_10000491 3300025961 Bacteria 32766
613 Ga0207712_10030220 3300025961 Bacteria 3640
614 Ga0207668_10000012 3300025972 Bacteria 182541
615 Ga0207668_10000060 3300025972 Bacteria 89732
616 Ga0207668_10000375 3300025972 Bacteria 28346
617 Ga0207668_10000576 3300025972 Bacteria 22928
618 Ga0207668_10000766 3300025972 Bacteria 19626
619 Ga0207668_10002897 3300025972 Bacteria 10066
620 Ga0207668_10006178 3300025972 Bacteria 7068
621 Ga0207668_10116834 3300025972 Bacteria 2012
622 Ga0207640_10000369 3300025981 Bacteria 29179
623 Ga0207640_10001408 3300025981 Bacteria 12992
624 Ga0207640_10001746 3300025981 Bacteria 11663
625 Ga0207640_10123868 3300025981 Bacteria 1857
626 Ga0207658_10000011 3300025986 Bacteria 239620
627 Ga0207658_10000022 3300025986 Bacteria 191235
628 Ga0207658_10004235 3300025986 Bacteria 9993
629 Ga0207658_10004678 3300025986 Bacteria 9481
630 Ga0207658_10005943 3300025986 Bacteria 8333
631 Ga0207658_10006908 3300025986 Bacteria 7726
632 Ga0207658_10008833 3300025986 Bacteria 6837
633 Ga0207658_10024141 3300025986 Bacteria 4251
634 Ga0207658_10024264 3300025986 Bacteria 4241
635 Ga0207658_10050633 3300025986 Bacteria 3057
636 Ga0207658_10064870 3300025986 Bacteria 2741
637 Ga0207658_10065947 3300025986 Bacteria 2721
638 Ga0207658_10069308 3300025986 Bacteria 2664
639 Ga0207658_10149835 3300025986 Bacteria 1899
640 Ga0207677_10000021 3300026023 Bacteria 131828
641 Ga0207677_10001176 3300026023 Bacteria 14230
642 Ga0207677_10006623 3300026023 Bacteria 6354
643 Ga0207677_10007012 3300026023 Bacteria 6201
644 Ga0207677_10008451 3300026023 Bacteria 5752
645 Ga0207703_10000538 3300026035 Bacteria 38989
646 Ga0207703_10001270 3300026035 Bacteria 23457
647 Ga0207703_10002126 3300026035 Bacteria 17427
648 Ga0207703_10002982 3300026035 Bacteria 14350
649 Ga0207703_10004732 3300026035 Bacteria 11107
650 Ga0207703_10006385 3300026035 Bacteria 9424
651 Ga0207703_10007171 3300026035 Bacteria 8867
652 Ga0207703_10029429 3300026035 Bacteria 4334
653 Ga0207639_10000144 3300026041 Bacteria 53312
654 Ga0207639_10000379 3300026041 Bacteria 30706
655 Ga0207639_10004498 3300026041 Bacteria 9404
656 Ga0207639_10013211 3300026041 Bacteria 5773
657 Ga0207639_10030651 3300026041 Bacteria 3946
658 Ga0207639_10041667 3300026041 Bacteria 3437
659 Ga0207639_10067971 3300026041 Bacteria 2775
660 Ga0207678_10000922 3300026067 Bacteria 26916
661 Ga0207678_10001423 3300026067 Bacteria 21936
662 Ga0207678_10005267 3300026067 Bacteria 11583
663 Ga0207678_10007936 3300026067 Bacteria 9360
664 Ga0207678_10015620 3300026067 Bacteria 6675
665 Ga0207678_10018378 3300026067 Bacteria 6138
666 Ga0207678_10021689 3300026067 Bacteria 5633
667 Ga0207678_10024061 3300026067 Bacteria 5322
668 Ga0207678_10097916 3300026067 Bacteria 2506
669 Ga0207702_10001142 3300026078 Bacteria 27150
670 Ga0207702_10007237 3300026078 Bacteria 9494
671 Ga0207702_10010107 3300026078 Bacteria 7907
672 Ga0207702_10016603 3300026078 Bacteria 6092
673 Ga0207702_10017939 3300026078 Bacteria 5855
674 Ga0207702_10023021 3300026078 Bacteria 5167
675 Ga0207702_10024630 3300026078 Bacteria 4994
676 Ga0207702_10031481 3300026078 Bacteria 4421
677 Ga0207702_10146049 3300026078 Bacteria 2146
678 Ga0207641_10000139 3300026088 Bacteria 105740
679 Ga0207641_10000228 3300026088 Bacteria 72357
680 Ga0207641_10001374 3300026088 Bacteria 24044
681 Ga0207641_10014111 3300026088 Bacteria 6549
682 Ga0207641_10014644 3300026088 Bacteria 6430
683 Ga0207641_10014741 3300026088 Bacteria 6408
684 Ga0207641_10056185 3300026088 Bacteria 3344
685 Ga0207641_10073677 3300026088 Bacteria 2943
686 Ga0207641_10077590 3300026088 Bacteria 2875
687 Ga0207641_10116142 3300026088 Bacteria 2381
688 Ga0207648_10000162 3300026089 Bacteria 68397
689 Ga0207648_10000962 3300026089 Bacteria 32576
690 Ga0207648_10005363 3300026089 Bacteria 12923
691 Ga0207648_10006581 3300026089 Bacteria 11535
692 Ga0207648_10010268 3300026089 Bacteria 8891
693 Ga0207676_10000345 3300026095 Bacteria 39937
694 Ga0207676_10002918 3300026095 Bacteria 12183
695 Ga0207676_10016784 3300026095 Bacteria 5300
696 Ga0207676_10040203 3300026095 Bacteria 3583
697 Ga0207676_10054631 3300026095 Bacteria 3131
698 Ga0207676_10126571 3300026095 Bacteria 2164
699 Ga0207676_10215742 3300026095 Bacteria 1705
700 Ga0207674_10000057 3300026116 Bacteria 113117
701 Ga0207674_10000345 3300026116 Bacteria 59803
702 Ga0207674_10001662 3300026116 Bacteria 28614
703 Ga0207674_10003393 3300026116 Bacteria 19537
704 Ga0207674_10005462 3300026116 Bacteria 15097
705 Ga0207674_10005506 3300026116 Bacteria 15034
706 Ga0207674_10009490 3300026116 Bacteria 11111
707 Ga0207674_10025338 3300026116 Bacteria 6327
708 Ga0207674_10030307 3300026116 Bacteria 5689
709 Ga0207674_10051362 3300026116 Bacteria 4208
710 Ga0207675_100022024 3300026118 Bacteria 5931
711 Ga0207675_100025578 3300026118 Bacteria 5494
712 Ga0207675_100094697 3300026118 Bacteria 2809
713 Ga0207683_10012311 3300026121 Bacteria 7302
714 Ga0207683_10045764 3300026121 Bacteria 3827
715 Ga0207683_10048111 3300026121 Bacteria 3734
716 Ga0207683_10071352 3300026121 Bacteria 3070
717 Ga0207698_10000058 3300026142 Bacteria 78048
718 Ga0207698_10000186 3300026142 Bacteria 38318
719 Ga0207698_10000220 3300026142 Bacteria 35458
720 Ga0207698_10000605 3300026142 Bacteria 21064
721 Ga0207698_10002303 3300026142 Bacteria 11300
722 Ga0207698_10003075 3300026142 Bacteria 10003
723 Ga0207698_10005264 3300026142 Bacteria 7956
724 Ga0207698_10016128 3300026142 Bacteria 5026
725 Ga0207698_10041945 3300026142 Bacteria 3414
726 Ga0207698_10051430 3300026142 Bacteria 3150
727 Ga0207698_10089381 3300026142 Bacteria 2515
728 Ga0207698_10180417 3300026142 Bacteria 1870
729 Ga0209813_10000047 3300027866 Bacteria 49657
730 Ga0209974_10000831 3300027876 Bacteria 10630
731 Ga0209974_10011811 3300027876 Bacteria 2928
732 Ga0207428_10000098 3300027907 Bacteria 120181
733 Ga0268266_10000841 3300028379 Bacteria 40070
734 Ga0268266_10002013 3300028379 Bacteria 22668
735 Ga0268266_10007283 3300028379 Bacteria 10005
736 Ga0268266_10012433 3300028379 Bacteria 7359
737 Ga0268266_10018502 3300028379 Bacteria 5936
738 Ga0268266_10024236 3300028379 Bacteria 5163
739 Ga0268266_10029757 3300028379 Bacteria 4640
740 Ga0268266_10035908 3300028379 Bacteria 4216
741 Ga0268265_10001537 3300028380 Bacteria 19180
742 Ga0268265_10002075 3300028380 Bacteria 15633
743 Ga0268265_10002132 3300028380 Bacteria 15340
744 Ga0268265_10007179 3300028380 Bacteria 7528
745 Ga0268265_10012417 3300028380 Bacteria 5772
746 Ga0268265_10018923 3300028380 Bacteria 4781
747 Ga0268265_10069878 3300028380 Bacteria 2728
748 Ga0268265_10080777 3300028380 Bacteria 2565
749 Ga0268265_10102576 3300028380 Bacteria 2314
750 Ga0268264_10000089 3300028381 Bacteria 234760
751 Ga0268264_10001319 3300028381 Bacteria 23348
752 Ga0268264_10002057 3300028381 Bacteria 17945
753 Ga0268264_10005121 3300028381 Bacteria 11112
754 Ga0268264_10012588 3300028381 Bacteria 6967
755 Ga0268264_10021730 3300028381 Bacteria 5239
756 Ga0307517_10024002 3300028786 Bacteria 7542
757 Ga0307517_10071277 3300028786 Bacteria 3117
758 Ga0316182_1136599 3300030745 Bacteria 6420
759 Ga0265327_10010345 3300031251 Bacteria 6576
760 Ga0307513_10114291 3300031456 Bacteria 2685
761 Ga0307408_100010470 3300031548 Bacteria 6114
762 Ga0307408_100025201 3300031548 Bacteria 4071
763 Ga0307408_100034484 3300031548 Bacteria 3545
764 Ga0307408_100088018 3300031548 Bacteria 2338
765 Ga0307405_10001415 3300031731 Bacteria 10090
766 Ga0307405_10004409 3300031731 Bacteria 6653
767 Ga0307405_10031728 3300031731 Bacteria 3114
768 Ga0307405_10049286 3300031731 Bacteria 2602
769 Ga0307405_10102123 3300031731 Bacteria 1925
770 Ga0307413_10011816 3300031824 Bacteria 4314
771 Ga0307413_10019228 3300031824 Bacteria 3604
772 Ga0307413_10020717 3300031824 Bacteria 3504
773 Ga0307413_10045390 3300031824 Bacteria 2604
774 Ga0307413_10058146 3300031824 Bacteria 2368
775 Ga0307410_10000614 3300031852 Bacteria 14673
776 Ga0307410_10010178 3300031852 Bacteria 5315
777 Ga0307410_10020753 3300031852 Bacteria 4027
778 Ga0307410_10051555 3300031852 Bacteria 2774
779 Ga0307410_10073683 3300031852 Bacteria 2375
780 Ga0307410_10089927 3300031852 Bacteria 2176
781 Ga0307410_10123577 3300031852 Bacteria 1891
782 Ga0307406_10027211 3300031901 Bacteria 3443
783 Ga0307406_10084199 3300031901 Bacteria 2122
784 Ga0307407_10003028 3300031903 Bacteria 6760
785 Ga0307407_10015512 3300031903 Bacteria 3770
786 Ga0307407_10030623 3300031903 Bacteria 2904
787 Ga0307407_10034252 3300031903 Bacteria 2778
788 Ga0307407_10037623 3300031903 Bacteria 2675
789 Ga0307407_10059297 3300031903 Bacteria 2228
790 Ga0307407_10062409 3300031903 Bacteria 2182
791 Ga0307412_10001051 3300031911 Bacteria 15766
792 Ga0307412_10020399 3300031911 Bacteria 4033
793 Ga0307412_10025327 3300031911 Bacteria 3673
794 Ga0307412_10053578 3300031911 Bacteria 2674
795 Ga0307412_10076356 3300031911 Bacteria 2301
796 Ga0307412_10092211 3300031911 Bacteria 2122
797 Ga0307409_100002345 3300031995 Bacteria 9844
798 Ga0307409_100033304 3300031995 Bacteria 3748
799 Ga0307409_100037140 3300031995 Bacteria 3588
800 Ga0307409_100038837 3300031995 Bacteria 3525
801 Ga0307409_100042903 3300031995 Bacteria 3391
802 Ga0307409_100063994 3300031995 Bacteria 2887
803 Ga0307409_100089120 3300031995 Bacteria 2521
804 Ga0307409_100138213 3300031995 Bacteria 2095
805 Ga0307416_100015410 3300032002 Bacteria 5280
806 Ga0307416_100034098 3300032002 Bacteria 3869
807 Ga0307414_10000223 3300032004 Bacteria 37440
808 Ga0307414_10009315 3300032004 Bacteria 5633
809 Ga0307414_10011707 3300032004 Bacteria 5156
810 Ga0307414_10013583 3300032004 Bacteria 4853
811 Ga0307414_10016316 3300032004 Bacteria 4512
812 Ga0307414_10042603 3300032004 Bacteria 3085
813 Ga0307414_10104387 3300032004 Bacteria 2140
814 Ga0307414_10137325 3300032004 Bacteria 1908
815 Ga0307411_10001495 3300032005 Bacteria 9612
816 Ga0307411_10006842 3300032005 Bacteria 5743
817 Ga0307411_10009972 3300032005 Bacteria 5032
818 Ga0307411_10031628 3300032005 Bacteria 3259
819 Ga0307411_10040218 3300032005 Bacteria 2964
820 Ga0307411_10070358 3300032005 Bacteria 2367
821 Ga0307411_10079700 3300032005 Bacteria 2249
822 Ga0307411_10106321 3300032005 Bacteria 1997
823 Ga0307411_10132959 3300032005 Bacteria 1821
824 Ga0307415_100001979 3300032126 Bacteria 10082
825 Ga0307415_100044767 3300032126 Bacteria 2961
826 Ga0307415_100056559 3300032126 Bacteria 2690
827 Ga0373943_0004664 3300035170 Bacteria 6200
828 Ga0373962_0023276 3300035242 Bacteria 1649
829 Ga0373931_0006998 3300035691 Bacteria 5308
830 Ga0373935_0013577 3300035692 Bacteria 4917
831 Ga0373933_0017273 3300035724 Bacteria 4046
832 Ga0373947_0036505 3300035725 Bacteria 2914
833 Ga0373925_0065984 3300037068 Bacteria 2727
834 Ga0395899_0000154 3300037312 Bacteria 104239
835 Ga0395899_0000469 3300037312 Bacteria 45619
836 Ga0395899_0000971 3300037312 Bacteria 26509
837 Ga0395899_0008824 3300037312 Bacteria 7759
838 Ga0395899_0009507 3300037312 Bacteria 7460
839 Ga0395899_0010217 3300037312 Bacteria 7190
840 Ga0395899_0028725 3300037312 Bacteria 4185
841 Ga0395899_0035670 3300037312 Bacteria 3732
842 Ga0395899_0055865 3300037312 Bacteria 2919
843 Ga0395899_0063570 3300037312 Bacteria 2715
844 Ga0395899_0070915 3300037312 Bacteria 2550
845 Ga0395899_0077207 3300037312 Bacteria 2429
846 Ga0395899_0086735 3300037312 Bacteria 2273
847 Ga0395899_0108823 3300037312 Bacteria 1994
848 Ga0395899_0126011 3300037312 Bacteria 1831
849 Ga0395899_0129818 3300037312 Bacteria 1800
850 Ga0395900_0000036 3300037418 Bacteria 250619
851 Ga0395900_0000293 3300037418 Bacteria 75318
852 Ga0395900_0000537 3300037418 Bacteria 53200
853 Ga0395900_0001293 3300037418 Bacteria 30511
854 Ga0395900_0016530 3300037418 Bacteria 7526
855 Ga0395900_0017453 3300037418 Bacteria 7327
856 Ga0395900_0019372 3300037418 Bacteria 6941
857 Ga0395900_0049441 3300037418 Bacteria 4332
858 Ga0395900_0054644 3300037418 Bacteria 4112
859 Ga0395900_0057054 3300037418 Bacteria 4020
860 Ga0395900_0062021 3300037418 Bacteria 3843
861 Ga0395900_0084867 3300037418 Bacteria 3254
862 Ga0395900_0126755 3300037418 Bacteria 2618
863 Ga0395898_0000219 3300037466 Bacteria 146838
864 Ga0395898_0000732 3300037466 Bacteria 57501
865 Ga0395898_0002321 3300037466 Bacteria 22734
866 Ga0395898_0012439 3300037466 Bacteria 8797
867 Ga0395898_0019716 3300037466 Bacteria 6859
868 Ga0395898_0034157 3300037466 Bacteria 5070
869 Ga0395898_0045014 3300037466 Bacteria 4339
870 Ga0395898_0048457 3300037466 Bacteria 4166
871 Ga0395898_0055495 3300037466 Bacteria 3864
872 Ga0395898_0058065 3300037466 Bacteria 3768
873 Ga0395898_0215461 3300037466 Bacteria 1831
874 Ga0395905_0000092 3300037471 Bacteria 149300
875 Ga0395905_0000094 3300037471 Bacteria 147776
876 Ga0395905_0000675 3300037471 Bacteria 45263
877 Ga0395905_0000730 3300037471 Bacteria 43339
878 Ga0395905_0000852 3300037471 Bacteria 39836
879 Ga0395905_0003469 3300037471 Bacteria 16851
880 Ga0395905_0011073 3300037471 Bacteria 8730
881 Ga0395905_0012841 3300037471 Bacteria 8051
882 Ga0395905_0014738 3300037471 Bacteria 7454
883 Ga0395905_0014833 3300037471 Bacteria 7431
884 Ga0395905_0019796 3300037471 Bacteria 6380
885 Ga0395905_0024814 3300037471 Bacteria 5658
886 Ga0395905_0025675 3300037471 Bacteria 5555
887 Ga0395905_0028903 3300037471 Bacteria 5225
888 Ga0395905_0039004 3300037471 Bacteria 4456
889 Ga0395905_0040395 3300037471 Bacteria 4376
890 Ga0395905_0040523 3300037471 Bacteria 4369
891 Ga0395905_0055855 3300037471 Bacteria 3695
892 Ga0395905_0057376 3300037471 Bacteria 3642
893 Ga0395905_0065466 3300037471 Bacteria 3402
894 Ga0395905_0080416 3300037471 Bacteria 3054
895 Ga0395905_0200964 3300037471 Bacteria 1868
896 Ga0395905_0215826 3300037471 Bacteria 1796
897 Ga0436364_1555870 3300037853 Bacteria 25716
898 Ga0395901_0000036 3300038443 Bacteria 214274
899 Ga0395901_0000188 3300038443 Bacteria 78908
900 Ga0395901_0000228 3300038443 Bacteria 70677
901 Ga0395901_0001956 3300038443 Bacteria 21217
902 Ga0395901_0002066 3300038443 Bacteria 20600
903 Ga0395901_0006402 3300038443 Bacteria 11930
904 Ga0395901_0006785 3300038443 Bacteria 11563
905 Ga0395901_0011987 3300038443 Bacteria 8794
906 Ga0395901_0014286 3300038443 Bacteria 8083
907 Ga0395901_0015498 3300038443 Bacteria 7761
908 Ga0395901_0017047 3300038443 Bacteria 7404
909 Ga0395901_0025726 3300038443 Bacteria 6042
910 Ga0395901_0028527 3300038443 Bacteria 5740
911 Ga0395901_0035191 3300038443 Bacteria 5174
912 Ga0395901_0047299 3300038443 Bacteria 4467
913 Ga0395901_0053143 3300038443 Bacteria 4210
914 Ga0395901_0064358 3300038443 Bacteria 3817
915 Ga0395901_0100058 3300038443 Bacteria 3041
916 Ga0395901_0135083 3300038443 Bacteria 2592
917 Ga0395901_0157444 3300038443 Bacteria 2385
918 Ga0436365_0878649 3300039437 Bacteria 21038
919 Ga0436361_0468477 3300039447 Bacteria 4703
920 Ga0436363_1409835 3300039450 Bacteria 2498
921 Ga0439445_0000526 3300042004 Bacteria 7750
922 Ga0439432_019091 3300042006 Bacteria 2287
923 Ga0450889_000450 3300042144 Bacteria 4550
924 Ga0439458_0001172 3300042157 Bacteria 6657
925 Ga0439458_0001350 3300042157 Bacteria 6184
926 Ga0466963_0001296 3300044694 Bacteria 13283
927 Ga0466963_0015309 3300044694 Bacteria 4745
928 Ga0466963_0067603 3300044694 Bacteria 2398
929 Ga0466964_0012592 3300044706 Bacteria 3202
930 Ga0466971_0047997 3300044719 Bacteria 1919
931 Ga0466957_0013396 3300044842 Bacteria 4755
932 Ga0466957_0016425 3300044842 Bacteria 4330
933 Ga0466957_0024478 3300044842 Bacteria 3573
934 Ga0466960_0007144 3300044901 Bacteria 4518
935 Ga0466959_0029684 3300045049 Bacteria 4051
936 Ga0466959_0053129 3300045049 Bacteria 2963
937 Ga0451576_0000017 3300045051 Bacteria 558261
938 Ga0466958_0007994 3300045836 Bacteria 5847
939 Ga0466958_0039451 3300045836 Bacteria 2838
940 Ga0466958_0074061 3300045836 Bacteria 2086
941 Ga0466967_0001666 3300045976 Bacteria 13169
942 Ga0466967_0003308 3300045976 Bacteria 10468
943 Ga0466967_0004245 3300045976 Bacteria 9621
944 Ga0466967_0045251 3300045976 Bacteria 3823
945 Ga0466967_0068584 3300045976 Bacteria 3167
946 Ga0466967_0107120 3300045976 Bacteria 2563
947 Ga0466967_0206424 3300045976 Bacteria 1862
948 Ga0495627_000217 3300046453 Bacteria 62536
949 Ga0495638_0000011 3300046460 Bacteria 442453
950 Ga0495650_0000559 3300046471 Bacteria 52755
951 Ga0495650_0004548 3300046471 Bacteria 9468
952 Ga0495662_0015752 3300046476 Bacteria 3669
953 Ga0495596_0002704 3300046500 Bacteria 9333
954 Ga0495596_0004636 3300046500 Bacteria 6652
955 Ga0495583_0000242 3300046506 Bacteria 90367
956 Ga0495583_0012894 3300046506 Bacteria 4698
957 Ga0495606_0000379 3300046507 Bacteria 75426
958 Ga0495606_0027407 3300046507 Bacteria 4041
959 Ga0495610_0000030 3300046512 Bacteria 265950
960 Ga0495610_0000247 3300046512 Bacteria 56834
961 Ga0495610_0001936 3300046512 Bacteria 17837
962 Ga0495616_0000017 3300046513 Bacteria 167324
963 Ga0495632_0011734 3300046519 Bacteria 5101
964 Ga0495637_0029368 3300046520 Bacteria 2448
965 Ga0495643_0000110 3300046522 Bacteria 135600
966 Ga0495643_0001844 3300046522 Bacteria 18000
967 Ga0495643_0003069 3300046522 Bacteria 12544
968 Ga0495643_0003519 3300046522 Bacteria 11386
969 Ga0495643_0035456 3300046522 Bacteria 2747
970 Ga0495648_0000023 3300046524 Bacteria 240174
971 Ga0495648_0004490 3300046524 Bacteria 11912
972 Ga0495663_0001663 3300046525 Bacteria 6930
973 Ga0495663_0009714 3300046525 Bacteria 2670
974 Ga0495621_0000006 3300046539 Bacteria 44306
975 Ga0495621_0017785 3300046539 Bacteria 2302
976 Ga0495622_0007646 3300046557 Bacteria 5020
977 Ga0495633_0000758 3300046558 Bacteria 29025
978 Ga0495633_0033855 3300046558 Bacteria 2461
979 Ga0495668_0000002 3300046616 Bacteria 763179
980 Ga0495668_0000548 3300046616 Bacteria 46481
981 Ga0495668_0011823 3300046616 Bacteria 5203
982 Ga0495668_0069012 3300046616 Bacteria 1944
983 Ga0495625_0000757 3300046660 Bacteria 45128
984 Ga0495625_0002711 3300046660 Bacteria 18789
985 Ga0495625_0009826 3300046660 Bacteria 7962
986 Ga0495669_0000385 3300046684 Bacteria 22116
987 Ga0495669_0000657 3300046684 Bacteria 15035
988 Ga0495669_0002162 3300046684 Bacteria 8074
989 Ga0495669_0024186 3300046684 Bacteria 2647
990 Ga0495669_0036144 3300046684 Bacteria 2183
991 Ga0495670_0000012 3300046691 Bacteria 170426
992 Ga0495670_0000226 3300046691 Bacteria 25540
993 Ga0495671_0000012 3300046692 Bacteria 358632
994 Ga0495671_0013838 3300046692 Bacteria 4354
995 Ga0495600_0001428 3300046809 Bacteria 13211
996 Ga0495683_0005196 3300047323 Bacteria 7251
997 Ga0495687_000192 3300047443 Bacteria 87877
998 Ga0495687_000611 3300047443 Bacteria 41726
999 Ga0495677_0000380 3300047445 Bacteria 19092
1000 Ga0495677_0013315 3300047445 Bacteria 2993
1001 Ga0495673_0000029 3300047469 Bacteria 471019
1002 Ga0495681_0000011 3300047470 Bacteria 201843
1003 Ga0495686_0001111 3300047472 Bacteria 31908
1004 Ga0495615_0000025 3300048090 Bacteria 49753
1005 Ga0495626_0002996 3300048091 Bacteria 11188
1006 Ga0496100_0014306 3300048903 Bacteria 4604
1007 Ga0496100_0029753 3300048903 Bacteria 3381
1008 Ga0496101_0007982 3300048904 Bacteria 6897
1009 Ga0496101_0008790 3300048904 Bacteria 6609
1010 Ga0496101_0183868 3300048904 Bacteria 1610
1011 Ga0496102_0000435 3300048905 Bacteria 47703
1012 Ga0496102_0001012 3300048905 Bacteria 26288
1013 Ga0496102_0052842 3300048905 Bacteria 3703
1014 Ga0496103_0000177 3300048906 Bacteria 65489
1015 Ga0496103_0000246 3300048906 Bacteria 52692
1016 Ga0496103_0070990 3300048906 Bacteria 2179
1017 Ga0496104_0000227 3300048907 Bacteria 49451
1018 Ga0496104_0053175 3300048907 Bacteria 3825
1019 Ga0496105_0000158 3300048908 Bacteria 44955
1020 Ga0496105_0000159 3300048908 Bacteria 44784
1021 Ga0496107_0002491 3300048910 Bacteria 11965
1022 Ga0496107_0002882 3300048910 Bacteria 11371
1023 Ga0496108_0012284 3300048911 Bacteria 6965
1024 Ga0496108_0025304 3300048911 Bacteria 4890
1025 Ga0496108_0120246 3300048911 Bacteria 2252
1026 Ga0496109_0006390 3300048912 Bacteria 9922
1027 Ga0496109_0022917 3300048912 Bacteria 5535
1028 Ga0496109_0035592 3300048912 Bacteria 4492
1029 Ga0496109_0044235 3300048912 Bacteria 4039
1030 Ga0496109_0077395 3300048912 Bacteria 3061
1031 Ga0496109_0079033 3300048912 Bacteria 3030
1032 Ga0496110_0012390 3300048913 Bacteria 7010
1033 Ga0496110_0028105 3300048913 Bacteria 4827
1034 Ga0496110_0041422 3300048913 Bacteria 4018
1035 Ga0496111_0001738 3300048914 Bacteria 12752
1036 Ga0496111_0015596 3300048914 Bacteria 5221
1037 Ga0496111_0022359 3300048914 Bacteria 4426
1038 Ga0496111_0033332 3300048914 Bacteria 3672
1039 Ga0496111_0037205 3300048914 Bacteria 3483
1040 Ga0496111_0054945 3300048914 Bacteria 2880
1041 Ga0496111_0060566 3300048914 Bacteria 2744
1042 Ga0496111_0093342 3300048914 Bacteria 2206
1043 Ga0496111_0117158 3300048914 Bacteria 1965
1044 Ga0496112_0004679 3300048915 Bacteria 11640
1045 Ga0496112_0005602 3300048915 Bacteria 10891
1046 Ga0496112_0007583 3300048915 Bacteria 9641
1047 Ga0496112_0011522 3300048915 Bacteria 8078
1048 Ga0496112_0012022 3300048915 Bacteria 7939
1049 Ga0496112_0069187 3300048915 Bacteria 3487
1050 Ga0496112_0098035 3300048915 Bacteria 2901
1051 Ga0496113_0000325 3300048916 Bacteria 22755
1052 Ga0496113_0002278 3300048916 Bacteria 11074
1053 Ga0496113_0002426 3300048916 Bacteria 10837
1054 Ga0496113_0011413 3300048916 Bacteria 5924
1055 Ga0496114_0000019 3300048917 Bacteria 244365
1056 Ga0496114_0006747 3300048917 Bacteria 9043
1057 Ga0496114_0017397 3300048917 Bacteria 5802
1058 Ga0496114_0048857 3300048917 Bacteria 3520
1059 Ga0496115_0000314 3300048918 Bacteria 41118
1060 Ga0496115_0000410 3300048918 Bacteria 35215
1061 Ga0496115_0002002 3300048918 Bacteria 14567
1062 Ga0496116_0000028 3300048919 Bacteria 424086
1063 Ga0496116_0011870 3300048919 Bacteria 7168
1064 Ga0496116_0024323 3300048919 Bacteria 4483
1065 Ga0496117_0004031 3300048920 Bacteria 16542
1066 Ga0496117_0009245 3300048920 Bacteria 9211
1067 Ga0496117_0023299 3300048920 Bacteria 4940
1068 Ga0496118_0000850 3300048921 Bacteria 48481
1069 Ga0496118_0002103 3300048921 Bacteria 27954
1070 Ga0496119_0000040 3300048922 Bacteria 208180
1071 Ga0496119_0019836 3300048922 Bacteria 4929
1072 Ga0496120_0000731 3300048923 Bacteria 48124
1073 Ga0496120_0041279 3300048923 Bacteria 2704
1074 Ga0496121_0000021 3300048924 Bacteria 478544
1075 Ga0496121_0002231 3300048924 Bacteria 30224
1076 Ga0496121_0003190 3300048924 Bacteria 23642
1077 Ga0496121_0003456 3300048924 Bacteria 22526
1078 Ga0496121_0005047 3300048924 Bacteria 17243
1079 Ga0496121_0153502 3300048924 Bacteria 1691
1080 Ga0496122_0003493 3300048925 Bacteria 20651
1081 Ga0496122_0026578 3300048925 Bacteria 4982
1082 Ga0496122_0038426 3300048925 Bacteria 3836
1083 Ga0496123_0001478 3300048926 Bacteria 32621
1084 Ga0496123_0001658 3300048926 Bacteria 29886
1085 Ga0496123_0001766 3300048926 Bacteria 28525
1086 Ga0496124_0000477 3300048927 Bacteria 68917
1087 Ga0496124_0004357 3300048927 Bacteria 16557
1088 Ga0496124_0004810 3300048927 Bacteria 15546
1089 Ga0496124_0007021 3300048927 Bacteria 12067
1090 Ga0496124_0016280 3300048927 Bacteria 7080
1091 Ga0496124_0023806 3300048927 Bacteria 5582
1092 Ga0496124_0036125 3300048927 Bacteria 4314
1093 Ga0496125_0003240 3300048928 Bacteria 20059
1094 Ga0496125_0003627 3300048928 Bacteria 18515
1095 Ga0496125_0036244 3300048928 Bacteria 4311
1096 Ga0496126_0000044 3300048929 Bacteria 335904
1097 Ga0496126_0000079 3300048929 Bacteria 222463
1098 Ga0496126_0004511 3300048929 Bacteria 16586
1099 Ga0496126_0006047 3300048929 Bacteria 13583
1100 Ga0501032_0000950 3300049569 Bacteria 23379
1101 Ga0501032_0008177 3300049569 Bacteria 7627
1102 Ga0501033_0001846 3300049570 Bacteria 18437
1103 Ga0501034_0053445 3300049571 Bacteria 4066
1104 Ga0501037_0001194 3300049573 Bacteria 19180
1105 Ga0501038_0000615 3300049574 Bacteria 31769
1106 Ga0501039_0003515 3300049575 Bacteria 11732
1107 Ga0501039_0032263 3300049575 Bacteria 4038
1108 Ga0501046_0002184 3300049580 Bacteria 18468
1109 Ga0501047_0000644 3300049581 Bacteria 36698
1110 Ga0501048_0024431 3300049582 Bacteria 4411
1111 Ga0501067_0000034 3300049583 Bacteria 84068
1112 Ga0501067_0087781 3300049583 Bacteria 1726
1113 Ga0501068_0002041 3300049584 Bacteria 10769
1114 Ga0501069_0000395 3300049585 Bacteria 19769
1115 Ga0501070_0001040 3300049586 Bacteria 24987
1116 Ga0501073_0000013 3300049589 Bacteria 160591
1117 Ga0501074_0003380 3300049590 Bacteria 11305
1118 Ga0501077_0000423 3300049593 Bacteria 25601
1119 Ga0501233_003014 3300049668 Bacteria 3009
1120 Ga0501246_001605 3300049676 Bacteria 1746
1121 Ga0501249_000105 3300049679 Bacteria 26462
1122 Ga0501080_0004631 3300049742 Bacteria 12256
1123 Ga0501080_0005180 3300049742 Bacteria 11615
1124 Ga0501080_0049273 3300049742 Bacteria 3921
1125 Ga0501083_0004995 3300049744 Bacteria 9396
1126 Ga0501044_0007097 3300049823 Bacteria 12327
1127 Ga0501044_0011184 3300049823 Bacteria 9733
1128 Ga0501044_0012195 3300049823 Bacteria 9304
1129 nmdc:mga03683_42_c1 3300050489 Bacteria 60876
1130 nmdc:mga03683_435_c1 3300050489 Bacteria 12060
1131 nmdc:mga03n38_959_c1 3300050490 Bacteria 7829
1132 nmdc:mga00v17_6840_c1 3300050491 Bacteria 6062
1133 nmdc:mga0k408_3_c1 3300050493 Bacteria 243777
1134 nmdc:mga07m45_164_c1 3300050496 Bacteria 26629
1135 nmdc:mga07m45_6_c1 3300050496 Bacteria 260521
1136 nmdc:mga08y16_20868_c1 3300050511 Bacteria 5428
1137 nmdc:mga08y16_385_c1 3300050511 Bacteria 40429
1138 nmdc:mga0sz30_298_c2 3300050516 Bacteria 7546
1139 Ga0500643_000137 3300053087 Bacteria 74194
1140 Ga0500643_002059 3300053087 Bacteria 10746
1141 Ga0500643_009912 3300053087 Bacteria 3595
1142 Ga0500647_0069397 3300053091 Bacteria 1695
1143 Ga0500595_000440 3300053119 Bacteria 25956
1144 Ga0500595_001838 3300053119 Bacteria 10986
1145 Ga0500607_001590 3300053121 Bacteria 20063
1146 Ga0500608_001066 3300053122 Bacteria 9814
1147 Ga0500658_0000044 3300053134 Bacteria 72423
1148 Ga0500588_0000160 3300053146 Bacteria 8978
1149 Ga0500604_0000072 3300053151 Bacteria 36198
1150 Ga0500616_0000140 3300053153 Bacteria 122250
1151 Ga0500616_0000906 3300053153 Bacteria 32497
1152 Ga0500622_0012157 3300053156 Bacteria 4670
1153 Ga0500624_000038 3300053157 Bacteria 93803
1154 Ga0500627_0000010 3300053158 Bacteria 152372
1155 Ga0500627_0006158 3300053158 Bacteria 4058
1156 Ga0500567_012701 3300053723 Bacteria 4048
1157 Ga0500625_000017 3300053729 Bacteria 96168
1158 Ga0500645_000116 3300053730 Bacteria 63698
1159 Ga0500645_002782 3300053730 Bacteria 7545
1160 Ga0501084_0069783 3300054114 Bacteria 2943
1161 Ga0500661_001005 3300055283 Bacteria 5297
1162 Ga0466962_0001131 3300061719 Bacteria 12328

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0070915 Ga0395899_0070915_43_1401 448
2 3300014325 Ga0163163_10216683 Ga0163163_102166832 453
3 3300005539 Ga0068853_100174435 Ga0068853_1001744351 461
4 3300009092 Ga0105250_10015557 Ga0105250_100155571 464
5 3300025924 Ga0207694_10063155 Ga0207694_100631552 469
6 3300003781 Ga0055536_1013547 Ga0055536_10135472 476
7 3300026078 Ga0207702_10146049 Ga0207702_101460492 483
8 3300005616 Ga0068852_100001658 Ga0068852_10000165812 484
9 3300026116 Ga0207674_10051362 Ga0207674_100513624 484
10 3300026142 Ga0207698_10000186 Ga0207698_1000018615 484
11 3300042157 Ga0439458_0001350 Ga0439458_0001350_3530_5089 484
12 3300044901 Ga0466960_0007144 Ga0466960_0007144_29_1594 484
13 3300045836 Ga0466958_0039451 Ga0466958_0039451_1125_2690 484
14 3300048927 Ga0496124_0023806 Ga0496124_0023806_4069_5547 486
15 3300049676 Ga0501246_001605 Ga0501246_001605_215_1693 486
16 3300009094 Ga0111539_10001101 Ga0111539_1000110121 487
17 3300010375 Ga0105239_10316328 Ga0105239_103163282 487
18 3300027907 Ga0207428_10000098 Ga0207428_1000009821 487
19 3300037312 Ga0395899_0008824 Ga0395899_0008824_269_1750 487
20 3300037418 Ga0395900_0126755 Ga0395900_0126755_21_1502 487
21 3300037466 Ga0395898_0000732 Ga0395898_0000732_47942_49423 487
22 3300037471 Ga0395905_0028903 Ga0395905_0028903_3635_5116 487
23 3300038443 Ga0395901_0014286 Ga0395901_0014286_6339_7820 487
24 3300038443 Ga0395901_0157444 Ga0395901_0157444_874_2355 487
25 3300048911 Ga0496108_0120246 Ga0496108_0120246_752_2233 487
26 3300050511 nmdc:mga08y16_385_c1 nmdc:mga08y16_385_c1_18763_20289 487
27 3300055283 Ga0500661_001005 Ga0500661_001005_3782_5263 487
28 3300013308 Ga0157375_10194923 Ga0157375_101949232 488
29 3300053122 Ga0500608_001066 Ga0500608_001066_167_1726 490
30 3300048912 Ga0496109_0077395 Ga0496109_0077395_1371_2906 493
31 3300037471 Ga0395905_0080416 Ga0395905_0080416_59_1561 494
32 3300047472 Ga0495686_0001111 Ga0495686_0001111_9489_10997 494
33 3300049668 Ga0501233_003014 Ga0501233_003014_738_2303 495
34 3300025937 Ga0207669_10017220 Ga0207669_100172203 496
35 3300032005 Ga0307411_10070358 Ga0307411_100703583 496
36 3300009177 Ga0105248_10262841 Ga0105248_102628411 497
37 3300048917 Ga0496114_0017397 Ga0496114_0017397_2463_4013 497
38 3300049569 Ga0501032_0008177 Ga0501032_0008177_3295_4821 497
39 3300049570 Ga0501033_0001846 Ga0501033_0001846_2841_4367 497
40 3300049573 Ga0501037_0001194 Ga0501037_0001194_4080_5606 497
41 3300049574 Ga0501038_0000615 Ga0501038_0000615_2288_3814 497
42 3300049575 Ga0501039_0003515 Ga0501039_0003515_4337_5863 497
43 3300049580 Ga0501046_0002184 Ga0501046_0002184_2672_4198 497
44 3300049582 Ga0501048_0024431 Ga0501048_0024431_2775_4304 497
45 3300049585 Ga0501069_0000395 Ga0501069_0000395_13602_15128 497
46 3300049586 Ga0501070_0001040 Ga0501070_0001040_15398_16924 497
47 3300049590 Ga0501074_0003380 Ga0501074_0003380_4800_6326 497
48 3300049742 Ga0501080_0004631 Ga0501080_0004631_4150_5676 497
49 3300049744 Ga0501083_0004995 Ga0501083_0004995_2916_4442 497
50 3300049823 Ga0501044_0011184 Ga0501044_0011184_6286_7812 497
51 3300054114 Ga0501084_0069783 Ga0501084_0069783_203_1729 497
52 3300009093 Ga0105240_10037918 Ga0105240_100379187 498
53 3300005328 Ga0070676_10001868 Ga0070676_100018682 500
54 3300005333 Ga0070677_10000990 Ga0070677_100009904 500
55 3300005347 Ga0070668_100000886 Ga0070668_1000008864 500
56 3300005354 Ga0070675_100008675 Ga0070675_1000086757 500
57 3300005355 Ga0070671_100016717 Ga0070671_1000167176 500
58 3300005456 Ga0070678_100011404 Ga0070678_1000114046 500
59 3300005617 Ga0068859_100013337 Ga0068859_1000133375 500
60 3300005618 Ga0068864_100016570 Ga0068864_1000165705 500
61 3300005844 Ga0068862_100012869 Ga0068862_1000128694 500
62 3300006931 Ga0097620_100013336 Ga0097620_1000133365 500
63 3300013306 Ga0163162_10146596 Ga0163162_101465962 500
64 3300014326 Ga0157380_10005888 Ga0157380_100058887 500
65 3300025315 Ga0207697_10001832 Ga0207697_100018326 500
66 3300025893 Ga0207682_10000484 Ga0207682_1000048416 500
67 3300025907 Ga0207645_10001759 Ga0207645_1000175913 500
68 3300025926 Ga0207659_10001202 Ga0207659_100012025 500
69 3300025933 Ga0207706_10001924 Ga0207706_1000192415 500
70 3300025940 Ga0207691_10002141 Ga0207691_1000214114 500
71 3300025972 Ga0207668_10000766 Ga0207668_100007662 500
72 3300025986 Ga0207658_10004235 Ga0207658_100042355 500
73 3300026089 Ga0207648_10010268 Ga0207648_100102683 500
74 3300026116 Ga0207674_10030307 Ga0207674_100303073 500
75 3300026118 Ga0207675_100022024 Ga0207675_1000220245 500
76 3300026121 Ga0207683_10045764 Ga0207683_100457645 500
77 3300050511 nmdc:mga08y16_20868_c1 nmdc:mga08y16_20868_c1_2545_4179 500
78 iso_pu_bacteria 2896184354 2896186668 500
79 3300009093 Ga0105240_10092759 Ga0105240_100927593 501
80 3300005331 Ga0070670_100009603 Ga0070670_1000096038 502
81 3300005458 Ga0070681_10078737 Ga0070681_100787372 502
82 3300005563 Ga0068855_100000263 Ga0068855_10000026330 502
83 3300005614 Ga0068856_100012456 Ga0068856_1000124563 502
84 3300009093 Ga0105240_10005402 Ga0105240_100054022 502
85 3300014325 Ga0163163_10024544 Ga0163163_100245447 502
86 3300025912 Ga0207707_10028574 Ga0207707_100285742 502
87 3300025913 Ga0207695_10054257 Ga0207695_100542572 502
88 3300025925 Ga0207650_10006445 Ga0207650_100064454 502
89 3300025949 Ga0207667_10002141 Ga0207667_1000214120 502
90 3300026078 Ga0207702_10007237 Ga0207702_100072372 502
91 3300046453 Ga0495627_000217 Ga0495627_000217_60077_61585 502
92 3300046471 Ga0495650_0000559 Ga0495650_0000559_13085_14593 502
93 3300047470 Ga0495681_0000011 Ga0495681_0000011_157122_158630 502
94 3300049569 Ga0501032_0000950 Ga0501032_0000950_2995_4557 502
95 iso_pu_bacteria 2738541275 2738710054 502
96 iso_pu_bacteria 2738541301 2738848479 502
97 iso_pu_bacteria 2738541304 2738864208 502
98 iso_pu_bacteria 2738543022 2739296726 502
99 iso_pu_bacteria 2738543033 2739358404 502
100 iso_pu_bacteria 2928100450 2928101757 502
101 iso_pu_bacteria 2928959182 2928959847 502
102 3300005548 Ga0070665_100005394 Ga0070665_1000053945 503
103 3300009551 Ga0105238_10000713 Ga0105238_1000071313 503
104 3300025924 Ga0207694_10001930 Ga0207694_100019304 503
105 3300025986 Ga0207658_10024141 Ga0207658_100241412 503
106 3300031731 Ga0307405_10031728 Ga0307405_100317282 503
107 3300031901 Ga0307406_10027211 Ga0307406_100272113 503
108 3300032005 Ga0307411_10106321 Ga0307411_101063212 503
109 3300053091 Ga0500647_0069397 Ga0500647_0069397_102_1661 503
110 3300053146 Ga0500588_0000160 Ga0500588_0000160_2673_4289 503
111 iso_pu_bacteria 2848297114 2848297621 503
112 3300003791 Ga0055530_10000137 Ga0055530_1000013738 504
113 3300005339 Ga0070660_100021489 Ga0070660_1000214894 504
114 3300025919 Ga0207657_10005880 Ga0207657_100058802 504
115 3300049571 Ga0501034_0053445 Ga0501034_0053445_2387_3958 504
116 3300049583 Ga0501067_0000034 Ga0501067_0000034_74567_76135 504
117 3300049584 Ga0501068_0002041 Ga0501068_0002041_529_2097 504
118 3300049589 Ga0501073_0000013 Ga0501073_0000013_16068_17636 504
119 3300049593 Ga0501077_0000423 Ga0501077_0000423_8888_10456 504
120 3300049742 Ga0501080_0005180 Ga0501080_0005180_9408_10976 504
121 3300049823 Ga0501044_0012195 Ga0501044_0012195_1533_3101 504
122 iso_pu_bacteria 2739367664 2739649858 504
123 iso_pu_bacteria 2739367865 2740028331 504
124 3300003781 Ga0055536_1000505 Ga0055536_10005056 505
125 3300005336 Ga0070680_100008094 Ga0070680_1000080944 505
126 3300005366 Ga0070659_100076703 Ga0070659_1000767032 505
127 3300005458 Ga0070681_10016123 Ga0070681_100161235 505
128 3300005471 Ga0070698_100099003 Ga0070698_1000990033 505
129 3300005530 Ga0070679_100004981 Ga0070679_10000498112 505
130 3300013104 Ga0157370_10004994 Ga0157370_100049943 505
131 3300025292 Ga0209676_1000045 Ga0209676_1000045148 505
132 3300025912 Ga0207707_10041846 Ga0207707_100418463 505
133 3300025917 Ga0207660_10016467 Ga0207660_100164672 505
134 3300025921 Ga0207652_10005250 Ga0207652_1000525012 505
135 3300026067 Ga0207678_10024061 Ga0207678_100240615 505
136 3300032004 Ga0307414_10000223 Ga0307414_1000022334 505
137 3300046525 Ga0495663_0009714 Ga0495663_0009714_328_1962 505
138 3300046539 Ga0495621_0017785 Ga0495621_0017785_473_2107 505
139 3300046616 Ga0495668_0000002 Ga0495668_0000002_9919_11466 505
140 3300048904 Ga0496101_0183868 Ga0496101_0183868_60_1583 505
141 3300048924 Ga0496121_0153502 Ga0496121_0153502_53_1609 505
142 3300048925 Ga0496122_0038426 Ga0496122_0038426_39_1583 505
143 3300048928 Ga0496125_0036244 Ga0496125_0036244_1000_2550 505
144 iso_pu_bacteria 2830075706 2830078640 505
145 iso_pu_bacteria 2896253425 2896256278 505
146 3300005289 Ga0065704_10070230 Ga0065704_1007023017 506
147 3300005347 Ga0070668_100019912 Ga0070668_1000199124 506
148 3300005353 Ga0070669_100002708 Ga0070669_10000270810 506
149 3300005843 Ga0068860_100099456 Ga0068860_1000994562 506
150 3300009177 Ga0105248_10217493 Ga0105248_102174933 506
151 3300013306 Ga0163162_10067401 Ga0163162_100674014 506
152 3300021361 Ga0213872_10021252 Ga0213872_100212522 506
153 3300025923 Ga0207681_10002585 Ga0207681_100025856 506
154 3300025931 Ga0207644_10009915 Ga0207644_100099154 506
155 3300025941 Ga0207711_10192261 Ga0207711_101922612 506
156 3300025972 Ga0207668_10006178 Ga0207668_100061783 506
157 3300028379 Ga0268266_10007283 Ga0268266_1000728310 506
158 3300028380 Ga0268265_10069878 Ga0268265_100698781 506
159 3300028381 Ga0268264_10021730 Ga0268264_100217305 506
160 3300039447 Ga0436361_0468477 Ga0436361_0468477_1829_3385 506
161 3300048903 Ga0496100_0014306 Ga0496100_0014306_1898_3454 506
162 3300048904 Ga0496101_0007982 Ga0496101_0007982_4029_5585 506
163 3300048905 Ga0496102_0001012 Ga0496102_0001012_24457_26013 506
164 3300048906 Ga0496103_0000246 Ga0496103_0000246_27142_28698 506
165 3300048907 Ga0496104_0000227 Ga0496104_0000227_18821_20377 506
166 3300048908 Ga0496105_0000158 Ga0496105_0000158_20846_22402 506
167 3300048914 Ga0496111_0117158 Ga0496111_0117158_45_1601 506
168 3300048915 Ga0496112_0012022 Ga0496112_0012022_5442_6998 506
169 3300048916 Ga0496113_0000325 Ga0496113_0000325_20787_22343 506
170 3300048919 Ga0496116_0024323 Ga0496116_0024323_717_2273 506
171 3300048920 Ga0496117_0023299 Ga0496117_0023299_3184_4740 506
172 3300048921 Ga0496118_0002103 Ga0496118_0002103_12753_14309 506
173 3300048922 Ga0496119_0000040 Ga0496119_0000040_128743_130299 506
174 3300048923 Ga0496120_0000731 Ga0496120_0000731_18647_20203 506
175 3300048924 Ga0496121_0005047 Ga0496121_0005047_14537_16093 506
176 3300048925 Ga0496122_0003493 Ga0496122_0003493_3711_5267 506
177 3300048926 Ga0496123_0001478 Ga0496123_0001478_24320_25876 506
178 3300048927 Ga0496124_0004810 Ga0496124_0004810_177_1733 506
179 3300048928 Ga0496125_0003627 Ga0496125_0003627_5219_6775 506
180 3300048929 Ga0496126_0000044 Ga0496126_0000044_197977_199533 506
181 3300053153 Ga0500616_0000906 Ga0500616_0000906_14335_15888 506
182 3300053157 Ga0500624_000038 Ga0500624_000038_6782_8446 506
183 3300053158 Ga0500627_0006158 Ga0500627_0006158_144_1712 506
184 iso_pu_bacteria 2599185354 2600201004 506
185 iso_pu_bacteria 2751185897 2753765296 506
186 3300006177 Ga0075362_10039299 Ga0075362_100392992 507
187 3300025909 Ga0207705_10016189 Ga0207705_100161892 507
188 3300044719 Ga0466971_0047997 Ga0466971_0047997_76_1719 507
189 3300045051 Ga0451576_0000017 Ga0451576_0000017_506843_508477 507
190 3300053723 Ga0500567_012701 Ga0500567_012701_1370_2929 507
191 3300053729 Ga0500625_000017 Ga0500625_000017_41076_42635 507
192 iso_pu_bacteria 2599185359 2600225633 507
193 iso_pu_bacteria 2818991466 2819714070 507
194 iso_pu_bacteria 2879163058 2879165033 507
195 iso_pu_bacteria 2882806704 2882808875 507
196 iso_pu_bacteria 2928526807 2928528629 507
197 iso_pu_bacteria 2928968154 2928970177 507
198 3300001990 JGI24737J22298_10000900 JGI24737J22298_100009002 508
199 3300005347 Ga0070668_100000027 Ga0070668_10000002759 508
200 3300005355 Ga0070671_100004231 Ga0070671_1000042318 508
201 3300005367 Ga0070667_100000017 Ga0070667_100000017184 508
202 3300005618 Ga0068864_100033504 Ga0068864_1000335042 508
203 3300005842 Ga0068858_100000103 Ga0068858_10000010331 508
204 3300005843 Ga0068860_100000056 Ga0068860_10000005660 508
205 3300005844 Ga0068862_100000520 Ga0068862_10000052013 508
206 3300015690 Ga0183363_1007 Ga0183363_1007177 508
207 3300025931 Ga0207644_10000066 Ga0207644_1000006660 508
208 3300025972 Ga0207668_10000012 Ga0207668_1000001258 508
209 3300025986 Ga0207658_10000011 Ga0207658_1000001159 508
210 3300026035 Ga0207703_10000538 Ga0207703_1000053811 508
211 3300026088 Ga0207641_10014644 Ga0207641_100146444 508
212 3300026118 Ga0207675_100094697 Ga0207675_1000946972 508
213 3300028380 Ga0268265_10002075 Ga0268265_100020756 508
214 3300028381 Ga0268264_10000089 Ga0268264_10000089191 508
215 3300005289 Ga0065704_10086462 Ga0065704_100864622 509
216 3300005327 Ga0070658_10000611 Ga0070658_1000061127 509
217 3300005356 Ga0070674_100009563 Ga0070674_1000095635 509
218 3300005456 Ga0070678_100001327 Ga0070678_1000013273 509
219 3300005844 Ga0068862_100004678 Ga0068862_1000046787 509
220 3300009148 Ga0105243_10000406 Ga0105243_100004062 509
221 3300009174 Ga0105241_10005328 Ga0105241_100053282 509
222 3300013102 Ga0157371_10000066 Ga0157371_1000006669 509
223 3300025229 Ga0209147_100409 Ga0209147_1004098 509
224 3300025321 Ga0207656_10007244 Ga0207656_100072443 509
225 3300025909 Ga0207705_10000523 Ga0207705_1000052317 509
226 3300025911 Ga0207654_10002580 Ga0207654_100025803 509
227 3300025919 Ga0207657_10001292 Ga0207657_1000129213 509
228 3300025920 Ga0207649_10000069 Ga0207649_1000006950 509
229 3300025924 Ga0207694_10005213 Ga0207694_1000521310 509
230 3300025935 Ga0207709_10000047 Ga0207709_10000047152 509
231 3300025937 Ga0207669_10000339 Ga0207669_100003395 509
232 3300025937 Ga0207669_10046968 Ga0207669_100469683 509
233 3300025941 Ga0207711_10062080 Ga0207711_100620805 509
234 3300025945 Ga0207679_10112589 Ga0207679_101125891 509
235 3300025949 Ga0207667_10000001 Ga0207667_10000001102 509
236 3300025960 Ga0207651_10047111 Ga0207651_100471112 509
237 3300025972 Ga0207668_10000576 Ga0207668_1000057617 509
238 3300025981 Ga0207640_10001746 Ga0207640_100017464 509
239 3300026041 Ga0207639_10000379 Ga0207639_1000037921 509
240 3300026078 Ga0207702_10024630 Ga0207702_100246303 509
241 3300026121 Ga0207683_10048111 Ga0207683_100481113 509
242 3300026142 Ga0207698_10000220 Ga0207698_1000022017 509
243 3300026142 Ga0207698_10000605 Ga0207698_1000060519 509
244 3300028380 Ga0268265_10018923 Ga0268265_100189232 509
245 3300028786 Ga0307517_10071277 Ga0307517_100712772 509
246 3300032005 Ga0307411_10040218 Ga0307411_100402184 509
247 3300046476 Ga0495662_0015752 Ga0495662_0015752_1963_3537 509
248 3300046506 Ga0495583_0012894 Ga0495583_0012894_1444_3018 509
249 3300046507 Ga0495606_0000379 Ga0495606_0000379_29764_31338 509
250 3300046507 Ga0495606_0027407 Ga0495606_0027407_1734_3308 509
251 3300046520 Ga0495637_0029368 Ga0495637_0029368_534_2108 509
252 3300046522 Ga0495643_0001844 Ga0495643_0001844_15006_16580 509
253 3300046522 Ga0495643_0003069 Ga0495643_0003069_1008_2582 509
254 3300046522 Ga0495643_0035456 Ga0495643_0035456_321_1895 509
255 3300046557 Ga0495622_0007646 Ga0495622_0007646_1674_3248 509
256 3300046558 Ga0495633_0000758 Ga0495633_0000758_16010_17584 509
257 3300046616 Ga0495668_0000548 Ga0495668_0000548_17781_19355 509
258 3300046660 Ga0495625_0000757 Ga0495625_0000757_3850_5424 509
259 3300046660 Ga0495625_0009826 Ga0495625_0009826_2737_4311 509
260 3300046684 Ga0495669_0000657 Ga0495669_0000657_1439_3013 509
261 3300046809 Ga0495600_0001428 Ga0495600_0001428_6143_7717 509
262 3300047443 Ga0495687_000192 Ga0495687_000192_39192_40766 509
263 3300047445 Ga0495677_0000380 Ga0495677_0000380_1833_3407 509
264 3300053087 Ga0500643_002059 Ga0500643_002059_7159_8727 509
265 3300053119 Ga0500595_000440 Ga0500595_000440_8230_9804 509
266 3300053730 Ga0500645_000116 Ga0500645_000116_39156_40730 509
267 3300003214 JGI25165J46597_1000179 JGI25165J46597_100017969 510
268 3300003759 Ga0055525_1000070 Ga0055525_1000070107 510
269 3300003763 Ga0055529_1000136 Ga0055529_100013669 510
270 3300003791 Ga0055530_10000082 Ga0055530_1000008259 510
271 3300005327 Ga0070658_10001051 Ga0070658_1000105113 510
272 3300005327 Ga0070658_10002340 Ga0070658_100023405 510
273 3300005327 Ga0070658_10003277 Ga0070658_100032777 510
274 3300005328 Ga0070676_10004536 Ga0070676_100045368 510
275 3300005338 Ga0068868_100000281 Ga0068868_10000028127 510
276 3300005339 Ga0070660_100018438 Ga0070660_1000184382 510
277 3300005353 Ga0070669_100113616 Ga0070669_1001136162 510
278 3300005355 Ga0070671_100034647 Ga0070671_1000346473 510
279 3300005364 Ga0070673_100000005 Ga0070673_100000005162 510
280 3300005367 Ga0070667_100000024 Ga0070667_100000024147 510
281 3300005459 Ga0068867_100000060 Ga0068867_10000006034 510
282 3300005539 Ga0068853_100085896 Ga0068853_1000858962 510
283 3300005578 Ga0068854_100000257 Ga0068854_10000025719 510
284 3300005618 Ga0068864_100003968 Ga0068864_10000396810 510
285 3300005841 Ga0068863_100000082 Ga0068863_10000008271 510
286 3300005841 Ga0068863_100005364 Ga0068863_1000053645 510
287 3300005843 Ga0068860_100008890 Ga0068860_10000889012 510
288 3300006881 Ga0068865_100000027 Ga0068865_10000002756 510
289 3300009098 Ga0105245_10024391 Ga0105245_100243912 510
290 3300009148 Ga0105243_10005280 Ga0105243_100052802 510
291 3300009176 Ga0105242_10000077 Ga0105242_1000007753 510
292 3300009545 Ga0105237_10152748 Ga0105237_101527482 510
293 3300009553 Ga0105249_10051385 Ga0105249_100513852 510
294 3300013297 Ga0157378_10013819 Ga0157378_100138196 510
295 3300013307 Ga0157372_10009766 Ga0157372_100097668 510
296 3300013308 Ga0157375_10000592 Ga0157375_1000059219 510
297 3300014969 Ga0157376_10000095 Ga0157376_1000009532 510
298 3300017792 Ga0163161_10014022 Ga0163161_100140222 510
299 3300017792 Ga0163161_10132252 Ga0163161_101322522 510
300 3300020082 Ga0206353_10511878 Ga0206353_1051187811 510
301 3300025230 Ga0209563_100053 Ga0209563_10005389 510
302 3300025231 Ga0207427_100691 Ga0207427_1006914 510
303 3300025254 Ga0209148_1000159 Ga0209148_1000159103 510
304 3300025261 Ga0209233_1000041 Ga0209233_1000041399 510
305 3300025272 Ga0209455_1000045 Ga0209455_100004540 510
306 3300025272 Ga0209455_1000712 Ga0209455_100071214 510
307 3300025904 Ga0207647_10050501 Ga0207647_100505012 510
308 3300025909 Ga0207705_10000022 Ga0207705_10000022211 510
309 3300025909 Ga0207705_10000591 Ga0207705_1000059111 510
310 3300025909 Ga0207705_10003948 Ga0207705_100039486 510
311 3300025914 Ga0207671_10013247 Ga0207671_100132475 510
312 3300025914 Ga0207671_10089601 Ga0207671_100896012 510
313 3300025919 Ga0207657_10004059 Ga0207657_1000405911 510
314 3300025919 Ga0207657_10050098 Ga0207657_100500982 510
315 3300025924 Ga0207694_10032229 Ga0207694_100322294 510
316 3300025925 Ga0207650_10017798 Ga0207650_100177982 510
317 3300025927 Ga0207687_10006208 Ga0207687_100062083 510
318 3300025931 Ga0207644_10053854 Ga0207644_100538542 510
319 3300025934 Ga0207686_10000866 Ga0207686_100008668 510
320 3300025935 Ga0207709_10000260 Ga0207709_1000026028 510
321 3300025938 Ga0207704_10000064 Ga0207704_1000006432 510
322 3300025960 Ga0207651_10000010 Ga0207651_10000010159 510
323 3300025961 Ga0207712_10030220 Ga0207712_100302203 510
324 3300025972 Ga0207668_10000375 Ga0207668_100003759 510
325 3300025981 Ga0207640_10000369 Ga0207640_1000036915 510
326 3300025986 Ga0207658_10000022 Ga0207658_1000002234 510
327 3300025986 Ga0207658_10149835 Ga0207658_101498352 510
328 3300026023 Ga0207677_10000021 Ga0207677_1000002111 510
329 3300026041 Ga0207639_10067971 Ga0207639_100679713 510
330 3300026088 Ga0207641_10000139 Ga0207641_1000013934 510
331 3300026088 Ga0207641_10000228 Ga0207641_1000022848 510
332 3300026089 Ga0207648_10000162 Ga0207648_1000016232 510
333 3300026095 Ga0207676_10002918 Ga0207676_1000291810 510
334 3300028381 Ga0268264_10005121 Ga0268264_100051212 510
335 3300028786 Ga0307517_10024002 Ga0307517_100240024 510
336 3300031911 Ga0307412_10001051 Ga0307412_100010512 510
337 3300037312 Ga0395899_0028725 Ga0395899_0028725_2090_3664 510
338 3300037312 Ga0395899_0086735 Ga0395899_0086735_35_1594 510
339 3300037466 Ga0395898_0045014 Ga0395898_0045014_569_2128 510
340 3300045976 Ga0466967_0001666 Ga0466967_0001666_1108_2667 510
341 3300046460 Ga0495638_0000011 Ga0495638_0000011_288585_290153 510
342 3300046471 Ga0495650_0004548 Ga0495650_0004548_3544_5118 510
343 3300046506 Ga0495583_0000242 Ga0495583_0000242_42605_44173 510
344 3300046513 Ga0495616_0000017 Ga0495616_0000017_99112_100692 510
345 3300046524 Ga0495648_0000023 Ga0495648_0000023_86305_87873 510
346 3300046524 Ga0495648_0004490 Ga0495648_0004490_1393_2967 510
347 3300046525 Ga0495663_0001663 Ga0495663_0001663_4334_5908 510
348 3300046691 Ga0495670_0000012 Ga0495670_0000012_78249_79820 510
349 3300046692 Ga0495671_0000012 Ga0495671_0000012_142621_144189 510
350 3300047323 Ga0495683_0005196 Ga0495683_0005196_1500_3074 510
351 3300047443 Ga0495687_000611 Ga0495687_000611_13300_14874 510
352 3300047469 Ga0495673_0000029 Ga0495673_0000029_214444_216012 510
353 3300048905 Ga0496102_0000435 Ga0496102_0000435_42404_43978 510
354 3300048906 Ga0496103_0000177 Ga0496103_0000177_20611_22185 510
355 3300048908 Ga0496105_0000159 Ga0496105_0000159_11975_13549 510
356 3300048913 Ga0496110_0028105 Ga0496110_0028105_913_2487 510
357 3300048914 Ga0496111_0015596 Ga0496111_0015596_2650_4224 510
358 3300048917 Ga0496114_0006747 Ga0496114_0006747_3739_5313 510
359 3300048918 Ga0496115_0000410 Ga0496115_0000410_11259_12833 510
360 3300048919 Ga0496116_0011870 Ga0496116_0011870_833_2407 510
361 3300048920 Ga0496117_0004031 Ga0496117_0004031_3747_5321 510
362 3300048920 Ga0496117_0009245 Ga0496117_0009245_6117_7691 510
363 3300048921 Ga0496118_0000850 Ga0496118_0000850_43158_44732 510
364 3300048922 Ga0496119_0019836 Ga0496119_0019836_916_2490 510
365 3300048923 Ga0496120_0041279 Ga0496120_0041279_826_2397 510
366 3300048924 Ga0496121_0002231 Ga0496121_0002231_24912_26486 510
367 3300048925 Ga0496122_0026578 Ga0496122_0026578_2347_3921 510
368 3300048927 Ga0496124_0004357 Ga0496124_0004357_11261_12835 510
369 3300048927 Ga0496124_0007021 Ga0496124_0007021_2020_3591 510
370 3300048927 Ga0496124_0016280 Ga0496124_0016280_488_2059 510
371 3300048928 Ga0496125_0003240 Ga0496125_0003240_1436_3010 510
372 3300048929 Ga0496126_0004511 Ga0496126_0004511_3743_5317 510
373 3300049679 Ga0501249_000105 Ga0501249_000105_23479_25050 510
374 3300049823 Ga0501044_0007097 Ga0501044_0007097_3929_5497 510
375 3300053087 Ga0500643_000137 Ga0500643_000137_61966_63534 510
376 3300053730 Ga0500645_002782 Ga0500645_002782_4219_5883 510
377 3300061719 Ga0466962_0001131 Ga0466962_0001131_10064_11743 510
378 3300001904 JGI24736J21556_1000403 JGI24736J21556_10004032 511
379 3300002774 JGI25150J39212_1000096 JGI25150J39212_100009624 511
380 3300003215 JGI25153J46596_10000021 JGI25153J46596_1000002139 511
381 3300003771 Ga0055526_1005868 Ga0055526_10058682 511
382 3300005262 Ga0065165_1001234 Ga0065165_100123423 511
383 3300005329 Ga0070683_100035661 Ga0070683_1000356611 511
384 3300005345 Ga0070692_10038631 Ga0070692_100386312 511
385 3300005353 Ga0070669_100093968 Ga0070669_1000939681 511
386 3300005364 Ga0070673_100037600 Ga0070673_1000376002 511
387 3300005366 Ga0070659_100083732 Ga0070659_1000837322 511
388 3300005457 Ga0070662_100013191 Ga0070662_1000131912 511
389 3300005530 Ga0070679_100201885 Ga0070679_1002018852 511
390 3300005530 Ga0070679_100206393 Ga0070679_1002063931 511
391 3300005842 Ga0068858_100028177 Ga0068858_1000281775 511
392 3300005985 Ga0081539_10011926 Ga0081539_100119263 511
393 3300025297 Ga0209758_1000023 Ga0209758_1000023244 511
394 3300025302 Ga0207426_1023666 Ga0207426_10236662 511
395 3300025893 Ga0207682_10000223 Ga0207682_1000022312 511
396 3300025917 Ga0207660_10068975 Ga0207660_100689752 511
397 3300025921 Ga0207652_10163445 Ga0207652_101634452 511
398 3300025923 Ga0207681_10040085 Ga0207681_100400852 511
399 3300025926 Ga0207659_10028342 Ga0207659_100283424 511
400 3300025932 Ga0207690_10011907 Ga0207690_100119072 511
401 3300025933 Ga0207706_10000143 Ga0207706_1000014319 511
402 3300025933 Ga0207706_10005314 Ga0207706_1000531411 511
403 3300025944 Ga0207661_10023997 Ga0207661_100239971 511
404 3300026035 Ga0207703_10029429 Ga0207703_100294294 511
405 3300026067 Ga0207678_10001423 Ga0207678_1000142312 511
406 3300031731 Ga0307405_10001415 Ga0307405_100014152 511
407 3300031731 Ga0307405_10004409 Ga0307405_100044095 511
408 3300031824 Ga0307413_10020717 Ga0307413_100207174 511
409 3300031852 Ga0307410_10000614 Ga0307410_1000061412 511
410 3300031852 Ga0307410_10051555 Ga0307410_100515552 511
411 3300031852 Ga0307410_10123577 Ga0307410_101235772 511
412 3300031903 Ga0307407_10003028 Ga0307407_100030282 511
413 3300031911 Ga0307412_10020399 Ga0307412_100203995 511
414 3300031995 Ga0307409_100002345 Ga0307409_1000023459 511
415 3300031995 Ga0307409_100138213 Ga0307409_1001382132 511
416 3300032002 Ga0307416_100034098 Ga0307416_1000340983 511
417 3300032005 Ga0307411_10009972 Ga0307411_100099723 511
418 3300032126 Ga0307415_100001979 Ga0307415_1000019795 511
419 3300037312 Ga0395899_0108823 Ga0395899_0108823_230_1798 511
420 3300037471 Ga0395905_0065466 Ga0395905_0065466_1301_2869 511
421 3300038443 Ga0395901_0135083 Ga0395901_0135083_230_1798 511
422 3300039450 Ga0436363_1409835 Ga0436363_1409835_112_1704 511
423 3300046684 Ga0495669_0000385 Ga0495669_0000385_12759_14321 511
424 3300048918 Ga0496115_0000314 Ga0496115_0000314_24081_25655 511
425 3300049581 Ga0501047_0000644 Ga0501047_0000644_10192_11766 511
426 3300049742 Ga0501080_0049273 Ga0501080_0049273_1989_3557 511
427 3300053087 Ga0500643_009912 Ga0500643_009912_1911_3479 511
428 3300053119 Ga0500595_001838 Ga0500595_001838_8856_10490 511
429 iso_pu_bacteria 2895880812 2895883067 511
430 3300001979 JGI24740J21852_10020525 JGI24740J21852_100205252 512
431 3300001989 JGI24739J22299_10016411 JGI24739J22299_100164112 512
432 3300001990 JGI24737J22298_10019419 JGI24737J22298_100194192 512
433 3300002067 JGI24735J21928_10001752 JGI24735J21928_1000175210 512
434 3300005327 Ga0070658_10132174 Ga0070658_101321742 512
435 3300005329 Ga0070683_100006972 Ga0070683_1000069725 512
436 3300005330 Ga0070690_100007063 Ga0070690_1000070633 512
437 3300005335 Ga0070666_10006666 Ga0070666_100066662 512
438 3300005337 Ga0070682_100045355 Ga0070682_1000453552 512
439 3300005338 Ga0068868_100001134 Ga0068868_1000011345 512
440 3300005339 Ga0070660_100000061 Ga0070660_10000006170 512
441 3300005339 Ga0070660_100003754 Ga0070660_1000037545 512
442 3300005339 Ga0070660_100028990 Ga0070660_1000289903 512
443 3300005355 Ga0070671_100001855 Ga0070671_10000185510 512
444 3300005364 Ga0070673_100009612 Ga0070673_1000096125 512
445 3300005367 Ga0070667_100019601 Ga0070667_1000196015 512
446 3300005457 Ga0070662_100064070 Ga0070662_1000640703 512
447 3300005458 Ga0070681_10084458 Ga0070681_100844582 512
448 3300005543 Ga0070672_100061631 Ga0070672_1000616312 512
449 3300005548 Ga0070665_100002034 Ga0070665_1000020345 512
450 3300005563 Ga0068855_100000318 Ga0068855_10000031812 512
451 3300005564 Ga0070664_100014088 Ga0070664_1000140882 512
452 3300005564 Ga0070664_100065118 Ga0070664_1000651182 512
453 3300005577 Ga0068857_100048849 Ga0068857_1000488492 512
454 3300005614 Ga0068856_100008544 Ga0068856_10000854410 512
455 3300005616 Ga0068852_100091859 Ga0068852_1000918593 512
456 3300005842 Ga0068858_100019553 Ga0068858_1000195535 512
457 3300005844 Ga0068862_100133797 Ga0068862_1001337972 512
458 3300006237 Ga0097621_100079021 Ga0097621_1000790213 512
459 3300009177 Ga0105248_10013326 Ga0105248_100133265 512
460 3300013102 Ga0157371_10000616 Ga0157371_1000061623 512
461 3300013102 Ga0157371_10037984 Ga0157371_100379843 512
462 3300013105 Ga0157369_10008794 Ga0157369_100087944 512
463 3300013308 Ga0157375_10109615 Ga0157375_101096152 512
464 3300014968 Ga0157379_10026180 Ga0157379_100261804 512
465 3300021388 Ga0213875_10002449 Ga0213875_100024499 512
466 3300025903 Ga0207680_10000835 Ga0207680_1000083515 512
467 3300025904 Ga0207647_10018313 Ga0207647_100183132 512
468 3300025909 Ga0207705_10020620 Ga0207705_100206205 512
469 3300025909 Ga0207705_10060369 Ga0207705_100603692 512
470 3300025909 Ga0207705_10070763 Ga0207705_100707632 512
471 3300025912 Ga0207707_10022651 Ga0207707_100226512 512
472 3300025917 Ga0207660_10001191 Ga0207660_1000119116 512
473 3300025917 Ga0207660_10151805 Ga0207660_101518052 512
474 3300025919 Ga0207657_10000181 Ga0207657_100001815 512
475 3300025919 Ga0207657_10000811 Ga0207657_1000081137 512
476 3300025919 Ga0207657_10002661 Ga0207657_1000266114 512
477 3300025920 Ga0207649_10110120 Ga0207649_101101202 512
478 3300025921 Ga0207652_10059174 Ga0207652_100591743 512
479 3300025931 Ga0207644_10118441 Ga0207644_101184412 512
480 3300025932 Ga0207690_10001891 Ga0207690_100018914 512
481 3300025933 Ga0207706_10007955 Ga0207706_1000795511 512
482 3300025940 Ga0207691_10079142 Ga0207691_100791422 512
483 3300025941 Ga0207711_10000180 Ga0207711_1000018061 512
484 3300025945 Ga0207679_10176627 Ga0207679_101766272 512
485 3300025949 Ga0207667_10000282 Ga0207667_1000028238 512
486 3300025949 Ga0207667_10167085 Ga0207667_101670852 512
487 3300025960 Ga0207651_10005501 Ga0207651_100055015 512
488 3300025986 Ga0207658_10008833 Ga0207658_100088336 512
489 3300026023 Ga0207677_10006623 Ga0207677_100066232 512
490 3300026035 Ga0207703_10004732 Ga0207703_100047328 512
491 3300026041 Ga0207639_10041667 Ga0207639_100416672 512
492 3300026067 Ga0207678_10005267 Ga0207678_1000526713 512
493 3300026078 Ga0207702_10010107 Ga0207702_100101073 512
494 3300026088 Ga0207641_10116142 Ga0207641_101161422 512
495 3300026095 Ga0207676_10126571 Ga0207676_101265712 512
496 3300026116 Ga0207674_10005506 Ga0207674_100055063 512
497 3300028379 Ga0268266_10000841 Ga0268266_1000084113 512
498 3300031251 Ga0265327_10010345 Ga0265327_100103456 512
499 3300031852 Ga0307410_10073683 Ga0307410_100736831 512
500 3300032004 Ga0307414_10104387 Ga0307414_101043872 512
501 3300035724 Ga0373933_0017273 Ga0373933_0017273_1593_3164 512
502 3300037312 Ga0395899_0000971 Ga0395899_0000971_16489_18060 512
503 3300037418 Ga0395900_0000036 Ga0395900_0000036_164116_165687 512
504 3300037853 Ga0436364_1555870 Ga0436364_1555870_6345_7913 512
505 3300038443 Ga0395901_0000036 Ga0395901_0000036_54211_55782 512
506 3300042006 Ga0439432_019091 Ga0439432_019091_237_1808 512
507 3300049583 Ga0501067_0087781 Ga0501067_0087781_37_1605 512
508 3300053151 Ga0500604_0000072 Ga0500604_0000072_11201_12769 512
509 iso_pu_bacteria 2919138771 2919140172 512
510 3300001979 JGI24740J21852_10012975 JGI24740J21852_100129752 513
511 3300001990 JGI24737J22298_10000221 JGI24737J22298_100002213 513
512 3300001990 JGI24737J22298_10000290 JGI24737J22298_100002905 513
513 3300001990 JGI24737J22298_10001215 JGI24737J22298_1000121510 513
514 3300001990 JGI24737J22298_10002168 JGI24737J22298_100021682 513
515 3300001990 JGI24737J22298_10004757 JGI24737J22298_100047575 513
516 3300002067 JGI24735J21928_10017711 JGI24735J21928_100177111 513
517 3300002075 JGI24738J21930_10000677 JGI24738J21930_1000067712 513
518 3300005327 Ga0070658_10000183 Ga0070658_1000018321 513
519 3300005327 Ga0070658_10021435 Ga0070658_100214352 513
520 3300005327 Ga0070658_10098617 Ga0070658_100986172 513
521 3300005329 Ga0070683_100001584 Ga0070683_10000158411 513
522 3300005329 Ga0070683_100012444 Ga0070683_1000124448 513
523 3300005331 Ga0070670_100011909 Ga0070670_1000119093 513
524 3300005331 Ga0070670_100022358 Ga0070670_1000223582 513
525 3300005331 Ga0070670_100057432 Ga0070670_1000574322 513
526 3300005331 Ga0070670_100077995 Ga0070670_1000779953 513
527 3300005334 Ga0068869_100000662 Ga0068869_10000066213 513
528 3300005335 Ga0070666_10011303 Ga0070666_100113035 513
529 3300005335 Ga0070666_10018749 Ga0070666_100187495 513
530 3300005335 Ga0070666_10042216 Ga0070666_100422164 513
531 3300005335 Ga0070666_10075796 Ga0070666_100757962 513
532 3300005336 Ga0070680_100000385 Ga0070680_10000038525 513
533 3300005336 Ga0070680_100002482 Ga0070680_10000248212 513
534 3300005336 Ga0070680_100010796 Ga0070680_1000107965 513
535 3300005337 Ga0070682_100027748 Ga0070682_1000277482 513
536 3300005338 Ga0068868_100001411 Ga0068868_10000141111 513
537 3300005338 Ga0068868_100007382 Ga0068868_1000073823 513
538 3300005339 Ga0070660_100000355 Ga0070660_10000035521 513
539 3300005339 Ga0070660_100001286 Ga0070660_1000012866 513
540 3300005339 Ga0070660_100005037 Ga0070660_1000050373 513
541 3300005339 Ga0070660_100006157 Ga0070660_1000061572 513
542 3300005339 Ga0070660_100021225 Ga0070660_1000212254 513
543 3300005339 Ga0070660_100036771 Ga0070660_1000367712 513
544 3300005344 Ga0070661_100000485 Ga0070661_10000048514 513
545 3300005344 Ga0070661_100006539 Ga0070661_1000065399 513
546 3300005344 Ga0070661_100041772 Ga0070661_1000417723 513
547 3300005345 Ga0070692_10000457 Ga0070692_100004578 513
548 3300005345 Ga0070692_10022598 Ga0070692_100225983 513
549 3300005347 Ga0070668_100003267 Ga0070668_1000032678 513
550 3300005347 Ga0070668_100009416 Ga0070668_1000094165 513
551 3300005347 Ga0070668_100010966 Ga0070668_1000109663 513
552 3300005353 Ga0070669_100008152 Ga0070669_1000081529 513
553 3300005353 Ga0070669_100020434 Ga0070669_1000204341 513
554 3300005353 Ga0070669_100056901 Ga0070669_1000569011 513
555 3300005354 Ga0070675_100004996 Ga0070675_1000049969 513
556 3300005354 Ga0070675_100006226 Ga0070675_1000062264 513
557 3300005355 Ga0070671_100000937 Ga0070671_1000009377 513
558 3300005355 Ga0070671_100002394 Ga0070671_10000239411 513
559 3300005355 Ga0070671_100068223 Ga0070671_1000682233 513
560 3300005364 Ga0070673_100000146 Ga0070673_10000014638 513
561 3300005364 Ga0070673_100012846 Ga0070673_1000128466 513
562 3300005364 Ga0070673_100023545 Ga0070673_1000235453 513
563 3300005364 Ga0070673_100035871 Ga0070673_1000358712 513
564 3300005364 Ga0070673_100055387 Ga0070673_1000553872 513
565 3300005364 Ga0070673_100127490 Ga0070673_1001274902 513
566 3300005366 Ga0070659_100000643 Ga0070659_10000064321 513
567 3300005366 Ga0070659_100021046 Ga0070659_1000210464 513
568 3300005366 Ga0070659_100032163 Ga0070659_1000321632 513
569 3300005367 Ga0070667_100007443 Ga0070667_1000074432 513
570 3300005367 Ga0070667_100017989 Ga0070667_1000179895 513
571 3300005367 Ga0070667_100036299 Ga0070667_1000362994 513
572 3300005367 Ga0070667_100049202 Ga0070667_1000492022 513
573 3300005367 Ga0070667_100075918 Ga0070667_1000759182 513
574 3300005367 Ga0070667_100146701 Ga0070667_1001467012 513
575 3300005435 Ga0070714_100035760 Ga0070714_1000357605 513
576 3300005435 Ga0070714_100074858 Ga0070714_1000748583 513
577 3300005436 Ga0070713_100004550 Ga0070713_1000045506 513
578 3300005436 Ga0070713_100114859 Ga0070713_1001148592 513
579 3300005455 Ga0070663_100008636 Ga0070663_1000086362 513
580 3300005457 Ga0070662_100000793 Ga0070662_1000007932 513
581 3300005457 Ga0070662_100026029 Ga0070662_1000260293 513
582 3300005457 Ga0070662_100047480 Ga0070662_1000474802 513
583 3300005457 Ga0070662_100087512 Ga0070662_1000875122 513
584 3300005458 Ga0070681_10016464 Ga0070681_100164648 513
585 3300005459 Ga0068867_100002761 Ga0068867_10000276114 513
586 3300005459 Ga0068867_100007573 Ga0068867_1000075737 513
587 3300005459 Ga0068867_100055922 Ga0068867_1000559223 513
588 3300005530 Ga0070679_100003093 Ga0070679_10000309312 513
589 3300005539 Ga0068853_100000848 Ga0068853_10000084823 513
590 3300005543 Ga0070672_100006694 Ga0070672_1000066942 513
591 3300005543 Ga0070672_100043774 Ga0070672_1000437742 513
592 3300005546 Ga0070696_100092585 Ga0070696_1000925852 513
593 3300005547 Ga0070693_100000320 Ga0070693_1000003206 513
594 3300005548 Ga0070665_100004295 Ga0070665_1000042958 513
595 3300005548 Ga0070665_100016938 Ga0070665_1000169387 513
596 3300005548 Ga0070665_100042630 Ga0070665_1000426304 513
597 3300005548 Ga0070665_100060432 Ga0070665_1000604322 513
598 3300005548 Ga0070665_100111910 Ga0070665_1001119101 513
599 3300005563 Ga0068855_100001622 Ga0068855_10000162215 513
600 3300005563 Ga0068855_100004908 Ga0068855_10000490812 513
601 3300005563 Ga0068855_100019513 Ga0068855_1000195136 513
602 3300005563 Ga0068855_100047979 Ga0068855_1000479795 513
603 3300005563 Ga0068855_100236322 Ga0068855_1002363222 513
604 3300005563 Ga0068855_100239239 Ga0068855_1002392392 513
605 3300005564 Ga0070664_100000066 Ga0070664_10000006614 513
606 3300005564 Ga0070664_100002424 Ga0070664_1000024245 513
607 3300005564 Ga0070664_100086935 Ga0070664_1000869351 513
608 3300005564 Ga0070664_100097991 Ga0070664_1000979912 513
609 3300005564 Ga0070664_100111928 Ga0070664_1001119282 513
610 3300005564 Ga0070664_100147615 Ga0070664_1001476152 513
611 3300005577 Ga0068857_100000692 Ga0068857_10000069212 513
612 3300005577 Ga0068857_100003820 Ga0068857_1000038202 513
613 3300005577 Ga0068857_100112097 Ga0068857_1001120973 513
614 3300005577 Ga0068857_100161742 Ga0068857_1001617422 513
615 3300005578 Ga0068854_100001058 Ga0068854_10000105811 513
616 3300005578 Ga0068854_100005628 Ga0068854_1000056285 513
617 3300005578 Ga0068854_100041423 Ga0068854_1000414234 513
618 3300005578 Ga0068854_100043606 Ga0068854_1000436062 513
619 3300005578 Ga0068854_100095096 Ga0068854_1000950962 513
620 3300005614 Ga0068856_100000213 Ga0068856_10000021321 513
621 3300005614 Ga0068856_100014514 Ga0068856_1000145144 513
622 3300005614 Ga0068856_100140928 Ga0068856_1001409281 513
623 3300005616 Ga0068852_100001507 Ga0068852_1000015076 513
624 3300005616 Ga0068852_100004169 Ga0068852_1000041698 513
625 3300005616 Ga0068852_100008088 Ga0068852_1000080882 513
626 3300005616 Ga0068852_100011209 Ga0068852_1000112097 513
627 3300005616 Ga0068852_100013457 Ga0068852_1000134575 513
628 3300005616 Ga0068852_100026871 Ga0068852_1000268716 513
629 3300005616 Ga0068852_100028319 Ga0068852_1000283192 513
630 3300005616 Ga0068852_100101246 Ga0068852_1001012463 513
631 3300005616 Ga0068852_100135197 Ga0068852_1001351972 513
632 3300005617 Ga0068859_100015173 Ga0068859_1000151735 513
633 3300005617 Ga0068859_100030683 Ga0068859_1000306832 513
634 3300005617 Ga0068859_100037605 Ga0068859_1000376052 513
635 3300005618 Ga0068864_100000748 Ga0068864_10000074829 513
636 3300005618 Ga0068864_100000894 Ga0068864_10000089414 513
637 3300005618 Ga0068864_100001115 Ga0068864_10000111521 513
638 3300005618 Ga0068864_100033016 Ga0068864_1000330163 513
639 3300005841 Ga0068863_100005172 Ga0068863_1000051729 513
640 3300005841 Ga0068863_100028414 Ga0068863_1000284142 513
641 3300005841 Ga0068863_100036472 Ga0068863_1000364725 513
642 3300005841 Ga0068863_100118312 Ga0068863_1001183122 513
643 3300005842 Ga0068858_100023025 Ga0068858_1000230256 513
644 3300005842 Ga0068858_100057107 Ga0068858_1000571072 513
645 3300005842 Ga0068858_100203654 Ga0068858_1002036542 513
646 3300005843 Ga0068860_100008281 Ga0068860_1000082815 513
647 3300005843 Ga0068860_100016018 Ga0068860_1000160186 513
648 3300005843 Ga0068860_100067699 Ga0068860_1000676994 513
649 3300005843 Ga0068860_100126868 Ga0068860_1001268682 513
650 3300005843 Ga0068860_100151570 Ga0068860_1001515702 513
651 3300005844 Ga0068862_100002736 Ga0068862_1000027365 513
652 3300005844 Ga0068862_100050802 Ga0068862_1000508022 513
653 3300006028 Ga0070717_10002807 Ga0070717_100028072 513
654 3300006028 Ga0070717_10021346 Ga0070717_100213464 513
655 3300006173 Ga0070716_100042866 Ga0070716_1000428662 513
656 3300006237 Ga0097621_100051812 Ga0097621_1000518124 513
657 3300006237 Ga0097621_100191152 Ga0097621_1001911522 513
658 3300006358 Ga0068871_100220644 Ga0068871_1002206441 513
659 3300006881 Ga0068865_100003386 Ga0068865_1000033866 513
660 3300006881 Ga0068865_100004453 Ga0068865_1000044534 513
661 3300006881 Ga0068865_100040849 Ga0068865_1000408493 513
662 3300006931 Ga0097620_100015173 Ga0097620_1000151735 513
663 3300006931 Ga0097620_100030685 Ga0097620_1000306856 513
664 3300006931 Ga0097620_100037606 Ga0097620_1000376065 513
665 3300009093 Ga0105240_10195974 Ga0105240_101959742 513
666 3300009098 Ga0105245_10005839 Ga0105245_1000583911 513
667 3300009148 Ga0105243_10029516 Ga0105243_100295163 513
668 3300009177 Ga0105248_10001298 Ga0105248_1000129822 513
669 3300009177 Ga0105248_10001574 Ga0105248_1000157430 513
670 3300009177 Ga0105248_10031916 Ga0105248_100319162 513
671 3300009177 Ga0105248_10047959 Ga0105248_100479592 513
672 3300009177 Ga0105248_10055668 Ga0105248_100556684 513
673 3300009177 Ga0105248_10145905 Ga0105248_101459052 513
674 3300009545 Ga0105237_10100907 Ga0105237_101009072 513
675 3300009551 Ga0105238_10008543 Ga0105238_100085432 513
676 3300009551 Ga0105238_10045733 Ga0105238_100457334 513
677 3300009551 Ga0105238_10064919 Ga0105238_100649192 513
678 3300009551 Ga0105238_10084833 Ga0105238_100848333 513
679 3300009553 Ga0105249_10008517 Ga0105249_100085173 513
680 3300013100 Ga0157373_10001899 Ga0157373_1000189915 513
681 3300013100 Ga0157373_10002987 Ga0157373_100029875 513
682 3300013100 Ga0157373_10012237 Ga0157373_100122376 513
683 3300013100 Ga0157373_10033778 Ga0157373_100337785 513
684 3300013102 Ga0157371_10003299 Ga0157371_100032996 513
685 3300013102 Ga0157371_10127530 Ga0157371_101275302 513
686 3300013104 Ga0157370_10000202 Ga0157370_1000020240 513
687 3300013104 Ga0157370_10000244 Ga0157370_1000024428 513
688 3300013104 Ga0157370_10004958 Ga0157370_1000495811 513
689 3300013104 Ga0157370_10030530 Ga0157370_100305302 513
690 3300013105 Ga0157369_10001746 Ga0157369_1000174625 513
691 3300013296 Ga0157374_10017303 Ga0157374_100173032 513
692 3300013296 Ga0157374_10134390 Ga0157374_101343901 513
693 3300013297 Ga0157378_10014990 Ga0157378_100149907 513
694 3300013297 Ga0157378_10018768 Ga0157378_100187685 513
695 3300013306 Ga0163162_10007111 Ga0163162_100071112 513
696 3300013307 Ga0157372_10172741 Ga0157372_101727412 513
697 3300013308 Ga0157375_10060795 Ga0157375_100607952 513
698 3300014325 Ga0163163_10000178 Ga0163163_1000017855 513
699 3300014325 Ga0163163_10124213 Ga0163163_101242132 513
700 3300014968 Ga0157379_10057487 Ga0157379_100574872 513
701 3300014969 Ga0157376_10026624 Ga0157376_100266242 513
702 3300021384 Ga0213876_10025782 Ga0213876_100257822 513
703 3300025315 Ga0207697_10000567 Ga0207697_100005672 513
704 3300025903 Ga0207680_10000519 Ga0207680_1000051911 513
705 3300025903 Ga0207680_10025100 Ga0207680_100251002 513
706 3300025904 Ga0207647_10000642 Ga0207647_100006426 513
707 3300025904 Ga0207647_10000721 Ga0207647_1000072123 513
708 3300025904 Ga0207647_10002940 Ga0207647_1000294015 513
709 3300025904 Ga0207647_10010247 Ga0207647_100102473 513
710 3300025904 Ga0207647_10013639 Ga0207647_100136392 513
711 3300025907 Ga0207645_10022807 Ga0207645_100228073 513
712 3300025909 Ga0207705_10000234 Ga0207705_1000023421 513
713 3300025909 Ga0207705_10002008 Ga0207705_100020085 513
714 3300025909 Ga0207705_10009577 Ga0207705_100095778 513
715 3300025909 Ga0207705_10016795 Ga0207705_100167955 513
716 3300025909 Ga0207705_10026921 Ga0207705_100269212 513
717 3300025909 Ga0207705_10039446 Ga0207705_100394462 513
718 3300025909 Ga0207705_10170086 Ga0207705_101700861 513
719 3300025913 Ga0207695_10088014 Ga0207695_100880143 513
720 3300025917 Ga0207660_10001495 Ga0207660_1000149517 513
721 3300025919 Ga0207657_10000598 Ga0207657_1000059821 513
722 3300025919 Ga0207657_10001262 Ga0207657_1000126214 513
723 3300025919 Ga0207657_10003476 Ga0207657_1000347611 513
724 3300025919 Ga0207657_10009578 Ga0207657_100095789 513
725 3300025919 Ga0207657_10011947 Ga0207657_100119475 513
726 3300025919 Ga0207657_10014121 Ga0207657_100141219 513
727 3300025919 Ga0207657_10177204 Ga0207657_101772041 513
728 3300025920 Ga0207649_10000159 Ga0207649_1000015938 513
729 3300025920 Ga0207649_10052931 Ga0207649_100529312 513
730 3300025921 Ga0207652_10009331 Ga0207652_100093312 513
731 3300025921 Ga0207652_10056143 Ga0207652_100561432 513
732 3300025923 Ga0207681_10001149 Ga0207681_1000114918 513
733 3300025923 Ga0207681_10007424 Ga0207681_100074247 513
734 3300025923 Ga0207681_10073226 Ga0207681_100732261 513
735 3300025924 Ga0207694_10060948 Ga0207694_100609482 513
736 3300025924 Ga0207694_10093960 Ga0207694_100939602 513
737 3300025925 Ga0207650_10006425 Ga0207650_100064252 513
738 3300025925 Ga0207650_10014607 Ga0207650_100146074 513
739 3300025925 Ga0207650_10058972 Ga0207650_100589723 513
740 3300025925 Ga0207650_10060923 Ga0207650_100609232 513
741 3300025925 Ga0207650_10071147 Ga0207650_100711472 513
742 3300025926 Ga0207659_10012945 Ga0207659_100129455 513
743 3300025926 Ga0207659_10054608 Ga0207659_100546082 513
744 3300025928 Ga0207700_10101582 Ga0207700_101015822 513
745 3300025929 Ga0207664_10057109 Ga0207664_100571092 513
746 3300025931 Ga0207644_10005675 Ga0207644_100056758 513
747 3300025931 Ga0207644_10017158 Ga0207644_100171585 513
748 3300025931 Ga0207644_10022018 Ga0207644_100220185 513
749 3300025931 Ga0207644_10022504 Ga0207644_100225044 513
750 3300025931 Ga0207644_10060416 Ga0207644_100604162 513
751 3300025931 Ga0207644_10086162 Ga0207644_100861622 513
752 3300025932 Ga0207690_10000120 Ga0207690_1000012023 513
753 3300025932 Ga0207690_10006698 Ga0207690_100066985 513
754 3300025932 Ga0207690_10023425 Ga0207690_100234252 513
755 3300025932 Ga0207690_10024809 Ga0207690_100248092 513
756 3300025932 Ga0207690_10068793 Ga0207690_100687932 513
757 3300025933 Ga0207706_10000200 Ga0207706_1000020021 513
758 3300025933 Ga0207706_10000869 Ga0207706_1000086930 513
759 3300025933 Ga0207706_10001211 Ga0207706_1000121118 513
760 3300025933 Ga0207706_10002133 Ga0207706_100021332 513
761 3300025933 Ga0207706_10013128 Ga0207706_100131289 513
762 3300025933 Ga0207706_10019863 Ga0207706_100198635 513
763 3300025933 Ga0207706_10119958 Ga0207706_101199582 513
764 3300025935 Ga0207709_10040064 Ga0207709_100400642 513
765 3300025937 Ga0207669_10028398 Ga0207669_100283983 513
766 3300025937 Ga0207669_10153730 Ga0207669_101537301 513
767 3300025938 Ga0207704_10017903 Ga0207704_100179032 513
768 3300025940 Ga0207691_10000901 Ga0207691_1000090130 513
769 3300025940 Ga0207691_10004966 Ga0207691_100049669 513
770 3300025940 Ga0207691_10015708 Ga0207691_100157089 513
771 3300025941 Ga0207711_10005431 Ga0207711_100054315 513
772 3300025941 Ga0207711_10006337 Ga0207711_100063379 513
773 3300025941 Ga0207711_10012014 Ga0207711_100120142 513
774 3300025941 Ga0207711_10013118 Ga0207711_100131182 513
775 3300025941 Ga0207711_10031455 Ga0207711_100314555 513
776 3300025941 Ga0207711_10086302 Ga0207711_100863022 513
777 3300025941 Ga0207711_10146526 Ga0207711_101465262 513
778 3300025941 Ga0207711_10200489 Ga0207711_102004891 513
779 3300025942 Ga0207689_10000372 Ga0207689_1000037242 513
780 3300025944 Ga0207661_10001732 Ga0207661_100017326 513
781 3300025944 Ga0207661_10048583 Ga0207661_100485832 513
782 3300025945 Ga0207679_10000150 Ga0207679_1000015039 513
783 3300025945 Ga0207679_10002410 Ga0207679_100024105 513
784 3300025945 Ga0207679_10020613 Ga0207679_100206132 513
785 3300025945 Ga0207679_10143643 Ga0207679_101436431 513
786 3300025945 Ga0207679_10195950 Ga0207679_101959501 513
787 3300025949 Ga0207667_10000443 Ga0207667_1000044335 513
788 3300025949 Ga0207667_10003333 Ga0207667_100033335 513
789 3300025949 Ga0207667_10018675 Ga0207667_100186755 513
790 3300025949 Ga0207667_10028728 Ga0207667_100287282 513
791 3300025949 Ga0207667_10058747 Ga0207667_100587473 513
792 3300025960 Ga0207651_10001795 Ga0207651_1000179510 513
793 3300025960 Ga0207651_10002905 Ga0207651_100029057 513
794 3300025960 Ga0207651_10055131 Ga0207651_100551313 513
795 3300025960 Ga0207651_10085909 Ga0207651_100859092 513
796 3300025961 Ga0207712_10000491 Ga0207712_1000049113 513
797 3300025972 Ga0207668_10000060 Ga0207668_1000006091 513
798 3300025972 Ga0207668_10002897 Ga0207668_100028975 513
799 3300025986 Ga0207658_10004678 Ga0207658_100046785 513
800 3300025986 Ga0207658_10024264 Ga0207658_100242642 513
801 3300025986 Ga0207658_10050633 Ga0207658_100506332 513
802 3300025986 Ga0207658_10065947 Ga0207658_100659472 513
803 3300025986 Ga0207658_10069308 Ga0207658_100693081 513
804 3300026023 Ga0207677_10001176 Ga0207677_100011766 513
805 3300026023 Ga0207677_10007012 Ga0207677_100070125 513
806 3300026023 Ga0207677_10008451 Ga0207677_100084512 513
807 3300026035 Ga0207703_10002126 Ga0207703_100021267 513
808 3300026035 Ga0207703_10006385 Ga0207703_100063859 513
809 3300026035 Ga0207703_10007171 Ga0207703_100071716 513
810 3300026041 Ga0207639_10004498 Ga0207639_100044989 513
811 3300026041 Ga0207639_10030651 Ga0207639_100306513 513
812 3300026067 Ga0207678_10000922 Ga0207678_100009227 513
813 3300026067 Ga0207678_10007936 Ga0207678_100079369 513
814 3300026067 Ga0207678_10015620 Ga0207678_100156207 513
815 3300026067 Ga0207678_10097916 Ga0207678_100979162 513
816 3300026078 Ga0207702_10001142 Ga0207702_1000114214 513
817 3300026078 Ga0207702_10016603 Ga0207702_100166035 513
818 3300026078 Ga0207702_10031481 Ga0207702_100314813 513
819 3300026088 Ga0207641_10014741 Ga0207641_100147412 513
820 3300026088 Ga0207641_10056185 Ga0207641_100561853 513
821 3300026088 Ga0207641_10073677 Ga0207641_100736773 513
822 3300026088 Ga0207641_10077590 Ga0207641_100775903 513
823 3300026089 Ga0207648_10000962 Ga0207648_1000096230 513
824 3300026089 Ga0207648_10005363 Ga0207648_100053635 513
825 3300026089 Ga0207648_10006581 Ga0207648_100065812 513
826 3300026095 Ga0207676_10016784 Ga0207676_100167846 513
827 3300026095 Ga0207676_10054631 Ga0207676_100546312 513
828 3300026095 Ga0207676_10215742 Ga0207676_102157421 513
829 3300026116 Ga0207674_10000057 Ga0207674_1000005723 513
830 3300026116 Ga0207674_10000345 Ga0207674_1000034553 513
831 3300026116 Ga0207674_10001662 Ga0207674_1000166210 513
832 3300026116 Ga0207674_10005462 Ga0207674_1000546217 513
833 3300026116 Ga0207674_10025338 Ga0207674_100253385 513
834 3300026118 Ga0207675_100025578 Ga0207675_1000255786 513
835 3300026121 Ga0207683_10012311 Ga0207683_100123111 513
836 3300026121 Ga0207683_10071352 Ga0207683_100713523 513
837 3300026142 Ga0207698_10003075 Ga0207698_100030759 513
838 3300026142 Ga0207698_10005264 Ga0207698_100052649 513
839 3300026142 Ga0207698_10016128 Ga0207698_100161283 513
840 3300026142 Ga0207698_10041945 Ga0207698_100419454 513
841 3300026142 Ga0207698_10051430 Ga0207698_100514303 513
842 3300026142 Ga0207698_10089381 Ga0207698_100893812 513
843 3300028379 Ga0268266_10002013 Ga0268266_1000201320 513
844 3300028379 Ga0268266_10012433 Ga0268266_100124337 513
845 3300028379 Ga0268266_10018502 Ga0268266_100185022 513
846 3300028379 Ga0268266_10024236 Ga0268266_100242362 513
847 3300028379 Ga0268266_10029757 Ga0268266_100297573 513
848 3300028379 Ga0268266_10035908 Ga0268266_100359085 513
849 3300028380 Ga0268265_10001537 Ga0268265_1000153715 513
850 3300028380 Ga0268265_10007179 Ga0268265_100071794 513
851 3300028380 Ga0268265_10012417 Ga0268265_100124172 513
852 3300028380 Ga0268265_10102576 Ga0268265_101025762 513
853 3300028381 Ga0268264_10002057 Ga0268264_1000205718 513
854 3300028381 Ga0268264_10012588 Ga0268264_100125882 513
855 3300031548 Ga0307408_100025201 Ga0307408_1000252014 513
856 3300031852 Ga0307410_10010178 Ga0307410_100101783 513
857 3300031903 Ga0307407_10030623 Ga0307407_100306232 513
858 3300031995 Ga0307409_100063994 Ga0307409_1000639942 513
859 3300032004 Ga0307414_10042603 Ga0307414_100426032 513
860 3300032005 Ga0307411_10006842 Ga0307411_100068424 513
861 3300035170 Ga0373943_0004664 Ga0373943_0004664_2985_4553 513
862 3300035691 Ga0373931_0006998 Ga0373931_0006998_1157_2725 513
863 3300035692 Ga0373935_0013577 Ga0373935_0013577_1370_2938 513
864 3300035725 Ga0373947_0036505 Ga0373947_0036505_502_2070 513
865 3300037068 Ga0373925_0065984 Ga0373925_0065984_574_2142 513
866 3300037312 Ga0395899_0000154 Ga0395899_0000154_18835_20409 513
867 3300037312 Ga0395899_0000469 Ga0395899_0000469_19336_20904 513
868 3300037312 Ga0395899_0009507 Ga0395899_0009507_5404_6972 513
869 3300037312 Ga0395899_0010217 Ga0395899_0010217_1884_3458 513
870 3300037312 Ga0395899_0035670 Ga0395899_0035670_1381_2949 513
871 3300037312 Ga0395899_0055865 Ga0395899_0055865_171_1739 513
872 3300037312 Ga0395899_0063570 Ga0395899_0063570_163_1731 513
873 3300037312 Ga0395899_0126011 Ga0395899_0126011_27_1595 513
874 3300037312 Ga0395899_0129818 Ga0395899_0129818_33_1601 513
875 3300037418 Ga0395900_0000293 Ga0395900_0000293_8628_10202 513
876 3300037418 Ga0395900_0016530 Ga0395900_0016530_264_1832 513
877 3300037418 Ga0395900_0017453 Ga0395900_0017453_3357_4925 513
878 3300037418 Ga0395900_0019372 Ga0395900_0019372_4179_5747 513
879 3300037418 Ga0395900_0049441 Ga0395900_0049441_1679_3247 513
880 3300037418 Ga0395900_0054644 Ga0395900_0054644_1635_3203 513
881 3300037418 Ga0395900_0057054 Ga0395900_0057054_144_1712 513
882 3300037418 Ga0395900_0062021 Ga0395900_0062021_1372_2946 513
883 3300037418 Ga0395900_0084867 Ga0395900_0084867_796_2370 513
884 3300037466 Ga0395898_0000219 Ga0395898_0000219_109025_110599 513
885 3300037466 Ga0395898_0002321 Ga0395898_0002321_15286_16854 513
886 3300037466 Ga0395898_0012439 Ga0395898_0012439_2982_4556 513
887 3300037466 Ga0395898_0019716 Ga0395898_0019716_4459_6027 513
888 3300037466 Ga0395898_0034157 Ga0395898_0034157_864_2438 513
889 3300037466 Ga0395898_0048457 Ga0395898_0048457_2005_3573 513
890 3300037466 Ga0395898_0055495 Ga0395898_0055495_1085_2656 513
891 3300037466 Ga0395898_0058065 Ga0395898_0058065_28_1596 513
892 3300037471 Ga0395905_0000092 Ga0395905_0000092_94301_95869 513
893 3300037471 Ga0395905_0000094 Ga0395905_0000094_109963_111537 513
894 3300037471 Ga0395905_0000852 Ga0395905_0000852_14405_15973 513
895 3300037471 Ga0395905_0003469 Ga0395905_0003469_10123_11691 513
896 3300037471 Ga0395905_0011073 Ga0395905_0011073_2592_4160 513
897 3300037471 Ga0395905_0012841 Ga0395905_0012841_1613_3181 513
898 3300037471 Ga0395905_0014738 Ga0395905_0014738_2401_3969 513
899 3300037471 Ga0395905_0014833 Ga0395905_0014833_2692_4266 513
900 3300037471 Ga0395905_0019796 Ga0395905_0019796_67_1635 513
901 3300037471 Ga0395905_0024814 Ga0395905_0024814_3842_5410 513
902 3300037471 Ga0395905_0025675 Ga0395905_0025675_2367_3935 513
903 3300037471 Ga0395905_0039004 Ga0395905_0039004_2150_3718 513
904 3300037471 Ga0395905_0040395 Ga0395905_0040395_1767_3338 513
905 3300037471 Ga0395905_0040523 Ga0395905_0040523_484_2052 513
906 3300037471 Ga0395905_0055855 Ga0395905_0055855_237_1811 513
907 3300037471 Ga0395905_0057376 Ga0395905_0057376_803_2371 513
908 3300037471 Ga0395905_0200964 Ga0395905_0200964_194_1762 513
909 3300037471 Ga0395905_0215826 Ga0395905_0215826_36_1604 513
910 3300038443 Ga0395901_0000188 Ga0395901_0000188_26504_28072 513
911 3300038443 Ga0395901_0000228 Ga0395901_0000228_8628_10202 513
912 3300038443 Ga0395901_0001956 Ga0395901_0001956_5695_7263 513
913 3300038443 Ga0395901_0006402 Ga0395901_0006402_1856_3424 513
914 3300038443 Ga0395901_0006785 Ga0395901_0006785_9651_11270 513
915 3300038443 Ga0395901_0011987 Ga0395901_0011987_1953_3521 513
916 3300038443 Ga0395901_0015498 Ga0395901_0015498_2860_4428 513
917 3300038443 Ga0395901_0017047 Ga0395901_0017047_3937_5511 513
918 3300038443 Ga0395901_0025726 Ga0395901_0025726_1289_2857 513
919 3300038443 Ga0395901_0028527 Ga0395901_0028527_1487_3055 513
920 3300038443 Ga0395901_0047299 Ga0395901_0047299_1595_3169 513
921 3300038443 Ga0395901_0053143 Ga0395901_0053143_2582_4150 513
922 3300038443 Ga0395901_0064358 Ga0395901_0064358_2026_3594 513
923 3300038443 Ga0395901_0100058 Ga0395901_0100058_1049_2620 513
924 3300039437 Ga0436365_0878649 Ga0436365_0878649_6016_7584 513
925 3300042144 Ga0450889_000450 Ga0450889_000450_715_2283 513
926 3300042157 Ga0439458_0001172 Ga0439458_0001172_3659_5227 513
927 3300044694 Ga0466963_0067603 Ga0466963_0067603_467_2098 513
928 3300044706 Ga0466964_0012592 Ga0466964_0012592_1564_3138 513
929 3300044842 Ga0466957_0024478 Ga0466957_0024478_1735_3309 513
930 3300045049 Ga0466959_0029684 Ga0466959_0029684_622_2196 513
931 3300045049 Ga0466959_0053129 Ga0466959_0053129_852_2510 513
932 3300045836 Ga0466958_0007994 Ga0466958_0007994_3454_5028 513
933 3300045976 Ga0466967_0004245 Ga0466967_0004245_3699_5273 513
934 3300045976 Ga0466967_0068584 Ga0466967_0068584_774_2342 513
935 3300045976 Ga0466967_0107120 Ga0466967_0107120_929_2497 513
936 3300045976 Ga0466967_0206424 Ga0466967_0206424_221_1852 513
937 3300046539 Ga0495621_0000006 Ga0495621_0000006_25698_27266 513
938 3300046616 Ga0495668_0011823 Ga0495668_0011823_3508_5076 513
939 3300046616 Ga0495668_0069012 Ga0495668_0069012_91_1659 513
940 3300046684 Ga0495669_0002162 Ga0495669_0002162_5695_7269 513
941 3300046684 Ga0495669_0024186 Ga0495669_0024186_631_2199 513
942 3300046684 Ga0495669_0036144 Ga0495669_0036144_525_2093 513
943 3300046691 Ga0495670_0000226 Ga0495670_0000226_22321_23889 513
944 3300047445 Ga0495677_0013315 Ga0495677_0013315_272_1840 513
945 3300048904 Ga0496101_0008790 Ga0496101_0008790_4288_5856 513
946 3300048905 Ga0496102_0052842 Ga0496102_0052842_899_2467 513
947 3300048906 Ga0496103_0070990 Ga0496103_0070990_341_1909 513
948 3300048910 Ga0496107_0002882 Ga0496107_0002882_1095_2663 513
949 3300048911 Ga0496108_0012284 Ga0496108_0012284_5280_6854 513
950 3300048911 Ga0496108_0025304 Ga0496108_0025304_214_1782 513
951 3300048912 Ga0496109_0006390 Ga0496109_0006390_7073_8641 513
952 3300048912 Ga0496109_0022917 Ga0496109_0022917_407_1975 513
953 3300048912 Ga0496109_0035592 Ga0496109_0035592_2807_4381 513
954 3300048912 Ga0496109_0044235 Ga0496109_0044235_2039_3613 513
955 3300048912 Ga0496109_0079033 Ga0496109_0079033_710_2278 513
956 3300048913 Ga0496110_0012390 Ga0496110_0012390_3850_5418 513
957 3300048913 Ga0496110_0041422 Ga0496110_0041422_2035_3603 513
958 3300048914 Ga0496111_0001738 Ga0496111_0001738_394_1962 513
959 3300048914 Ga0496111_0033332 Ga0496111_0033332_1107_2675 513
960 3300048914 Ga0496111_0037205 Ga0496111_0037205_108_1682 513
961 3300048914 Ga0496111_0054945 Ga0496111_0054945_750_2318 513
962 3300048914 Ga0496111_0060566 Ga0496111_0060566_626_2200 513
963 3300048915 Ga0496112_0004679 Ga0496112_0004679_9442_11016 513
964 3300048915 Ga0496112_0005602 Ga0496112_0005602_6010_7578 513
965 3300048915 Ga0496112_0007583 Ga0496112_0007583_234_1808 513
966 3300048915 Ga0496112_0011522 Ga0496112_0011522_2480_4048 513
967 3300048915 Ga0496112_0069187 Ga0496112_0069187_547_2121 513
968 3300048915 Ga0496112_0098035 Ga0496112_0098035_511_2079 513
969 3300048916 Ga0496113_0002278 Ga0496113_0002278_7948_9516 513
970 3300048916 Ga0496113_0011413 Ga0496113_0011413_964_2538 513
971 3300048917 Ga0496114_0000019 Ga0496114_0000019_119212_120780 513
972 3300053134 Ga0500658_0000044 Ga0500658_0000044_3380_4948 513
973 3300053153 Ga0500616_0000140 Ga0500616_0000140_87814_89418 513
974 iso_pu_bacteria 2896429255 2896430634 513
975 3300005327 Ga0070658_10053938 Ga0070658_100539382 514
976 3300005327 Ga0070658_10066077 Ga0070658_100660773 514
977 3300005334 Ga0068869_100031072 Ga0068869_1000310725 514
978 3300005339 Ga0070660_100003337 Ga0070660_10000333710 514
979 3300005344 Ga0070661_100004629 Ga0070661_1000046292 514
980 3300005355 Ga0070671_100047744 Ga0070671_1000477442 514
981 3300005366 Ga0070659_100000952 Ga0070659_1000009524 514
982 3300005367 Ga0070667_100000776 Ga0070667_10000077611 514
983 3300005458 Ga0070681_10018913 Ga0070681_100189131 514
984 3300005530 Ga0070679_100012704 Ga0070679_1000127043 514
985 3300005539 Ga0068853_100010006 Ga0068853_1000100063 514
986 3300005539 Ga0068853_100032362 Ga0068853_1000323622 514
987 3300005563 Ga0068855_100028425 Ga0068855_1000284257 514
988 3300005577 Ga0068857_100029415 Ga0068857_1000294153 514
989 3300005578 Ga0068854_100016766 Ga0068854_1000167665 514
990 3300005617 Ga0068859_100001405 Ga0068859_1000014054 514
991 3300005618 Ga0068864_100000287 Ga0068864_1000002878 514
992 3300005834 Ga0068851_10016075 Ga0068851_100160753 514
993 3300005841 Ga0068863_100010902 Ga0068863_1000109029 514
994 3300005842 Ga0068858_100000579 Ga0068858_10000057916 514
995 3300005843 Ga0068860_100004159 Ga0068860_10000415911 514
996 3300006931 Ga0097620_100001405 Ga0097620_10000140526 514
997 3300009093 Ga0105240_10009782 Ga0105240_100097822 514
998 3300009177 Ga0105248_10000552 Ga0105248_1000055223 514
999 3300009545 Ga0105237_10010455 Ga0105237_100104552 514
1000 3300009551 Ga0105238_10002513 Ga0105238_1000251310 514
1001 3300013105 Ga0157369_10026544 Ga0157369_100265442 514
1002 3300014325 Ga0163163_10000390 Ga0163163_1000039047 514
1003 3300014968 Ga0157379_10173609 Ga0157379_101736091 514
1004 3300025904 Ga0207647_10002263 Ga0207647_100022635 514
1005 3300025914 Ga0207671_10015467 Ga0207671_100154673 514
1006 3300025919 Ga0207657_10002867 Ga0207657_1000286718 514
1007 3300025919 Ga0207657_10038490 Ga0207657_100384904 514
1008 3300025924 Ga0207694_10001011 Ga0207694_1000101121 514
1009 3300025929 Ga0207664_10097703 Ga0207664_100977032 514
1010 3300025931 Ga0207644_10062029 Ga0207644_100620292 514
1011 3300025932 Ga0207690_10010570 Ga0207690_100105704 514
1012 3300025941 Ga0207711_10000046 Ga0207711_10000046124 514
1013 3300025949 Ga0207667_10039888 Ga0207667_100398886 514
1014 3300025981 Ga0207640_10123868 Ga0207640_101238682 514
1015 3300025986 Ga0207658_10006908 Ga0207658_100069082 514
1016 3300026035 Ga0207703_10002982 Ga0207703_100029825 514
1017 3300026041 Ga0207639_10000144 Ga0207639_100001447 514
1018 3300026041 Ga0207639_10013211 Ga0207639_100132113 514
1019 3300026067 Ga0207678_10021689 Ga0207678_100216897 514
1020 3300026078 Ga0207702_10023021 Ga0207702_100230214 514
1021 3300026088 Ga0207641_10001374 Ga0207641_100013742 514
1022 3300026095 Ga0207676_10000345 Ga0207676_1000034528 514
1023 3300026116 Ga0207674_10003393 Ga0207674_100033937 514
1024 3300026116 Ga0207674_10009490 Ga0207674_100094904 514
1025 3300028380 Ga0268265_10080777 Ga0268265_100807772 514
1026 3300028381 Ga0268264_10001319 Ga0268264_1000131919 514
1027 3300031456 Ga0307513_10114291 Ga0307513_101142912 514
1028 3300037312 Ga0395899_0077207 Ga0395899_0077207_257_1834 514
1029 3300037418 Ga0395900_0001293 Ga0395900_0001293_7939_9516 514
1030 3300037466 Ga0395898_0215461 Ga0395898_0215461_43_1620 514
1031 3300037471 Ga0395905_0000675 Ga0395905_0000675_34309_35886 514
1032 3300038443 Ga0395901_0035191 Ga0395901_0035191_492_2069 514
1033 3300044694 Ga0466963_0001296 Ga0466963_0001296_8358_9947 514
1034 3300044842 Ga0466957_0013396 Ga0466957_0013396_2099_3754 514
1035 3300044842 Ga0466957_0016425 Ga0466957_0016425_2710_4299 514
1036 3300045976 Ga0466967_0045251 Ga0466967_0045251_1418_3073 514
1037 3300048914 Ga0496111_0022359 Ga0496111_0022359_272_1873 514
1038 3300048917 Ga0496114_0048857 Ga0496114_0048857_1262_2863 514
1039 3300048918 Ga0496115_0002002 Ga0496115_0002002_2193_3794 514
1040 3300005327 Ga0070658_10001203 Ga0070658_1000120314 515
1041 3300005366 Ga0070659_100057882 Ga0070659_1000578822 515
1042 3300005546 Ga0070696_100006123 Ga0070696_1000061236 515
1043 3300005563 Ga0068855_100023625 Ga0068855_1000236252 515
1044 3300005563 Ga0068855_100035028 Ga0068855_1000350284 515
1045 3300005578 Ga0068854_100003369 Ga0068854_1000033696 515
1046 3300005614 Ga0068856_100007071 Ga0068856_10000707110 515
1047 3300005616 Ga0068852_100000205 Ga0068852_10000020523 515
1048 3300005616 Ga0068852_100012469 Ga0068852_1000124692 515
1049 3300009093 Ga0105240_10168642 Ga0105240_101686422 515
1050 3300025909 Ga0207705_10000004 Ga0207705_10000004121 515
1051 3300025913 Ga0207695_10129274 Ga0207695_101292742 515
1052 3300025949 Ga0207667_10016430 Ga0207667_100164306 515
1053 3300025949 Ga0207667_10030274 Ga0207667_100302744 515
1054 3300025981 Ga0207640_10001408 Ga0207640_1000140811 515
1055 3300026078 Ga0207702_10017939 Ga0207702_100179395 515
1056 3300026142 Ga0207698_10000058 Ga0207698_1000005870 515
1057 3300026142 Ga0207698_10002303 Ga0207698_100023037 515
1058 3300027876 Ga0209974_10000831 Ga0209974_1000083112 515
1059 3300031731 Ga0307405_10049286 Ga0307405_100492862 515
1060 3300031852 Ga0307410_10089927 Ga0307410_100899272 515
1061 3300044694 Ga0466963_0015309 Ga0466963_0015309_510_2093 515
1062 3300005331 Ga0070670_100005076 Ga0070670_1000050762 516
1063 3300025925 Ga0207650_10083293 Ga0207650_100832932 516
1064 3300030745 Ga0316182_1136599 Ga0316182_11365999 516
1065 3300031548 Ga0307408_100010470 Ga0307408_1000104702 516
1066 3300031548 Ga0307408_100034484 Ga0307408_1000344842 516
1067 3300031731 Ga0307405_10102123 Ga0307405_101021231 516
1068 3300031824 Ga0307413_10011816 Ga0307413_100118163 516
1069 3300031824 Ga0307413_10019228 Ga0307413_100192284 516
1070 3300031824 Ga0307413_10058146 Ga0307413_100581462 516
1071 3300031901 Ga0307406_10084199 Ga0307406_100841992 516
1072 3300031903 Ga0307407_10059297 Ga0307407_100592972 516
1073 3300031903 Ga0307407_10062409 Ga0307407_100624092 516
1074 3300031911 Ga0307412_10053578 Ga0307412_100535782 516
1075 3300031911 Ga0307412_10076356 Ga0307412_100763562 516
1076 3300031995 Ga0307409_100033304 Ga0307409_1000333043 516
1077 3300031995 Ga0307409_100037140 Ga0307409_1000371402 516
1078 3300031995 Ga0307409_100038837 Ga0307409_1000388374 516
1079 3300031995 Ga0307409_100042903 Ga0307409_1000429032 516
1080 3300032002 Ga0307416_100015410 Ga0307416_1000154102 516
1081 3300032004 Ga0307414_10009315 Ga0307414_100093153 516
1082 3300032005 Ga0307411_10001495 Ga0307411_100014953 516
1083 3300032005 Ga0307411_10031628 Ga0307411_100316282 516
1084 3300032005 Ga0307411_10079700 Ga0307411_100797003 516
1085 3300032005 Ga0307411_10132959 Ga0307411_101329592 516
1086 3300032126 Ga0307415_100044767 Ga0307415_1000447672 516
1087 3300037418 Ga0395900_0000537 Ga0395900_0000537_18060_19652 516
1088 3300037471 Ga0395905_0000730 Ga0395905_0000730_5323_6915 516
1089 3300038443 Ga0395901_0002066 Ga0395901_0002066_1639_3231 516
1090 3300045836 Ga0466958_0074061 Ga0466958_0074061_107_1768 516
1091 iso_pu_bacteria 2643221560 2643821354 516
1092 3300005293 Ga0065715_10119835 Ga0065715_101198352 517
1093 3300005455 Ga0070663_100021227 Ga0070663_1000212272 517
1094 3300005539 Ga0068853_100045638 Ga0068853_1000456385 517
1095 3300005563 Ga0068855_100021268 Ga0068855_1000212682 517
1096 3300005616 Ga0068852_100149447 Ga0068852_1001494472 517
1097 3300005842 Ga0068858_100211646 Ga0068858_1002116462 517
1098 3300013306 Ga0163162_10017313 Ga0163162_100173132 517
1099 3300025909 Ga0207705_10000358 Ga0207705_100003586 517
1100 3300025945 Ga0207679_10029125 Ga0207679_100291252 517
1101 3300026067 Ga0207678_10018378 Ga0207678_100183782 517
1102 3300026095 Ga0207676_10040203 Ga0207676_100402032 517
1103 3300026142 Ga0207698_10180417 Ga0207698_101804172 517
1104 3300031548 Ga0307408_100088018 Ga0307408_1000880182 517
1105 3300031903 Ga0307407_10037623 Ga0307407_100376232 517
1106 3300031995 Ga0307409_100089120 Ga0307409_1000891202 517
1107 3300042004 Ga0439445_0000526 Ga0439445_0000526_5150_6790 517
1108 3300048924 Ga0496121_0000021 Ga0496121_0000021_360150_361709 517
1109 3300006048 Ga0075363_100004586 Ga0075363_1000045862 518
1110 3300006177 Ga0075362_10000023 Ga0075362_1000002348 518
1111 3300006186 Ga0075369_10005681 Ga0075369_100056812 518
1112 3300006195 Ga0075366_10000034 Ga0075366_1000003416 518
1113 3300006353 Ga0075370_10000077 Ga0075370_100000774 518
1114 3300031911 Ga0307412_10025327 Ga0307412_100253273 518
1115 3300032004 Ga0307414_10013583 Ga0307414_100135837 518
1116 3300032004 Ga0307414_10137325 Ga0307414_101373251 518
1117 3300032126 Ga0307415_100056559 Ga0307415_1000565591 518
1118 3300045976 Ga0466967_0003308 Ga0466967_0003308_2172_3830 518
1119 3300049575 Ga0501039_0032263 Ga0501039_0032263_754_2343 518
1120 3300050489 nmdc:mga03683_42_c1 nmdc:mga03683_42_c1_18607_20166 518
1121 3300050490 nmdc:mga03n38_959_c1 nmdc:mga03n38_959_c1_1211_2770 518
1122 3300050493 nmdc:mga0k408_3_c1 nmdc:mga0k408_3_c1_87998_89557 518
1123 3300050496 nmdc:mga07m45_6_c1 nmdc:mga07m45_6_c1_158727_160286 518
1124 3300050516 nmdc:mga0sz30_298_c2 nmdc:mga0sz30_298_c2_3453_5012 518
1125 3300006042 Ga0075368_10000063 Ga0075368_1000006334 519
1126 3300006177 Ga0075362_10000649 Ga0075362_100006497 519
1127 3300006178 Ga0075367_10001443 Ga0075367_100014437 519
1128 3300025304 Ga0209257_1003077 Ga0209257_100307710 519
1129 3300027866 Ga0209813_10000047 Ga0209813_1000004755 519
1130 3300031911 Ga0307412_10092211 Ga0307412_100922112 519
1131 3300032004 Ga0307414_10016316 Ga0307414_100163162 519
1132 3300050489 nmdc:mga03683_435_c1 nmdc:mga03683_435_c1_9453_11018 519
1133 3300050491 nmdc:mga00v17_6840_c1 nmdc:mga00v17_6840_c1_2771_4336 519
1134 3300050496 nmdc:mga07m45_164_c1 nmdc:mga07m45_164_c1_23254_24819 519
1135 3300053156 Ga0500622_0012157 Ga0500622_0012157_2582_4147 519
1136 3300053158 Ga0500627_0000010 Ga0500627_0000010_70584_72179 519
1137 3300005335 Ga0070666_10028034 Ga0070666_100280342 520
1138 3300005355 Ga0070671_100000066 Ga0070671_1000000669 520
1139 3300005548 Ga0070665_100067025 Ga0070665_1000670253 520
1140 3300025931 Ga0207644_10000087 Ga0207644_1000008767 520
1141 3300025986 Ga0207658_10064870 Ga0207658_100648702 520
1142 3300026035 Ga0207703_10001270 Ga0207703_1000127010 520
1143 3300031824 Ga0307413_10045390 Ga0307413_100453901 520
1144 3300031852 Ga0307410_10020753 Ga0307410_100207532 520
1145 3300031903 Ga0307407_10015512 Ga0307407_100155122 520
1146 3300032004 Ga0307414_10011707 Ga0307414_100117074 520
1147 3300046500 Ga0495596_0004636 Ga0495596_0004636_766_2331 520
1148 3300046512 Ga0495610_0000030 Ga0495610_0000030_154987_156549 520
1149 3300046519 Ga0495632_0011734 Ga0495632_0011734_554_2119 520
1150 3300046558 Ga0495633_0033855 Ga0495633_0033855_201_1766 520
1151 3300046660 Ga0495625_0002711 Ga0495625_0002711_12993_14558 520
1152 3300046692 Ga0495671_0013838 Ga0495671_0013838_2123_3688 520
1153 3300048903 Ga0496100_0029753 Ga0496100_0029753_266_1834 520
1154 3300048907 Ga0496104_0053175 Ga0496104_0053175_1078_2646 520
1155 3300048910 Ga0496107_0002491 Ga0496107_0002491_2015_3583 520
1156 3300048914 Ga0496111_0093342 Ga0496111_0093342_415_1983 520
1157 3300048916 Ga0496113_0002426 Ga0496113_0002426_1866_3434 520
1158 3300048929 Ga0496126_0006047 Ga0496126_0006047_3811_5379 520
1159 3300053121 Ga0500607_001590 Ga0500607_001590_11315_12886 520
1160 iso_pu_bacteria 2885427238 2885427976 520
1161 3300031903 Ga0307407_10034252 Ga0307407_100342522 521
1162 3300035242 Ga0373962_0023276 Ga0373962_0023276_11_1579 521
1163 3300005353 Ga0070669_100004379 Ga0070669_10000437910 522
1164 3300005367 Ga0070667_100005752 Ga0070667_1000057528 525
1165 3300005841 Ga0068863_100006521 Ga0068863_10000652114 525
1166 3300025986 Ga0207658_10005943 Ga0207658_100059434 525
1167 3300026088 Ga0207641_10014111 Ga0207641_100141113 525
1168 3300025972 Ga0207668_10116834 Ga0207668_101168342 527
1169 3300027876 Ga0209974_10011811 Ga0209974_100118113 528
1170 iso_pu_bacteria 2510917021 2511127090 528
1171 iso_pu_bacteria 2818991438 2819553039 528
1172 iso_pu_bacteria 8054302542 8054305929 528
1173 3300005844 Ga0068862_100004894 Ga0068862_1000048948 530
1174 3300028380 Ga0268265_10002132 Ga0268265_100021322 530
1175 3300048924 Ga0496121_0003456 Ga0496121_0003456_14014_15636 531
1176 2162886007 SwRhRL2b_contig_154827 SwRhRL2b_0375.00000820 532
1177 3300025298 Ga0209050_1001213 Ga0209050_10012136 532
1178 3300046500 Ga0495596_0002704 Ga0495596_0002704_1723_3324 532
1179 3300046512 Ga0495610_0000247 Ga0495610_0000247_3046_4647 532
1180 3300046512 Ga0495610_0001936 Ga0495610_0001936_1259_2860 532
1181 3300046522 Ga0495643_0000110 Ga0495643_0000110_5585_7186 532
1182 3300046522 Ga0495643_0003519 Ga0495643_0003519_1622_3220 532
1183 3300048090 Ga0495615_0000025 Ga0495615_0000025_45106_46704 532
1184 3300048091 Ga0495626_0002996 Ga0495626_0002996_5060_6661 532
1185 3300048919 Ga0496116_0000028 Ga0496116_0000028_72896_74497 532
1186 3300048924 Ga0496121_0003190 Ga0496121_0003190_1995_3596 532
1187 3300048926 Ga0496123_0001658 Ga0496123_0001658_3031_4629 532
1188 3300048926 Ga0496123_0001766 Ga0496123_0001766_23540_25141 532
1189 3300048927 Ga0496124_0000477 Ga0496124_0000477_63150_64751 532
1190 3300048927 Ga0496124_0036125 Ga0496124_0036125_710_2308 532
1191 3300048929 Ga0496126_0000079 Ga0496126_0000079_168322_169923 532

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21478

GcvP2_C

Glycine dehydrogenase, C-terminal domain

413

525

0.89

PF00266

Aminotran_5

Aminotransferase class-V

201

337

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lhc-assembly1.cif.gz_B crystal structure of synechocystis sp. pcc 6803 glycine decarboxylase (p-protein), holo form with pyridoxal-5'-phosphate and glycine 0.7755 115 494
4lhc-assembly1.cif.gz_A crystal structure of synechocystis sp. pcc 6803 glycine decarboxylase (p-protein), holo form with pyridoxal-5'-phosphate and glycine 0.7567 107 486
6i34-assembly2.cif.gz_C crystal structure of neanderthal glycine decarboxylase (p-protein) 0.7542 115 485
6i35-assembly2.cif.gz_D crystal structure of human glycine decarboxylase (p-protein) bound with pyridoxyl-glycine-5'-monophosphate 0.7537 99 485
4lgl-assembly1.cif.gz_B crystal structure of glycine decarboxylase p-protein from synechocystis sp. pcc 6803, apo form 0.7385 99 494
ID Description Score Start End Superfamily
af_K7TIN2_588_818_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8532 113 323 3.40.640.10
1wyvH03 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8434 108 380 3.40.640.10
af_Q54KM7_558_805_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8364 117 371 3.40.640.10
1wyvH03 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8346 108 380 3.40.640.10
af_Q54KM7_558_805_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8274 117 371 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A354FBL3-F1-model_v4 Aminomethyl-transferring glycine dehydrogenase subunit GcvPB (EC 1.4.4.2) 0.9078 136 284 GO:0004375
GO:0005829
GO:0005960
GO:0016594
GO:0019464
GO:0030170
AF-X1RQM3-F1-model_v4 Aminotransferase class V domain-containing protein 0.9026 171 272 GO:0004375
GO:0005829
GO:0005960
GO:0016594
GO:0019464
GO:0030170
AF-A0A6V8QCP3-F1-model_v4 Glycine dehydrogenase 0.8952 173 381 GO:0004375
GO:0005829
GO:0005960
GO:0016594
GO:0019464
GO:0030170
AF-A0A349P8E8-F1-model_v4 Aminomethyl-transferring glycine dehydrogenase subunit GcvPB (EC 1.4.4.2) 0.895 155 336 GO:0004375
GO:0005829
GO:0005960
GO:0016594
GO:0019464
GO:0030170
AF-A0A7J8XT10-F1-model_v4 Glycine cleavage system P-protein N-terminal domain-containing protein 0.8949 141 323 GO:0004375
GO:0005739
GO:0005960
GO:0009941
GO:0016594
GO:0019464
GO:0030170
GO:0048046

Feature Viewer

pLDDT pTM Quality
68.27 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map