F491457
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1191 | 512 | 1120 | 409 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100096303|Ga0070665_1000963032 |
| Length | 487 |
| Sequence | MAAPGVADGSVNVHLAPSTATCKSLASAGGCFLLHAGTNSTQSVGLNVQRGFTFKAKLWNNSARGWQFRLATGVNMLLARVLSRVLGEGQLIIIDAAGQQHRIDGARKGPSVTMRIHTWWTGIRLILQPRLAFGEAYMDGKITVENGDIYDLLDLLGRNMAAIDGTPFVRWSYLWQKTIRWIEQYNPVGKAQRNVAHHYDLNGQLYDFFLDRDRQYSCAYFKNGDEPLEEAQLDKKRHIAAKMLLLPGQKVLDIGSGWGGLGLFLGQQYGVDVTGVTLSTEQHTVSSRRALEGGLADRVRFKLLDYREEPDRYDRIVSVGMFEHVGVAHYVEYFRKVKELLKDDGVMVLHAIGRMEPPGATNTWLKKYIFPGGYTPALSEVMAAIEKVGLWVTDVEILRLHYAETLRHWRQRFLANRERIKQQSGYDERFCRMWEFYLAGCEVSFRYMNQMVFQIQLARKQDAVPLTRDYIVDAERGMAISRSMAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 3 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 4 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 5 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 6 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 7 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 8 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 9 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 10 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 11 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 12 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 13 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 14 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 15 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 16 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 17 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 18 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 19 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 20 | 2684623219 | Planctomyces sp. SH-PL14 | Isolate | Unclassified |
| 21 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 22 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 23 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 24 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 25 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 26 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 27 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 28 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 29 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 30 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 31 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 32 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 33 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 34 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 35 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 36 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 37 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 38 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 39 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 40 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 41 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 42 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 43 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 44 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 45 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 46 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 47 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 48 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 49 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 50 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 51 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 52 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 53 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 54 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 55 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 56 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 57 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 58 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 59 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 60 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 61 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 62 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 63 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 64 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 65 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 66 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 67 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 68 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 69 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 70 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 71 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 72 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 73 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 74 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 75 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 76 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 77 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 78 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 79 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 80 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 81 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 82 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 83 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 84 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 85 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 86 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 92 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 100 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 110 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 114 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 115 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 120 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 122 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 123 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 124 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 125 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 126 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 127 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 128 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 129 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 130 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 131 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 132 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 133 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 134 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 135 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 137 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 138 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 139 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 140 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 141 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 142 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 143 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 144 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 145 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 147 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 148 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 149 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 150 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 151 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 152 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 153 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 155 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 156 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 157 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 170 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 171 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 176 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 183 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 186 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 187 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 188 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 189 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 190 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 191 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 192 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 193 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 194 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 196 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 205 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 208 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 261 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 265 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 266 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 267 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 268 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 269 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 270 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 271 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 272 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 273 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 274 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 275 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 276 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 277 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 278 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 279 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 280 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 281 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 282 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 283 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 284 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 285 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 286 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 287 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 288 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 289 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 290 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 291 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 292 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 293 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 294 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 296 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 297 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 299 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 300 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 301 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 302 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 303 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 305 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 306 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 308 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 309 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 310 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 311 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 312 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 313 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 314 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 315 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 316 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 317 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 318 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 319 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 320 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 321 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 322 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 323 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 324 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 325 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 389 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 390 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 391 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 392 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 393 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 394 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 395 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 397 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 398 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 399 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 400 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 401 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 402 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 403 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 404 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 405 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 406 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 407 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 408 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 409 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 410 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 411 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 412 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 413 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 439 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 440 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 441 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 442 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 443 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 444 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 449 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 453 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 454 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 455 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 456 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 457 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 458 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 459 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 460 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 468 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 470 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 473 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 474 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 475 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 476 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 477 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 478 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 479 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 480 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 481 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 482 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 483 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 484 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 485 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 486 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 487 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 488 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 489 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 490 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 491 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 493 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 494 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 495 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 496 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 497 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 498 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 499 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 500 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 501 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 502 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 503 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 504 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 507 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 508 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 509 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 510 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 511 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 512 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.95 |
| Metatranscriptomes | 0.25 |
| Isolates | 5.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.29 |
| Nodule | 2.18 |
| Rhizoplane | 2.94 |
| Rhizosphere | 69.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1374729 | 2162886007 | Bacteria | 6133 |
| 2 | JGI24736J21556_1000471 | 3300001904 | Bacteria | 7533 |
| 3 | JGI24741J21665_1000382 | 3300001915 | Bacteria | 13287 |
| 4 | JGI24740J21852_10001194 | 3300001979 | Bacteria | 11724 |
| 5 | JGI24739J22299_10010844 | 3300001989 | Bacteria | 3374 |
| 6 | JGI24739J22299_10014105 | 3300001989 | Bacteria | 2910 |
| 7 | JGI24737J22298_10004375 | 3300001990 | Bacteria | 4930 |
| 8 | JGI24735J21928_10001449 | 3300002067 | Bacteria | 8389 |
| 9 | JGI24738J21930_10008186 | 3300002075 | Bacteria | 2383 |
| 10 | JGI25159J45721_1002192 | 3300002987 | Bacteria | 7596 |
| 11 | JGI25159J45721_1015584 | 3300002987 | Bacteria | 1658 |
| 12 | JGI25151J46595_10000018 | 3300003187 | Bacteria | 238438 |
| 13 | JGI25151J46595_10000268 | 3300003187 | Bacteria | 59703 |
| 14 | JGI25153J46596_10000062 | 3300003215 | Bacteria | 129749 |
| 15 | JGI25153J46596_10004997 | 3300003215 | Bacteria | 7038 |
| 16 | JGI25153J46596_10015785 | 3300003215 | Bacteria | 3058 |
| 17 | JGI25153J46596_10019572 | 3300003215 | Bacteria | 2587 |
| 18 | rootH2_10104849 | 3300003320 | Bacteria | 7138 |
| 19 | rootL2_10076554 | 3300003322 | Bacteria | 2321 |
| 20 | JGI25160J50197_1000477 | 3300003354 | Bacteria | 24324 |
| 21 | JGI25160J50197_1009821 | 3300003354 | Bacteria | 3513 |
| 22 | Ga0055526_1001056 | 3300003771 | Bacteria | 20118 |
| 23 | Ga0055526_1002567 | 3300003771 | Bacteria | 12179 |
| 24 | Ga0055537_1001474 | 3300003773 | Bacteria | 9126 |
| 25 | Ga0055524_1000048 | 3300003775 | Bacteria | 149598 |
| 26 | Ga0055524_1003107 | 3300003775 | Bacteria | 8196 |
| 27 | Ga0055524_1006095 | 3300003775 | Bacteria | 5277 |
| 28 | Ga0055524_1006307 | 3300003775 | Bacteria | 5157 |
| 29 | Ga0055536_1001392 | 3300003781 | Bacteria | 14629 |
| 30 | Ga0055536_1003842 | 3300003781 | Bacteria | 7905 |
| 31 | Ga0055536_1005608 | 3300003781 | Bacteria | 6081 |
| 32 | Ga0055530_10000337 | 3300003791 | Bacteria | 42372 |
| 33 | Ga0055530_10005206 | 3300003791 | Bacteria | 6309 |
| 34 | Ga0055530_10005885 | 3300003791 | Bacteria | 5665 |
| 35 | Ga0055531_10000820 | 3300003794 | Bacteria | 25755 |
| 36 | Ga0055531_10001142 | 3300003794 | Bacteria | 20555 |
| 37 | Ga0065165_1000062 | 3300005262 | Bacteria | 178885 |
| 38 | Ga0065165_1000171 | 3300005262 | Bacteria | 114917 |
| 39 | Ga0065165_1001332 | 3300005262 | Bacteria | 27434 |
| 40 | Ga0065165_1001692 | 3300005262 | Bacteria | 22261 |
| 41 | Ga0065165_1019308 | 3300005262 | Bacteria | 2439 |
| 42 | Ga0065165_1019889 | 3300005262 | Bacteria | 2382 |
| 43 | Ga0065704_10011258 | 3300005289 | Bacteria | 2172 |
| 44 | Ga0065704_10072447 | 3300005289 | Bacteria | 8513 |
| 45 | Ga0065704_10145782 | 3300005289 | Bacteria | 1452 |
| 46 | Ga0065712_10089656 | 3300005290 | Bacteria | 2460 |
| 47 | Ga0065715_10017061 | 3300005293 | Unclassified | 1968 |
| 48 | Ga0070658_10010617 | 3300005327 | Bacteria | 7378 |
| 49 | Ga0070658_10020815 | 3300005327 | Bacteria | 5256 |
| 50 | Ga0070683_100092955 | 3300005329 | Bacteria | 2833 |
| 51 | Ga0070683_100164806 | 3300005329 | Bacteria | 2103 |
| 52 | Ga0070683_100173143 | 3300005329 | Bacteria | 2049 |
| 53 | Ga0070670_100000128 | 3300005331 | Bacteria | 71585 |
| 54 | Ga0070670_100005254 | 3300005331 | Bacteria | 10909 |
| 55 | Ga0070670_100101569 | 3300005331 | Unclassified | 2476 |
| 56 | Ga0070670_100184868 | 3300005331 | Bacteria | 1810 |
| 57 | Ga0070666_10062863 | 3300005335 | Bacteria | 2516 |
| 58 | Ga0070680_100000264 | 3300005336 | Bacteria | 34683 |
| 59 | Ga0070680_100016723 | 3300005336 | Bacteria | 5775 |
| 60 | Ga0070680_100026049 | 3300005336 | Bacteria | 4676 |
| 61 | Ga0070680_100027191 | 3300005336 | Bacteria | 4581 |
| 62 | Ga0070680_100160063 | 3300005336 | Bacteria | 1892 |
| 63 | Ga0070680_100263208 | 3300005336 | Bacteria | 1459 |
| 64 | Ga0068868_100008896 | 3300005338 | Bacteria | 7197 |
| 65 | Ga0068868_100152170 | 3300005338 | Bacteria | 1906 |
| 66 | Ga0070660_100011131 | 3300005339 | Bacteria | 6380 |
| 67 | Ga0070660_100068056 | 3300005339 | Bacteria | 2775 |
| 68 | Ga0070661_100038900 | 3300005344 | Bacteria | 3464 |
| 69 | Ga0070668_100000584 | 3300005347 | Bacteria | 24454 |
| 70 | Ga0070668_100001376 | 3300005347 | Bacteria | 17440 |
| 71 | Ga0070668_100001584 | 3300005347 | Bacteria | 16459 |
| 72 | Ga0070668_100004146 | 3300005347 | Bacteria | 10732 |
| 73 | Ga0070668_100006149 | 3300005347 | Bacteria | 8894 |
| 74 | Ga0070668_100007411 | 3300005347 | Bacteria | 8143 |
| 75 | Ga0070668_100009650 | 3300005347 | Bacteria | 7160 |
| 76 | Ga0070668_100011336 | 3300005347 | Bacteria | 6641 |
| 77 | Ga0070669_100039331 | 3300005353 | Bacteria | 3436 |
| 78 | Ga0070669_100056464 | 3300005353 | Bacteria | 2879 |
| 79 | Ga0070669_100101527 | 3300005353 | Bacteria | 2171 |
| 80 | Ga0070671_100000209 | 3300005355 | Bacteria | 38883 |
| 81 | Ga0070671_100002549 | 3300005355 | Bacteria | 14119 |
| 82 | Ga0070671_100206807 | 3300005355 | Bacteria | 1664 |
| 83 | Ga0070674_100005598 | 3300005356 | Bacteria | 7272 |
| 84 | Ga0070673_100081992 | 3300005364 | Bacteria | 2617 |
| 85 | Ga0070688_100003954 | 3300005365 | Bacteria | 7686 |
| 86 | Ga0070667_100000169 | 3300005367 | Bacteria | 81539 |
| 87 | Ga0070667_100004942 | 3300005367 | Bacteria | 11168 |
| 88 | Ga0070667_100027219 | 3300005367 | Bacteria | 4757 |
| 89 | Ga0070714_100001181 | 3300005435 | Bacteria | 18803 |
| 90 | Ga0070714_100033522 | 3300005435 | Bacteria | 4293 |
| 91 | Ga0070714_100067083 | 3300005435 | Bacteria | 3093 |
| 92 | Ga0070714_100186792 | 3300005435 | Bacteria | 1889 |
| 93 | Ga0070714_100223090 | 3300005435 | Bacteria | 1733 |
| 94 | Ga0070713_100010091 | 3300005436 | Bacteria | 6810 |
| 95 | Ga0070713_100014715 | 3300005436 | Bacteria | 5821 |
| 96 | Ga0070713_100037311 | 3300005436 | Bacteria | 3928 |
| 97 | Ga0070713_100075374 | 3300005436 | Bacteria | 2861 |
| 98 | Ga0070713_100096823 | 3300005436 | Bacteria | 2548 |
| 99 | Ga0070713_100165154 | 3300005436 | Bacteria | 1979 |
| 100 | Ga0070710_10006545 | 3300005437 | Bacteria | 5600 |
| 101 | Ga0070711_100009694 | 3300005439 | Bacteria | 5933 |
| 102 | Ga0070711_100012222 | 3300005439 | Bacteria | 5358 |
| 103 | Ga0070711_100023880 | 3300005439 | Bacteria | 3982 |
| 104 | Ga0070711_100053079 | 3300005439 | Bacteria | 2792 |
| 105 | Ga0070708_100115632 | 3300005445 | Bacteria | 2469 |
| 106 | Ga0070663_100199956 | 3300005455 | Bacteria | 1559 |
| 107 | Ga0070678_100029192 | 3300005456 | Bacteria | 3774 |
| 108 | Ga0070662_100008266 | 3300005457 | Bacteria | 6778 |
| 109 | Ga0070662_100016079 | 3300005457 | Bacteria | 5020 |
| 110 | Ga0070662_100100099 | 3300005457 | Bacteria | 2192 |
| 111 | Ga0070681_10000213 | 3300005458 | Bacteria | 45271 |
| 112 | Ga0070681_10016080 | 3300005458 | Bacteria | 7458 |
| 113 | Ga0070681_10020990 | 3300005458 | Bacteria | 6544 |
| 114 | Ga0070681_10058541 | 3300005458 | Bacteria | 3832 |
| 115 | Ga0070681_10081643 | 3300005458 | Bacteria | 3189 |
| 116 | Ga0070681_10098715 | 3300005458 | Bacteria | 2867 |
| 117 | Ga0070681_10202857 | 3300005458 | Bacteria | 1901 |
| 118 | Ga0070707_100018906 | 3300005468 | Bacteria | 6488 |
| 119 | Ga0070707_100087168 | 3300005468 | Bacteria | 3020 |
| 120 | Ga0070707_100161609 | 3300005468 | Bacteria | 2182 |
| 121 | Ga0070698_100020755 | 3300005471 | Bacteria | 6885 |
| 122 | Ga0070698_100049414 | 3300005471 | Bacteria | 4293 |
| 123 | Ga0070698_100066969 | 3300005471 | Bacteria | 3612 |
| 124 | Ga0070698_100249573 | 3300005471 | Bacteria | 1708 |
| 125 | Ga0070699_100044333 | 3300005518 | Bacteria | 3851 |
| 126 | Ga0070699_100137617 | 3300005518 | Bacteria | 2155 |
| 127 | Ga0070699_100239284 | 3300005518 | Bacteria | 1620 |
| 128 | Ga0070679_100001596 | 3300005530 | Bacteria | 20324 |
| 129 | Ga0070679_100003428 | 3300005530 | Bacteria | 14519 |
| 130 | Ga0070679_100058571 | 3300005530 | Bacteria | 3838 |
| 131 | Ga0070679_100145365 | 3300005530 | Bacteria | 2349 |
| 132 | Ga0068853_100051683 | 3300005539 | Bacteria | 3538 |
| 133 | Ga0068853_100054797 | 3300005539 | Bacteria | 3437 |
| 134 | Ga0068853_100115687 | 3300005539 | Bacteria | 2387 |
| 135 | Ga0068853_100261827 | 3300005539 | Bacteria | 1590 |
| 136 | Ga0070695_100067300 | 3300005545 | Bacteria | 2336 |
| 137 | Ga0070696_100013231 | 3300005546 | Bacteria | 5537 |
| 138 | Ga0070696_100056823 | 3300005546 | Bacteria | 2730 |
| 139 | Ga0070665_100000610 | 3300005548 | Bacteria | 49084 |
| 140 | Ga0070665_100002779 | 3300005548 | Bacteria | 18970 |
| 141 | Ga0070665_100069536 | 3300005548 | Bacteria | 3529 |
| 142 | Ga0070665_100096303 | 3300005548 | Bacteria | 2964 |
| 143 | Ga0070665_100168980 | 3300005548 | Bacteria | 2188 |
| 144 | Ga0070704_100002436 | 3300005549 | Bacteria | 10439 |
| 145 | Ga0070704_100069692 | 3300005549 | Bacteria | 2549 |
| 146 | Ga0070704_100163512 | 3300005549 | Bacteria | 1763 |
| 147 | Ga0068855_100000267 | 3300005563 | Bacteria | 64909 |
| 148 | Ga0068855_100001693 | 3300005563 | Bacteria | 27587 |
| 149 | Ga0068855_100016855 | 3300005563 | Bacteria | 8788 |
| 150 | Ga0068855_100088405 | 3300005563 | Bacteria | 3579 |
| 151 | Ga0070664_100187562 | 3300005564 | Bacteria | 1841 |
| 152 | Ga0068857_100074831 | 3300005577 | Bacteria | 3019 |
| 153 | Ga0068856_100012963 | 3300005614 | Bacteria | 8071 |
| 154 | Ga0068856_100027948 | 3300005614 | Bacteria | 5504 |
| 155 | Ga0068856_100030161 | 3300005614 | Bacteria | 5301 |
| 156 | Ga0068852_100011907 | 3300005616 | Bacteria | 6577 |
| 157 | Ga0068852_100119430 | 3300005616 | Bacteria | 2410 |
| 158 | Ga0068859_100005908 | 3300005617 | Bacteria | 12424 |
| 159 | Ga0068859_100021915 | 3300005617 | Bacteria | 6405 |
| 160 | Ga0068859_100156163 | 3300005617 | Bacteria | 2359 |
| 161 | Ga0068859_100468035 | 3300005617 | Bacteria | 1356 |
| 162 | Ga0068864_100000284 | 3300005618 | Bacteria | 45254 |
| 163 | Ga0068864_100000461 | 3300005618 | Bacteria | 35261 |
| 164 | Ga0068864_100026541 | 3300005618 | Bacteria | 4885 |
| 165 | Ga0068864_100145254 | 3300005618 | Unclassified | 2144 |
| 166 | Ga0068851_10009846 | 3300005834 | Bacteria | 4452 |
| 167 | Ga0068863_100000101 | 3300005841 | Bacteria | 92384 |
| 168 | Ga0068863_100000185 | 3300005841 | Bacteria | 66169 |
| 169 | Ga0068863_100004288 | 3300005841 | Bacteria | 14042 |
| 170 | Ga0068863_100013552 | 3300005841 | Bacteria | 7866 |
| 171 | Ga0068863_100071333 | 3300005841 | Bacteria | 3286 |
| 172 | Ga0068863_100100629 | 3300005841 | Bacteria | 2747 |
| 173 | Ga0068858_100000271 | 3300005842 | Bacteria | 55626 |
| 174 | Ga0068858_100006545 | 3300005842 | Bacteria | 11329 |
| 175 | Ga0068858_100009567 | 3300005842 | Bacteria | 9247 |
| 176 | Ga0068860_100000051 | 3300005843 | Bacteria | 208179 |
| 177 | Ga0068860_100000211 | 3300005843 | Bacteria | 91286 |
| 178 | Ga0068860_100006897 | 3300005843 | Bacteria | 11391 |
| 179 | Ga0068860_100009534 | 3300005843 | Bacteria | 9644 |
| 180 | Ga0068860_100023514 | 3300005843 | Bacteria | 5955 |
| 181 | Ga0068860_100038489 | 3300005843 | Bacteria | 4575 |
| 182 | Ga0068860_100076811 | 3300005843 | Bacteria | 3176 |
| 183 | Ga0068862_100002355 | 3300005844 | Bacteria | 16829 |
| 184 | Ga0068862_100018741 | 3300005844 | Bacteria | 5765 |
| 185 | Ga0068862_100053014 | 3300005844 | Bacteria | 3472 |
| 186 | Ga0068862_100088048 | 3300005844 | Bacteria | 2701 |
| 187 | Ga0081455_10008107 | 3300005937 | Bacteria | 10963 |
| 188 | Ga0081455_10026716 | 3300005937 | Bacteria | 5301 |
| 189 | Ga0081538_10006460 | 3300005981 | Bacteria | 10317 |
| 190 | Ga0081540_1019744 | 3300005983 | Bacteria | 4082 |
| 191 | Ga0081539_10001888 | 3300005985 | Bacteria | 32580 |
| 192 | Ga0081539_10015621 | 3300005985 | Bacteria | 5504 |
| 193 | Ga0070717_10000290 | 3300006028 | Bacteria | 33745 |
| 194 | Ga0070717_10017976 | 3300006028 | Bacteria | 5515 |
| 195 | Ga0070717_10065502 | 3300006028 | Bacteria | 3021 |
| 196 | Ga0075365_10026026 | 3300006038 | Bacteria | 3709 |
| 197 | Ga0075365_10042899 | 3300006038 | Bacteria | 2959 |
| 198 | Ga0075365_10059534 | 3300006038 | Bacteria | 2546 |
| 199 | Ga0075368_10010676 | 3300006042 | Bacteria | 3325 |
| 200 | Ga0075368_10074008 | 3300006042 | Bacteria | 1379 |
| 201 | Ga0075363_100005046 | 3300006048 | Bacteria | 5840 |
| 202 | Ga0075363_100090541 | 3300006048 | Bacteria | 1683 |
| 203 | Ga0075364_10007544 | 3300006051 | Bacteria | 6467 |
| 204 | Ga0075364_10009110 | 3300006051 | Bacteria | 5945 |
| 205 | Ga0075364_10047139 | 3300006051 | Bacteria | 2806 |
| 206 | Ga0070712_100002544 | 3300006175 | Bacteria | 11264 |
| 207 | Ga0070712_100074225 | 3300006175 | Bacteria | 2443 |
| 208 | Ga0075362_10000564 | 3300006177 | Bacteria | 10793 |
| 209 | Ga0075362_10002519 | 3300006177 | Bacteria | 6169 |
| 210 | Ga0075362_10003140 | 3300006177 | Bacteria | 5706 |
| 211 | Ga0075362_10008081 | 3300006177 | Bacteria | 4010 |
| 212 | Ga0075362_10034628 | 3300006177 | Bacteria | 2202 |
| 213 | Ga0075367_10000028 | 3300006178 | Bacteria | 31226 |
| 214 | Ga0075367_10000812 | 3300006178 | Bacteria | 12330 |
| 215 | Ga0075367_10002060 | 3300006178 | Bacteria | 8998 |
| 216 | Ga0075367_10007484 | 3300006178 | Bacteria | 5594 |
| 217 | Ga0075367_10014633 | 3300006178 | Bacteria | 4249 |
| 218 | Ga0075367_10015872 | 3300006178 | Bacteria | 4104 |
| 219 | Ga0075367_10036221 | 3300006178 | Bacteria | 2860 |
| 220 | Ga0075369_10000566 | 3300006186 | Bacteria | 11697 |
| 221 | Ga0075369_10013908 | 3300006186 | Bacteria | 3205 |
| 222 | Ga0075369_10027042 | 3300006186 | Bacteria | 2396 |
| 223 | Ga0075366_10004811 | 3300006195 | Bacteria | 7284 |
| 224 | Ga0075366_10016899 | 3300006195 | Bacteria | 4193 |
| 225 | Ga0075366_10022022 | 3300006195 | Bacteria | 3705 |
| 226 | Ga0097621_100092973 | 3300006237 | Bacteria | 2527 |
| 227 | Ga0075370_10109241 | 3300006353 | Bacteria | 1605 |
| 228 | Ga0075428_100111725 | 3300006844 | Bacteria | 2977 |
| 229 | Ga0075430_100007703 | 3300006846 | Bacteria | 9096 |
| 230 | Ga0075430_100164948 | 3300006846 | Bacteria | 1843 |
| 231 | Ga0075433_10024821 | 3300006852 | Bacteria | 5064 |
| 232 | Ga0075434_100162133 | 3300006871 | Bacteria | 2256 |
| 233 | Ga0075434_100322164 | 3300006871 | Bacteria | 1566 |
| 234 | Ga0075429_100051899 | 3300006880 | Bacteria | 3567 |
| 235 | Ga0075429_100115094 | 3300006880 | Bacteria | 2351 |
| 236 | Ga0075436_100024956 | 3300006914 | Bacteria | 4110 |
| 237 | Ga0075436_100033782 | 3300006914 | Bacteria | 3525 |
| 238 | Ga0075436_100098073 | 3300006914 | Bacteria | 2039 |
| 239 | Ga0097620_100005908 | 3300006931 | Bacteria | 12424 |
| 240 | Ga0097620_100021915 | 3300006931 | Bacteria | 6405 |
| 241 | Ga0097620_100156153 | 3300006931 | Bacteria | 2359 |
| 242 | Ga0097620_100467967 | 3300006931 | Bacteria | 1356 |
| 243 | Ga0099824_1027176 | 3300006942 | Bacteria | 2812 |
| 244 | Ga0075435_100144345 | 3300007076 | Bacteria | 1998 |
| 245 | Ga0099795_10005208 | 3300007788 | Bacteria | 3435 |
| 246 | Ga0099795_10059757 | 3300007788 | Bacteria | 1411 |
| 247 | Ga0105240_10000287 | 3300009093 | Bacteria | 98443 |
| 248 | Ga0105240_10000874 | 3300009093 | Bacteria | 54221 |
| 249 | Ga0105240_10001197 | 3300009093 | Bacteria | 45241 |
| 250 | Ga0105240_10103180 | 3300009093 | Bacteria | 3465 |
| 251 | Ga0105240_10121211 | 3300009093 | Bacteria | 3149 |
| 252 | Ga0105240_10141508 | 3300009093 | Bacteria | 2876 |
| 253 | Ga0105240_10424181 | 3300009093 | Bacteria | 1494 |
| 254 | Ga0111539_10000041 | 3300009094 | Bacteria | 131679 |
| 255 | Ga0111539_10005028 | 3300009094 | Bacteria | 17187 |
| 256 | Ga0111539_10043198 | 3300009094 | Bacteria | 5405 |
| 257 | Ga0111539_10100322 | 3300009094 | Bacteria | 3400 |
| 258 | Ga0105245_10156045 | 3300009098 | Bacteria | 2162 |
| 259 | Ga0105247_10031668 | 3300009101 | Bacteria | 3210 |
| 260 | Ga0114129_10009933 | 3300009147 | Bacteria | 13566 |
| 261 | Ga0114129_10058588 | 3300009147 | Bacteria | 5387 |
| 262 | Ga0114129_10125067 | 3300009147 | Bacteria | 3536 |
| 263 | Ga0114129_10168313 | 3300009147 | Bacteria | 2989 |
| 264 | Ga0114129_10301951 | 3300009147 | Bacteria | 2133 |
| 265 | Ga0114129_10388447 | 3300009147 | Bacteria | 1841 |
| 266 | Ga0105243_10055150 | 3300009148 | Bacteria | 3157 |
| 267 | Ga0105241_10009670 | 3300009174 | Bacteria | 7086 |
| 268 | Ga0105242_10223647 | 3300009176 | Bacteria | 1684 |
| 269 | Ga0105248_10000349 | 3300009177 | Bacteria | 54104 |
| 270 | Ga0105248_10001964 | 3300009177 | Bacteria | 22859 |
| 271 | Ga0105248_10027599 | 3300009177 | Bacteria | 6322 |
| 272 | Ga0105248_10053132 | 3300009177 | Bacteria | 4546 |
| 273 | Ga0105248_10062788 | 3300009177 | Bacteria | 4171 |
| 274 | Ga0105248_10162713 | 3300009177 | Bacteria | 2516 |
| 275 | Ga0105248_10177416 | 3300009177 | Bacteria | 2401 |
| 276 | Ga0105248_10345857 | 3300009177 | Bacteria | 1674 |
| 277 | Ga0105237_10002777 | 3300009545 | Bacteria | 21277 |
| 278 | Ga0105237_10190789 | 3300009545 | Bacteria | 2049 |
| 279 | Ga0105237_10244215 | 3300009545 | Bacteria | 1797 |
| 280 | Ga0105238_10003746 | 3300009551 | Bacteria | 15114 |
| 281 | Ga0105238_10005330 | 3300009551 | Bacteria | 12704 |
| 282 | Ga0105238_10051165 | 3300009551 | Bacteria | 4155 |
| 283 | Ga0105238_10119769 | 3300009551 | Bacteria | 2612 |
| 284 | Ga0105238_10211098 | 3300009551 | Bacteria | 1917 |
| 285 | Ga0105238_10356358 | 3300009551 | Bacteria | 1452 |
| 286 | Ga0105249_10001221 | 3300009553 | Bacteria | 22640 |
| 287 | Ga0105249_10157607 | 3300009553 | Bacteria | 2191 |
| 288 | Ga0105148_100001 | 3300009978 | Bacteria | 58900 |
| 289 | Ga0105033_100251 | 3300009986 | Bacteria | 4205 |
| 290 | Ga0105239_10001954 | 3300010375 | Bacteria | 26883 |
| 291 | Ga0105239_10003114 | 3300010375 | Bacteria | 20575 |
| 292 | Ga0105239_10012735 | 3300010375 | Bacteria | 9357 |
| 293 | Ga0105239_10032508 | 3300010375 | Bacteria | 5732 |
| 294 | Ga0105239_10102494 | 3300010375 | Bacteria | 3167 |
| 295 | Ga0105239_10158045 | 3300010375 | Bacteria | 2532 |
| 296 | Ga0105239_10170963 | 3300010375 | Bacteria | 2430 |
| 297 | Ga0157373_10018656 | 3300013100 | Bacteria | 5049 |
| 298 | Ga0157370_10010836 | 3300013104 | Bacteria | 9576 |
| 299 | Ga0157370_10011034 | 3300013104 | Bacteria | 9476 |
| 300 | Ga0157369_10020792 | 3300013105 | Bacteria | 7335 |
| 301 | Ga0157369_10122712 | 3300013105 | Bacteria | 2756 |
| 302 | Ga0157369_10335420 | 3300013105 | Bacteria | 1571 |
| 303 | Ga0171462_1009 | 3300013250 | Bacteria | 344993 |
| 304 | Ga0157378_10046086 | 3300013297 | Bacteria | 3876 |
| 305 | Ga0163162_10101686 | 3300013306 | Bacteria | 2967 |
| 306 | Ga0163162_10118704 | 3300013306 | Bacteria | 2747 |
| 307 | Ga0163162_10293934 | 3300013306 | Bacteria | 1756 |
| 308 | Ga0157372_10011020 | 3300013307 | Bacteria | 9623 |
| 309 | Ga0157372_10069791 | 3300013307 | Bacteria | 3952 |
| 310 | Ga0157372_10074817 | 3300013307 | Bacteria | 3820 |
| 311 | Ga0157375_10549956 | 3300013308 | Bacteria | 1316 |
| 312 | Ga0163163_10038387 | 3300014325 | Bacteria | 4668 |
| 313 | Ga0163163_10151940 | 3300014325 | Bacteria | 2359 |
| 314 | Ga0163163_10156415 | 3300014325 | Bacteria | 2324 |
| 315 | Ga0163163_10157466 | 3300014325 | Bacteria | 2316 |
| 316 | Ga0163163_10223001 | 3300014325 | Bacteria | 1934 |
| 317 | Ga0163163_10347325 | 3300014325 | Bacteria | 1539 |
| 318 | Ga0157380_10157152 | 3300014326 | Bacteria | 1972 |
| 319 | Ga0182008_10011892 | 3300014497 | Bacteria | 4612 |
| 320 | Ga0182008_10034895 | 3300014497 | Bacteria | 2521 |
| 321 | Ga0182008_10048830 | 3300014497 | Bacteria | 2101 |
| 322 | Ga0157379_10000119 | 3300014968 | Bacteria | 54670 |
| 323 | Ga0157379_10010097 | 3300014968 | Bacteria | 8231 |
| 324 | Ga0157379_10066237 | 3300014968 | Bacteria | 3229 |
| 325 | Ga0157379_10079688 | 3300014968 | Bacteria | 2933 |
| 326 | Ga0163161_10009072 | 3300017792 | Bacteria | 6879 |
| 327 | Ga0206350_11260676 | 3300020080 | Bacteria | 1450 |
| 328 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 329 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 330 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 331 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 332 | Ga0213872_10015277 | 3300021361 | Bacteria | 3573 |
| 333 | Ga0213872_10016262 | 3300021361 | Bacteria | 3454 |
| 334 | Ga0213875_10000132 | 3300021388 | Bacteria | 82929 |
| 335 | Ga0213875_10000451 | 3300021388 | Bacteria | 35624 |
| 336 | Ga0213875_10000936 | 3300021388 | Bacteria | 20989 |
| 337 | Ga0213875_10001552 | 3300021388 | Bacteria | 14716 |
| 338 | Ga0213875_10001756 | 3300021388 | Bacteria | 13594 |
| 339 | Ga0213871_10000041 | 3300021441 | Bacteria | 9498 |
| 340 | Ga0224712_10012001 | 3300022467 | Bacteria | 2709 |
| 341 | Ga0224712_10071142 | 3300022467 | Bacteria | 1412 |
| 342 | Ga0209147_100894 | 3300025229 | Bacteria | 13651 |
| 343 | Ga0209026_1001299 | 3300025250 | Bacteria | 11295 |
| 344 | Ga0209148_1000732 | 3300025254 | Bacteria | 25625 |
| 345 | Ga0209565_1000183 | 3300025263 | Bacteria | 76983 |
| 346 | Ga0209455_1000572 | 3300025272 | Bacteria | 24133 |
| 347 | Ga0209673_1001029 | 3300025273 | Bacteria | 33050 |
| 348 | Ga0209673_1006747 | 3300025273 | Bacteria | 5462 |
| 349 | Ga0209130_1000235 | 3300025284 | Bacteria | 71379 |
| 350 | Ga0209130_1004232 | 3300025284 | Bacteria | 5578 |
| 351 | Ga0209675_1000239 | 3300025291 | Bacteria | 54796 |
| 352 | Ga0209675_1003504 | 3300025291 | Bacteria | 7419 |
| 353 | Ga0209675_1015088 | 3300025291 | Bacteria | 2314 |
| 354 | Ga0209676_1000169 | 3300025292 | Bacteria | 155600 |
| 355 | Ga0209676_1000284 | 3300025292 | Bacteria | 104999 |
| 356 | Ga0209676_1000319 | 3300025292 | Bacteria | 93542 |
| 357 | Ga0209676_1008945 | 3300025292 | Bacteria | 4395 |
| 358 | Ga0209025_1000010 | 3300025294 | Bacteria | 986612 |
| 359 | Ga0209025_1000146 | 3300025294 | Bacteria | 180022 |
| 360 | Ga0209025_1000149 | 3300025294 | Bacteria | 173393 |
| 361 | Ga0209025_1020824 | 3300025294 | Bacteria | 3563 |
| 362 | Ga0209025_1037455 | 3300025294 | Bacteria | 2152 |
| 363 | Ga0209025_1038926 | 3300025294 | Bacteria | 2083 |
| 364 | Ga0209564_1000019 | 3300025295 | Bacteria | 573686 |
| 365 | Ga0209564_1000034 | 3300025295 | Bacteria | 444284 |
| 366 | Ga0209564_1018697 | 3300025295 | Bacteria | 2628 |
| 367 | Ga0209758_1000029 | 3300025297 | Bacteria | 520787 |
| 368 | Ga0209758_1000252 | 3300025297 | Bacteria | 108214 |
| 369 | Ga0209758_1001837 | 3300025297 | Bacteria | 23337 |
| 370 | Ga0209758_1002076 | 3300025297 | Bacteria | 21317 |
| 371 | Ga0209758_1005157 | 3300025297 | Bacteria | 10288 |
| 372 | Ga0209758_1007713 | 3300025297 | Bacteria | 7227 |
| 373 | Ga0209758_1011627 | 3300025297 | Bacteria | 5066 |
| 374 | Ga0209050_1000095 | 3300025298 | Bacteria | 242722 |
| 375 | Ga0209050_1000737 | 3300025298 | Bacteria | 47468 |
| 376 | Ga0209050_1001426 | 3300025298 | Bacteria | 25794 |
| 377 | Ga0209050_1005949 | 3300025298 | Bacteria | 7418 |
| 378 | Ga0209050_1011618 | 3300025298 | Bacteria | 4148 |
| 379 | Ga0209050_1011818 | 3300025298 | Bacteria | 4086 |
| 380 | Ga0209256_1000026 | 3300025299 | Bacteria | 432835 |
| 381 | Ga0209256_1000182 | 3300025299 | Bacteria | 122471 |
| 382 | Ga0209256_1000694 | 3300025299 | Bacteria | 44757 |
| 383 | Ga0209256_1015406 | 3300025299 | Bacteria | 2676 |
| 384 | Ga0207426_1000046 | 3300025302 | Bacteria | 422271 |
| 385 | Ga0207426_1000626 | 3300025302 | Bacteria | 44875 |
| 386 | Ga0209051_1001836 | 3300025303 | Bacteria | 16785 |
| 387 | Ga0209257_1000106 | 3300025304 | Bacteria | 242634 |
| 388 | Ga0209257_1000352 | 3300025304 | Bacteria | 94530 |
| 389 | Ga0209257_1000743 | 3300025304 | Bacteria | 49251 |
| 390 | Ga0209257_1001595 | 3300025304 | Bacteria | 25963 |
| 391 | Ga0209257_1016114 | 3300025304 | Bacteria | 3049 |
| 392 | Ga0207682_10003431 | 3300025893 | Bacteria | 6894 |
| 393 | Ga0207692_10004177 | 3300025898 | Bacteria | 5701 |
| 394 | Ga0207692_10022843 | 3300025898 | Bacteria | 2885 |
| 395 | Ga0207710_10012358 | 3300025900 | Bacteria | 3593 |
| 396 | Ga0207680_10023407 | 3300025903 | Bacteria | 3373 |
| 397 | Ga0207647_10001677 | 3300025904 | Bacteria | 17048 |
| 398 | Ga0207647_10004458 | 3300025904 | Bacteria | 10378 |
| 399 | Ga0207645_10049491 | 3300025907 | Bacteria | 2683 |
| 400 | Ga0207705_10006356 | 3300025909 | Bacteria | 8763 |
| 401 | Ga0207654_10008215 | 3300025911 | Bacteria | 5267 |
| 402 | Ga0207654_10032342 | 3300025911 | Bacteria | 2890 |
| 403 | Ga0207707_10006168 | 3300025912 | Bacteria | 10474 |
| 404 | Ga0207707_10016865 | 3300025912 | Bacteria | 6362 |
| 405 | Ga0207707_10023011 | 3300025912 | Bacteria | 5450 |
| 406 | Ga0207707_10049183 | 3300025912 | Bacteria | 3673 |
| 407 | Ga0207707_10180922 | 3300025912 | Bacteria | 1841 |
| 408 | Ga0207707_10199761 | 3300025912 | Bacteria | 1743 |
| 409 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 410 | Ga0207695_10001005 | 3300025913 | Bacteria | 49964 |
| 411 | Ga0207695_10006511 | 3300025913 | Bacteria | 15126 |
| 412 | Ga0207695_10028663 | 3300025913 | Bacteria | 6165 |
| 413 | Ga0207695_10081855 | 3300025913 | Bacteria | 3266 |
| 414 | Ga0207695_10152083 | 3300025913 | Bacteria | 2253 |
| 415 | Ga0207695_10279054 | 3300025913 | Bacteria | 1565 |
| 416 | Ga0207671_10002149 | 3300025914 | Bacteria | 21495 |
| 417 | Ga0207671_10088695 | 3300025914 | Bacteria | 2327 |
| 418 | Ga0207671_10130797 | 3300025914 | Bacteria | 1926 |
| 419 | Ga0207693_10009794 | 3300025915 | Bacteria | 7799 |
| 420 | Ga0207693_10207502 | 3300025915 | Bacteria | 1540 |
| 421 | Ga0207663_10014871 | 3300025916 | Bacteria | 4276 |
| 422 | Ga0207660_10003027 | 3300025917 | Bacteria | 11000 |
| 423 | Ga0207660_10034296 | 3300025917 | Bacteria | 3517 |
| 424 | Ga0207660_10047791 | 3300025917 | Bacteria | 3027 |
| 425 | Ga0207657_10077580 | 3300025919 | Bacteria | 2799 |
| 426 | Ga0207652_10006822 | 3300025921 | Bacteria | 9200 |
| 427 | Ga0207652_10008514 | 3300025921 | Bacteria | 8255 |
| 428 | Ga0207652_10018920 | 3300025921 | Bacteria | 5655 |
| 429 | Ga0207652_10033786 | 3300025921 | Bacteria | 4308 |
| 430 | Ga0207652_10075431 | 3300025921 | Bacteria | 2939 |
| 431 | Ga0207652_10131431 | 3300025921 | Bacteria | 2233 |
| 432 | Ga0207652_10132720 | 3300025921 | Bacteria | 2222 |
| 433 | Ga0207646_10020030 | 3300025922 | Bacteria | 6204 |
| 434 | Ga0207681_10027788 | 3300025923 | Bacteria | 3661 |
| 435 | Ga0207681_10031848 | 3300025923 | Bacteria | 3447 |
| 436 | Ga0207694_10000156 | 3300025924 | Bacteria | 70186 |
| 437 | Ga0207694_10040185 | 3300025924 | Bacteria | 3601 |
| 438 | Ga0207694_10061926 | 3300025924 | Bacteria | 2912 |
| 439 | Ga0207694_10169746 | 3300025924 | Bacteria | 1766 |
| 440 | Ga0207650_10000315 | 3300025925 | Bacteria | 47489 |
| 441 | Ga0207659_10020609 | 3300025926 | Bacteria | 4361 |
| 442 | Ga0207659_10095584 | 3300025926 | Bacteria | 2229 |
| 443 | Ga0207687_10191253 | 3300025927 | Bacteria | 1593 |
| 444 | Ga0207687_10262125 | 3300025927 | Bacteria | 1378 |
| 445 | Ga0207700_10043519 | 3300025928 | Bacteria | 3298 |
| 446 | Ga0207700_10051190 | 3300025928 | Bacteria | 3081 |
| 447 | Ga0207700_10116473 | 3300025928 | Bacteria | 2159 |
| 448 | Ga0207664_10000344 | 3300025929 | Bacteria | 34246 |
| 449 | Ga0207664_10102963 | 3300025929 | Bacteria | 2361 |
| 450 | Ga0207644_10000679 | 3300025931 | Bacteria | 21492 |
| 451 | Ga0207644_10044716 | 3300025931 | Bacteria | 3147 |
| 452 | Ga0207690_10130557 | 3300025932 | Bacteria | 1838 |
| 453 | Ga0207706_10041661 | 3300025933 | Bacteria | 4070 |
| 454 | Ga0207706_10045644 | 3300025933 | Bacteria | 3881 |
| 455 | Ga0207706_10049658 | 3300025933 | Bacteria | 3707 |
| 456 | Ga0207686_10230674 | 3300025934 | Bacteria | 1342 |
| 457 | Ga0207665_10055663 | 3300025939 | Bacteria | 2669 |
| 458 | Ga0207691_10014107 | 3300025940 | Bacteria | 7622 |
| 459 | Ga0207711_10001341 | 3300025941 | Bacteria | 23240 |
| 460 | Ga0207711_10002092 | 3300025941 | Bacteria | 18020 |
| 461 | Ga0207711_10022190 | 3300025941 | Bacteria | 5308 |
| 462 | Ga0207711_10025515 | 3300025941 | Bacteria | 4957 |
| 463 | Ga0207679_10045212 | 3300025945 | Bacteria | 3183 |
| 464 | Ga0207667_10000068 | 3300025949 | Bacteria | 180716 |
| 465 | Ga0207667_10016842 | 3300025949 | Bacteria | 8246 |
| 466 | Ga0207667_10024236 | 3300025949 | Bacteria | 6667 |
| 467 | Ga0207667_10123693 | 3300025949 | Bacteria | 2665 |
| 468 | Ga0207712_10000203 | 3300025961 | Bacteria | 59867 |
| 469 | Ga0207712_10196656 | 3300025961 | Bacteria | 1595 |
| 470 | Ga0207668_10000007 | 3300025972 | Bacteria | 190613 |
| 471 | Ga0207668_10000427 | 3300025972 | Bacteria | 26560 |
| 472 | Ga0207668_10001120 | 3300025972 | Bacteria | 15979 |
| 473 | Ga0207668_10002487 | 3300025972 | Bacteria | 10758 |
| 474 | Ga0207668_10027033 | 3300025972 | Bacteria | 3734 |
| 475 | Ga0207668_10032299 | 3300025972 | Bacteria | 3457 |
| 476 | Ga0207668_10065961 | 3300025972 | Bacteria | 2564 |
| 477 | Ga0207668_10101201 | 3300025972 | Bacteria | 2141 |
| 478 | Ga0207658_10001368 | 3300025986 | Bacteria | 19037 |
| 479 | Ga0207658_10001403 | 3300025986 | Bacteria | 18780 |
| 480 | Ga0207658_10008299 | 3300025986 | Bacteria | 7074 |
| 481 | Ga0207677_10137945 | 3300026023 | Bacteria | 1863 |
| 482 | Ga0207703_10000105 | 3300026035 | Bacteria | 99702 |
| 483 | Ga0207703_10003669 | 3300026035 | Bacteria | 12795 |
| 484 | Ga0207703_10011130 | 3300026035 | Bacteria | 7005 |
| 485 | Ga0207639_10001279 | 3300026041 | Bacteria | 16988 |
| 486 | Ga0207639_10020905 | 3300026041 | Bacteria | 4695 |
| 487 | Ga0207639_10064567 | 3300026041 | Bacteria | 2838 |
| 488 | Ga0207678_10000402 | 3300026067 | Bacteria | 39370 |
| 489 | Ga0207678_10132688 | 3300026067 | Bacteria | 2125 |
| 490 | Ga0207708_10024701 | 3300026075 | Bacteria | 4545 |
| 491 | Ga0207702_10004355 | 3300026078 | Bacteria | 12623 |
| 492 | Ga0207702_10010520 | 3300026078 | Bacteria | 7738 |
| 493 | Ga0207641_10000109 | 3300026088 | Bacteria | 121126 |
| 494 | Ga0207641_10001763 | 3300026088 | Bacteria | 20861 |
| 495 | Ga0207641_10002034 | 3300026088 | Bacteria | 19258 |
| 496 | Ga0207641_10030198 | 3300026088 | Bacteria | 4487 |
| 497 | Ga0207676_10000159 | 3300026095 | Bacteria | 59242 |
| 498 | Ga0207676_10001888 | 3300026095 | Bacteria | 15316 |
| 499 | Ga0207676_10017898 | 3300026095 | Bacteria | 5142 |
| 500 | Ga0207674_10010437 | 3300026116 | Bacteria | 10520 |
| 501 | Ga0207674_10016891 | 3300026116 | Bacteria | 7974 |
| 502 | Ga0207674_10083288 | 3300026116 | Bacteria | 3198 |
| 503 | Ga0207675_100448159 | 3300026118 | Bacteria | 1279 |
| 504 | Ga0207683_10008376 | 3300026121 | Bacteria | 8843 |
| 505 | Ga0207683_10025859 | 3300026121 | Bacteria | 5065 |
| 506 | Ga0207683_10348770 | 3300026121 | Bacteria | 1358 |
| 507 | Ga0207698_10028109 | 3300026142 | Bacteria | 4005 |
| 508 | Ga0207698_10046813 | 3300026142 | Bacteria | 3270 |
| 509 | Ga0207698_10084003 | 3300026142 | Bacteria | 2579 |
| 510 | Ga0207698_10159691 | 3300026142 | Bacteria | 1969 |
| 511 | Ga0209813_10000019 | 3300027866 | Bacteria | 75575 |
| 512 | Ga0207428_10001809 | 3300027907 | Bacteria | 21897 |
| 513 | Ga0268266_10001260 | 3300028379 | Bacteria | 30951 |
| 514 | Ga0268266_10006212 | 3300028379 | Bacteria | 10972 |
| 515 | Ga0268266_10013295 | 3300028379 | Bacteria | 7094 |
| 516 | Ga0268266_10224025 | 3300028379 | Bacteria | 1730 |
| 517 | Ga0268265_10002114 | 3300028380 | Bacteria | 15413 |
| 518 | Ga0268265_10002154 | 3300028380 | Bacteria | 15249 |
| 519 | Ga0268265_10003045 | 3300028380 | Bacteria | 12224 |
| 520 | Ga0268265_10010280 | 3300028380 | Bacteria | 6321 |
| 521 | Ga0268264_10000021 | 3300028381 | Bacteria | 481580 |
| 522 | Ga0268264_10000270 | 3300028381 | Bacteria | 90954 |
| 523 | Ga0268264_10003426 | 3300028381 | Bacteria | 13679 |
| 524 | Ga0268264_10009573 | 3300028381 | Bacteria | 8022 |
| 525 | Ga0265334_10001920 | 3300028573 | Bacteria | 9868 |
| 526 | Ga0265318_10005668 | 3300028577 | Bacteria | 5843 |
| 527 | Ga0307517_10000714 | 3300028786 | Bacteria | 57225 |
| 528 | Ga0307517_10018527 | 3300028786 | Bacteria | 8998 |
| 529 | Ga0307515_10003572 | 3300028794 | Bacteria | 32658 |
| 530 | Ga0307515_10008637 | 3300028794 | Bacteria | 19826 |
| 531 | Ga0307515_10040608 | 3300028794 | Bacteria | 7351 |
| 532 | Ga0307515_10155748 | 3300028794 | Bacteria | 2359 |
| 533 | Ga0265338_10004430 | 3300028800 | Bacteria | 18977 |
| 534 | Ga0265338_10026563 | 3300028800 | Bacteria | 5835 |
| 535 | Ga0265338_10045536 | 3300028800 | Bacteria | 4031 |
| 536 | Ga0265324_10001398 | 3300029957 | Bacteria | 13930 |
| 537 | Ga0307511_10015070 | 3300030521 | Bacteria | 7500 |
| 538 | Ga0265330_10041268 | 3300031235 | Bacteria | 2046 |
| 539 | Ga0265332_10065927 | 3300031238 | Bacteria | 1546 |
| 540 | Ga0265325_10003952 | 3300031241 | Bacteria | 9485 |
| 541 | Ga0265325_10011897 | 3300031241 | Bacteria | 4989 |
| 542 | Ga0265325_10023938 | 3300031241 | Bacteria | 3327 |
| 543 | Ga0265340_10015778 | 3300031247 | Bacteria | 3919 |
| 544 | Ga0265340_10024189 | 3300031247 | Bacteria | 3087 |
| 545 | Ga0265340_10030478 | 3300031247 | Bacteria | 2702 |
| 546 | Ga0265339_10000024 | 3300031249 | Bacteria | 169774 |
| 547 | Ga0265331_10000162 | 3300031250 | Bacteria | 84055 |
| 548 | Ga0265331_10063233 | 3300031250 | Unclassified | 1744 |
| 549 | Ga0265327_10011785 | 3300031251 | Bacteria | 5980 |
| 550 | Ga0265327_10039006 | 3300031251 | Bacteria | 2584 |
| 551 | Ga0265316_10040642 | 3300031344 | Bacteria | 3727 |
| 552 | Ga0265316_10086217 | 3300031344 | Bacteria | 2401 |
| 553 | Ga0307513_10000063 | 3300031456 | Bacteria | 142538 |
| 554 | Ga0307513_10007717 | 3300031456 | Bacteria | 13899 |
| 555 | Ga0307513_10009979 | 3300031456 | Bacteria | 11979 |
| 556 | Ga0307513_10017608 | 3300031456 | Bacteria | 8564 |
| 557 | Ga0307513_10115642 | 3300031456 | Bacteria | 2664 |
| 558 | Ga0307513_10196494 | 3300031456 | Bacteria | 1863 |
| 559 | Ga0265313_10000006 | 3300031595 | Bacteria | 183184 |
| 560 | Ga0265313_10000839 | 3300031595 | Bacteria | 30966 |
| 561 | Ga0265313_10032122 | 3300031595 | Bacteria | 2685 |
| 562 | Ga0307508_10111558 | 3300031616 | Bacteria | 2335 |
| 563 | Ga0265314_10010786 | 3300031711 | Bacteria | 7597 |
| 564 | Ga0265342_10040177 | 3300031712 | Bacteria | 2838 |
| 565 | Ga0265342_10072636 | 3300031712 | Bacteria | 2002 |
| 566 | Ga0316576_10010072 | 3300031727 | Bacteria | 6123 |
| 567 | Ga0316578_10039845 | 3300031728 | Bacteria | 2714 |
| 568 | Ga0307405_10005099 | 3300031731 | Bacteria | 6289 |
| 569 | Ga0307413_10034611 | 3300031824 | Bacteria | 2889 |
| 570 | Ga0307410_10058026 | 3300031852 | Bacteria | 2638 |
| 571 | Ga0307409_100094808 | 3300031995 | Bacteria | 2457 |
| 572 | Ga0307416_100016945 | 3300032002 | Bacteria | 5081 |
| 573 | Ga0307510_10002995 | 3300033180 | Bacteria | 19438 |
| 574 | Ga0373936_0022443 | 3300035113 | Bacteria | 2458 |
| 575 | Ga0373939_0000982 | 3300035114 | Bacteria | 7076 |
| 576 | Ga0373941_0027967 | 3300035115 | Bacteria | 1651 |
| 577 | Ga0373943_0015678 | 3300035170 | Bacteria | 3446 |
| 578 | Ga0373943_0136432 | 3300035170 | Bacteria | 1318 |
| 579 | Ga0373955_0013635 | 3300035172 | Bacteria | 3937 |
| 580 | Ga0373961_0006992 | 3300035241 | Bacteria | 2717 |
| 581 | Ga0316574_0054878 | 3300035398 | Bacteria | 2489 |
| 582 | Ga0316574_0056685 | 3300035398 | Bacteria | 2452 |
| 583 | Ga0373931_0010799 | 3300035691 | Bacteria | 4397 |
| 584 | Ga0373931_0036668 | 3300035691 | Bacteria | 2557 |
| 585 | Ga0373931_0074602 | 3300035691 | Bacteria | 1858 |
| 586 | Ga0373931_0210880 | 3300035691 | Bacteria | 1165 |
| 587 | Ga0373935_0010737 | 3300035692 | Bacteria | 5502 |
| 588 | Ga0373935_0030455 | 3300035692 | Bacteria | 3345 |
| 589 | Ga0373935_0036814 | 3300035692 | Bacteria | 3061 |
| 590 | Ga0373927_0000925 | 3300035695 | Bacteria | 22236 |
| 591 | Ga0373927_0060216 | 3300035695 | Bacteria | 2456 |
| 592 | Ga0373947_0009938 | 3300035725 | Bacteria | 5466 |
| 593 | Ga0373947_0022783 | 3300035725 | Bacteria | 3635 |
| 594 | Ga0373947_0068438 | 3300035725 | Bacteria | 2171 |
| 595 | Ga0373947_0090168 | 3300035725 | Bacteria | 1910 |
| 596 | Ga0373947_0094826 | 3300035725 | Bacteria | 1867 |
| 597 | Ga0373937_0003803 | 3300036401 | Bacteria | 12752 |
| 598 | Ga0373937_0005722 | 3300036401 | Bacteria | 10677 |
| 599 | Ga0373937_0008212 | 3300036401 | Bacteria | 9066 |
| 600 | Ga0373937_0025405 | 3300036401 | Bacteria | 5347 |
| 601 | Ga0373937_0068094 | 3300036401 | Bacteria | 3281 |
| 602 | Ga0373937_0146539 | 3300036401 | Bacteria | 2210 |
| 603 | Ga0373937_0215721 | 3300036401 | Bacteria | 1806 |
| 604 | Ga0316582_0084657 | 3300036647 | Bacteria | 2076 |
| 605 | Ga0316584_0042846 | 3300036712 | Bacteria | 3374 |
| 606 | Ga0316584_0082630 | 3300036712 | Bacteria | 2406 |
| 607 | Ga0316584_0191992 | 3300036712 | Bacteria | 1509 |
| 608 | Ga0373925_0007893 | 3300037068 | Bacteria | 7751 |
| 609 | Ga0373925_0023328 | 3300037068 | Bacteria | 4515 |
| 610 | Ga0373925_0106217 | 3300037068 | Bacteria | 2164 |
| 611 | Ga0373925_0151637 | 3300037068 | Bacteria | 1820 |
| 612 | Ga0373925_0250306 | 3300037068 | Bacteria | 1421 |
| 613 | Ga0395899_0002095 | 3300037312 | Bacteria | 16380 |
| 614 | Ga0395899_0008589 | 3300037312 | Bacteria | 7865 |
| 615 | Ga0395899_0022653 | 3300037312 | Bacteria | 4758 |
| 616 | Ga0395900_0002747 | 3300037418 | Bacteria | 19217 |
| 617 | Ga0395900_0004161 | 3300037418 | Bacteria | 15398 |
| 618 | Ga0395900_0025037 | 3300037418 | Bacteria | 6108 |
| 619 | Ga0395900_0059962 | 3300037418 | Bacteria | 3916 |
| 620 | Ga0395900_0377084 | 3300037418 | Bacteria | 1387 |
| 621 | Ga0395900_0505181 | 3300037418 | Bacteria | 1159 |
| 622 | Ga0395898_0020728 | 3300037466 | Bacteria | 6674 |
| 623 | Ga0395898_0119465 | 3300037466 | Bacteria | 2525 |
| 624 | Ga0395905_0000174 | 3300037471 | Bacteria | 104301 |
| 625 | Ga0395905_0000711 | 3300037471 | Bacteria | 44086 |
| 626 | Ga0395905_0022173 | 3300037471 | Bacteria | 6008 |
| 627 | Ga0395905_0029294 | 3300037471 | Bacteria | 5187 |
| 628 | Ga0436364_0179869 | 3300037853 | Bacteria | 1908 |
| 629 | Ga0436364_0717863 | 3300037853 | Bacteria | 145182 |
| 630 | Ga0436364_0810561 | 3300037853 | Bacteria | 34372 |
| 631 | Ga0436364_0956907 | 3300037853 | Bacteria | 10485 |
| 632 | Ga0436364_0992577 | 3300037853 | Bacteria | 61189 |
| 633 | Ga0436364_1161582 | 3300037853 | Bacteria | 4717 |
| 634 | Ga0436364_1279775 | 3300037853 | Bacteria | 2908 |
| 635 | Ga0436364_1305431 | 3300037853 | Bacteria | 36077 |
| 636 | Ga0436364_1401862 | 3300037853 | Bacteria | 3526 |
| 637 | Ga0436364_1451573 | 3300037853 | Bacteria | 15638 |
| 638 | Ga0395901_0001835 | 3300038443 | Bacteria | 21949 |
| 639 | Ga0395901_0003662 | 3300038443 | Bacteria | 15497 |
| 640 | Ga0395901_0007828 | 3300038443 | Bacteria | 10783 |
| 641 | Ga0395901_0028623 | 3300038443 | Bacteria | 5730 |
| 642 | Ga0395901_0034805 | 3300038443 | Bacteria | 5202 |
| 643 | Ga0395901_0169614 | 3300038443 | Bacteria | 2290 |
| 644 | Ga0436365_0578833 | 3300039437 | Bacteria | 16736 |
| 645 | Ga0436365_1543965 | 3300039437 | Bacteria | 1516 |
| 646 | Ga0436365_1878082 | 3300039437 | Bacteria | 4023 |
| 647 | Ga0436360_0157856 | 3300039438 | Bacteria | 21123 |
| 648 | Ga0436360_0998447 | 3300039438 | Bacteria | 2093 |
| 649 | Ga0436360_1052754 | 3300039438 | Bacteria | 4290 |
| 650 | Ga0436360_1359148 | 3300039438 | Bacteria | 7070 |
| 651 | Ga0436361_0060422 | 3300039447 | Bacteria | 3458 |
| 652 | Ga0436361_0106319 | 3300039447 | Bacteria | 3166 |
| 653 | Ga0436361_0211622 | 3300039447 | Bacteria | 7071 |
| 654 | Ga0436361_0409735 | 3300039447 | Bacteria | 8288 |
| 655 | Ga0436361_0480426 | 3300039447 | Bacteria | 1647 |
| 656 | Ga0436361_0574409 | 3300039447 | Bacteria | 2999 |
| 657 | Ga0436361_0909929 | 3300039447 | Bacteria | 3694 |
| 658 | Ga0436361_0996213 | 3300039447 | Bacteria | 28534 |
| 659 | Ga0436361_1100325 | 3300039447 | Bacteria | 14756 |
| 660 | Ga0436363_0278096 | 3300039450 | Bacteria | 3303 |
| 661 | Ga0436363_0405125 | 3300039450 | Bacteria | 7901 |
| 662 | Ga0436363_0514829 | 3300039450 | Bacteria | 1475 |
| 663 | Ga0436363_1198557 | 3300039450 | Bacteria | 2576 |
| 664 | Ga0436363_1681949 | 3300039450 | Bacteria | 34688 |
| 665 | Ga0436362_0536913 | 3300039453 | Bacteria | 6058 |
| 666 | Ga0436362_0548901 | 3300039453 | Bacteria | 2259 |
| 667 | Ga0436362_0729911 | 3300039453 | Bacteria | 3390 |
| 668 | Ga0451853_1379231 | 3300041512 | Bacteria | 3276 |
| 669 | Ga0439441_006883 | 3300042001 | Bacteria | 1815 |
| 670 | Ga0439446_0021669 | 3300042156 | Bacteria | 1817 |
| 671 | Ga0466963_0067164 | 3300044694 | Bacteria | 2406 |
| 672 | Ga0466959_0122789 | 3300045049 | Bacteria | 1845 |
| 673 | Ga0451576_0002320 | 3300045051 | Bacteria | 28818 |
| 674 | Ga0466967_0037584 | 3300045976 | Bacteria | 4145 |
| 675 | Ga0466967_0053041 | 3300045976 | Bacteria | 3563 |
| 676 | Ga0495617_011202 | 3300046452 | Bacteria | 3063 |
| 677 | Ga0495627_000112 | 3300046453 | Bacteria | 101337 |
| 678 | Ga0495627_000206 | 3300046453 | Bacteria | 63802 |
| 679 | Ga0495627_000654 | 3300046453 | Bacteria | 26690 |
| 680 | Ga0495592_0035657 | 3300046454 | Bacteria | 3749 |
| 681 | Ga0495629_0038576 | 3300046459 | Bacteria | 3364 |
| 682 | Ga0495629_0052952 | 3300046459 | Bacteria | 2840 |
| 683 | Ga0495638_0000230 | 3300046460 | Bacteria | 76565 |
| 684 | Ga0495638_0000688 | 3300046460 | Bacteria | 36751 |
| 685 | Ga0495638_0002300 | 3300046460 | Bacteria | 15755 |
| 686 | Ga0495638_0021896 | 3300046460 | Bacteria | 4201 |
| 687 | Ga0495638_0025076 | 3300046460 | Bacteria | 3880 |
| 688 | Ga0495638_0034944 | 3300046460 | Bacteria | 3206 |
| 689 | Ga0495638_0037556 | 3300046460 | Bacteria | 3080 |
| 690 | Ga0495638_0116647 | 3300046460 | Bacteria | 1581 |
| 691 | Ga0495651_0021640 | 3300046462 | Bacteria | 4999 |
| 692 | Ga0495651_0073840 | 3300046462 | Bacteria | 2588 |
| 693 | Ga0495653_0029597 | 3300046463 | Bacteria | 4370 |
| 694 | Ga0495653_0084457 | 3300046463 | Bacteria | 2338 |
| 695 | Ga0495650_0000207 | 3300046471 | Bacteria | 127568 |
| 696 | Ga0495580_0005218 | 3300046472 | Bacteria | 10792 |
| 697 | Ga0495580_0023817 | 3300046472 | Bacteria | 4490 |
| 698 | Ga0495664_0003101 | 3300046477 | Bacteria | 9010 |
| 699 | Ga0495664_0158121 | 3300046477 | Bacteria | 1375 |
| 700 | Ga0495584_0030416 | 3300046491 | Bacteria | 2735 |
| 701 | Ga0495607_0033225 | 3300046501 | Bacteria | 3140 |
| 702 | Ga0495583_0000025 | 3300046506 | Bacteria | 263775 |
| 703 | Ga0495606_0016964 | 3300046507 | Bacteria | 5526 |
| 704 | Ga0495608_0010439 | 3300046511 | Bacteria | 6481 |
| 705 | Ga0495608_0012618 | 3300046511 | Bacteria | 5863 |
| 706 | Ga0495610_0000085 | 3300046512 | Bacteria | 112390 |
| 707 | Ga0495610_0000794 | 3300046512 | Bacteria | 29605 |
| 708 | Ga0495610_0003006 | 3300046512 | Bacteria | 13537 |
| 709 | Ga0495610_0003243 | 3300046512 | Bacteria | 12868 |
| 710 | Ga0495610_0003341 | 3300046512 | Bacteria | 12593 |
| 711 | Ga0495610_0069311 | 3300046512 | Bacteria | 1651 |
| 712 | Ga0495616_0000461 | 3300046513 | Bacteria | 30938 |
| 713 | Ga0495616_0001257 | 3300046513 | Bacteria | 17834 |
| 714 | Ga0495616_0037938 | 3300046513 | Bacteria | 2476 |
| 715 | Ga0495618_0008723 | 3300046514 | Bacteria | 6126 |
| 716 | Ga0495620_0009408 | 3300046515 | Bacteria | 5199 |
| 717 | Ga0495620_0042212 | 3300046515 | Bacteria | 1994 |
| 718 | Ga0495628_0046984 | 3300046516 | Bacteria | 3427 |
| 719 | Ga0495628_0050079 | 3300046516 | Bacteria | 3305 |
| 720 | Ga0495632_0000095 | 3300046519 | Bacteria | 89499 |
| 721 | Ga0495632_0000380 | 3300046519 | Bacteria | 42320 |
| 722 | Ga0495632_0000545 | 3300046519 | Bacteria | 35398 |
| 723 | Ga0495632_0000761 | 3300046519 | Bacteria | 28951 |
| 724 | Ga0495632_0064485 | 3300046519 | Bacteria | 1771 |
| 725 | Ga0495637_0001011 | 3300046520 | Bacteria | 17698 |
| 726 | Ga0495637_0010056 | 3300046520 | Bacteria | 4593 |
| 727 | Ga0495637_0022075 | 3300046520 | Bacteria | 2908 |
| 728 | Ga0495643_0000038 | 3300046522 | Bacteria | 236010 |
| 729 | Ga0495643_0040613 | 3300046522 | Bacteria | 2540 |
| 730 | Ga0495648_0000039 | 3300046524 | Bacteria | 185430 |
| 731 | Ga0495663_0000028 | 3300046525 | Bacteria | 89526 |
| 732 | Ga0495663_0001633 | 3300046525 | Bacteria | 7010 |
| 733 | Ga0495642_0003816 | 3300046528 | Bacteria | 5905 |
| 734 | Ga0495642_0067624 | 3300046528 | Bacteria | 1490 |
| 735 | Ga0495652_0027554 | 3300046529 | Bacteria | 5004 |
| 736 | Ga0495654_0000016 | 3300046530 | Bacteria | 306416 |
| 737 | Ga0495654_0050754 | 3300046530 | Bacteria | 2026 |
| 738 | Ga0495640_0007595 | 3300046533 | Bacteria | 8519 |
| 739 | Ga0495640_0078034 | 3300046533 | Bacteria | 2207 |
| 740 | Ga0495587_0006694 | 3300046536 | Bacteria | 7506 |
| 741 | Ga0495587_0012147 | 3300046536 | Bacteria | 5436 |
| 742 | Ga0495597_0010529 | 3300046542 | Bacteria | 4513 |
| 743 | Ga0495597_0020822 | 3300046542 | Bacteria | 3051 |
| 744 | Ga0495645_0033050 | 3300046543 | Bacteria | 3773 |
| 745 | Ga0495633_0000136 | 3300046558 | Bacteria | 97314 |
| 746 | Ga0495633_0001114 | 3300046558 | Bacteria | 21590 |
| 747 | Ga0495633_0058417 | 3300046558 | Bacteria | 1811 |
| 748 | Ga0495667_0055344 | 3300046559 | Bacteria | 2609 |
| 749 | Ga0495668_0000040 | 3300046616 | Bacteria | 230681 |
| 750 | Ga0495668_0001804 | 3300046616 | Bacteria | 19521 |
| 751 | Ga0495668_0002079 | 3300046616 | Bacteria | 17342 |
| 752 | Ga0495668_0011857 | 3300046616 | Bacteria | 5195 |
| 753 | Ga0495668_0012223 | 3300046616 | Bacteria | 5101 |
| 754 | Ga0495668_0035955 | 3300046616 | Bacteria | 2776 |
| 755 | Ga0495668_0058151 | 3300046616 | Bacteria | 2134 |
| 756 | Ga0495668_0077410 | 3300046616 | Bacteria | 1826 |
| 757 | Ga0495634_0037347 | 3300046642 | Bacteria | 3319 |
| 758 | Ga0495611_0007116 | 3300046648 | Bacteria | 4752 |
| 759 | Ga0495625_0000043 | 3300046660 | Bacteria | 205715 |
| 760 | Ga0495625_0002055 | 3300046660 | Bacteria | 22587 |
| 761 | Ga0495625_0008772 | 3300046660 | Bacteria | 8567 |
| 762 | Ga0495625_0014285 | 3300046660 | Bacteria | 6344 |
| 763 | Ga0495625_0042371 | 3300046660 | Bacteria | 3309 |
| 764 | Ga0495625_0056351 | 3300046660 | Bacteria | 2798 |
| 765 | Ga0495625_0115003 | 3300046660 | Bacteria | 1836 |
| 766 | Ga0495635_0174088 | 3300046663 | Bacteria | 1463 |
| 767 | Ga0495657_0135188 | 3300046675 | Bacteria | 1541 |
| 768 | Ga0495599_0006566 | 3300046678 | Bacteria | 7017 |
| 769 | Ga0495599_0054218 | 3300046678 | Bacteria | 2512 |
| 770 | Ga0495623_0047042 | 3300046679 | Bacteria | 2738 |
| 771 | Ga0495623_0082523 | 3300046679 | Bacteria | 1986 |
| 772 | Ga0495646_0010821 | 3300046680 | Bacteria | 5796 |
| 773 | Ga0495646_0039710 | 3300046680 | Bacteria | 2901 |
| 774 | Ga0495658_0001976 | 3300046683 | Bacteria | 10451 |
| 775 | Ga0495658_0017515 | 3300046683 | Bacteria | 3703 |
| 776 | Ga0495613_0129630 | 3300046689 | Bacteria | 1807 |
| 777 | Ga0495624_0038255 | 3300046690 | Bacteria | 3083 |
| 778 | Ga0495671_0000027 | 3300046692 | Bacteria | 236011 |
| 779 | Ga0495589_0000982 | 3300046794 | Bacteria | 17349 |
| 780 | Ga0495600_0006058 | 3300046809 | Bacteria | 7326 |
| 781 | Ga0495660_0091121 | 3300046810 | Bacteria | 1584 |
| 782 | Ga0495604_0006924 | 3300047317 | Bacteria | 8986 |
| 783 | Ga0495604_0033817 | 3300047317 | Bacteria | 4046 |
| 784 | Ga0495674_0014792 | 3300047319 | Bacteria | 7300 |
| 785 | Ga0495672_0001651 | 3300047320 | Bacteria | 21680 |
| 786 | Ga0495672_0003346 | 3300047320 | Bacteria | 13811 |
| 787 | Ga0495672_0007502 | 3300047320 | Bacteria | 8196 |
| 788 | Ga0495672_0023601 | 3300047320 | Bacteria | 3978 |
| 789 | Ga0495672_0027507 | 3300047320 | Bacteria | 3613 |
| 790 | Ga0495680_0012308 | 3300047322 | Bacteria | 7538 |
| 791 | Ga0495680_0035999 | 3300047322 | Bacteria | 3980 |
| 792 | Ga0495680_0039121 | 3300047322 | Bacteria | 3785 |
| 793 | Ga0495687_020767 | 3300047443 | Bacteria | 3195 |
| 794 | Ga0495679_001492 | 3300047446 | Bacteria | 13209 |
| 795 | Ga0495673_0001020 | 3300047469 | Bacteria | 24700 |
| 796 | Ga0495673_0004053 | 3300047469 | Bacteria | 9335 |
| 797 | Ga0495681_0000013 | 3300047470 | Bacteria | 189155 |
| 798 | Ga0495681_0001132 | 3300047470 | Bacteria | 20269 |
| 799 | Ga0495681_0031256 | 3300047470 | Bacteria | 2698 |
| 800 | Ga0495681_0041565 | 3300047470 | Bacteria | 2231 |
| 801 | Ga0495681_0064193 | 3300047470 | Bacteria | 1683 |
| 802 | Ga0495681_0086906 | 3300047470 | Bacteria | 1387 |
| 803 | Ga0495684_0230238 | 3300047471 | Bacteria | 1356 |
| 804 | Ga0495686_0002348 | 3300047472 | Bacteria | 18058 |
| 805 | Ga0495686_0005443 | 3300047472 | Bacteria | 10042 |
| 806 | Ga0495686_0005745 | 3300047472 | Bacteria | 9697 |
| 807 | Ga0495686_0024572 | 3300047472 | Bacteria | 3957 |
| 808 | Ga0495686_0031218 | 3300047472 | Bacteria | 3456 |
| 809 | Ga0495686_0035025 | 3300047472 | Bacteria | 3230 |
| 810 | Ga0495686_0077292 | 3300047472 | Bacteria | 2039 |
| 811 | Ga0495686_0086892 | 3300047472 | Bacteria | 1903 |
| 812 | Ga0495686_0114194 | 3300047472 | Bacteria | 1617 |
| 813 | Ga0495686_0145124 | 3300047472 | Bacteria | 1397 |
| 814 | Ga0495593_0068247 | 3300047673 | Bacteria | 1850 |
| 815 | Ga0495602_0000162 | 3300048088 | Bacteria | 62143 |
| 816 | Ga0495602_0021910 | 3300048088 | Bacteria | 6272 |
| 817 | Ga0495602_0056209 | 3300048088 | Bacteria | 3462 |
| 818 | Ga0496100_0124502 | 3300048903 | Bacteria | 1808 |
| 819 | Ga0496102_0000575 | 3300048905 | Bacteria | 39009 |
| 820 | Ga0496102_0183359 | 3300048905 | Bacteria | 1972 |
| 821 | Ga0496103_0018338 | 3300048906 | Bacteria | 4198 |
| 822 | Ga0496103_0161582 | 3300048906 | Bacteria | 1437 |
| 823 | Ga0496104_0021209 | 3300048907 | Bacteria | 5962 |
| 824 | Ga0496104_0257053 | 3300048907 | Bacteria | 1659 |
| 825 | Ga0496105_0036935 | 3300048908 | Bacteria | 4025 |
| 826 | Ga0496105_0071626 | 3300048908 | Bacteria | 2864 |
| 827 | Ga0496106_0002493 | 3300048909 | Bacteria | 13699 |
| 828 | Ga0496106_0006998 | 3300048909 | Bacteria | 8331 |
| 829 | Ga0496106_0007733 | 3300048909 | Bacteria | 7956 |
| 830 | Ga0496106_0076960 | 3300048909 | Bacteria | 2558 |
| 831 | Ga0496106_0121952 | 3300048909 | Bacteria | 2038 |
| 832 | Ga0496106_0204425 | 3300048909 | Bacteria | 1572 |
| 833 | Ga0496107_0000029 | 3300048910 | Bacteria | 102345 |
| 834 | Ga0496107_0000086 | 3300048910 | Bacteria | 44285 |
| 835 | Ga0496108_0241207 | 3300048911 | Bacteria | 1572 |
| 836 | Ga0496108_0248373 | 3300048911 | Bacteria | 1548 |
| 837 | Ga0496109_0079402 | 3300048912 | Bacteria | 3023 |
| 838 | Ga0496109_0116756 | 3300048912 | Bacteria | 2484 |
| 839 | Ga0496110_0055094 | 3300048913 | Bacteria | 3499 |
| 840 | Ga0496110_0061792 | 3300048913 | Bacteria | 3307 |
| 841 | Ga0496110_0108936 | 3300048913 | Bacteria | 2487 |
| 842 | Ga0496110_0197205 | 3300048913 | Bacteria | 1829 |
| 843 | Ga0496111_0046698 | 3300048914 | Bacteria | 3118 |
| 844 | Ga0496111_0197461 | 3300048914 | Bacteria | 1496 |
| 845 | Ga0496112_0098221 | 3300048915 | Bacteria | 2898 |
| 846 | Ga0496112_0167113 | 3300048915 | Bacteria | 2166 |
| 847 | Ga0496112_0170214 | 3300048915 | Bacteria | 2143 |
| 848 | Ga0496113_0122192 | 3300048916 | Bacteria | 2037 |
| 849 | Ga0496113_0130843 | 3300048916 | Bacteria | 1969 |
| 850 | Ga0496114_0016149 | 3300048917 | Bacteria | 6008 |
| 851 | Ga0496115_0002259 | 3300048918 | Bacteria | 13788 |
| 852 | Ga0496115_0315072 | 3300048918 | Bacteria | 1280 |
| 853 | Ga0496116_0002427 | 3300048919 | Bacteria | 19634 |
| 854 | Ga0496117_0002946 | 3300048920 | Bacteria | 20582 |
| 855 | Ga0496117_0007358 | 3300048920 | Bacteria | 10779 |
| 856 | Ga0496117_0023559 | 3300048920 | Bacteria | 4900 |
| 857 | Ga0496117_0047413 | 3300048920 | Bacteria | 3081 |
| 858 | Ga0496118_0003282 | 3300048921 | Bacteria | 20581 |
| 859 | Ga0496118_0038502 | 3300048921 | Bacteria | 3831 |
| 860 | Ga0496118_0070650 | 3300048921 | Bacteria | 2519 |
| 861 | Ga0496119_0002396 | 3300048922 | Bacteria | 20582 |
| 862 | Ga0496119_0034571 | 3300048922 | Bacteria | 3325 |
| 863 | Ga0496120_0002204 | 3300048923 | Bacteria | 20582 |
| 864 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 865 | Ga0496121_0001387 | 3300048924 | Bacteria | 41011 |
| 866 | Ga0496121_0001426 | 3300048924 | Bacteria | 40386 |
| 867 | Ga0496121_0002142 | 3300048924 | Bacteria | 31007 |
| 868 | Ga0496121_0003931 | 3300048924 | Bacteria | 20582 |
| 869 | Ga0496121_0061574 | 3300048924 | Bacteria | 3079 |
| 870 | Ga0496122_0000492 | 3300048925 | Bacteria | 82125 |
| 871 | Ga0496122_0011807 | 3300048925 | Bacteria | 8785 |
| 872 | Ga0496122_0036836 | 3300048925 | Bacteria | 3948 |
| 873 | Ga0496123_0000460 | 3300048926 | Bacteria | 71476 |
| 874 | Ga0496123_0016176 | 3300048926 | Bacteria | 6072 |
| 875 | Ga0496123_0025859 | 3300048926 | Bacteria | 4412 |
| 876 | Ga0496123_0081718 | 3300048926 | Bacteria | 1962 |
| 877 | Ga0496124_0003112 | 3300048927 | Bacteria | 20582 |
| 878 | Ga0496124_0005670 | 3300048927 | Bacteria | 13923 |
| 879 | Ga0496124_0019516 | 3300048927 | Bacteria | 6306 |
| 880 | Ga0496124_0024037 | 3300048927 | Bacteria | 5548 |
| 881 | Ga0496125_0000425 | 3300048928 | Bacteria | 78294 |
| 882 | Ga0496125_0004516 | 3300048928 | Bacteria | 15997 |
| 883 | Ga0496125_0027998 | 3300048928 | Bacteria | 5097 |
| 884 | Ga0496125_0029758 | 3300048928 | Bacteria | 4901 |
| 885 | Ga0496125_0101775 | 3300048928 | Bacteria | 2113 |
| 886 | Ga0496126_0001886 | 3300048929 | Bacteria | 30413 |
| 887 | Ga0496126_0010007 | 3300048929 | Bacteria | 10006 |
| 888 | Ga0496126_0020076 | 3300048929 | Bacteria | 6560 |
| 889 | Ga0496126_0036098 | 3300048929 | Bacteria | 4625 |
| 890 | Ga0496126_0051648 | 3300048929 | Bacteria | 3741 |
| 891 | Ga0496126_0129679 | 3300048929 | Bacteria | 2180 |
| 892 | Ga0496126_0167025 | 3300048929 | Bacteria | 1877 |
| 893 | Ga0495678_001042 | 3300049459 | Bacteria | 23497 |
| 894 | Ga0495678_033410 | 3300049459 | Bacteria | 2124 |
| 895 | Ga0495682_0031217 | 3300049460 | Bacteria | 1969 |
| 896 | Ga0501031_0052216 | 3300049568 | Bacteria | 2663 |
| 897 | Ga0501032_0004270 | 3300049569 | Bacteria | 10790 |
| 898 | Ga0501032_0009315 | 3300049569 | Bacteria | 7111 |
| 899 | Ga0501032_0013530 | 3300049569 | Bacteria | 5800 |
| 900 | Ga0501032_0034120 | 3300049569 | Bacteria | 3484 |
| 901 | Ga0501033_0000145 | 3300049570 | Bacteria | 68524 |
| 902 | Ga0501033_0000231 | 3300049570 | Bacteria | 53855 |
| 903 | Ga0501033_0001382 | 3300049570 | Bacteria | 21599 |
| 904 | Ga0501033_0047724 | 3300049570 | Bacteria | 3183 |
| 905 | Ga0501033_0120784 | 3300049570 | Bacteria | 1902 |
| 906 | Ga0501034_0006983 | 3300049571 | Bacteria | 12057 |
| 907 | Ga0501034_0012828 | 3300049571 | Bacteria | 8642 |
| 908 | Ga0501034_0021114 | 3300049571 | Bacteria | 6643 |
| 909 | Ga0501034_0070227 | 3300049571 | Bacteria | 3514 |
| 910 | Ga0501034_0115466 | 3300049571 | Bacteria | 2673 |
| 911 | Ga0501034_0134764 | 3300049571 | Bacteria | 2451 |
| 912 | Ga0501034_0160395 | 3300049571 | Bacteria | 2220 |
| 913 | Ga0501034_0293009 | 3300049571 | Bacteria | 1565 |
| 914 | Ga0501036_0010628 | 3300049572 | Bacteria | 7605 |
| 915 | Ga0501036_0087767 | 3300049572 | Bacteria | 2629 |
| 916 | Ga0501037_0004264 | 3300049573 | Bacteria | 10366 |
| 917 | Ga0501037_0059306 | 3300049573 | Bacteria | 2792 |
| 918 | Ga0501037_0153173 | 3300049573 | Bacteria | 1647 |
| 919 | Ga0501038_0017376 | 3300049574 | Bacteria | 6501 |
| 920 | Ga0501039_0010777 | 3300049575 | Bacteria | 6962 |
| 921 | Ga0501039_0110785 | 3300049575 | Bacteria | 2146 |
| 922 | Ga0501040_0038620 | 3300049576 | Bacteria | 3246 |
| 923 | Ga0501040_0078756 | 3300049576 | Bacteria | 2281 |
| 924 | Ga0501041_0195377 | 3300049577 | Bacteria | 1268 |
| 925 | Ga0501042_0012026 | 3300049578 | Bacteria | 5853 |
| 926 | Ga0501042_0123361 | 3300049578 | Bacteria | 1865 |
| 927 | Ga0501043_0005887 | 3300049579 | Bacteria | 9864 |
| 928 | Ga0501043_0010684 | 3300049579 | Bacteria | 7192 |
| 929 | Ga0501043_0014846 | 3300049579 | Bacteria | 6099 |
| 930 | Ga0501043_0016044 | 3300049579 | Bacteria | 5873 |
| 931 | Ga0501046_0000948 | 3300049580 | Bacteria | 28442 |
| 932 | Ga0501046_0047396 | 3300049580 | Bacteria | 3407 |
| 933 | Ga0501047_0001771 | 3300049581 | Bacteria | 20857 |
| 934 | Ga0501047_0005393 | 3300049581 | Bacteria | 12020 |
| 935 | Ga0501047_0072931 | 3300049581 | Bacteria | 3305 |
| 936 | Ga0501047_0073199 | 3300049581 | Bacteria | 3299 |
| 937 | Ga0501047_0134586 | 3300049581 | Bacteria | 2352 |
| 938 | Ga0501047_0346955 | 3300049581 | Bacteria | 1321 |
| 939 | Ga0501048_0029797 | 3300049582 | Bacteria | 3953 |
| 940 | Ga0501067_0019975 | 3300049583 | Bacteria | 3707 |
| 941 | Ga0501068_0027343 | 3300049584 | Bacteria | 3368 |
| 942 | Ga0501069_0002003 | 3300049585 | Bacteria | 10200 |
| 943 | Ga0501069_0044271 | 3300049585 | Bacteria | 2464 |
| 944 | Ga0501070_0001431 | 3300049586 | Bacteria | 21359 |
| 945 | Ga0501070_0016838 | 3300049586 | Bacteria | 6136 |
| 946 | Ga0501070_0025713 | 3300049586 | Bacteria | 4938 |
| 947 | Ga0501070_0058955 | 3300049586 | Bacteria | 3182 |
| 948 | Ga0501070_0059337 | 3300049586 | Bacteria | 3172 |
| 949 | Ga0501070_0123279 | 3300049586 | Bacteria | 2142 |
| 950 | Ga0501070_0149969 | 3300049586 | Bacteria | 1924 |
| 951 | Ga0501070_0176023 | 3300049586 | Bacteria | 1761 |
| 952 | Ga0501070_0179033 | 3300049586 | Bacteria | 1745 |
| 953 | Ga0501070_0323910 | 3300049586 | Bacteria | 1253 |
| 954 | Ga0501072_0015036 | 3300049588 | Bacteria | 5934 |
| 955 | Ga0501072_0026730 | 3300049588 | Bacteria | 4501 |
| 956 | Ga0501073_0003268 | 3300049589 | Bacteria | 12167 |
| 957 | Ga0501073_0005127 | 3300049589 | Bacteria | 9830 |
| 958 | Ga0501073_0019107 | 3300049589 | Bacteria | 4950 |
| 959 | Ga0501073_0088314 | 3300049589 | Bacteria | 2155 |
| 960 | Ga0501074_0130528 | 3300049590 | Bacteria | 1798 |
| 961 | Ga0501077_0033850 | 3300049593 | Bacteria | 3253 |
| 962 | Ga0501211_001280 | 3300049658 | Bacteria | 2690 |
| 963 | Ga0501223_000080 | 3300049663 | Bacteria | 28958 |
| 964 | Ga0501235_000785 | 3300049669 | Bacteria | 6473 |
| 965 | Ga0501235_013853 | 3300049669 | Bacteria | 1776 |
| 966 | Ga0501236_004335 | 3300049670 | Bacteria | 1680 |
| 967 | Ga0501225_0000092 | 3300049705 | Bacteria | 28671 |
| 968 | Ga0501225_0004314 | 3300049705 | Bacteria | 4251 |
| 969 | Ga0501245_000399 | 3300049708 | Bacteria | 5242 |
| 970 | Ga0501079_0215911 | 3300049741 | Bacteria | 1498 |
| 971 | Ga0501080_0000595 | 3300049742 | Bacteria | 28622 |
| 972 | Ga0501080_0019288 | 3300049742 | Bacteria | 6318 |
| 973 | Ga0501080_0024273 | 3300049742 | Bacteria | 5621 |
| 974 | Ga0501080_0026922 | 3300049742 | Bacteria | 5347 |
| 975 | Ga0501080_0027791 | 3300049742 | Bacteria | 5260 |
| 976 | Ga0501080_0036930 | 3300049742 | Bacteria | 4561 |
| 977 | Ga0501080_0099180 | 3300049742 | Bacteria | 2703 |
| 978 | Ga0501080_0136102 | 3300049742 | Bacteria | 2273 |
| 979 | Ga0501081_0027872 | 3300049743 | Bacteria | 3809 |
| 980 | Ga0501083_0012128 | 3300049744 | Bacteria | 6033 |
| 981 | Ga0501083_0015362 | 3300049744 | Bacteria | 5363 |
| 982 | Ga0501083_0016788 | 3300049744 | Bacteria | 5113 |
| 983 | Ga0501083_0017777 | 3300049744 | Bacteria | 4960 |
| 984 | Ga0501083_0045421 | 3300049744 | Bacteria | 2972 |
| 985 | Ga0501083_0046972 | 3300049744 | Bacteria | 2919 |
| 986 | Ga0501083_0060986 | 3300049744 | Bacteria | 2519 |
| 987 | Ga0501083_0082138 | 3300049744 | Bacteria | 2135 |
| 988 | Ga0501264_002384 | 3300049761 | Bacteria | 1764 |
| 989 | Ga0501035_0001815 | 3300049822 | Bacteria | 21593 |
| 990 | Ga0501035_0003515 | 3300049822 | Bacteria | 14978 |
| 991 | Ga0501035_0044098 | 3300049822 | Bacteria | 4017 |
| 992 | Ga0501035_0088420 | 3300049822 | Bacteria | 2730 |
| 993 | Ga0501035_0094603 | 3300049822 | Bacteria | 2627 |
| 994 | Ga0501044_0000453 | 3300049823 | Bacteria | 49990 |
| 995 | Ga0501044_0003187 | 3300049823 | Bacteria | 18514 |
| 996 | Ga0501044_0007461 | 3300049823 | Bacteria | 12027 |
| 997 | Ga0501044_0019892 | 3300049823 | Bacteria | 7171 |
| 998 | Ga0501044_0027392 | 3300049823 | Bacteria | 6024 |
| 999 | Ga0501044_0033888 | 3300049823 | Bacteria | 5362 |
| 1000 | Ga0501044_0042745 | 3300049823 | Bacteria | 4712 |
| 1001 | Ga0501044_0092981 | 3300049823 | Bacteria | 3041 |
| 1002 | Ga0501044_0101527 | 3300049823 | Bacteria | 2894 |
| 1003 | Ga0501044_0220284 | 3300049823 | Bacteria | 1848 |
| 1004 | Ga0501044_0269483 | 3300049823 | Bacteria | 1639 |
| 1005 | Ga0501045_0093119 | 3300049824 | Bacteria | 2229 |
| 1006 | nmdc:mga03683_18911_c1 | 3300050489 | Bacteria | 2172 |
| 1007 | nmdc:mga03683_2194_c1 | 3300050489 | Bacteria | 6028 |
| 1008 | nmdc:mga03683_36907_c1 | 3300050489 | Bacteria | 1584 |
| 1009 | nmdc:mga03683_5373_c1 | 3300050489 | Bacteria | 4324 |
| 1010 | nmdc:mga03683_55976_c1 | 3300050489 | Bacteria | 1657 |
| 1011 | nmdc:mga03683_6375_c1 | 3300050489 | Bacteria | 4035 |
| 1012 | nmdc:mga03683_739_c1 | 3300050489 | Bacteria | 9349 |
| 1013 | nmdc:mga03n38_31224_c1 | 3300050490 | Bacteria | 2246 |
| 1014 | nmdc:mga00v17_13036_c1 | 3300050491 | Bacteria | 4605 |
| 1015 | nmdc:mga00v17_393_c1 | 3300050491 | Bacteria | 13156 |
| 1016 | nmdc:mga0yw44_135714_c1 | 3300050492 | Bacteria | 1596 |
| 1017 | nmdc:mga0k408_11574_c1 | 3300050493 | Bacteria | 4808 |
| 1018 | nmdc:mga0k408_23263_c1 | 3300050493 | Bacteria | 3494 |
| 1019 | nmdc:mga0k408_37533_c1 | 3300050493 | Bacteria | 2782 |
| 1020 | nmdc:mga06z11_101703_c1 | 3300050494 | Bacteria | 1578 |
| 1021 | nmdc:mga06z11_255_c1 | 3300050494 | Bacteria | 20756 |
| 1022 | nmdc:mga06z11_571_c1 | 3300050494 | Bacteria | 13469 |
| 1023 | nmdc:mga04h51_62_c1 | 3300050495 | Bacteria | 34326 |
| 1024 | nmdc:mga07m45_44858_c1 | 3300050496 | Bacteria | 1667 |
| 1025 | nmdc:mga05p37_115069_c1 | 3300050507 | Bacteria | 3306 |
| 1026 | nmdc:mga05p37_2869_c1 | 3300050507 | Bacteria | 8026 |
| 1027 | nmdc:mga05p37_62352_c1 | 3300050507 | Bacteria | 4588 |
| 1028 | nmdc:mga0qj67_3611_c1 | 3300050509 | Bacteria | 11162 |
| 1029 | nmdc:mga08y16_167771_c1 | 3300050511 | Bacteria | 2281 |
| 1030 | nmdc:mga08y16_179940_c1 | 3300050511 | Bacteria | 2195 |
| 1031 | nmdc:mga08y16_25630_c1 | 3300050511 | Bacteria | 6221 |
| 1032 | nmdc:mga08y16_279_c1 | 3300050511 | Bacteria | 46569 |
| 1033 | nmdc:mga08y16_28162_c1 | 3300050511 | Bacteria | 5922 |
| 1034 | nmdc:mga0n895_59450_c1 | 3300050512 | Bacteria | 3770 |
| 1035 | nmdc:mga0rr50_41064_c1 | 3300050513 | Bacteria | 3368 |
| 1036 | nmdc:mga0rr50_45155_c1 | 3300050513 | Bacteria | 3236 |
| 1037 | nmdc:mga0rr50_73300_c1 | 3300050513 | Bacteria | 2617 |
| 1038 | nmdc:mga08x19_193398_c1 | 3300050514 | Bacteria | 1392 |
| 1039 | nmdc:mga08x19_46408_c1 | 3300050514 | Bacteria | 2778 |
| 1040 | nmdc:mga08x19_4_c2 | 3300050514 | Bacteria | 202063 |
| 1041 | nmdc:mga0a205_165544_c1 | 3300050515 | Bacteria | 2106 |
| 1042 | nmdc:mga0a205_189724_c1 | 3300050515 | Bacteria | 1948 |
| 1043 | nmdc:mga0a205_56508_c1 | 3300050515 | Bacteria | 3789 |
| 1044 | nmdc:mga0a205_70422_c1 | 3300050515 | Bacteria | 3376 |
| 1045 | nmdc:mga0sz30_1132_c1 | 3300050516 | Bacteria | 9563 |
| 1046 | nmdc:mga0sz30_1334_c1 | 3300050516 | Bacteria | 8798 |
| 1047 | Ga0495612_0003425 | 3300053078 | Bacteria | 6575 |
| 1048 | Ga0500635_0000052 | 3300053080 | Bacteria | 75372 |
| 1049 | Ga0495595_0002120 | 3300053084 | Bacteria | 7703 |
| 1050 | Ga0495595_0006813 | 3300053084 | Bacteria | 4664 |
| 1051 | Ga0495619_0011297 | 3300053085 | Bacteria | 5618 |
| 1052 | Ga0495619_0036027 | 3300053085 | Bacteria | 3221 |
| 1053 | Ga0500578_0000041 | 3300053086 | Bacteria | 129580 |
| 1054 | Ga0500643_002829 | 3300053087 | Bacteria | 8671 |
| 1055 | Ga0500643_010631 | 3300053087 | Bacteria | 3412 |
| 1056 | Ga0500644_0004719 | 3300053088 | Bacteria | 3419 |
| 1057 | Ga0500644_0011737 | 3300053088 | Bacteria | 2403 |
| 1058 | Ga0500644_0020003 | 3300053088 | Bacteria | 1984 |
| 1059 | Ga0500644_0040340 | 3300053088 | Bacteria | 1544 |
| 1060 | Ga0500646_0029951 | 3300053090 | Bacteria | 1492 |
| 1061 | Ga0500651_0014192 | 3300053093 | Bacteria | 4872 |
| 1062 | Ga0500566_0006891 | 3300053094 | Bacteria | 6727 |
| 1063 | Ga0500641_0000152 | 3300053096 | Bacteria | 25722 |
| 1064 | Ga0500641_0003048 | 3300053096 | Bacteria | 5940 |
| 1065 | Ga0500555_010770 | 3300053103 | Bacteria | 2625 |
| 1066 | Ga0500556_0003307 | 3300053104 | Bacteria | 4775 |
| 1067 | Ga0500556_0003699 | 3300053104 | Bacteria | 4443 |
| 1068 | Ga0500562_000213 | 3300053108 | Bacteria | 15703 |
| 1069 | Ga0500562_002691 | 3300053108 | Bacteria | 4418 |
| 1070 | Ga0500562_024015 | 3300053108 | Bacteria | 1593 |
| 1071 | Ga0500569_002082 | 3300053109 | Bacteria | 3896 |
| 1072 | Ga0500595_000107 | 3300053119 | Bacteria | 56944 |
| 1073 | Ga0500595_000667 | 3300053119 | Bacteria | 20599 |
| 1074 | Ga0500608_000105 | 3300053122 | Bacteria | 34366 |
| 1075 | Ga0500608_011759 | 3300053122 | Bacteria | 3813 |
| 1076 | Ga0500608_088158 | 3300053122 | Bacteria | 1454 |
| 1077 | Ga0500614_002523 | 3300053123 | Bacteria | 4060 |
| 1078 | Ga0500614_006378 | 3300053123 | Bacteria | 2479 |
| 1079 | Ga0500618_000022 | 3300053125 | Bacteria | 157907 |
| 1080 | Ga0500618_000053 | 3300053125 | Bacteria | 101079 |
| 1081 | Ga0500642_0058659 | 3300053130 | Bacteria | 1721 |
| 1082 | Ga0500655_003142 | 3300053133 | Bacteria | 2994 |
| 1083 | Ga0500658_0009137 | 3300053134 | Bacteria | 3657 |
| 1084 | Ga0500559_0000005 | 3300053136 | Bacteria | 230231 |
| 1085 | Ga0500559_0000054 | 3300053136 | Bacteria | 90695 |
| 1086 | Ga0500559_0003825 | 3300053136 | Bacteria | 7284 |
| 1087 | Ga0500559_0025855 | 3300053136 | Bacteria | 2499 |
| 1088 | Ga0500564_003005 | 3300053138 | Bacteria | 6423 |
| 1089 | Ga0500577_0001675 | 3300053142 | Bacteria | 5673 |
| 1090 | Ga0500577_0012279 | 3300053142 | Bacteria | 2583 |
| 1091 | Ga0500590_000472 | 3300053148 | Bacteria | 13775 |
| 1092 | Ga0500616_0000501 | 3300053153 | Bacteria | 50041 |
| 1093 | Ga0500616_0000555 | 3300053153 | Bacteria | 46139 |
| 1094 | Ga0500616_0016047 | 3300053153 | Bacteria | 4273 |
| 1095 | Ga0500616_0030438 | 3300053153 | Bacteria | 2964 |
| 1096 | Ga0500616_0044667 | 3300053153 | Bacteria | 2363 |
| 1097 | Ga0500619_031333 | 3300053154 | Bacteria | 1622 |
| 1098 | Ga0500622_0000695 | 3300053156 | Bacteria | 29628 |
| 1099 | Ga0500622_0004581 | 3300053156 | Bacteria | 8610 |
| 1100 | Ga0500622_0005841 | 3300053156 | Bacteria | 7287 |
| 1101 | Ga0500622_0006217 | 3300053156 | Bacteria | 6987 |
| 1102 | Ga0500622_0008629 | 3300053156 | Bacteria | 5689 |
| 1103 | Ga0500622_0017312 | 3300053156 | Bacteria | 3835 |
| 1104 | Ga0500622_0030266 | 3300053156 | Bacteria | 2843 |
| 1105 | Ga0500624_000028 | 3300053157 | Bacteria | 106675 |
| 1106 | Ga0500634_0051614 | 3300053161 | Bacteria | 2212 |
| 1107 | Ga0500636_0040124 | 3300053177 | Bacteria | 2768 |
| 1108 | Ga0500636_0057228 | 3300053177 | Bacteria | 2282 |
| 1109 | Ga0500637_0000212 | 3300053178 | Bacteria | 21766 |
| 1110 | Ga0500645_000519 | 3300053730 | Bacteria | 25756 |
| 1111 | Ga0500645_000893 | 3300053730 | Bacteria | 17254 |
| 1112 | Ga0500645_014346 | 3300053730 | Bacteria | 2525 |
| 1113 | Ga0500609_002360 | 3300053731 | Bacteria | 2699 |
| 1114 | Ga0500596_007021 | 3300053735 | Bacteria | 1865 |
| 1115 | Ga0501084_0026997 | 3300054114 | Bacteria | 4797 |
| 1116 | Ga0501082_0005314 | 3300060353 | Bacteria | 11193 |
| 1117 | Ga0501082_0070736 | 3300060353 | Bacteria | 3004 |
| 1118 | Ga0501082_0109910 | 3300060353 | Bacteria | 2386 |
| 1119 | Ga0501082_0220088 | 3300060353 | Bacteria | 1652 |
| 1120 | Ga0530510_0045413 | 3300061734 | Bacteria | 3174 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009176 | Ga0105242_10223647 | Ga0105242_102236472 | 322 |
| 2 | 3300025934 | Ga0207686_10230674 | Ga0207686_102306742 | 324 |
| 3 | 3300005618 | Ga0068864_100145254 | Ga0068864_1001452542 | 330 |
| 4 | 3300046675 | Ga0495657_0135188 | Ga0495657_0135188_450_1514 | 334 |
| 5 | 3300035115 | Ga0373941_0027967 | Ga0373941_0027967_579_1625 | 336 |
| 6 | 3300049593 | Ga0501077_0033850 | Ga0501077_0033850_22_1065 | 336 |
| 7 | 3300026121 | Ga0207683_10348770 | Ga0207683_103487702 | 337 |
| 8 | 3300037418 | Ga0395900_0505181 | Ga0395900_0505181_58_1128 | 337 |
| 9 | 3300048924 | Ga0496121_0061574 | Ga0496121_0061574_1874_3031 | 341 |
| 10 | 3300037312 | Ga0395899_0022653 | Ga0395899_0022653_11_1156 | 345 |
| 11 | 3300038443 | Ga0395901_0028623 | Ga0395901_0028623_12_1157 | 345 |
| 12 | iso_pu_bacteria | 2841760612 | 2841763818 | 345 |
| 13 | iso_pu_bacteria | 2844104063 | 2844109278 | 345 |
| 14 | iso_pu_bacteria | 2851182111 | 2851183071 | 345 |
| 15 | iso_pu_bacteria | 2851246043 | 2851251385 | 345 |
| 16 | 3300046663 | Ga0495635_0174088 | Ga0495635_0174088_27_1127 | 346 |
| 17 | 3300047322 | Ga0495680_0012308 | Ga0495680_0012308_6356_7456 | 346 |
| 18 | 3300049577 | Ga0501041_0195377 | Ga0501041_0195377_107_1204 | 347 |
| 19 | 3300046528 | Ga0495642_0067624 | Ga0495642_0067624_43_1152 | 348 |
| 20 | 3300048912 | Ga0496109_0116756 | Ga0496109_0116756_1243_2346 | 348 |
| 21 | 3300035691 | Ga0373931_0210880 | Ga0373931_0210880_14_1120 | 349 |
| 22 | 3300053161 | Ga0500634_0051614 | Ga0500634_0051614_223_1293 | 349 |
| 23 | 3300046519 | Ga0495632_0064485 | Ga0495632_0064485_672_1748 | 352 |
| 24 | 3300035170 | Ga0373943_0136432 | Ga0373943_0136432_41_1177 | 353 |
| 25 | 3300035725 | Ga0373947_0094826 | Ga0373947_0094826_653_1759 | 353 |
| 26 | 3300046810 | Ga0495660_0091121 | Ga0495660_0091121_478_1557 | 353 |
| 27 | 3300049578 | Ga0501042_0123361 | Ga0501042_0123361_30_1160 | 353 |
| 28 | 3300039450 | Ga0436363_1198557 | Ga0436363_1198557_1392_2513 | 362 |
| 29 | 3300049822 | Ga0501035_0088420 | Ga0501035_0088420_1543_2688 | 362 |
| 30 | 3300053108 | Ga0500562_002691 | Ga0500562_002691_2270_3451 | 362 |
| 31 | 3300053153 | Ga0500616_0044667 | Ga0500616_0044667_50_1231 | 363 |
| 32 | 3300047472 | Ga0495686_0086892 | Ga0495686_0086892_32_1189 | 364 |
| 33 | 3300049571 | Ga0501034_0134764 | Ga0501034_0134764_810_2009 | 364 |
| 34 | 3300005546 | Ga0070696_100056823 | Ga0070696_1000568233 | 367 |
| 35 | 3300005617 | Ga0068859_100156163 | Ga0068859_1001561632 | 367 |
| 36 | 3300006931 | Ga0097620_100156153 | Ga0097620_1001561532 | 367 |
| 37 | 3300049581 | Ga0501047_0001771 | Ga0501047_0001771_2414_3610 | 367 |
| 38 | 3300053108 | Ga0500562_024015 | Ga0500562_024015_31_1212 | 367 |
| 39 | 3300053156 | Ga0500622_0004581 | Ga0500622_0004581_55_1236 | 367 |
| 40 | 3300005843 | Ga0068860_100076811 | Ga0068860_1000768112 | 368 |
| 41 | 3300003322 | rootL2_10076554 | rootL2_100765542 | 369 |
| 42 | 3300037853 | Ga0436364_1305431 | Ga0436364_1305431_27451_28653 | 370 |
| 43 | iso_pu_bacteria | 8054563764 | 8054566196 | 370 |
| 44 | 3300031824 | Ga0307413_10034611 | Ga0307413_100346112 | 371 |
| 45 | 3300031852 | Ga0307410_10058026 | Ga0307410_100580263 | 371 |
| 46 | 3300037853 | Ga0436364_1161582 | Ga0436364_1161582_3382_4572 | 372 |
| 47 | 3300039437 | Ga0436365_1878082 | Ga0436365_1878082_1426_2679 | 372 |
| 48 | 3300049585 | Ga0501069_0044271 | Ga0501069_0044271_243_1502 | 372 |
| 49 | 3300049586 | Ga0501070_0323910 | Ga0501070_0323910_61_1236 | 373 |
| 50 | 3300005262 | Ga0065165_1019308 | Ga0065165_10193084 | 374 |
| 51 | 3300047472 | Ga0495686_0035025 | Ga0495686_0035025_239_1363 | 374 |
| 52 | 3300049586 | Ga0501070_0016838 | Ga0501070_0016838_3113_4357 | 374 |
| 53 | 3300053730 | Ga0500645_014346 | Ga0500645_014346_469_1683 | 374 |
| 54 | 3300046477 | Ga0495664_0158121 | Ga0495664_0158121_170_1354 | 375 |
| 55 | 3300046512 | Ga0495610_0069311 | Ga0495610_0069311_251_1495 | 375 |
| 56 | 3300049586 | Ga0501070_0059337 | Ga0501070_0059337_1803_3047 | 375 |
| 57 | 3300028794 | Ga0307515_10008637 | Ga0307515_1000863721 | 376 |
| 58 | 3300039447 | Ga0436361_0480426 | Ga0436361_0480426_265_1461 | 376 |
| 59 | 3300049586 | Ga0501070_0149969 | Ga0501070_0149969_385_1635 | 376 |
| 60 | 3300049586 | Ga0501070_0176023 | Ga0501070_0176023_32_1294 | 376 |
| 61 | 3300049744 | Ga0501083_0016788 | Ga0501083_0016788_257_1519 | 376 |
| 62 | 3300060353 | Ga0501082_0109910 | Ga0501082_0109910_653_1915 | 376 |
| 63 | 3300005347 | Ga0070668_100001584 | Ga0070668_1000015842 | 377 |
| 64 | 3300005355 | Ga0070671_100002549 | Ga0070671_10000254916 | 377 |
| 65 | 3300005548 | Ga0070665_100168980 | Ga0070665_1001689802 | 377 |
| 66 | 3300005841 | Ga0068863_100013552 | Ga0068863_1000135523 | 377 |
| 67 | 3300005843 | Ga0068860_100009534 | Ga0068860_1000095343 | 377 |
| 68 | 3300025931 | Ga0207644_10044716 | Ga0207644_100447163 | 377 |
| 69 | 3300025972 | Ga0207668_10001120 | Ga0207668_1000112016 | 377 |
| 70 | 3300026088 | Ga0207641_10001763 | Ga0207641_100017632 | 377 |
| 71 | 3300050489 | nmdc:mga03683_36907_c1 | nmdc:mga03683_36907_c1_251_1459 | 378 |
| 72 | 3300050494 | nmdc:mga06z11_101703_c1 | nmdc:mga06z11_101703_c1_296_1504 | 378 |
| 73 | 3300049570 | Ga0501033_0120784 | Ga0501033_0120784_415_1668 | 379 |
| 74 | 3300049742 | Ga0501080_0024273 | Ga0501080_0024273_1811_3073 | 379 |
| 75 | 3300053096 | Ga0500641_0000152 | Ga0500641_0000152_18970_20151 | 379 |
| 76 | 3300053104 | Ga0500556_0003307 | Ga0500556_0003307_1256_2437 | 379 |
| 77 | 3300053153 | Ga0500616_0016047 | Ga0500616_0016047_1769_2950 | 379 |
| 78 | 3300053156 | Ga0500622_0017312 | Ga0500622_0017312_1255_2436 | 379 |
| 79 | 3300053730 | Ga0500645_000519 | Ga0500645_000519_13465_14646 | 379 |
| 80 | iso_pu_bacteria | 2884960567 | 2884963727 | 380 |
| 81 | 3300006048 | Ga0075363_100005046 | Ga0075363_1000050465 | 381 |
| 82 | 3300006051 | Ga0075364_10009110 | Ga0075364_100091104 | 381 |
| 83 | 3300006177 | Ga0075362_10002519 | Ga0075362_100025194 | 381 |
| 84 | 3300006178 | Ga0075367_10015872 | Ga0075367_100158723 | 381 |
| 85 | 3300013306 | Ga0163162_10293934 | Ga0163162_102939341 | 381 |
| 86 | 3300036712 | Ga0316584_0191992 | Ga0316584_0191992_140_1390 | 381 |
| 87 | 3300049586 | Ga0501070_0179033 | Ga0501070_0179033_323_1546 | 381 |
| 88 | 3300050489 | nmdc:mga03683_6375_c1 | nmdc:mga03683_6375_c1_1137_2393 | 381 |
| 89 | 3300050490 | nmdc:mga03n38_31224_c1 | nmdc:mga03n38_31224_c1_184_1440 | 381 |
| 90 | 3300050491 | nmdc:mga00v17_13036_c1 | nmdc:mga00v17_13036_c1_515_1771 | 381 |
| 91 | 3300050493 | nmdc:mga0k408_11574_c1 | nmdc:mga0k408_11574_c1_119_1375 | 381 |
| 92 | iso_pu_bacteria | 2585428106 | 2587919816 | 381 |
| 93 | iso_pu_bacteria | 2643221640 | 2644223556 | 381 |
| 94 | iso_pu_bacteria | 2643221642 | 2644236354 | 381 |
| 95 | 3300035725 | Ga0373947_0022783 | Ga0373947_0022783_31_1203 | 382 |
| 96 | 3300036712 | Ga0316584_0042846 | Ga0316584_0042846_1340_2569 | 382 |
| 97 | 3300047472 | Ga0495686_0114194 | Ga0495686_0114194_155_1366 | 382 |
| 98 | iso_pu_bacteria | 2582581279 | 2585150173 | 382 |
| 99 | iso_pu_bacteria | 2857504554 | 2857505917 | 382 |
| 100 | iso_pu_bacteria | 2928531327 | 2928531976 | 382 |
| 101 | 3300053177 | Ga0500636_0040124 | Ga0500636_0040124_1382_2554 | 383 |
| 102 | iso_pu_bacteria | 2643221736 | 2644742393 | 383 |
| 103 | iso_pu_bacteria | 2818991435 | 2819538340 | 383 |
| 104 | iso_pu_bacteria | 2818991454 | 2819649410 | 383 |
| 105 | iso_pu_bacteria | 8057529695 | 8057534255 | 383 |
| 106 | 3300002987 | JGI25159J45721_1002192 | JGI25159J45721_10021922 | 384 |
| 107 | 3300003771 | Ga0055526_1001056 | Ga0055526_100105611 | 384 |
| 108 | 3300005262 | Ga0065165_1000062 | Ga0065165_100006227 | 384 |
| 109 | 3300025284 | Ga0209130_1000235 | Ga0209130_100023560 | 384 |
| 110 | 3300025294 | Ga0209025_1037455 | Ga0209025_10374552 | 384 |
| 111 | 3300025295 | Ga0209564_1000019 | Ga0209564_1000019296 | 384 |
| 112 | 3300046512 | Ga0495610_0003006 | Ga0495610_0003006_9745_10920 | 384 |
| 113 | 3300046524 | Ga0495648_0000039 | Ga0495648_0000039_161878_163053 | 384 |
| 114 | 3300047470 | Ga0495681_0086906 | Ga0495681_0086906_125_1300 | 384 |
| 115 | 3300048906 | Ga0496103_0161582 | Ga0496103_0161582_186_1418 | 384 |
| 116 | 3300049459 | Ga0495678_001042 | Ga0495678_001042_9377_10552 | 384 |
| 117 | 3300049569 | Ga0501032_0034120 | Ga0501032_0034120_858_2051 | 384 |
| 118 | 3300049571 | Ga0501034_0115466 | Ga0501034_0115466_1143_2336 | 384 |
| 119 | 3300049572 | Ga0501036_0087767 | Ga0501036_0087767_979_2172 | 384 |
| 120 | 3300049581 | Ga0501047_0346955 | Ga0501047_0346955_110_1303 | 384 |
| 121 | 3300049589 | Ga0501073_0019107 | Ga0501073_0019107_3506_4699 | 384 |
| 122 | 3300049742 | Ga0501080_0136102 | Ga0501080_0136102_447_1640 | 384 |
| 123 | 3300049822 | Ga0501035_0094603 | Ga0501035_0094603_153_1346 | 384 |
| 124 | 3300050496 | nmdc:mga07m45_44858_c1 | nmdc:mga07m45_44858_c1_66_1241 | 384 |
| 125 | 3300053086 | Ga0500578_0000041 | Ga0500578_0000041_21013_22188 | 384 |
| 126 | 3300053088 | Ga0500644_0004719 | Ga0500644_0004719_2159_3334 | 384 |
| 127 | 3300053088 | Ga0500644_0011737 | Ga0500644_0011737_1158_2333 | 384 |
| 128 | 3300053138 | Ga0500564_003005 | Ga0500564_003005_217_1392 | 384 |
| 129 | 3300053153 | Ga0500616_0000501 | Ga0500616_0000501_23437_24642 | 384 |
| 130 | 3300053156 | Ga0500622_0005841 | Ga0500622_0005841_60_1235 | 384 |
| 131 | 3300053156 | Ga0500622_0008629 | Ga0500622_0008629_4444_5619 | 384 |
| 132 | 3300054114 | Ga0501084_0026997 | Ga0501084_0026997_2954_4147 | 384 |
| 133 | iso_pu_bacteria | 2643221552 | 2643780049 | 384 |
| 134 | iso_pu_bacteria | 2643221584 | 2643932104 | 384 |
| 135 | iso_pu_bacteria | 2841911363 | 2841916892 | 384 |
| 136 | iso_pu_bacteria | 2841917233 | 2841917604 | 384 |
| 137 | 3300005331 | Ga0070670_100005254 | Ga0070670_1000052546 | 385 |
| 138 | 3300005347 | Ga0070668_100007411 | Ga0070668_1000074113 | 385 |
| 139 | 3300005367 | Ga0070667_100027219 | Ga0070667_1000272194 | 385 |
| 140 | 3300005617 | Ga0068859_100021915 | Ga0068859_1000219152 | 385 |
| 141 | 3300005841 | Ga0068863_100071333 | Ga0068863_1000713333 | 385 |
| 142 | 3300006931 | Ga0097620_100021915 | Ga0097620_1000219152 | 385 |
| 143 | 3300010375 | Ga0105239_10032508 | Ga0105239_100325086 | 385 |
| 144 | 3300025294 | Ga0209025_1038926 | Ga0209025_10389261 | 385 |
| 145 | 3300025295 | Ga0209564_1018697 | Ga0209564_10186973 | 385 |
| 146 | 3300025986 | Ga0207658_10008299 | Ga0207658_100082997 | 385 |
| 147 | 3300026118 | Ga0207675_100448159 | Ga0207675_1004481591 | 385 |
| 148 | 3300028381 | Ga0268264_10003426 | Ga0268264_100034263 | 385 |
| 149 | 3300046460 | Ga0495638_0000688 | Ga0495638_0000688_23584_24762 | 385 |
| 150 | 3300046460 | Ga0495638_0034944 | Ga0495638_0034944_1046_2224 | 385 |
| 151 | 3300047469 | Ga0495673_0001020 | Ga0495673_0001020_23379_24557 | 385 |
| 152 | 3300048905 | Ga0496102_0183359 | Ga0496102_0183359_431_1639 | 385 |
| 153 | 3300048909 | Ga0496106_0006998 | Ga0496106_0006998_44_1252 | 385 |
| 154 | 3300048915 | Ga0496112_0098221 | Ga0496112_0098221_1564_2772 | 385 |
| 155 | 3300048928 | Ga0496125_0101775 | Ga0496125_0101775_733_1911 | 385 |
| 156 | 3300048929 | Ga0496126_0036098 | Ga0496126_0036098_833_2011 | 385 |
| 157 | 3300049742 | Ga0501080_0019288 | Ga0501080_0019288_2911_4107 | 385 |
| 158 | 3300049744 | Ga0501083_0015362 | Ga0501083_0015362_1527_2723 | 385 |
| 159 | 3300050513 | nmdc:mga0rr50_45155_c1 | nmdc:mga0rr50_45155_c1_318_1517 | 385 |
| 160 | 3300050515 | nmdc:mga0a205_189724_c1 | nmdc:mga0a205_189724_c1_154_1362 | 385 |
| 161 | 3300053156 | Ga0500622_0030266 | Ga0500622_0030266_304_1482 | 385 |
| 162 | iso_pu_bacteria | 2643221545 | 2643750370 | 385 |
| 163 | iso_pu_bacteria | 2643221691 | 2644507259 | 385 |
| 164 | 3300003781 | Ga0055536_1001392 | Ga0055536_100139212 | 386 |
| 165 | 3300003781 | Ga0055536_1003842 | Ga0055536_10038424 | 386 |
| 166 | 3300003791 | Ga0055530_10005206 | Ga0055530_100052063 | 386 |
| 167 | 3300003791 | Ga0055530_10005885 | Ga0055530_100058854 | 386 |
| 168 | 3300003794 | Ga0055531_10000820 | Ga0055531_1000082025 | 386 |
| 169 | 3300005293 | Ga0065715_10017061 | Ga0065715_100170612 | 386 |
| 170 | 3300005331 | Ga0070670_100000128 | Ga0070670_10000012811 | 386 |
| 171 | 3300005331 | Ga0070670_100101569 | Ga0070670_1001015692 | 386 |
| 172 | 3300005331 | Ga0070670_100184868 | Ga0070670_1001848682 | 386 |
| 173 | 3300005335 | Ga0070666_10062863 | Ga0070666_100628632 | 386 |
| 174 | 3300005338 | Ga0068868_100152170 | Ga0068868_1001521701 | 386 |
| 175 | 3300005347 | Ga0070668_100000584 | Ga0070668_1000005849 | 386 |
| 176 | 3300005347 | Ga0070668_100001376 | Ga0070668_1000013767 | 386 |
| 177 | 3300005347 | Ga0070668_100004146 | Ga0070668_1000041466 | 386 |
| 178 | 3300005355 | Ga0070671_100000209 | Ga0070671_10000020910 | 386 |
| 179 | 3300005355 | Ga0070671_100206807 | Ga0070671_1002068072 | 386 |
| 180 | 3300005367 | Ga0070667_100000169 | Ga0070667_10000016949 | 386 |
| 181 | 3300005367 | Ga0070667_100004942 | Ga0070667_10000494210 | 386 |
| 182 | 3300005435 | Ga0070714_100223090 | Ga0070714_1002230901 | 386 |
| 183 | 3300005545 | Ga0070695_100067300 | Ga0070695_1000673002 | 386 |
| 184 | 3300005548 | Ga0070665_100000610 | Ga0070665_1000006102 | 386 |
| 185 | 3300005548 | Ga0070665_100002779 | Ga0070665_10000277911 | 386 |
| 186 | 3300005617 | Ga0068859_100005908 | Ga0068859_1000059086 | 386 |
| 187 | 3300005618 | Ga0068864_100000284 | Ga0068864_1000002842 | 386 |
| 188 | 3300005618 | Ga0068864_100000461 | Ga0068864_10000046124 | 386 |
| 189 | 3300005841 | Ga0068863_100000101 | Ga0068863_10000010139 | 386 |
| 190 | 3300005841 | Ga0068863_100000185 | Ga0068863_10000018525 | 386 |
| 191 | 3300005841 | Ga0068863_100004288 | Ga0068863_1000042889 | 386 |
| 192 | 3300005841 | Ga0068863_100100629 | Ga0068863_1001006292 | 386 |
| 193 | 3300005842 | Ga0068858_100000271 | Ga0068858_10000027113 | 386 |
| 194 | 3300005842 | Ga0068858_100006545 | Ga0068858_10000654511 | 386 |
| 195 | 3300005842 | Ga0068858_100009567 | Ga0068858_1000095673 | 386 |
| 196 | 3300005843 | Ga0068860_100000211 | Ga0068860_10000021152 | 386 |
| 197 | 3300005843 | Ga0068860_100006897 | Ga0068860_10000689711 | 386 |
| 198 | 3300005843 | Ga0068860_100023514 | Ga0068860_1000235145 | 386 |
| 199 | 3300005844 | Ga0068862_100002355 | Ga0068862_10000235510 | 386 |
| 200 | 3300005844 | Ga0068862_100053014 | Ga0068862_1000530143 | 386 |
| 201 | 3300005844 | Ga0068862_100088048 | Ga0068862_1000880482 | 386 |
| 202 | 3300006042 | Ga0075368_10010676 | Ga0075368_100106764 | 386 |
| 203 | 3300006048 | Ga0075363_100090541 | Ga0075363_1000905412 | 386 |
| 204 | 3300006051 | Ga0075364_10007544 | Ga0075364_100075448 | 386 |
| 205 | 3300006178 | Ga0075367_10000812 | Ga0075367_100008121 | 386 |
| 206 | 3300006195 | Ga0075366_10016899 | Ga0075366_100168995 | 386 |
| 207 | 3300006195 | Ga0075366_10022022 | Ga0075366_100220222 | 386 |
| 208 | 3300006931 | Ga0097620_100005908 | Ga0097620_10000590810 | 386 |
| 209 | 3300009177 | Ga0105248_10000349 | Ga0105248_1000034943 | 386 |
| 210 | 3300009177 | Ga0105248_10001964 | Ga0105248_100019649 | 386 |
| 211 | 3300009177 | Ga0105248_10027599 | Ga0105248_100275992 | 386 |
| 212 | 3300009553 | Ga0105249_10001221 | Ga0105249_100012218 | 386 |
| 213 | 3300009553 | Ga0105249_10157607 | Ga0105249_101576073 | 386 |
| 214 | 3300010375 | Ga0105239_10170963 | Ga0105239_101709632 | 386 |
| 215 | 3300013306 | Ga0163162_10101686 | Ga0163162_101016862 | 386 |
| 216 | 3300013306 | Ga0163162_10118704 | Ga0163162_101187042 | 386 |
| 217 | 3300014325 | Ga0163163_10151940 | Ga0163163_101519402 | 386 |
| 218 | 3300014325 | Ga0163163_10156415 | Ga0163163_101564152 | 386 |
| 219 | 3300014325 | Ga0163163_10157466 | Ga0163163_101574662 | 386 |
| 220 | 3300014968 | Ga0157379_10000119 | Ga0157379_1000011932 | 386 |
| 221 | 3300014968 | Ga0157379_10010097 | Ga0157379_100100972 | 386 |
| 222 | 3300014968 | Ga0157379_10079688 | Ga0157379_100796884 | 386 |
| 223 | 3300025292 | Ga0209676_1000169 | Ga0209676_1000169150 | 386 |
| 224 | 3300025292 | Ga0209676_1000319 | Ga0209676_100031936 | 386 |
| 225 | 3300025298 | Ga0209050_1000737 | Ga0209050_100073740 | 386 |
| 226 | 3300025298 | Ga0209050_1001426 | Ga0209050_10014264 | 386 |
| 227 | 3300025303 | Ga0209051_1001836 | Ga0209051_10018365 | 386 |
| 228 | 3300025304 | Ga0209257_1001595 | Ga0209257_100159526 | 386 |
| 229 | 3300025304 | Ga0209257_1016114 | Ga0209257_10161143 | 386 |
| 230 | 3300025893 | Ga0207682_10003431 | Ga0207682_100034312 | 386 |
| 231 | 3300025903 | Ga0207680_10023407 | Ga0207680_100234072 | 386 |
| 232 | 3300025923 | Ga0207681_10027788 | Ga0207681_100277882 | 386 |
| 233 | 3300025925 | Ga0207650_10000315 | Ga0207650_1000031536 | 386 |
| 234 | 3300025931 | Ga0207644_10000679 | Ga0207644_100006793 | 386 |
| 235 | 3300025940 | Ga0207691_10014107 | Ga0207691_100141075 | 386 |
| 236 | 3300025941 | Ga0207711_10001341 | Ga0207711_1000134128 | 386 |
| 237 | 3300025941 | Ga0207711_10002092 | Ga0207711_100020925 | 386 |
| 238 | 3300025941 | Ga0207711_10022190 | Ga0207711_100221902 | 386 |
| 239 | 3300025961 | Ga0207712_10000203 | Ga0207712_1000020315 | 386 |
| 240 | 3300025961 | Ga0207712_10196656 | Ga0207712_101966562 | 386 |
| 241 | 3300025972 | Ga0207668_10000007 | Ga0207668_10000007160 | 386 |
| 242 | 3300025972 | Ga0207668_10000427 | Ga0207668_1000042715 | 386 |
| 243 | 3300025972 | Ga0207668_10002487 | Ga0207668_100024879 | 386 |
| 244 | 3300025986 | Ga0207658_10001368 | Ga0207658_1000136810 | 386 |
| 245 | 3300025986 | Ga0207658_10001403 | Ga0207658_100014038 | 386 |
| 246 | 3300026035 | Ga0207703_10000105 | Ga0207703_100001054 | 386 |
| 247 | 3300026035 | Ga0207703_10003669 | Ga0207703_100036698 | 386 |
| 248 | 3300026035 | Ga0207703_10011130 | Ga0207703_100111302 | 386 |
| 249 | 3300026088 | Ga0207641_10000109 | Ga0207641_10000109112 | 386 |
| 250 | 3300026088 | Ga0207641_10002034 | Ga0207641_1000203410 | 386 |
| 251 | 3300026088 | Ga0207641_10030198 | Ga0207641_100301983 | 386 |
| 252 | 3300026095 | Ga0207676_10000159 | Ga0207676_1000015948 | 386 |
| 253 | 3300026095 | Ga0207676_10001888 | Ga0207676_100018888 | 386 |
| 254 | 3300026121 | Ga0207683_10008376 | Ga0207683_100083765 | 386 |
| 255 | 3300028379 | Ga0268266_10001260 | Ga0268266_100012606 | 386 |
| 256 | 3300028379 | Ga0268266_10006212 | Ga0268266_100062122 | 386 |
| 257 | 3300028380 | Ga0268265_10002154 | Ga0268265_100021542 | 386 |
| 258 | 3300028380 | Ga0268265_10010280 | Ga0268265_100102803 | 386 |
| 259 | 3300028381 | Ga0268264_10000270 | Ga0268264_1000027040 | 386 |
| 260 | 3300028381 | Ga0268264_10009573 | Ga0268264_100095733 | 386 |
| 261 | 3300031456 | Ga0307513_10007717 | Ga0307513_100077177 | 386 |
| 262 | 3300036401 | Ga0373937_0146539 | Ga0373937_0146539_569_1813 | 386 |
| 263 | 3300039450 | Ga0436363_0514829 | Ga0436363_0514829_165_1397 | 386 |
| 264 | 3300046459 | Ga0495629_0038576 | Ga0495629_0038576_328_1509 | 386 |
| 265 | 3300046515 | Ga0495620_0009408 | Ga0495620_0009408_3547_4728 | 386 |
| 266 | 3300046522 | Ga0495643_0040613 | Ga0495643_0040613_1220_2401 | 386 |
| 267 | 3300046528 | Ga0495642_0003816 | Ga0495642_0003816_494_1681 | 386 |
| 268 | 3300046542 | Ga0495597_0010529 | Ga0495597_0010529_1462_2643 | 386 |
| 269 | 3300046616 | Ga0495668_0000040 | Ga0495668_0000040_183429_184610 | 386 |
| 270 | 3300046616 | Ga0495668_0001804 | Ga0495668_0001804_2562_3743 | 386 |
| 271 | 3300046648 | Ga0495611_0007116 | Ga0495611_0007116_813_2000 | 386 |
| 272 | 3300046660 | Ga0495625_0042371 | Ga0495625_0042371_121_1302 | 386 |
| 273 | 3300046689 | Ga0495613_0129630 | Ga0495613_0129630_520_1719 | 386 |
| 274 | 3300047320 | Ga0495672_0027507 | Ga0495672_0027507_581_1768 | 386 |
| 275 | 3300047443 | Ga0495687_020767 | Ga0495687_020767_196_1377 | 386 |
| 276 | 3300047472 | Ga0495686_0002348 | Ga0495686_0002348_14565_15746 | 386 |
| 277 | 3300047472 | Ga0495686_0077292 | Ga0495686_0077292_695_1876 | 386 |
| 278 | 3300047673 | Ga0495593_0068247 | Ga0495593_0068247_201_1382 | 386 |
| 279 | 3300048903 | Ga0496100_0124502 | Ga0496100_0124502_173_1360 | 386 |
| 280 | 3300048911 | Ga0496108_0241207 | Ga0496108_0241207_196_1383 | 386 |
| 281 | 3300048918 | Ga0496115_0315072 | Ga0496115_0315072_49_1269 | 386 |
| 282 | 3300048921 | Ga0496118_0070650 | Ga0496118_0070650_145_1344 | 386 |
| 283 | 3300048922 | Ga0496119_0034571 | Ga0496119_0034571_663_1862 | 386 |
| 284 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_495526_496725 | 386 |
| 285 | 3300048927 | Ga0496124_0024037 | Ga0496124_0024037_2335_3516 | 386 |
| 286 | 3300050491 | nmdc:mga00v17_393_c1 | nmdc:mga00v17_393_c1_86_1267 | 386 |
| 287 | 3300050493 | nmdc:mga0k408_23263_c1 | nmdc:mga0k408_23263_c1_1890_3071 | 386 |
| 288 | 3300050511 | nmdc:mga08y16_179940_c1 | nmdc:mga08y16_179940_c1_338_1612 | 386 |
| 289 | 3300050516 | nmdc:mga0sz30_1132_c1 | nmdc:mga0sz30_1132_c1_332_1513 | 386 |
| 290 | 3300053080 | Ga0500635_0000052 | Ga0500635_0000052_38278_39459 | 386 |
| 291 | 3300053087 | Ga0500643_010631 | Ga0500643_010631_1461_2657 | 386 |
| 292 | 3300053094 | Ga0500566_0006891 | Ga0500566_0006891_51_1250 | 386 |
| 293 | 3300053108 | Ga0500562_000213 | Ga0500562_000213_5577_6758 | 386 |
| 294 | 3300053109 | Ga0500569_002082 | Ga0500569_002082_2198_3379 | 386 |
| 295 | 3300053119 | Ga0500595_000667 | Ga0500595_000667_3437_4618 | 386 |
| 296 | 3300053122 | Ga0500608_000105 | Ga0500608_000105_112_1293 | 386 |
| 297 | 3300053122 | Ga0500608_011759 | Ga0500608_011759_2238_3419 | 386 |
| 298 | 3300053123 | Ga0500614_002523 | Ga0500614_002523_710_1891 | 386 |
| 299 | 3300053154 | Ga0500619_031333 | Ga0500619_031333_138_1319 | 386 |
| 300 | 3300053735 | Ga0500596_007021 | Ga0500596_007021_512_1693 | 386 |
| 301 | 3300060353 | Ga0501082_0220088 | Ga0501082_0220088_81_1286 | 386 |
| 302 | iso_pu_bacteria | 2643221583 | 2643926952 | 386 |
| 303 | 3300001989 | JGI24739J22299_10010844 | JGI24739J22299_100108444 | 387 |
| 304 | 3300003215 | JGI25153J46596_10019572 | JGI25153J46596_100195721 | 387 |
| 305 | 3300005539 | Ga0068853_100115687 | Ga0068853_1001156871 | 387 |
| 306 | 3300005546 | Ga0070696_100013231 | Ga0070696_1000132316 | 387 |
| 307 | 3300005549 | Ga0070704_100002436 | Ga0070704_1000024367 | 387 |
| 308 | 3300006038 | Ga0075365_10042899 | Ga0075365_100428992 | 387 |
| 309 | 3300006177 | Ga0075362_10034628 | Ga0075362_100346282 | 387 |
| 310 | 3300006178 | Ga0075367_10002060 | Ga0075367_100020601 | 387 |
| 311 | 3300009545 | Ga0105237_10002777 | Ga0105237_100027779 | 387 |
| 312 | 3300010375 | Ga0105239_10003114 | Ga0105239_100031149 | 387 |
| 313 | 3300010375 | Ga0105239_10012735 | Ga0105239_100127356 | 387 |
| 314 | 3300025297 | Ga0209758_1011627 | Ga0209758_10116273 | 387 |
| 315 | 3300025304 | Ga0209257_1000352 | Ga0209257_100035286 | 387 |
| 316 | 3300025904 | Ga0207647_10001677 | Ga0207647_1000167722 | 387 |
| 317 | 3300025914 | Ga0207671_10002149 | Ga0207671_1000214912 | 387 |
| 318 | 3300028786 | Ga0307517_10018527 | Ga0307517_100185279 | 387 |
| 319 | 3300028794 | Ga0307515_10155748 | Ga0307515_101557483 | 387 |
| 320 | 3300029957 | Ga0265324_10001398 | Ga0265324_100013989 | 387 |
| 321 | 3300031250 | Ga0265331_10000162 | Ga0265331_1000016216 | 387 |
| 322 | 3300037068 | Ga0373925_0151637 | Ga0373925_0151637_14_1258 | 387 |
| 323 | 3300037312 | Ga0395899_0008589 | Ga0395899_0008589_2589_3935 | 387 |
| 324 | 3300037418 | Ga0395900_0004161 | Ga0395900_0004161_8152_9498 | 387 |
| 325 | 3300038443 | Ga0395901_0007828 | Ga0395901_0007828_5530_6876 | 387 |
| 326 | 3300042156 | Ga0439446_0021669 | Ga0439446_0021669_193_1377 | 387 |
| 327 | 3300046460 | Ga0495638_0000230 | Ga0495638_0000230_38958_40142 | 387 |
| 328 | 3300046460 | Ga0495638_0021896 | Ga0495638_0021896_238_1422 | 387 |
| 329 | 3300046471 | Ga0495650_0000207 | Ga0495650_0000207_86415_87599 | 387 |
| 330 | 3300046515 | Ga0495620_0042212 | Ga0495620_0042212_738_1922 | 387 |
| 331 | 3300046520 | Ga0495637_0022075 | Ga0495637_0022075_642_1826 | 387 |
| 332 | 3300046530 | Ga0495654_0000016 | Ga0495654_0000016_219776_220960 | 387 |
| 333 | 3300046660 | Ga0495625_0000043 | Ga0495625_0000043_9287_10471 | 387 |
| 334 | 3300046660 | Ga0495625_0002055 | Ga0495625_0002055_3207_4391 | 387 |
| 335 | 3300046660 | Ga0495625_0014285 | Ga0495625_0014285_202_1386 | 387 |
| 336 | 3300046660 | Ga0495625_0056351 | Ga0495625_0056351_291_1475 | 387 |
| 337 | 3300047470 | Ga0495681_0031256 | Ga0495681_0031256_329_1513 | 387 |
| 338 | 3300047470 | Ga0495681_0064193 | Ga0495681_0064193_424_1608 | 387 |
| 339 | 3300048905 | Ga0496102_0000575 | Ga0496102_0000575_13922_15154 | 387 |
| 340 | 3300048906 | Ga0496103_0018338 | Ga0496103_0018338_1954_3186 | 387 |
| 341 | 3300048919 | Ga0496116_0002427 | Ga0496116_0002427_10530_11762 | 387 |
| 342 | 3300048920 | Ga0496117_0002946 | Ga0496117_0002946_5429_6661 | 387 |
| 343 | 3300048921 | Ga0496118_0003282 | Ga0496118_0003282_5428_6660 | 387 |
| 344 | 3300048922 | Ga0496119_0002396 | Ga0496119_0002396_5429_6661 | 387 |
| 345 | 3300048923 | Ga0496120_0002204 | Ga0496120_0002204_5429_6661 | 387 |
| 346 | 3300048924 | Ga0496121_0003931 | Ga0496121_0003931_5429_6661 | 387 |
| 347 | 3300048927 | Ga0496124_0003112 | Ga0496124_0003112_13922_15154 | 387 |
| 348 | 3300049742 | Ga0501080_0036930 | Ga0501080_0036930_1816_3042 | 387 |
| 349 | 3300049744 | Ga0501083_0045421 | Ga0501083_0045421_1261_2487 | 387 |
| 350 | 3300049823 | Ga0501044_0000453 | Ga0501044_0000453_8253_9551 | 387 |
| 351 | 3300049823 | Ga0501044_0269483 | Ga0501044_0269483_55_1263 | 387 |
| 352 | 3300053104 | Ga0500556_0003699 | Ga0500556_0003699_1240_2424 | 387 |
| 353 | 3300053136 | Ga0500559_0025855 | Ga0500559_0025855_326_1510 | 387 |
| 354 | 3300053730 | Ga0500645_000893 | Ga0500645_000893_13306_14490 | 387 |
| 355 | 3300053731 | Ga0500609_002360 | Ga0500609_002360_140_1324 | 387 |
| 356 | iso_pu_bacteria | 2510917020 | 2511122314 | 387 |
| 357 | iso_pu_bacteria | 2582581280 | 2585154548 | 387 |
| 358 | iso_pu_bacteria | 2582581293 | 2585198563 | 387 |
| 359 | iso_pu_bacteria | 2684623219 | 2687240501 | 387 |
| 360 | iso_pu_bacteria | 2844533157 | 2844539046 | 387 |
| 361 | 3300003773 | Ga0055537_1001474 | Ga0055537_10014746 | 388 |
| 362 | 3300003775 | Ga0055524_1003107 | Ga0055524_10031076 | 388 |
| 363 | 3300003775 | Ga0055524_1006095 | Ga0055524_10060955 | 388 |
| 364 | 3300005262 | Ga0065165_1001692 | Ga0065165_100169213 | 388 |
| 365 | 3300005347 | Ga0070668_100011336 | Ga0070668_1000113362 | 388 |
| 366 | 3300005455 | Ga0070663_100199956 | Ga0070663_1001999561 | 388 |
| 367 | 3300005468 | Ga0070707_100087168 | Ga0070707_1000871681 | 388 |
| 368 | 3300005518 | Ga0070699_100137617 | Ga0070699_1001376172 | 388 |
| 369 | 3300009148 | Ga0105243_10055150 | Ga0105243_100551503 | 388 |
| 370 | 3300021361 | Ga0213872_10016262 | Ga0213872_100162622 | 388 |
| 371 | 3300025263 | Ga0209565_1000183 | Ga0209565_10001835 | 388 |
| 372 | 3300025273 | Ga0209673_1001029 | Ga0209673_100102922 | 388 |
| 373 | 3300025291 | Ga0209675_1015088 | Ga0209675_10150882 | 388 |
| 374 | 3300025297 | Ga0209758_1001837 | Ga0209758_10018374 | 388 |
| 375 | 3300025299 | Ga0209256_1000694 | Ga0209256_100069411 | 388 |
| 376 | 3300025299 | Ga0209256_1015406 | Ga0209256_10154062 | 388 |
| 377 | 3300025907 | Ga0207645_10049491 | Ga0207645_100494912 | 388 |
| 378 | 3300025922 | Ga0207646_10020030 | Ga0207646_100200304 | 388 |
| 379 | 3300025972 | Ga0207668_10065961 | Ga0207668_100659612 | 388 |
| 380 | 3300033180 | Ga0307510_10002995 | Ga0307510_100029952 | 388 |
| 381 | 3300035398 | Ga0316574_0056685 | Ga0316574_0056685_235_1461 | 388 |
| 382 | 3300039447 | Ga0436361_0409735 | Ga0436361_0409735_2892_4109 | 388 |
| 383 | 3300046453 | Ga0495627_000654 | Ga0495627_000654_2215_3402 | 388 |
| 384 | 3300046460 | Ga0495638_0037556 | Ga0495638_0037556_596_1783 | 388 |
| 385 | 3300046501 | Ga0495607_0033225 | Ga0495607_0033225_1471_2658 | 388 |
| 386 | 3300046507 | Ga0495606_0016964 | Ga0495606_0016964_1028_2227 | 388 |
| 387 | 3300046512 | Ga0495610_0000794 | Ga0495610_0000794_21208_22395 | 388 |
| 388 | 3300046512 | Ga0495610_0003341 | Ga0495610_0003341_5729_6916 | 388 |
| 389 | 3300046513 | Ga0495616_0037938 | Ga0495616_0037938_481_1668 | 388 |
| 390 | 3300046616 | Ga0495668_0002079 | Ga0495668_0002079_5364_6551 | 388 |
| 391 | 3300046616 | Ga0495668_0035955 | Ga0495668_0035955_1148_2335 | 388 |
| 392 | 3300046660 | Ga0495625_0008772 | Ga0495625_0008772_2321_3508 | 388 |
| 393 | 3300047320 | Ga0495672_0001651 | Ga0495672_0001651_14460_15647 | 388 |
| 394 | 3300047446 | Ga0495679_001492 | Ga0495679_001492_1331_2518 | 388 |
| 395 | 3300047469 | Ga0495673_0004053 | Ga0495673_0004053_5712_6899 | 388 |
| 396 | 3300047472 | Ga0495686_0024572 | Ga0495686_0024572_1098_2297 | 388 |
| 397 | 3300047472 | Ga0495686_0031218 | Ga0495686_0031218_628_1815 | 388 |
| 398 | 3300048920 | Ga0496117_0047413 | Ga0496117_0047413_529_1749 | 388 |
| 399 | 3300048925 | Ga0496122_0036836 | Ga0496122_0036836_968_2185 | 388 |
| 400 | 3300048926 | Ga0496123_0081718 | Ga0496123_0081718_443_1660 | 388 |
| 401 | 3300053123 | Ga0500614_006378 | Ga0500614_006378_719_1906 | 388 |
| 402 | 3300053125 | Ga0500618_000022 | Ga0500618_000022_6671_7858 | 388 |
| 403 | 3300053134 | Ga0500658_0009137 | Ga0500658_0009137_1931_3118 | 388 |
| 404 | 3300053136 | Ga0500559_0000054 | Ga0500559_0000054_40679_41866 | 388 |
| 405 | 3300053156 | Ga0500622_0006217 | Ga0500622_0006217_2223_3410 | 388 |
| 406 | 3300003781 | Ga0055536_1005608 | Ga0055536_10056083 | 389 |
| 407 | 3300005262 | Ga0065165_1019889 | Ga0065165_10198891 | 389 |
| 408 | 3300009147 | Ga0114129_10301951 | Ga0114129_103019512 | 389 |
| 409 | 3300013307 | Ga0157372_10069791 | Ga0157372_100697912 | 389 |
| 410 | 3300021388 | Ga0213875_10000451 | Ga0213875_1000045114 | 389 |
| 411 | 3300025292 | Ga0209676_1000284 | Ga0209676_100028412 | 389 |
| 412 | 3300025298 | Ga0209050_1011818 | Ga0209050_10118184 | 389 |
| 413 | 3300028794 | Ga0307515_10040608 | Ga0307515_100406083 | 389 |
| 414 | 3300030521 | Ga0307511_10015070 | Ga0307511_100150703 | 389 |
| 415 | 3300031456 | Ga0307513_10000063 | Ga0307513_1000006372 | 389 |
| 416 | 3300031456 | Ga0307513_10115642 | Ga0307513_101156422 | 389 |
| 417 | 3300035691 | Ga0373931_0074602 | Ga0373931_0074602_601_1821 | 389 |
| 418 | 3300037853 | Ga0436364_0810561 | Ga0436364_0810561_9965_11203 | 389 |
| 419 | 3300038443 | Ga0395901_0169614 | Ga0395901_0169614_811_2049 | 389 |
| 420 | 3300039438 | Ga0436360_0998447 | Ga0436360_0998447_612_1829 | 389 |
| 421 | 3300039447 | Ga0436361_0574409 | Ga0436361_0574409_649_1866 | 389 |
| 422 | 3300046506 | Ga0495583_0000025 | Ga0495583_0000025_251297_252487 | 389 |
| 423 | 3300048918 | Ga0496115_0002259 | Ga0496115_0002259_8084_9274 | 389 |
| 424 | 3300049568 | Ga0501031_0052216 | Ga0501031_0052216_525_1811 | 389 |
| 425 | 3300049569 | Ga0501032_0013530 | Ga0501032_0013530_915_2201 | 389 |
| 426 | 3300049571 | Ga0501034_0070227 | Ga0501034_0070227_489_1733 | 389 |
| 427 | 3300049573 | Ga0501037_0059306 | Ga0501037_0059306_819_2105 | 389 |
| 428 | 3300049579 | Ga0501043_0016044 | Ga0501043_0016044_3668_4954 | 389 |
| 429 | 3300049581 | Ga0501047_0072931 | Ga0501047_0072931_571_1815 | 389 |
| 430 | 3300049583 | Ga0501067_0019975 | Ga0501067_0019975_2342_3586 | 389 |
| 431 | 3300049586 | Ga0501070_0025713 | Ga0501070_0025713_2490_3734 | 389 |
| 432 | 3300049588 | Ga0501072_0026730 | Ga0501072_0026730_1123_2367 | 389 |
| 433 | 3300049589 | Ga0501073_0088314 | Ga0501073_0088314_190_1434 | 389 |
| 434 | 3300049741 | Ga0501079_0215911 | Ga0501079_0215911_47_1291 | 389 |
| 435 | 3300049823 | Ga0501044_0027392 | Ga0501044_0027392_3440_4726 | 389 |
| 436 | 3300049823 | Ga0501044_0042745 | Ga0501044_0042745_2688_3932 | 389 |
| 437 | 3300053103 | Ga0500555_010770 | Ga0500555_010770_1112_2326 | 389 |
| 438 | 3300053148 | Ga0500590_000472 | Ga0500590_000472_6824_8050 | 389 |
| 439 | 3300003791 | Ga0055530_10000337 | Ga0055530_1000033752 | 390 |
| 440 | 3300003794 | Ga0055531_10001142 | Ga0055531_1000114227 | 390 |
| 441 | 3300005262 | Ga0065165_1000171 | Ga0065165_10001714 | 390 |
| 442 | 3300009551 | Ga0105238_10051165 | Ga0105238_100511653 | 390 |
| 443 | 3300025250 | Ga0209026_1001299 | Ga0209026_10012997 | 390 |
| 444 | 3300025297 | Ga0209758_1005157 | Ga0209758_100515711 | 390 |
| 445 | 3300025298 | Ga0209050_1000095 | Ga0209050_1000095238 | 390 |
| 446 | 3300025304 | Ga0209257_1000106 | Ga0209257_100010615 | 390 |
| 447 | 3300025911 | Ga0207654_10032342 | Ga0207654_100323423 | 390 |
| 448 | 3300031595 | Ga0265313_10000839 | Ga0265313_1000083922 | 390 |
| 449 | 3300046460 | Ga0495638_0025076 | Ga0495638_0025076_2587_3780 | 390 |
| 450 | 3300046460 | Ga0495638_0116647 | Ga0495638_0116647_33_1226 | 390 |
| 451 | 3300046513 | Ga0495616_0001257 | Ga0495616_0001257_1237_2433 | 390 |
| 452 | 3300046519 | Ga0495632_0000545 | Ga0495632_0000545_16949_18145 | 390 |
| 453 | 3300046530 | Ga0495654_0050754 | Ga0495654_0050754_26_1222 | 390 |
| 454 | 3300046616 | Ga0495668_0077410 | Ga0495668_0077410_525_1739 | 390 |
| 455 | 3300046794 | Ga0495589_0000982 | Ga0495589_0000982_2299_3492 | 390 |
| 456 | 3300047472 | Ga0495686_0005443 | Ga0495686_0005443_7843_9057 | 390 |
| 457 | 3300002987 | JGI25159J45721_1015584 | JGI25159J45721_10155842 | 391 |
| 458 | 3300003187 | JGI25151J46595_10000268 | JGI25151J46595_1000026831 | 391 |
| 459 | 3300003354 | JGI25160J50197_1009821 | JGI25160J50197_10098212 | 391 |
| 460 | 3300005336 | Ga0070680_100016723 | Ga0070680_1000167232 | 391 |
| 461 | 3300005336 | Ga0070680_100026049 | Ga0070680_1000260492 | 391 |
| 462 | 3300005458 | Ga0070681_10058541 | Ga0070681_100585414 | 391 |
| 463 | 3300005530 | Ga0070679_100058571 | Ga0070679_1000585714 | 391 |
| 464 | 3300009986 | Ga0105033_100251 | Ga0105033_1002513 | 391 |
| 465 | 3300013104 | Ga0157370_10011034 | Ga0157370_100110348 | 391 |
| 466 | 3300021388 | Ga0213875_10000936 | Ga0213875_100009363 | 391 |
| 467 | 3300025284 | Ga0209130_1004232 | Ga0209130_10042325 | 391 |
| 468 | 3300025294 | Ga0209025_1000146 | Ga0209025_1000146113 | 391 |
| 469 | 3300025297 | Ga0209758_1002076 | Ga0209758_100207611 | 391 |
| 470 | 3300025302 | Ga0207426_1000046 | Ga0207426_1000046274 | 391 |
| 471 | 3300025912 | Ga0207707_10006168 | Ga0207707_100061682 | 391 |
| 472 | 3300025917 | Ga0207660_10034296 | Ga0207660_100342964 | 391 |
| 473 | 3300025917 | Ga0207660_10047791 | Ga0207660_100477912 | 391 |
| 474 | 3300025921 | Ga0207652_10008514 | Ga0207652_100085144 | 391 |
| 475 | 3300025921 | Ga0207652_10018920 | Ga0207652_100189204 | 391 |
| 476 | 3300028800 | Ga0265338_10026563 | Ga0265338_100265632 | 391 |
| 477 | 3300037853 | Ga0436364_0992577 | Ga0436364_0992577_17501_18721 | 391 |
| 478 | 3300046512 | Ga0495610_0003243 | Ga0495610_0003243_8057_9301 | 391 |
| 479 | iso_pu_bacteria | 2643221733 | 2644728094 | 391 |
| 480 | iso_pu_bacteria | 2643221734 | 2644733876 | 391 |
| 481 | iso_pu_bacteria | 2883291878 | 2883293459 | 391 |
| 482 | iso_pu_bacteria | 2883354860 | 2883357960 | 391 |
| 483 | iso_pu_bacteria | 2917699015 | 2917701650 | 391 |
| 484 | 3300003187 | JGI25151J46595_10000018 | JGI25151J46595_10000018111 | 392 |
| 485 | 3300003320 | rootH2_10104849 | rootH2_101048492 | 392 |
| 486 | 3300003771 | Ga0055526_1002567 | Ga0055526_10025676 | 392 |
| 487 | 3300003775 | Ga0055524_1000048 | Ga0055524_100004819 | 392 |
| 488 | 3300003775 | Ga0055524_1006307 | Ga0055524_10063074 | 392 |
| 489 | 3300005347 | Ga0070668_100006149 | Ga0070668_1000061493 | 392 |
| 490 | 3300005471 | Ga0070698_100249573 | Ga0070698_1002495731 | 392 |
| 491 | 3300005530 | Ga0070679_100145365 | Ga0070679_1001453652 | 392 |
| 492 | 3300005617 | Ga0068859_100468035 | Ga0068859_1004680352 | 392 |
| 493 | 3300005843 | Ga0068860_100000051 | Ga0068860_10000005133 | 392 |
| 494 | 3300005844 | Ga0068862_100018741 | Ga0068862_1000187412 | 392 |
| 495 | 3300006042 | Ga0075368_10074008 | Ga0075368_100740081 | 392 |
| 496 | 3300006051 | Ga0075364_10047139 | Ga0075364_100471392 | 392 |
| 497 | 3300006186 | Ga0075369_10027042 | Ga0075369_100270422 | 392 |
| 498 | 3300006914 | Ga0075436_100033782 | Ga0075436_1000337822 | 392 |
| 499 | 3300006931 | Ga0097620_100467967 | Ga0097620_1004679672 | 392 |
| 500 | 3300013250 | Ga0171462_1009 | Ga0171462_100913 | 392 |
| 501 | 3300013308 | Ga0157375_10549956 | Ga0157375_105499561 | 392 |
| 502 | 3300025273 | Ga0209673_1006747 | Ga0209673_10067475 | 392 |
| 503 | 3300025291 | Ga0209675_1000239 | Ga0209675_100023947 | 392 |
| 504 | 3300025294 | Ga0209025_1000010 | Ga0209025_1000010119 | 392 |
| 505 | 3300025294 | Ga0209025_1020824 | Ga0209025_10208242 | 392 |
| 506 | 3300025295 | Ga0209564_1000034 | Ga0209564_1000034286 | 392 |
| 507 | 3300025299 | Ga0209256_1000026 | Ga0209256_1000026274 | 392 |
| 508 | 3300025299 | Ga0209256_1000182 | Ga0209256_100018267 | 392 |
| 509 | 3300025921 | Ga0207652_10132720 | Ga0207652_101327202 | 392 |
| 510 | 3300025972 | Ga0207668_10032299 | Ga0207668_100322993 | 392 |
| 511 | 3300025972 | Ga0207668_10101201 | Ga0207668_101012012 | 392 |
| 512 | 3300026116 | Ga0207674_10016891 | Ga0207674_1001689110 | 392 |
| 513 | 3300028380 | Ga0268265_10002114 | Ga0268265_100021142 | 392 |
| 514 | 3300028381 | Ga0268264_10000021 | Ga0268264_10000021405 | 392 |
| 515 | 3300028800 | Ga0265338_10004430 | Ga0265338_100044305 | 392 |
| 516 | 3300031247 | Ga0265340_10024189 | Ga0265340_100241892 | 392 |
| 517 | 3300037068 | Ga0373925_0250306 | Ga0373925_0250306_97_1329 | 392 |
| 518 | 3300037471 | Ga0395905_0000174 | Ga0395905_0000174_68866_70101 | 392 |
| 519 | 3300045976 | Ga0466967_0053041 | Ga0466967_0053041_851_2098 | 392 |
| 520 | 3300048909 | Ga0496106_0007733 | Ga0496106_0007733_5944_7155 | 392 |
| 521 | 3300048910 | Ga0496107_0000029 | Ga0496107_0000029_16229_17440 | 392 |
| 522 | 3300048924 | Ga0496121_0002142 | Ga0496121_0002142_21060_22271 | 392 |
| 523 | 3300048926 | Ga0496123_0016176 | Ga0496123_0016176_722_2065 | 392 |
| 524 | 3300048928 | Ga0496125_0029758 | Ga0496125_0029758_817_2043 | 392 |
| 525 | 3300048929 | Ga0496126_0167025 | Ga0496126_0167025_68_1294 | 392 |
| 526 | 3300049571 | Ga0501034_0293009 | Ga0501034_0293009_184_1527 | 392 |
| 527 | 3300049581 | Ga0501047_0073199 | Ga0501047_0073199_1147_2361 | 392 |
| 528 | 3300050514 | nmdc:mga08x19_46408_c1 | nmdc:mga08x19_46408_c1_736_1968 | 392 |
| 529 | 3300053177 | Ga0500636_0057228 | Ga0500636_0057228_71_1345 | 392 |
| 530 | iso_pu_bacteria | 2818991467 | 2819716836 | 392 |
| 531 | iso_pu_bacteria | 8024486573 | 8024488943 | 392 |
| 532 | 3300005329 | Ga0070683_100092955 | Ga0070683_1000929553 | 393 |
| 533 | 3300005329 | Ga0070683_100173143 | Ga0070683_1001731432 | 393 |
| 534 | 3300005539 | Ga0068853_100051683 | Ga0068853_1000516832 | 393 |
| 535 | 3300005563 | Ga0068855_100000267 | Ga0068855_10000026712 | 393 |
| 536 | 3300005577 | Ga0068857_100074831 | Ga0068857_1000748312 | 393 |
| 537 | 3300005616 | Ga0068852_100119430 | Ga0068852_1001194302 | 393 |
| 538 | 3300005843 | Ga0068860_100038489 | Ga0068860_1000384892 | 393 |
| 539 | 3300006844 | Ga0075428_100111725 | Ga0075428_1001117252 | 393 |
| 540 | 3300006846 | Ga0075430_100164948 | Ga0075430_1001649482 | 393 |
| 541 | 3300006880 | Ga0075429_100051899 | Ga0075429_1000518992 | 393 |
| 542 | 3300006914 | Ga0075436_100098073 | Ga0075436_1000980732 | 393 |
| 543 | 3300009093 | Ga0105240_10001197 | Ga0105240_1000119728 | 393 |
| 544 | 3300009093 | Ga0105240_10141508 | Ga0105240_101415082 | 393 |
| 545 | 3300009094 | Ga0111539_10000041 | Ga0111539_1000004183 | 393 |
| 546 | 3300009094 | Ga0111539_10005028 | Ga0111539_100050286 | 393 |
| 547 | 3300009098 | Ga0105245_10156045 | Ga0105245_101560452 | 393 |
| 548 | 3300009101 | Ga0105247_10031668 | Ga0105247_100316682 | 393 |
| 549 | 3300009147 | Ga0114129_10168313 | Ga0114129_101683132 | 393 |
| 550 | 3300009177 | Ga0105248_10162713 | Ga0105248_101627132 | 393 |
| 551 | 3300009177 | Ga0105248_10177416 | Ga0105248_101774163 | 393 |
| 552 | 3300009177 | Ga0105248_10345857 | Ga0105248_103458572 | 393 |
| 553 | 3300009551 | Ga0105238_10003746 | Ga0105238_100037468 | 393 |
| 554 | 3300010375 | Ga0105239_10001954 | Ga0105239_1000195410 | 393 |
| 555 | 3300013105 | Ga0157369_10020792 | Ga0157369_100207926 | 393 |
| 556 | 3300013297 | Ga0157378_10046086 | Ga0157378_100460863 | 393 |
| 557 | 3300014325 | Ga0163163_10038387 | Ga0163163_100383874 | 393 |
| 558 | 3300014968 | Ga0157379_10066237 | Ga0157379_100662372 | 393 |
| 559 | 3300025900 | Ga0207710_10012358 | Ga0207710_100123583 | 393 |
| 560 | 3300025913 | Ga0207695_10000012 | Ga0207695_10000012716 | 393 |
| 561 | 3300025913 | Ga0207695_10279054 | Ga0207695_102790541 | 393 |
| 562 | 3300025924 | Ga0207694_10000156 | Ga0207694_1000015636 | 393 |
| 563 | 3300025924 | Ga0207694_10169746 | Ga0207694_101697462 | 393 |
| 564 | 3300025927 | Ga0207687_10191253 | Ga0207687_101912531 | 393 |
| 565 | 3300025949 | Ga0207667_10000068 | Ga0207667_1000006842 | 393 |
| 566 | 3300025972 | Ga0207668_10027033 | Ga0207668_100270334 | 393 |
| 567 | 3300026041 | Ga0207639_10020905 | Ga0207639_100209053 | 393 |
| 568 | 3300026067 | Ga0207678_10132688 | Ga0207678_101326882 | 393 |
| 569 | 3300026116 | Ga0207674_10083288 | Ga0207674_100832883 | 393 |
| 570 | 3300026142 | Ga0207698_10028109 | Ga0207698_100281094 | 393 |
| 571 | 3300026142 | Ga0207698_10159691 | Ga0207698_101596912 | 393 |
| 572 | 3300027907 | Ga0207428_10001809 | Ga0207428_1000180918 | 393 |
| 573 | 3300031250 | Ga0265331_10063233 | Ga0265331_100632332 | 393 |
| 574 | 3300031251 | Ga0265327_10039006 | Ga0265327_100390061 | 393 |
| 575 | 3300031456 | Ga0307513_10009979 | Ga0307513_100099799 | 393 |
| 576 | 3300035113 | Ga0373936_0022443 | Ga0373936_0022443_630_1865 | 393 |
| 577 | 3300035725 | Ga0373947_0068438 | Ga0373947_0068438_196_1461 | 393 |
| 578 | 3300036401 | Ga0373937_0025405 | Ga0373937_0025405_1315_2580 | 393 |
| 579 | 3300037068 | Ga0373925_0106217 | Ga0373925_0106217_673_1938 | 393 |
| 580 | 3300037418 | Ga0395900_0377084 | Ga0395900_0377084_80_1321 | 393 |
| 581 | 3300037853 | Ga0436364_0179869 | Ga0436364_0179869_223_1446 | 393 |
| 582 | 3300038443 | Ga0395901_0001835 | Ga0395901_0001835_11645_12883 | 393 |
| 583 | 3300044694 | Ga0466963_0067164 | Ga0466963_0067164_1133_2368 | 393 |
| 584 | 3300046519 | Ga0495632_0000380 | Ga0495632_0000380_7606_8829 | 393 |
| 585 | 3300046616 | Ga0495668_0012223 | Ga0495668_0012223_1022_2245 | 393 |
| 586 | 3300047320 | Ga0495672_0007502 | Ga0495672_0007502_2993_4249 | 393 |
| 587 | 3300047320 | Ga0495672_0023601 | Ga0495672_0023601_1503_2882 | 393 |
| 588 | 3300047471 | Ga0495684_0230238 | Ga0495684_0230238_51_1316 | 393 |
| 589 | 3300048907 | Ga0496104_0021209 | Ga0496104_0021209_4389_5627 | 393 |
| 590 | 3300048909 | Ga0496106_0076960 | Ga0496106_0076960_1071_2309 | 393 |
| 591 | 3300048913 | Ga0496110_0197205 | Ga0496110_0197205_431_1669 | 393 |
| 592 | 3300048915 | Ga0496112_0170214 | Ga0496112_0170214_703_1941 | 393 |
| 593 | 3300048916 | Ga0496113_0122192 | Ga0496113_0122192_526_1773 | 393 |
| 594 | 3300049460 | Ga0495682_0031217 | Ga0495682_0031217_362_1600 | 393 |
| 595 | 3300049581 | Ga0501047_0134586 | Ga0501047_0134586_136_1362 | 393 |
| 596 | 3300049586 | Ga0501070_0058955 | Ga0501070_0058955_1701_2936 | 393 |
| 597 | 3300049744 | Ga0501083_0060986 | Ga0501083_0060986_971_2206 | 393 |
| 598 | 3300050511 | nmdc:mga08y16_167771_c1 | nmdc:mga08y16_167771_c1_388_1638 | 393 |
| 599 | 3300050511 | nmdc:mga08y16_25630_c1 | nmdc:mga08y16_25630_c1_4566_5816 | 393 |
| 600 | 3300050511 | nmdc:mga08y16_279_c1 | nmdc:mga08y16_279_c1_4396_5634 | 393 |
| 601 | 3300050512 | nmdc:mga0n895_59450_c1 | nmdc:mga0n895_59450_c1_2075_3322 | 393 |
| 602 | 3300050514 | nmdc:mga08x19_193398_c1 | nmdc:mga08x19_193398_c1_108_1328 | 393 |
| 603 | 3300050515 | nmdc:mga0a205_70422_c1 | nmdc:mga0a205_70422_c1_1141_2388 | 393 |
| 604 | 3300053085 | Ga0495619_0036027 | Ga0495619_0036027_425_1663 | 393 |
| 605 | 3300053087 | Ga0500643_002829 | Ga0500643_002829_70_1323 | 393 |
| 606 | 3300053090 | Ga0500646_0029951 | Ga0500646_0029951_164_1420 | 393 |
| 607 | 3300053133 | Ga0500655_003142 | Ga0500655_003142_1270_2508 | 393 |
| 608 | 3300053178 | Ga0500637_0000212 | Ga0500637_0000212_15074_16330 | 393 |
| 609 | 3300060353 | Ga0501082_0070736 | Ga0501082_0070736_1174_2409 | 393 |
| 610 | 3300003215 | JGI25153J46596_10000062 | JGI25153J46596_1000006258 | 394 |
| 611 | 3300005327 | Ga0070658_10010617 | Ga0070658_100106177 | 394 |
| 612 | 3300005336 | Ga0070680_100000264 | Ga0070680_10000026433 | 394 |
| 613 | 3300005353 | Ga0070669_100039331 | Ga0070669_1000393312 | 394 |
| 614 | 3300005435 | Ga0070714_100033522 | Ga0070714_1000335224 | 394 |
| 615 | 3300005435 | Ga0070714_100067083 | Ga0070714_1000670832 | 394 |
| 616 | 3300005436 | Ga0070713_100010091 | Ga0070713_1000100914 | 394 |
| 617 | 3300005436 | Ga0070713_100037311 | Ga0070713_1000373112 | 394 |
| 618 | 3300005436 | Ga0070713_100075374 | Ga0070713_1000753742 | 394 |
| 619 | 3300005436 | Ga0070713_100096823 | Ga0070713_1000968232 | 394 |
| 620 | 3300005437 | Ga0070710_10006545 | Ga0070710_100065453 | 394 |
| 621 | 3300005439 | Ga0070711_100009694 | Ga0070711_1000096943 | 394 |
| 622 | 3300005439 | Ga0070711_100012222 | Ga0070711_1000122222 | 394 |
| 623 | 3300005439 | Ga0070711_100023880 | Ga0070711_1000238805 | 394 |
| 624 | 3300005439 | Ga0070711_100053079 | Ga0070711_1000530792 | 394 |
| 625 | 3300005445 | Ga0070708_100115632 | Ga0070708_1001156322 | 394 |
| 626 | 3300005457 | Ga0070662_100100099 | Ga0070662_1001000991 | 394 |
| 627 | 3300005458 | Ga0070681_10000213 | Ga0070681_1000021333 | 394 |
| 628 | 3300005458 | Ga0070681_10081643 | Ga0070681_100816432 | 394 |
| 629 | 3300005458 | Ga0070681_10098715 | Ga0070681_100987151 | 394 |
| 630 | 3300005458 | Ga0070681_10202857 | Ga0070681_102028571 | 394 |
| 631 | 3300005468 | Ga0070707_100018906 | Ga0070707_1000189065 | 394 |
| 632 | 3300005468 | Ga0070707_100161609 | Ga0070707_1001616092 | 394 |
| 633 | 3300005471 | Ga0070698_100020755 | Ga0070698_1000207551 | 394 |
| 634 | 3300005471 | Ga0070698_100049414 | Ga0070698_1000494146 | 394 |
| 635 | 3300005471 | Ga0070698_100066969 | Ga0070698_1000669693 | 394 |
| 636 | 3300005518 | Ga0070699_100044333 | Ga0070699_1000443333 | 394 |
| 637 | 3300005518 | Ga0070699_100239284 | Ga0070699_1002392842 | 394 |
| 638 | 3300005530 | Ga0070679_100001596 | Ga0070679_1000015966 | 394 |
| 639 | 3300005539 | Ga0068853_100054797 | Ga0068853_1000547972 | 394 |
| 640 | 3300005539 | Ga0068853_100261827 | Ga0068853_1002618271 | 394 |
| 641 | 3300005548 | Ga0070665_100069536 | Ga0070665_1000695362 | 394 |
| 642 | 3300005548 | Ga0070665_100096303 | Ga0070665_1000963032 | 394 |
| 643 | 3300005549 | Ga0070704_100163512 | Ga0070704_1001635121 | 394 |
| 644 | 3300005563 | Ga0068855_100001693 | Ga0068855_10000169324 | 394 |
| 645 | 3300005563 | Ga0068855_100088405 | Ga0068855_1000884052 | 394 |
| 646 | 3300005564 | Ga0070664_100187562 | Ga0070664_1001875622 | 394 |
| 647 | 3300005614 | Ga0068856_100012963 | Ga0068856_1000129636 | 394 |
| 648 | 3300005614 | Ga0068856_100030161 | Ga0068856_1000301616 | 394 |
| 649 | 3300005616 | Ga0068852_100011907 | Ga0068852_1000119072 | 394 |
| 650 | 3300005983 | Ga0081540_1019744 | Ga0081540_10197441 | 394 |
| 651 | 3300005985 | Ga0081539_10001888 | Ga0081539_1000188811 | 394 |
| 652 | 3300005985 | Ga0081539_10015621 | Ga0081539_100156214 | 394 |
| 653 | 3300006028 | Ga0070717_10000290 | Ga0070717_100002902 | 394 |
| 654 | 3300006028 | Ga0070717_10017976 | Ga0070717_100179765 | 394 |
| 655 | 3300006038 | Ga0075365_10026026 | Ga0075365_100260262 | 394 |
| 656 | 3300006175 | Ga0070712_100002544 | Ga0070712_1000025443 | 394 |
| 657 | 3300006175 | Ga0070712_100074225 | Ga0070712_1000742252 | 394 |
| 658 | 3300006177 | Ga0075362_10000564 | Ga0075362_100005646 | 394 |
| 659 | 3300006177 | Ga0075362_10008081 | Ga0075362_100080811 | 394 |
| 660 | 3300006178 | Ga0075367_10014633 | Ga0075367_100146331 | 394 |
| 661 | 3300006178 | Ga0075367_10036221 | Ga0075367_100362212 | 394 |
| 662 | 3300006186 | Ga0075369_10000566 | Ga0075369_100005662 | 394 |
| 663 | 3300006186 | Ga0075369_10013908 | Ga0075369_100139082 | 394 |
| 664 | 3300006195 | Ga0075366_10004811 | Ga0075366_100048117 | 394 |
| 665 | 3300006353 | Ga0075370_10109241 | Ga0075370_101092411 | 394 |
| 666 | 3300006852 | Ga0075433_10024821 | Ga0075433_100248211 | 394 |
| 667 | 3300006871 | Ga0075434_100322164 | Ga0075434_1003221641 | 394 |
| 668 | 3300006914 | Ga0075436_100024956 | Ga0075436_1000249562 | 394 |
| 669 | 3300007788 | Ga0099795_10005208 | Ga0099795_100052083 | 394 |
| 670 | 3300007788 | Ga0099795_10059757 | Ga0099795_100597571 | 394 |
| 671 | 3300009093 | Ga0105240_10424181 | Ga0105240_104241811 | 394 |
| 672 | 3300009147 | Ga0114129_10009933 | Ga0114129_100099332 | 394 |
| 673 | 3300009551 | Ga0105238_10005330 | Ga0105238_100053306 | 394 |
| 674 | 3300010375 | Ga0105239_10102494 | Ga0105239_101024942 | 394 |
| 675 | 3300013307 | Ga0157372_10011020 | Ga0157372_100110206 | 394 |
| 676 | 3300013307 | Ga0157372_10074817 | Ga0157372_100748173 | 394 |
| 677 | 3300014497 | Ga0182008_10011892 | Ga0182008_100118923 | 394 |
| 678 | 3300021388 | Ga0213875_10000132 | Ga0213875_1000013269 | 394 |
| 679 | 3300021388 | Ga0213875_10001552 | Ga0213875_100015527 | 394 |
| 680 | 3300021441 | Ga0213871_10000041 | Ga0213871_100000414 | 394 |
| 681 | 3300025292 | Ga0209676_1008945 | Ga0209676_10089452 | 394 |
| 682 | 3300025297 | Ga0209758_1000029 | Ga0209758_1000029304 | 394 |
| 683 | 3300025297 | Ga0209758_1007713 | Ga0209758_10077135 | 394 |
| 684 | 3300025298 | Ga0209050_1005949 | Ga0209050_10059492 | 394 |
| 685 | 3300025304 | Ga0209257_1000743 | Ga0209257_100074335 | 394 |
| 686 | 3300025898 | Ga0207692_10004177 | Ga0207692_100041777 | 394 |
| 687 | 3300025898 | Ga0207692_10022843 | Ga0207692_100228433 | 394 |
| 688 | 3300025909 | Ga0207705_10006356 | Ga0207705_100063568 | 394 |
| 689 | 3300025912 | Ga0207707_10016865 | Ga0207707_100168656 | 394 |
| 690 | 3300025912 | Ga0207707_10049183 | Ga0207707_100491832 | 394 |
| 691 | 3300025912 | Ga0207707_10180922 | Ga0207707_101809222 | 394 |
| 692 | 3300025912 | Ga0207707_10199761 | Ga0207707_101997612 | 394 |
| 693 | 3300025915 | Ga0207693_10009794 | Ga0207693_100097947 | 394 |
| 694 | 3300025915 | Ga0207693_10207502 | Ga0207693_102075021 | 394 |
| 695 | 3300025916 | Ga0207663_10014871 | Ga0207663_100148712 | 394 |
| 696 | 3300025917 | Ga0207660_10003027 | Ga0207660_100030272 | 394 |
| 697 | 3300025921 | Ga0207652_10006822 | Ga0207652_1000682210 | 394 |
| 698 | 3300025921 | Ga0207652_10131431 | Ga0207652_101314312 | 394 |
| 699 | 3300025924 | Ga0207694_10040185 | Ga0207694_100401852 | 394 |
| 700 | 3300025926 | Ga0207659_10020609 | Ga0207659_100206092 | 394 |
| 701 | 3300025928 | Ga0207700_10043519 | Ga0207700_100435192 | 394 |
| 702 | 3300025928 | Ga0207700_10116473 | Ga0207700_101164731 | 394 |
| 703 | 3300025929 | Ga0207664_10102963 | Ga0207664_101029633 | 394 |
| 704 | 3300025939 | Ga0207665_10055663 | Ga0207665_100556632 | 394 |
| 705 | 3300025945 | Ga0207679_10045212 | Ga0207679_100452122 | 394 |
| 706 | 3300025949 | Ga0207667_10024236 | Ga0207667_100242366 | 394 |
| 707 | 3300026041 | Ga0207639_10064567 | Ga0207639_100645671 | 394 |
| 708 | 3300026078 | Ga0207702_10010520 | Ga0207702_100105201 | 394 |
| 709 | 3300026142 | Ga0207698_10084003 | Ga0207698_100840032 | 394 |
| 710 | 3300028379 | Ga0268266_10013295 | Ga0268266_100132955 | 394 |
| 711 | 3300028380 | Ga0268265_10003045 | Ga0268265_100030456 | 394 |
| 712 | 3300028573 | Ga0265334_10001920 | Ga0265334_100019208 | 394 |
| 713 | 3300031238 | Ga0265332_10065927 | Ga0265332_100659271 | 394 |
| 714 | 3300031251 | Ga0265327_10011785 | Ga0265327_100117856 | 394 |
| 715 | 3300031344 | Ga0265316_10086217 | Ga0265316_100862173 | 394 |
| 716 | 3300031456 | Ga0307513_10196494 | Ga0307513_101964941 | 394 |
| 717 | 3300031616 | Ga0307508_10111558 | Ga0307508_101115583 | 394 |
| 718 | 3300031995 | Ga0307409_100094808 | Ga0307409_1000948082 | 394 |
| 719 | 3300035170 | Ga0373943_0015678 | Ga0373943_0015678_2140_3384 | 394 |
| 720 | 3300035691 | Ga0373931_0036668 | Ga0373931_0036668_784_2028 | 394 |
| 721 | 3300035692 | Ga0373935_0010737 | Ga0373935_0010737_225_1469 | 394 |
| 722 | 3300035692 | Ga0373935_0030455 | Ga0373935_0030455_818_2065 | 394 |
| 723 | 3300035695 | Ga0373927_0060216 | Ga0373927_0060216_1174_2403 | 394 |
| 724 | 3300035725 | Ga0373947_0009938 | Ga0373947_0009938_2791_4035 | 394 |
| 725 | 3300035725 | Ga0373947_0090168 | Ga0373947_0090168_198_1427 | 394 |
| 726 | 3300036401 | Ga0373937_0003803 | Ga0373937_0003803_5581_6849 | 394 |
| 727 | 3300036401 | Ga0373937_0005722 | Ga0373937_0005722_9122_10363 | 394 |
| 728 | 3300036401 | Ga0373937_0008212 | Ga0373937_0008212_4219_5475 | 394 |
| 729 | 3300036401 | Ga0373937_0215721 | Ga0373937_0215721_366_1592 | 394 |
| 730 | 3300037068 | Ga0373925_0007893 | Ga0373925_0007893_4111_5355 | 394 |
| 731 | 3300037312 | Ga0395899_0002095 | Ga0395899_0002095_478_1722 | 394 |
| 732 | 3300037418 | Ga0395900_0002747 | Ga0395900_0002747_5689_6990 | 394 |
| 733 | 3300037418 | Ga0395900_0025037 | Ga0395900_0025037_1570_2814 | 394 |
| 734 | 3300037418 | Ga0395900_0059962 | Ga0395900_0059962_1766_3010 | 394 |
| 735 | 3300037466 | Ga0395898_0020728 | Ga0395898_0020728_1460_2704 | 394 |
| 736 | 3300037466 | Ga0395898_0119465 | Ga0395898_0119465_737_2038 | 394 |
| 737 | 3300037853 | Ga0436364_0717863 | Ga0436364_0717863_58298_59530 | 394 |
| 738 | 3300037853 | Ga0436364_1401862 | Ga0436364_1401862_1918_3165 | 394 |
| 739 | 3300037853 | Ga0436364_1451573 | Ga0436364_1451573_4909_6198 | 394 |
| 740 | 3300038443 | Ga0395901_0003662 | Ga0395901_0003662_12684_13928 | 394 |
| 741 | 3300039437 | Ga0436365_0578833 | Ga0436365_0578833_9487_10725 | 394 |
| 742 | 3300039437 | Ga0436365_1543965 | Ga0436365_1543965_270_1493 | 394 |
| 743 | 3300039438 | Ga0436360_0157856 | Ga0436360_0157856_4145_5386 | 394 |
| 744 | 3300039438 | Ga0436360_1359148 | Ga0436360_1359148_4904_6130 | 394 |
| 745 | 3300039447 | Ga0436361_0106319 | Ga0436361_0106319_305_1546 | 394 |
| 746 | 3300039450 | Ga0436363_0405125 | Ga0436363_0405125_5859_7100 | 394 |
| 747 | 3300039450 | Ga0436363_1681949 | Ga0436363_1681949_2865_4103 | 394 |
| 748 | 3300039453 | Ga0436362_0536913 | Ga0436362_0536913_2909_4147 | 394 |
| 749 | 3300039453 | Ga0436362_0548901 | Ga0436362_0548901_576_1802 | 394 |
| 750 | 3300039453 | Ga0436362_0729911 | Ga0436362_0729911_2052_3278 | 394 |
| 751 | 3300042001 | Ga0439441_006883 | Ga0439441_006883_310_1545 | 394 |
| 752 | 3300045976 | Ga0466967_0037584 | Ga0466967_0037584_1849_3156 | 394 |
| 753 | 3300046454 | Ga0495592_0035657 | Ga0495592_0035657_2229_3470 | 394 |
| 754 | 3300046459 | Ga0495629_0052952 | Ga0495629_0052952_1119_2363 | 394 |
| 755 | 3300046462 | Ga0495651_0021640 | Ga0495651_0021640_1029_2285 | 394 |
| 756 | 3300046463 | Ga0495653_0029597 | Ga0495653_0029597_2404_3660 | 394 |
| 757 | 3300046463 | Ga0495653_0084457 | Ga0495653_0084457_781_2049 | 394 |
| 758 | 3300046472 | Ga0495580_0005218 | Ga0495580_0005218_6913_8157 | 394 |
| 759 | 3300046472 | Ga0495580_0023817 | Ga0495580_0023817_506_1735 | 394 |
| 760 | 3300046477 | Ga0495664_0003101 | Ga0495664_0003101_7128_8396 | 394 |
| 761 | 3300046511 | Ga0495608_0010439 | Ga0495608_0010439_3171_4427 | 394 |
| 762 | 3300046511 | Ga0495608_0012618 | Ga0495608_0012618_1897_3165 | 394 |
| 763 | 3300046514 | Ga0495618_0008723 | Ga0495618_0008723_3823_5079 | 394 |
| 764 | 3300046516 | Ga0495628_0050079 | Ga0495628_0050079_120_1376 | 394 |
| 765 | 3300046529 | Ga0495652_0027554 | Ga0495652_0027554_2912_4168 | 394 |
| 766 | 3300046533 | Ga0495640_0007595 | Ga0495640_0007595_2614_3870 | 394 |
| 767 | 3300046533 | Ga0495640_0078034 | Ga0495640_0078034_11_1279 | 394 |
| 768 | 3300046536 | Ga0495587_0006694 | Ga0495587_0006694_3121_4377 | 394 |
| 769 | 3300046536 | Ga0495587_0012147 | Ga0495587_0012147_1362_2630 | 394 |
| 770 | 3300046543 | Ga0495645_0033050 | Ga0495645_0033050_1213_2481 | 394 |
| 771 | 3300046559 | Ga0495667_0055344 | Ga0495667_0055344_1066_2307 | 394 |
| 772 | 3300046642 | Ga0495634_0037347 | Ga0495634_0037347_837_2093 | 394 |
| 773 | 3300046678 | Ga0495599_0006566 | Ga0495599_0006566_1198_2466 | 394 |
| 774 | 3300046678 | Ga0495599_0054218 | Ga0495599_0054218_743_1999 | 394 |
| 775 | 3300046679 | Ga0495623_0047042 | Ga0495623_0047042_1265_2533 | 394 |
| 776 | 3300046679 | Ga0495623_0082523 | Ga0495623_0082523_562_1818 | 394 |
| 777 | 3300046680 | Ga0495646_0010821 | Ga0495646_0010821_3657_4925 | 394 |
| 778 | 3300046680 | Ga0495646_0039710 | Ga0495646_0039710_1410_2666 | 394 |
| 779 | 3300046683 | Ga0495658_0001976 | Ga0495658_0001976_4617_5861 | 394 |
| 780 | 3300046683 | Ga0495658_0017515 | Ga0495658_0017515_1735_2976 | 394 |
| 781 | 3300046690 | Ga0495624_0038255 | Ga0495624_0038255_1168_2424 | 394 |
| 782 | 3300046809 | Ga0495600_0006058 | Ga0495600_0006058_2878_4134 | 394 |
| 783 | 3300047317 | Ga0495604_0006924 | Ga0495604_0006924_3677_4933 | 394 |
| 784 | 3300047317 | Ga0495604_0033817 | Ga0495604_0033817_217_1485 | 394 |
| 785 | 3300047319 | Ga0495674_0014792 | Ga0495674_0014792_1838_3094 | 394 |
| 786 | 3300047320 | Ga0495672_0003346 | Ga0495672_0003346_8326_9561 | 394 |
| 787 | 3300047322 | Ga0495680_0035999 | Ga0495680_0035999_2368_3609 | 394 |
| 788 | 3300048088 | Ga0495602_0000162 | Ga0495602_0000162_57488_58756 | 394 |
| 789 | 3300048088 | Ga0495602_0021910 | Ga0495602_0021910_2735_3991 | 394 |
| 790 | 3300048908 | Ga0496105_0036935 | Ga0496105_0036935_865_2112 | 394 |
| 791 | 3300048914 | Ga0496111_0197461 | Ga0496111_0197461_101_1348 | 394 |
| 792 | 3300048929 | Ga0496126_0020076 | Ga0496126_0020076_4482_5723 | 394 |
| 793 | 3300049569 | Ga0501032_0004270 | Ga0501032_0004270_6054_7358 | 394 |
| 794 | 3300049570 | Ga0501033_0001382 | Ga0501033_0001382_16643_17947 | 394 |
| 795 | 3300049570 | Ga0501033_0047724 | Ga0501033_0047724_1569_2813 | 394 |
| 796 | 3300049571 | Ga0501034_0006983 | Ga0501034_0006983_2688_3929 | 394 |
| 797 | 3300049571 | Ga0501034_0021114 | Ga0501034_0021114_2086_3390 | 394 |
| 798 | 3300049572 | Ga0501036_0010628 | Ga0501036_0010628_3019_4323 | 394 |
| 799 | 3300049573 | Ga0501037_0004264 | Ga0501037_0004264_2470_3774 | 394 |
| 800 | 3300049573 | Ga0501037_0153173 | Ga0501037_0153173_35_1279 | 394 |
| 801 | 3300049574 | Ga0501038_0017376 | Ga0501038_0017376_902_2206 | 394 |
| 802 | 3300049575 | Ga0501039_0010777 | Ga0501039_0010777_2312_3616 | 394 |
| 803 | 3300049575 | Ga0501039_0110785 | Ga0501039_0110785_689_1939 | 394 |
| 804 | 3300049576 | Ga0501040_0038620 | Ga0501040_0038620_159_1409 | 394 |
| 805 | 3300049576 | Ga0501040_0078756 | Ga0501040_0078756_792_2018 | 394 |
| 806 | 3300049579 | Ga0501043_0005887 | Ga0501043_0005887_6603_7907 | 394 |
| 807 | 3300049579 | Ga0501043_0014846 | Ga0501043_0014846_2590_3834 | 394 |
| 808 | 3300049580 | Ga0501046_0000948 | Ga0501046_0000948_20032_21336 | 394 |
| 809 | 3300049580 | Ga0501046_0047396 | Ga0501046_0047396_1129_2376 | 394 |
| 810 | 3300049581 | Ga0501047_0005393 | Ga0501047_0005393_8205_9509 | 394 |
| 811 | 3300049582 | Ga0501048_0029797 | Ga0501048_0029797_2491_3795 | 394 |
| 812 | 3300049584 | Ga0501068_0027343 | Ga0501068_0027343_406_1710 | 394 |
| 813 | 3300049585 | Ga0501069_0002003 | Ga0501069_0002003_6385_7689 | 394 |
| 814 | 3300049586 | Ga0501070_0001431 | Ga0501070_0001431_3712_5016 | 394 |
| 815 | 3300049586 | Ga0501070_0123279 | Ga0501070_0123279_671_1918 | 394 |
| 816 | 3300049589 | Ga0501073_0005127 | Ga0501073_0005127_5096_6400 | 394 |
| 817 | 3300049590 | Ga0501074_0130528 | Ga0501074_0130528_459_1685 | 394 |
| 818 | 3300049742 | Ga0501080_0000595 | Ga0501080_0000595_2722_4026 | 394 |
| 819 | 3300049742 | Ga0501080_0026922 | Ga0501080_0026922_2028_3272 | 394 |
| 820 | 3300049742 | Ga0501080_0027791 | Ga0501080_0027791_1044_2291 | 394 |
| 821 | 3300049742 | Ga0501080_0099180 | Ga0501080_0099180_325_1572 | 394 |
| 822 | 3300049743 | Ga0501081_0027872 | Ga0501081_0027872_2071_3297 | 394 |
| 823 | 3300049744 | Ga0501083_0012128 | Ga0501083_0012128_2722_4026 | 394 |
| 824 | 3300049744 | Ga0501083_0046972 | Ga0501083_0046972_1059_2306 | 394 |
| 825 | 3300049744 | Ga0501083_0082138 | Ga0501083_0082138_91_1338 | 394 |
| 826 | 3300049822 | Ga0501035_0003515 | Ga0501035_0003515_10307_11611 | 394 |
| 827 | 3300049823 | Ga0501044_0003187 | Ga0501044_0003187_13779_15083 | 394 |
| 828 | 3300049823 | Ga0501044_0019892 | Ga0501044_0019892_1168_2412 | 394 |
| 829 | 3300049823 | Ga0501044_0033888 | Ga0501044_0033888_3735_4982 | 394 |
| 830 | 3300049823 | Ga0501044_0101527 | Ga0501044_0101527_254_1501 | 394 |
| 831 | 3300050489 | nmdc:mga03683_18911_c1 | nmdc:mga03683_18911_c1_832_2070 | 394 |
| 832 | 3300050489 | nmdc:mga03683_2194_c1 | nmdc:mga03683_2194_c1_2232_3470 | 394 |
| 833 | 3300050489 | nmdc:mga03683_55976_c1 | nmdc:mga03683_55976_c1_351_1589 | 394 |
| 834 | 3300050489 | nmdc:mga03683_739_c1 | nmdc:mga03683_739_c1_6822_8060 | 394 |
| 835 | 3300050492 | nmdc:mga0yw44_135714_c1 | nmdc:mga0yw44_135714_c1_118_1356 | 394 |
| 836 | 3300050493 | nmdc:mga0k408_37533_c1 | nmdc:mga0k408_37533_c1_1060_2298 | 394 |
| 837 | 3300050507 | nmdc:mga05p37_2869_c1 | nmdc:mga05p37_2869_c1_2088_3341 | 394 |
| 838 | 3300050516 | nmdc:mga0sz30_1334_c1 | nmdc:mga0sz30_1334_c1_6784_8022 | 394 |
| 839 | 3300053078 | Ga0495612_0003425 | Ga0495612_0003425_3315_4583 | 394 |
| 840 | 3300053084 | Ga0495595_0002120 | Ga0495595_0002120_3356_4612 | 394 |
| 841 | 3300053084 | Ga0495595_0006813 | Ga0495595_0006813_3411_4652 | 394 |
| 842 | 3300053085 | Ga0495619_0011297 | Ga0495619_0011297_4219_5475 | 394 |
| 843 | 3300053088 | Ga0500644_0020003 | Ga0500644_0020003_66_1313 | 394 |
| 844 | 3300053088 | Ga0500644_0040340 | Ga0500644_0040340_67_1305 | 394 |
| 845 | 3300053096 | Ga0500641_0003048 | Ga0500641_0003048_1326_2573 | 394 |
| 846 | 3300053119 | Ga0500595_000107 | Ga0500595_000107_25501_26748 | 394 |
| 847 | 3300053130 | Ga0500642_0058659 | Ga0500642_0058659_303_1595 | 394 |
| 848 | 3300053142 | Ga0500577_0012279 | Ga0500577_0012279_328_1575 | 394 |
| 849 | 3300053153 | Ga0500616_0000555 | Ga0500616_0000555_11253_12500 | 394 |
| 850 | 3300053153 | Ga0500616_0030438 | Ga0500616_0030438_674_1903 | 394 |
| 851 | 3300060353 | Ga0501082_0005314 | Ga0501082_0005314_6602_7906 | 394 |
| 852 | 3300061734 | Ga0530510_0045413 | Ga0530510_0045413_401_1627 | 394 |
| 853 | iso_pu_bacteria | 2513237087 | 2513590203 | 394 |
| 854 | iso_pu_bacteria | 2617270741 | 2617375614 | 394 |
| 855 | iso_pu_bacteria | 2824617872 | 2824617873 | 394 |
| 856 | iso_pu_bacteria | 2824679649 | 2824685166 | 394 |
| 857 | iso_pu_bacteria | 2824732956 | 2824738127 | 394 |
| 858 | iso_pu_bacteria | 2824746037 | 2824752321 | 394 |
| 859 | iso_pu_bacteria | 2874612657 | 2874615065 | 394 |
| 860 | iso_pu_bacteria | 2891373044 | 2891374688 | 394 |
| 861 | iso_pu_bacteria | 2908775508 | 2908780319 | 394 |
| 862 | iso_pu_bacteria | 2922393267 | 2922400659 | 394 |
| 863 | iso_pu_bacteria | 2935908558 | 2935908972 | 394 |
| 864 | iso_pu_bacteria | 2935916978 | 2935919690 | 394 |
| 865 | iso_pu_bacteria | 2935926038 | 2935926454 | 394 |
| 866 | iso_pu_bacteria | 2935934488 | 2935934904 | 394 |
| 867 | iso_pu_bacteria | 2935942939 | 2935943354 | 394 |
| 868 | iso_pu_bacteria | 2935951376 | 2935951792 | 394 |
| 869 | iso_pu_bacteria | 2935967501 | 2935967917 | 394 |
| 870 | iso_pu_bacteria | 2989349275 | 2989354169 | 394 |
| 871 | iso_pu_bacteria | 2989771324 | 2989772060 | 394 |
| 872 | iso_pu_bacteria | 3003930520 | 3003932670 | 394 |
| 873 | iso_pu_bacteria | 3005483717 | 3005484456 | 394 |
| 874 | iso_pu_bacteria | 3005587118 | 3005587901 | 394 |
| 875 | iso_pu_bacteria | 8019648815 | 8019658549 | 394 |
| 876 | iso_pu_bacteria | 8045864390 | 8045865905 | 394 |
| 877 | iso_pu_bacteria | 8054558443 | 8054562959 | 394 |
| 878 | 3300003215 | JGI25153J46596_10004997 | JGI25153J46596_100049974 | 395 |
| 879 | 3300003215 | JGI25153J46596_10015785 | JGI25153J46596_100157852 | 395 |
| 880 | 3300003354 | JGI25160J50197_1000477 | JGI25160J50197_100047721 | 395 |
| 881 | 3300005262 | Ga0065165_1001332 | Ga0065165_100133224 | 395 |
| 882 | 3300005290 | Ga0065712_10089656 | Ga0065712_100896562 | 395 |
| 883 | 3300005329 | Ga0070683_100164806 | Ga0070683_1001648062 | 395 |
| 884 | 3300005336 | Ga0070680_100027191 | Ga0070680_1000271912 | 395 |
| 885 | 3300005336 | Ga0070680_100263208 | Ga0070680_1002632081 | 395 |
| 886 | 3300005338 | Ga0068868_100008896 | Ga0068868_1000088964 | 395 |
| 887 | 3300005339 | Ga0070660_100068056 | Ga0070660_1000680562 | 395 |
| 888 | 3300005353 | Ga0070669_100101527 | Ga0070669_1001015271 | 395 |
| 889 | 3300005356 | Ga0070674_100005598 | Ga0070674_1000055982 | 395 |
| 890 | 3300005364 | Ga0070673_100081992 | Ga0070673_1000819923 | 395 |
| 891 | 3300005365 | Ga0070688_100003954 | Ga0070688_1000039543 | 395 |
| 892 | 3300005435 | Ga0070714_100186792 | Ga0070714_1001867922 | 395 |
| 893 | 3300005436 | Ga0070713_100165154 | Ga0070713_1001651541 | 395 |
| 894 | 3300005456 | Ga0070678_100029192 | Ga0070678_1000291923 | 395 |
| 895 | 3300005457 | Ga0070662_100016079 | Ga0070662_1000160794 | 395 |
| 896 | 3300005458 | Ga0070681_10016080 | Ga0070681_100160802 | 395 |
| 897 | 3300005458 | Ga0070681_10020990 | Ga0070681_100209906 | 395 |
| 898 | 3300005530 | Ga0070679_100003428 | Ga0070679_10000342815 | 395 |
| 899 | 3300005618 | Ga0068864_100026541 | Ga0068864_1000265412 | 395 |
| 900 | 3300005981 | Ga0081538_10006460 | Ga0081538_100064607 | 395 |
| 901 | 3300006038 | Ga0075365_10059534 | Ga0075365_100595344 | 395 |
| 902 | 3300006177 | Ga0075362_10003140 | Ga0075362_100031405 | 395 |
| 903 | 3300006178 | Ga0075367_10007484 | Ga0075367_100074843 | 395 |
| 904 | 3300006237 | Ga0097621_100092973 | Ga0097621_1000929733 | 395 |
| 905 | 3300006846 | Ga0075430_100007703 | Ga0075430_1000077032 | 395 |
| 906 | 3300006871 | Ga0075434_100162133 | Ga0075434_1001621332 | 395 |
| 907 | 3300006880 | Ga0075429_100115094 | Ga0075429_1001150942 | 395 |
| 908 | 3300006942 | Ga0099824_1027176 | Ga0099824_10271762 | 395 |
| 909 | 3300009093 | Ga0105240_10103180 | Ga0105240_101031802 | 395 |
| 910 | 3300009093 | Ga0105240_10103180 | Ga0105240_101031803 | 395 |
| 911 | 3300009093 | Ga0105240_10121211 | Ga0105240_101212112 | 395 |
| 912 | 3300009094 | Ga0111539_10043198 | Ga0111539_100431984 | 395 |
| 913 | 3300009094 | Ga0111539_10100322 | Ga0111539_101003222 | 395 |
| 914 | 3300009147 | Ga0114129_10058588 | Ga0114129_100585885 | 395 |
| 915 | 3300009147 | Ga0114129_10125067 | Ga0114129_101250673 | 395 |
| 916 | 3300009147 | Ga0114129_10388447 | Ga0114129_103884471 | 395 |
| 917 | 3300009177 | Ga0105248_10053132 | Ga0105248_100531324 | 395 |
| 918 | 3300009177 | Ga0105248_10062788 | Ga0105248_100627885 | 395 |
| 919 | 3300009545 | Ga0105237_10190789 | Ga0105237_101907892 | 395 |
| 920 | 3300009545 | Ga0105237_10244215 | Ga0105237_102442152 | 395 |
| 921 | 3300009551 | Ga0105238_10119769 | Ga0105238_101197692 | 395 |
| 922 | 3300009551 | Ga0105238_10211098 | Ga0105238_102110982 | 395 |
| 923 | 3300010375 | Ga0105239_10158045 | Ga0105239_101580452 | 395 |
| 924 | 3300013105 | Ga0157369_10122712 | Ga0157369_101227122 | 395 |
| 925 | 3300014325 | Ga0163163_10223001 | Ga0163163_102230012 | 395 |
| 926 | 3300014326 | Ga0157380_10157152 | Ga0157380_101571522 | 395 |
| 927 | 3300021320 | Ga0214544_1000002 | Ga0214544_1000002296 | 395 |
| 928 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001646 | 395 |
| 929 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001712 | 395 |
| 930 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001483 | 395 |
| 931 | 3300021361 | Ga0213872_10015277 | Ga0213872_100152773 | 395 |
| 932 | 3300022467 | Ga0224712_10071142 | Ga0224712_100711421 | 395 |
| 933 | 3300025254 | Ga0209148_1000732 | Ga0209148_10007324 | 395 |
| 934 | 3300025272 | Ga0209455_1000572 | Ga0209455_100057211 | 395 |
| 935 | 3300025294 | Ga0209025_1000149 | Ga0209025_100014971 | 395 |
| 936 | 3300025297 | Ga0209758_1000252 | Ga0209758_100025242 | 395 |
| 937 | 3300025298 | Ga0209050_1011618 | Ga0209050_10116184 | 395 |
| 938 | 3300025302 | Ga0207426_1000626 | Ga0207426_100062634 | 395 |
| 939 | 3300025912 | Ga0207707_10023011 | Ga0207707_100230113 | 395 |
| 940 | 3300025913 | Ga0207695_10028663 | Ga0207695_100286632 | 395 |
| 941 | 3300025913 | Ga0207695_10028663 | Ga0207695_100286633 | 395 |
| 942 | 3300025913 | Ga0207695_10081855 | Ga0207695_100818552 | 395 |
| 943 | 3300025914 | Ga0207671_10088695 | Ga0207671_100886951 | 395 |
| 944 | 3300025914 | Ga0207671_10130797 | Ga0207671_101307971 | 395 |
| 945 | 3300025919 | Ga0207657_10077580 | Ga0207657_100775802 | 395 |
| 946 | 3300025921 | Ga0207652_10075431 | Ga0207652_100754312 | 395 |
| 947 | 3300025924 | Ga0207694_10061926 | Ga0207694_100619262 | 395 |
| 948 | 3300025926 | Ga0207659_10095584 | Ga0207659_100955842 | 395 |
| 949 | 3300025933 | Ga0207706_10041661 | Ga0207706_100416612 | 395 |
| 950 | 3300025933 | Ga0207706_10049658 | Ga0207706_100496581 | 395 |
| 951 | 3300025941 | Ga0207711_10025515 | Ga0207711_100255151 | 395 |
| 952 | 3300026023 | Ga0207677_10137945 | Ga0207677_101379451 | 395 |
| 953 | 3300026075 | Ga0207708_10024701 | Ga0207708_100247012 | 395 |
| 954 | 3300026095 | Ga0207676_10017898 | Ga0207676_100178985 | 395 |
| 955 | 3300026121 | Ga0207683_10025859 | Ga0207683_100258592 | 395 |
| 956 | 3300028577 | Ga0265318_10005668 | Ga0265318_100056688 | 395 |
| 957 | 3300028786 | Ga0307517_10000714 | Ga0307517_1000071434 | 395 |
| 958 | 3300028794 | Ga0307515_10003572 | Ga0307515_1000357212 | 395 |
| 959 | 3300028800 | Ga0265338_10045536 | Ga0265338_100455362 | 395 |
| 960 | 3300031235 | Ga0265330_10041268 | Ga0265330_100412681 | 395 |
| 961 | 3300031241 | Ga0265325_10003952 | Ga0265325_100039522 | 395 |
| 962 | 3300031241 | Ga0265325_10011897 | Ga0265325_100118975 | 395 |
| 963 | 3300031241 | Ga0265325_10023938 | Ga0265325_100239381 | 395 |
| 964 | 3300031247 | Ga0265340_10015778 | Ga0265340_100157782 | 395 |
| 965 | 3300031247 | Ga0265340_10030478 | Ga0265340_100304782 | 395 |
| 966 | 3300031249 | Ga0265339_10000024 | Ga0265339_10000024164 | 395 |
| 967 | 3300031344 | Ga0265316_10040642 | Ga0265316_100406423 | 395 |
| 968 | 3300031456 | Ga0307513_10017608 | Ga0307513_100176089 | 395 |
| 969 | 3300031595 | Ga0265313_10000006 | Ga0265313_10000006153 | 395 |
| 970 | 3300031595 | Ga0265313_10032122 | Ga0265313_100321222 | 395 |
| 971 | 3300031711 | Ga0265314_10010786 | Ga0265314_100107865 | 395 |
| 972 | 3300031712 | Ga0265342_10040177 | Ga0265342_100401772 | 395 |
| 973 | 3300031712 | Ga0265342_10072636 | Ga0265342_100726362 | 395 |
| 974 | 3300031727 | Ga0316576_10010072 | Ga0316576_100100722 | 395 |
| 975 | 3300031728 | Ga0316578_10039845 | Ga0316578_100398452 | 395 |
| 976 | 3300035114 | Ga0373939_0000982 | Ga0373939_0000982_1263_2528 | 395 |
| 977 | 3300035241 | Ga0373961_0006992 | Ga0373961_0006992_522_1778 | 395 |
| 978 | 3300035398 | Ga0316574_0054878 | Ga0316574_0054878_262_1572 | 395 |
| 979 | 3300035691 | Ga0373931_0010799 | Ga0373931_0010799_885_2141 | 395 |
| 980 | 3300035692 | Ga0373935_0036814 | Ga0373935_0036814_964_2241 | 395 |
| 981 | 3300035695 | Ga0373927_0000925 | Ga0373927_0000925_19724_21001 | 395 |
| 982 | 3300036647 | Ga0316582_0084657 | Ga0316582_0084657_693_1916 | 395 |
| 983 | 3300036712 | Ga0316584_0082630 | Ga0316584_0082630_266_1576 | 395 |
| 984 | 3300037471 | Ga0395905_0000711 | Ga0395905_0000711_38878_40158 | 395 |
| 985 | 3300037471 | Ga0395905_0022173 | Ga0395905_0022173_4628_5884 | 395 |
| 986 | 3300037471 | Ga0395905_0029294 | Ga0395905_0029294_2589_3935 | 395 |
| 987 | 3300039447 | Ga0436361_0060422 | Ga0436361_0060422_1669_2922 | 395 |
| 988 | 3300039447 | Ga0436361_0211622 | Ga0436361_0211622_4426_5676 | 395 |
| 989 | 3300039447 | Ga0436361_0909929 | Ga0436361_0909929_1620_2873 | 395 |
| 990 | 3300039450 | Ga0436363_0278096 | Ga0436363_0278096_447_1700 | 395 |
| 991 | 3300041512 | Ga0451853_1379231 | Ga0451853_1379231_1534_2790 | 395 |
| 992 | 3300046460 | Ga0495638_0002300 | Ga0495638_0002300_5511_6743 | 395 |
| 993 | 3300046513 | Ga0495616_0000461 | Ga0495616_0000461_17042_18274 | 395 |
| 994 | 3300046519 | Ga0495632_0000761 | Ga0495632_0000761_8454_9686 | 395 |
| 995 | 3300046542 | Ga0495597_0020822 | Ga0495597_0020822_617_1873 | 395 |
| 996 | 3300046616 | Ga0495668_0011857 | Ga0495668_0011857_1252_2484 | 395 |
| 997 | 3300046616 | Ga0495668_0058151 | Ga0495668_0058151_460_1716 | 395 |
| 998 | 3300046660 | Ga0495625_0115003 | Ga0495625_0115003_251_1579 | 395 |
| 999 | 3300047470 | Ga0495681_0041565 | Ga0495681_0041565_308_1540 | 395 |
| 1000 | 3300048088 | Ga0495602_0056209 | Ga0495602_0056209_2174_3430 | 395 |
| 1001 | 3300048907 | Ga0496104_0257053 | Ga0496104_0257053_270_1526 | 395 |
| 1002 | 3300048908 | Ga0496105_0071626 | Ga0496105_0071626_528_1784 | 395 |
| 1003 | 3300048909 | Ga0496106_0002493 | Ga0496106_0002493_2114_3352 | 395 |
| 1004 | 3300048909 | Ga0496106_0121952 | Ga0496106_0121952_708_1964 | 395 |
| 1005 | 3300048909 | Ga0496106_0204425 | Ga0496106_0204425_122_1378 | 395 |
| 1006 | 3300048910 | Ga0496107_0000086 | Ga0496107_0000086_13630_14868 | 395 |
| 1007 | 3300048911 | Ga0496108_0248373 | Ga0496108_0248373_270_1526 | 395 |
| 1008 | 3300048912 | Ga0496109_0079402 | Ga0496109_0079402_447_1703 | 395 |
| 1009 | 3300048913 | Ga0496110_0108936 | Ga0496110_0108936_1191_2447 | 395 |
| 1010 | 3300048914 | Ga0496111_0046698 | Ga0496111_0046698_1754_3010 | 395 |
| 1011 | 3300048917 | Ga0496114_0016149 | Ga0496114_0016149_268_1524 | 395 |
| 1012 | 3300048920 | Ga0496117_0007358 | Ga0496117_0007358_5056_6342 | 395 |
| 1013 | 3300048924 | Ga0496121_0001387 | Ga0496121_0001387_6657_7895 | 395 |
| 1014 | 3300048925 | Ga0496122_0000492 | Ga0496122_0000492_17651_18937 | 395 |
| 1015 | 3300048926 | Ga0496123_0000460 | Ga0496123_0000460_502_1788 | 395 |
| 1016 | 3300048927 | Ga0496124_0005670 | Ga0496124_0005670_4913_6199 | 395 |
| 1017 | 3300048928 | Ga0496125_0004516 | Ga0496125_0004516_2156_3442 | 395 |
| 1018 | 3300048929 | Ga0496126_0001886 | Ga0496126_0001886_1514_2800 | 395 |
| 1019 | 3300048929 | Ga0496126_0051648 | Ga0496126_0051648_1321_2607 | 395 |
| 1020 | 3300048929 | Ga0496126_0129679 | Ga0496126_0129679_266_1498 | 395 |
| 1021 | 3300049569 | Ga0501032_0009315 | Ga0501032_0009315_897_2159 | 395 |
| 1022 | 3300049570 | Ga0501033_0000145 | Ga0501033_0000145_66456_67712 | 395 |
| 1023 | 3300049570 | Ga0501033_0000231 | Ga0501033_0000231_12741_14003 | 395 |
| 1024 | 3300049571 | Ga0501034_0012828 | Ga0501034_0012828_1339_2586 | 395 |
| 1025 | 3300049571 | Ga0501034_0160395 | Ga0501034_0160395_594_1880 | 395 |
| 1026 | 3300049578 | Ga0501042_0012026 | Ga0501042_0012026_3959_5224 | 395 |
| 1027 | 3300049579 | Ga0501043_0010684 | Ga0501043_0010684_778_2040 | 395 |
| 1028 | 3300049588 | Ga0501072_0015036 | Ga0501072_0015036_2104_3360 | 395 |
| 1029 | 3300049589 | Ga0501073_0003268 | Ga0501073_0003268_8193_9455 | 395 |
| 1030 | 3300049744 | Ga0501083_0017777 | Ga0501083_0017777_985_2313 | 395 |
| 1031 | 3300049822 | Ga0501035_0001815 | Ga0501035_0001815_10013_11269 | 395 |
| 1032 | 3300049822 | Ga0501035_0044098 | Ga0501035_0044098_641_1903 | 395 |
| 1033 | 3300049823 | Ga0501044_0007461 | Ga0501044_0007461_6717_7991 | 395 |
| 1034 | 3300049823 | Ga0501044_0092981 | Ga0501044_0092981_1135_2373 | 395 |
| 1035 | 3300049824 | Ga0501045_0093119 | Ga0501045_0093119_529_1818 | 395 |
| 1036 | 3300050489 | nmdc:mga03683_5373_c1 | nmdc:mga03683_5373_c1_2737_3984 | 395 |
| 1037 | 3300050494 | nmdc:mga06z11_571_c1 | nmdc:mga06z11_571_c1_7793_9061 | 395 |
| 1038 | 3300050507 | nmdc:mga05p37_115069_c1 | nmdc:mga05p37_115069_c1_436_1692 | 395 |
| 1039 | 3300050507 | nmdc:mga05p37_62352_c1 | nmdc:mga05p37_62352_c1_500_1783 | 395 |
| 1040 | 3300050509 | nmdc:mga0qj67_3611_c1 | nmdc:mga0qj67_3611_c1_8389_9630 | 395 |
| 1041 | 3300050511 | nmdc:mga08y16_28162_c1 | nmdc:mga08y16_28162_c1_2668_3918 | 395 |
| 1042 | 3300050513 | nmdc:mga0rr50_41064_c1 | nmdc:mga0rr50_41064_c1_1942_3192 | 395 |
| 1043 | 3300050515 | nmdc:mga0a205_165544_c1 | nmdc:mga0a205_165544_c1_284_1540 | 395 |
| 1044 | 3300050515 | nmdc:mga0a205_56508_c1 | nmdc:mga0a205_56508_c1_850_2100 | 395 |
| 1045 | 3300053093 | Ga0500651_0014192 | Ga0500651_0014192_1570_2826 | 395 |
| 1046 | 3300053122 | Ga0500608_088158 | Ga0500608_088158_31_1311 | 395 |
| 1047 | 3300053125 | Ga0500618_000053 | Ga0500618_000053_88074_89342 | 395 |
| 1048 | 3300053136 | Ga0500559_0000005 | Ga0500559_0000005_102270_103526 | 395 |
| 1049 | 3300053136 | Ga0500559_0003825 | Ga0500559_0003825_1535_2818 | 395 |
| 1050 | 3300053142 | Ga0500577_0001675 | Ga0500577_0001675_977_2233 | 395 |
| 1051 | 3300053156 | Ga0500622_0000695 | Ga0500622_0000695_27460_28740 | 395 |
| 1052 | iso_pu_bacteria | 2582581280 | 2585154225 | 395 |
| 1053 | iso_pu_bacteria | 2582581293 | 2585197844 | 395 |
| 1054 | 3300005435 | Ga0070714_100001181 | Ga0070714_10000118113 | 396 |
| 1055 | 3300005549 | Ga0070704_100069692 | Ga0070704_1000696922 | 396 |
| 1056 | 3300005937 | Ga0081455_10008107 | Ga0081455_100081073 | 396 |
| 1057 | 3300005937 | Ga0081455_10026716 | Ga0081455_100267164 | 396 |
| 1058 | 3300007076 | Ga0075435_100144345 | Ga0075435_1001443452 | 396 |
| 1059 | 3300009551 | Ga0105238_10356358 | Ga0105238_103563581 | 396 |
| 1060 | 3300020080 | Ga0206350_11260676 | Ga0206350_112606761 | 396 |
| 1061 | 3300025291 | Ga0209675_1003504 | Ga0209675_10035042 | 396 |
| 1062 | 3300025927 | Ga0207687_10262125 | Ga0207687_102621251 | 396 |
| 1063 | 3300025929 | Ga0207664_10000344 | Ga0207664_1000034413 | 396 |
| 1064 | 3300028379 | Ga0268266_10224025 | Ga0268266_102240251 | 396 |
| 1065 | 3300035172 | Ga0373955_0013635 | Ga0373955_0013635_2538_3794 | 396 |
| 1066 | 3300036401 | Ga0373937_0068094 | Ga0373937_0068094_180_1436 | 396 |
| 1067 | 3300037068 | Ga0373925_0023328 | Ga0373925_0023328_3184_4440 | 396 |
| 1068 | 3300038443 | Ga0395901_0034805 | Ga0395901_0034805_210_1520 | 396 |
| 1069 | 3300039438 | Ga0436360_1052754 | Ga0436360_1052754_2407_3645 | 396 |
| 1070 | 3300046462 | Ga0495651_0073840 | Ga0495651_0073840_1109_2365 | 396 |
| 1071 | 3300046516 | Ga0495628_0046984 | Ga0495628_0046984_2146_3402 | 396 |
| 1072 | 3300047322 | Ga0495680_0039121 | Ga0495680_0039121_1168_2424 | 396 |
| 1073 | 3300049823 | Ga0501044_0220284 | Ga0501044_0220284_253_1500 | 396 |
| 1074 | 3300050513 | nmdc:mga0rr50_73300_c1 | nmdc:mga0rr50_73300_c1_127_1386 | 396 |
| 1075 | 3300050514 | nmdc:mga08x19_4_c2 | nmdc:mga08x19_4_c2_126370_127629 | 396 |
| 1076 | 3300005336 | Ga0070680_100160063 | Ga0070680_1001600631 | 397 |
| 1077 | 3300005436 | Ga0070713_100014715 | Ga0070713_1000147152 | 397 |
| 1078 | 3300005563 | Ga0068855_100016855 | Ga0068855_10001685512 | 397 |
| 1079 | 3300006028 | Ga0070717_10065502 | Ga0070717_100655022 | 397 |
| 1080 | 3300009093 | Ga0105240_10000287 | Ga0105240_1000028733 | 397 |
| 1081 | 3300009093 | Ga0105240_10000874 | Ga0105240_100008745 | 397 |
| 1082 | 3300014325 | Ga0163163_10347325 | Ga0163163_103473251 | 397 |
| 1083 | 3300014497 | Ga0182008_10034895 | Ga0182008_100348952 | 397 |
| 1084 | 3300014497 | Ga0182008_10048830 | Ga0182008_100488301 | 397 |
| 1085 | 3300021388 | Ga0213875_10001756 | Ga0213875_1000175614 | 397 |
| 1086 | 3300022467 | Ga0224712_10012001 | Ga0224712_100120012 | 397 |
| 1087 | 3300025913 | Ga0207695_10001005 | Ga0207695_1000100544 | 397 |
| 1088 | 3300025913 | Ga0207695_10006511 | Ga0207695_100065115 | 397 |
| 1089 | 3300025921 | Ga0207652_10033786 | Ga0207652_100337862 | 397 |
| 1090 | 3300025928 | Ga0207700_10051190 | Ga0207700_100511902 | 397 |
| 1091 | 3300025949 | Ga0207667_10016842 | Ga0207667_1001684211 | 397 |
| 1092 | 3300037853 | Ga0436364_0956907 | Ga0436364_0956907_7956_9311 | 397 |
| 1093 | 3300037853 | Ga0436364_1279775 | Ga0436364_1279775_133_1410 | 397 |
| 1094 | 3300039447 | Ga0436361_0996213 | Ga0436361_0996213_15715_16947 | 397 |
| 1095 | 3300039447 | Ga0436361_1100325 | Ga0436361_1100325_2891_4123 | 397 |
| 1096 | 3300045049 | Ga0466959_0122789 | Ga0466959_0122789_574_1809 | 397 |
| 1097 | 3300045051 | Ga0451576_0002320 | Ga0451576_0002320_22700_24001 | 397 |
| 1098 | 3300048915 | Ga0496112_0167113 | Ga0496112_0167113_108_1376 | 397 |
| 1099 | 3300013105 | Ga0157369_10335420 | Ga0157369_103354202 | 398 |
| 1100 | 3300025904 | Ga0207647_10004458 | Ga0207647_100044583 | 398 |
| 1101 | 3300005457 | Ga0070662_100008266 | Ga0070662_1000082663 | 400 |
| 1102 | 3300046525 | Ga0495663_0001633 | Ga0495663_0001633_5363_6616 | 400 |
| 1103 | 3300046558 | Ga0495633_0058417 | Ga0495633_0058417_285_1499 | 400 |
| 1104 | iso_pu_bacteria | 2512564014 | 2512644446 | 409 |
| 1105 | iso_pu_bacteria | 2775507255 | 2778123294 | 409 |
| 1106 | iso_pu_bacteria | 2808606401 | 2809063427 | 409 |
| 1107 | iso_pu_bacteria | 2808606404 | 2809079137 | 409 |
| 1108 | iso_pu_bacteria | 2808606405 | 2809083489 | 409 |
| 1109 | iso_pu_bacteria | 2880518877 | 2880520697 | 409 |
| 1110 | iso_pu_bacteria | 2919709256 | 2919712435 | 409 |
| 1111 | 2162886007 | SwRhRL2b_contig_1374729 | SwRhRL2b_0675.00001340 | 413 |
| 1112 | 3300001904 | JGI24736J21556_1000471 | JGI24736J21556_10004717 | 413 |
| 1113 | 3300001915 | JGI24741J21665_1000382 | JGI24741J21665_10003822 | 413 |
| 1114 | 3300001979 | JGI24740J21852_10001194 | JGI24740J21852_100011943 | 413 |
| 1115 | 3300001989 | JGI24739J22299_10014105 | JGI24739J22299_100141053 | 413 |
| 1116 | 3300001990 | JGI24737J22298_10004375 | JGI24737J22298_100043753 | 413 |
| 1117 | 3300002067 | JGI24735J21928_10001449 | JGI24735J21928_100014493 | 413 |
| 1118 | 3300002075 | JGI24738J21930_10008186 | JGI24738J21930_100081861 | 413 |
| 1119 | 3300005289 | Ga0065704_10011258 | Ga0065704_100112581 | 413 |
| 1120 | 3300005289 | Ga0065704_10072447 | Ga0065704_100724476 | 413 |
| 1121 | 3300005289 | Ga0065704_10145782 | Ga0065704_101457821 | 413 |
| 1122 | 3300005327 | Ga0070658_10020815 | Ga0070658_100208153 | 413 |
| 1123 | 3300005339 | Ga0070660_100011131 | Ga0070660_1000111317 | 413 |
| 1124 | 3300005344 | Ga0070661_100038900 | Ga0070661_1000389003 | 413 |
| 1125 | 3300005347 | Ga0070668_100009650 | Ga0070668_1000096507 | 413 |
| 1126 | 3300005353 | Ga0070669_100056464 | Ga0070669_1000564642 | 413 |
| 1127 | 3300005614 | Ga0068856_100027948 | Ga0068856_1000279483 | 413 |
| 1128 | 3300005834 | Ga0068851_10009846 | Ga0068851_100098462 | 413 |
| 1129 | 3300006178 | Ga0075367_10000028 | Ga0075367_1000002820 | 413 |
| 1130 | 3300009174 | Ga0105241_10009670 | Ga0105241_100096706 | 413 |
| 1131 | 3300009978 | Ga0105148_100001 | Ga0105148_10000147 | 413 |
| 1132 | 3300013100 | Ga0157373_10018656 | Ga0157373_100186563 | 413 |
| 1133 | 3300013104 | Ga0157370_10010836 | Ga0157370_100108364 | 413 |
| 1134 | 3300017792 | Ga0163161_10009072 | Ga0163161_100090725 | 413 |
| 1135 | 3300025229 | Ga0209147_100894 | Ga0209147_10089412 | 413 |
| 1136 | 3300025911 | Ga0207654_10008215 | Ga0207654_100082155 | 413 |
| 1137 | 3300025913 | Ga0207695_10152083 | Ga0207695_101520833 | 413 |
| 1138 | 3300025923 | Ga0207681_10031848 | Ga0207681_100318483 | 413 |
| 1139 | 3300025932 | Ga0207690_10130557 | Ga0207690_101305571 | 413 |
| 1140 | 3300025933 | Ga0207706_10045644 | Ga0207706_100456442 | 413 |
| 1141 | 3300025949 | Ga0207667_10123693 | Ga0207667_101236933 | 413 |
| 1142 | 3300026041 | Ga0207639_10001279 | Ga0207639_100012795 | 413 |
| 1143 | 3300026067 | Ga0207678_10000402 | Ga0207678_1000040226 | 413 |
| 1144 | 3300026078 | Ga0207702_10004355 | Ga0207702_1000435512 | 413 |
| 1145 | 3300026116 | Ga0207674_10010437 | Ga0207674_100104378 | 413 |
| 1146 | 3300026142 | Ga0207698_10046813 | Ga0207698_100468134 | 413 |
| 1147 | 3300027866 | Ga0209813_10000019 | Ga0209813_100000191 | 413 |
| 1148 | 3300031731 | Ga0307405_10005099 | Ga0307405_100050996 | 413 |
| 1149 | 3300032002 | Ga0307416_100016945 | Ga0307416_1000169456 | 413 |
| 1150 | 3300046452 | Ga0495617_011202 | Ga0495617_011202_307_1548 | 413 |
| 1151 | 3300046453 | Ga0495627_000112 | Ga0495627_000112_18334_19575 | 413 |
| 1152 | 3300046453 | Ga0495627_000206 | Ga0495627_000206_27479_28720 | 413 |
| 1153 | 3300046491 | Ga0495584_0030416 | Ga0495584_0030416_744_1985 | 413 |
| 1154 | 3300046512 | Ga0495610_0000085 | Ga0495610_0000085_86669_87910 | 413 |
| 1155 | 3300046519 | Ga0495632_0000095 | Ga0495632_0000095_76653_77894 | 413 |
| 1156 | 3300046520 | Ga0495637_0001011 | Ga0495637_0001011_6978_8219 | 413 |
| 1157 | 3300046520 | Ga0495637_0010056 | Ga0495637_0010056_658_1899 | 413 |
| 1158 | 3300046522 | Ga0495643_0000038 | Ga0495643_0000038_223132_224373 | 413 |
| 1159 | 3300046525 | Ga0495663_0000028 | Ga0495663_0000028_76653_77894 | 413 |
| 1160 | 3300046558 | Ga0495633_0000136 | Ga0495633_0000136_32643_33884 | 413 |
| 1161 | 3300046558 | Ga0495633_0001114 | Ga0495633_0001114_11633_12874 | 413 |
| 1162 | 3300046692 | Ga0495671_0000027 | Ga0495671_0000027_11639_12880 | 413 |
| 1163 | 3300047470 | Ga0495681_0000013 | Ga0495681_0000013_89733_90974 | 413 |
| 1164 | 3300047470 | Ga0495681_0001132 | Ga0495681_0001132_7614_8855 | 413 |
| 1165 | 3300047472 | Ga0495686_0005745 | Ga0495686_0005745_6227_7468 | 413 |
| 1166 | 3300047472 | Ga0495686_0145124 | Ga0495686_0145124_98_1339 | 413 |
| 1167 | 3300048913 | Ga0496110_0055094 | Ga0496110_0055094_377_1618 | 413 |
| 1168 | 3300048913 | Ga0496110_0061792 | Ga0496110_0061792_1260_2501 | 413 |
| 1169 | 3300048916 | Ga0496113_0130843 | Ga0496113_0130843_469_1710 | 413 |
| 1170 | 3300048920 | Ga0496117_0023559 | Ga0496117_0023559_574_1815 | 413 |
| 1171 | 3300048921 | Ga0496118_0038502 | Ga0496118_0038502_774_2015 | 413 |
| 1172 | 3300048924 | Ga0496121_0001426 | Ga0496121_0001426_13573_14814 | 413 |
| 1173 | 3300048925 | Ga0496122_0011807 | Ga0496122_0011807_6161_7402 | 413 |
| 1174 | 3300048926 | Ga0496123_0025859 | Ga0496123_0025859_1787_3028 | 413 |
| 1175 | 3300048927 | Ga0496124_0019516 | Ga0496124_0019516_1596_2837 | 413 |
| 1176 | 3300048928 | Ga0496125_0000425 | Ga0496125_0000425_73516_74757 | 413 |
| 1177 | 3300048928 | Ga0496125_0027998 | Ga0496125_0027998_3172_4413 | 413 |
| 1178 | 3300048929 | Ga0496126_0010007 | Ga0496126_0010007_4003_5244 | 413 |
| 1179 | 3300049459 | Ga0495678_033410 | Ga0495678_033410_223_1464 | 413 |
| 1180 | 3300049658 | Ga0501211_001280 | Ga0501211_001280_420_1661 | 413 |
| 1181 | 3300049663 | Ga0501223_000080 | Ga0501223_000080_17765_19006 | 413 |
| 1182 | 3300049669 | Ga0501235_000785 | Ga0501235_000785_4288_5529 | 413 |
| 1183 | 3300049669 | Ga0501235_013853 | Ga0501235_013853_212_1453 | 413 |
| 1184 | 3300049670 | Ga0501236_004335 | Ga0501236_004335_355_1596 | 413 |
| 1185 | 3300049705 | Ga0501225_0000092 | Ga0501225_0000092_9837_11078 | 413 |
| 1186 | 3300049705 | Ga0501225_0004314 | Ga0501225_0004314_978_2219 | 413 |
| 1187 | 3300049708 | Ga0501245_000399 | Ga0501245_000399_293_1534 | 413 |
| 1188 | 3300049761 | Ga0501264_002384 | Ga0501264_002384_280_1521 | 413 |
| 1189 | 3300050494 | nmdc:mga06z11_255_c1 | nmdc:mga06z11_255_c1_9036_10277 | 413 |
| 1190 | 3300050495 | nmdc:mga04h51_62_c1 | nmdc:mga04h51_62_c1_10446_11687 | 413 |
| 1191 | 3300053157 | Ga0500624_000028 | Ga0500624_000028_45700_46941 | 413 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tpy-assembly1.cif.gz_A | structure of the cyclopropane synthase mmaa2 from mycobacterium tuberculosis | 0.9339 | 122 | 390 |
| 7qos-assembly2.cif.gz_B | cyclopropane fatty acid synthase from aquifex aeolicous with bound ligands | 0.9319 | 3 | 391 |
| 1l1e-assembly2.cif.gz_B | crystal structure of mycolic acid cyclopropane synthase pcaa complexed with s-adenosyl-l-homocysteine | 0.9298 | 129 | 390 |
| 3hem-assembly1.cif.gz_A | structure of mycobacterium tuberculosis mycolic acid cyclopropane synthase cmaa2 in complex with dioctylamine | 0.9277 | 123 | 390 |
| 1l1e-assembly1.cif.gz_A | crystal structure of mycolic acid cyclopropane synthase pcaa complexed with s-adenosyl-l-homocysteine | 0.9265 | 129 | 390 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O69687_132_410_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9622 | 117 | 390 | 3.40.50.150 |
| af_Q5APD4_189_477_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9403 | 117 | 390 | 3.40.50.150 |
| af_Q54QG2_134_419_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9366 | 110 | 391 | 3.40.50.150 |
| af_O69687_132_410_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9352 | 117 | 390 | 3.40.50.150 |
| af_Q2QUD2_542_827_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9345 | 110 | 391 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H8W8X6-F1-model_v4 | Mycolic acid cyclopropane synthetase | 0.9888 | 213 | 409 |
|
| AF-A0A6J4S1F2-F1-model_v4 | Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79) | 0.9884 | 209 | 410 |
GO:0008610
GO:0008825 GO:0032259 |
| AF-A0A2U8G8I5-F1-model_v4 | deleted | 0.9853 | 183 | 409 |
|
| AF-A0A353R2W9-F1-model_v4 | UvrD-like helicase C-terminal domain-containing protein | 0.9831 | 183 | 413 |
GO:0004386
GO:0005524 GO:0016787 |
| AF-A0A259HFD8-F1-model_v4 | SAM-dependent methyltransferase | 0.9787 | 284 | 413 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar