F491457

General Info

Members Datasets Scaffolds Average Seq Length
1191 512 1120 409

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100096303|Ga0070665_1000963032
Length 487
Sequence MAAPGVADGSVNVHLAPSTATCKSLASAGGCFLLHAGTNSTQSVGLNVQRGFTFKAKLWNNSARGWQFRLATGVNMLLARVLSRVLGEGQLIIIDAAGQQHRIDGARKGPSVTMRIHTWWTGIRLILQPRLAFGEAYMDGKITVENGDIYDLLDLLGRNMAAIDGTPFVRWSYLWQKTIRWIEQYNPVGKAQRNVAHHYDLNGQLYDFFLDRDRQYSCAYFKNGDEPLEEAQLDKKRHIAAKMLLLPGQKVLDIGSGWGGLGLFLGQQYGVDVTGVTLSTEQHTVSSRRALEGGLADRVRFKLLDYREEPDRYDRIVSVGMFEHVGVAHYVEYFRKVKELLKDDGVMVLHAIGRMEPPGATNTWLKKYIFPGGYTPALSEVMAAIEKVGLWVTDVEILRLHYAETLRHWRQRFLANRERIKQQSGYDERFCRMWEFYLAGCEVSFRYMNQMVFQIQLARKQDAVPLTRDYIVDAERGMAISRSMAAE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
5 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
6 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
7 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
8 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
9 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
10 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
11 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
12 2643221583 Caulobacter sp. Root655 Isolate Unclassified
13 2643221584 Caulobacter sp. Root656 Isolate Unclassified
14 2643221640 Caulobacter sp. Root342 Isolate Unclassified
15 2643221642 Caulobacter sp. Root343 Isolate Unclassified
16 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
17 2643221733 Bosea sp. Root381 Isolate Unclassified
18 2643221734 Bosea sp. Root670 Isolate Unclassified
19 2643221736 Bosea sp. Root483D1 Isolate Unclassified
20 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
21 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
22 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
23 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
24 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
25 2818991435 Caulobacter henricii 536 Isolate Unclassified
26 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
27 2818991467 Bosea vestrisii 3192 Isolate Unclassified
28 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
29 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
30 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
31 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
32 2841760612 Bosea sp. Tri-49 Isolate Nodule
33 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
34 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
35 2844104063 Bosea sp. Tri-39 Isolate Nodule
36 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
37 2851182111 Bosea sp. Tri-44 Isolate Nodule
38 2851246043 Bosea sp. Tri-54 Isolate Nodule
39 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
40 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
41 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
42 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
43 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
44 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
45 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
46 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
47 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
48 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
49 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
50 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
51 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
52 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
53 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
54 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
55 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
56 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
57 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
58 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
59 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
60 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
61 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
62 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
63 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
64 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
65 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
66 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
67 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
68 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
69 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
70 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
71 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
72 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
73 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
74 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
75 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
76 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
77 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
78 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
79 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
80 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
81 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
82 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
83 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
84 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
85 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
86 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
87 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
88 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
89 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
90 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
91 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
92 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
93 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
94 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
95 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
96 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
97 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
98 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
99 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
100 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
101 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
102 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
103 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
104 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
105 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
106 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
107 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
108 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
109 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
110 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
111 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
112 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
113 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
114 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
115 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
116 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
117 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
118 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
121 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
122 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
123 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
124 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
125 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
126 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
127 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
128 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
129 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
130 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
131 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
132 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
133 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
134 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
135 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
136 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
137 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
138 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
139 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
140 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
141 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
142 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
143 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
144 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
145 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
147 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
148 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
149 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
150 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
151 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
152 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
153 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
154 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
155 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
156 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
157 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
158 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
159 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
160 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
161 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
162 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
163 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
164 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
165 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
166 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
167 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
168 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
169 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
170 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
171 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
172 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
173 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
174 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
175 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
176 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
177 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
178 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
179 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
180 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
181 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
182 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
183 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
184 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
185 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
187 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
188 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
189 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
190 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
191 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
192 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
193 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
196 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
201 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
204 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
206 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
209 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
260 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
261 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
265 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
266 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
267 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
268 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
269 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
270 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
271 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
272 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
273 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
274 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
275 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
276 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
277 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
278 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
279 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
280 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
281 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
282 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
283 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
284 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
285 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
286 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
287 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
288 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
289 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
290 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
291 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
292 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
294 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
295 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
296 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
297 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
298 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
299 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
300 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
301 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
302 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
303 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
304 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
305 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
306 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
307 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
308 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
309 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
310 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
311 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
312 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
313 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
314 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
315 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
316 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
317 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
318 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
319 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
320 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
321 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
322 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
323 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
324 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
325 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
326 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
329 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
330 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
331 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
332 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
333 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
334 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
335 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
336 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
337 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
338 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
339 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
340 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
341 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
342 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
343 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
344 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
345 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
346 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
347 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
348 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
349 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
350 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
351 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
352 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
353 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
354 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
355 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
356 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
357 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
358 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
359 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
360 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
361 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
362 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
363 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
364 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
365 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
366 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
367 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
368 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
369 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
370 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
371 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
372 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
373 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
374 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
375 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
376 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
377 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
378 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
379 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
380 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
381 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
382 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
383 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
384 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
385 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
386 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
387 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
388 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
389 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
390 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
391 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
392 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
393 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
394 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
395 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
396 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
397 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
398 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
399 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
400 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
401 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
402 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
403 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
404 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
405 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
406 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
407 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
408 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
409 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
410 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
411 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
412 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
413 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
414 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
415 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
431 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
432 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
433 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
434 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
435 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
436 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
437 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
438 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
439 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
440 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
441 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
442 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
443 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
444 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
445 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
446 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
447 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
448 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
449 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
452 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
453 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
454 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
455 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
456 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
457 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
458 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
459 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
460 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
461 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
462 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
463 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
464 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
465 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
466 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
467 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
468 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
469 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
470 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
471 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
472 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
473 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
474 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
475 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
476 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
477 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
478 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
479 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
480 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
481 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
482 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
483 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
484 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
485 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
486 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
487 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
488 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
489 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
490 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
491 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
492 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
493 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
494 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
495 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
496 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
497 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
498 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
499 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
500 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
501 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
502 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
503 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
504 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
505 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
506 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
507 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
508 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
509 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
510 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
511 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
512 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.95
Metatranscriptomes 0.25
Isolates 5.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.29
Nodule 2.18
Rhizoplane 2.94
Rhizosphere 69.44
Stem 0
Stem Tuber 0
Unclassified 9.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1374729 2162886007 Bacteria 6133
2 JGI24736J21556_1000471 3300001904 Bacteria 7533
3 JGI24741J21665_1000382 3300001915 Bacteria 13287
4 JGI24740J21852_10001194 3300001979 Bacteria 11724
5 JGI24739J22299_10010844 3300001989 Bacteria 3374
6 JGI24739J22299_10014105 3300001989 Bacteria 2910
7 JGI24737J22298_10004375 3300001990 Bacteria 4930
8 JGI24735J21928_10001449 3300002067 Bacteria 8389
9 JGI24738J21930_10008186 3300002075 Bacteria 2383
10 JGI25159J45721_1002192 3300002987 Bacteria 7596
11 JGI25159J45721_1015584 3300002987 Bacteria 1658
12 JGI25151J46595_10000018 3300003187 Bacteria 238438
13 JGI25151J46595_10000268 3300003187 Bacteria 59703
14 JGI25153J46596_10000062 3300003215 Bacteria 129749
15 JGI25153J46596_10004997 3300003215 Bacteria 7038
16 JGI25153J46596_10015785 3300003215 Bacteria 3058
17 JGI25153J46596_10019572 3300003215 Bacteria 2587
18 rootH2_10104849 3300003320 Bacteria 7138
19 rootL2_10076554 3300003322 Bacteria 2321
20 JGI25160J50197_1000477 3300003354 Bacteria 24324
21 JGI25160J50197_1009821 3300003354 Bacteria 3513
22 Ga0055526_1001056 3300003771 Bacteria 20118
23 Ga0055526_1002567 3300003771 Bacteria 12179
24 Ga0055537_1001474 3300003773 Bacteria 9126
25 Ga0055524_1000048 3300003775 Bacteria 149598
26 Ga0055524_1003107 3300003775 Bacteria 8196
27 Ga0055524_1006095 3300003775 Bacteria 5277
28 Ga0055524_1006307 3300003775 Bacteria 5157
29 Ga0055536_1001392 3300003781 Bacteria 14629
30 Ga0055536_1003842 3300003781 Bacteria 7905
31 Ga0055536_1005608 3300003781 Bacteria 6081
32 Ga0055530_10000337 3300003791 Bacteria 42372
33 Ga0055530_10005206 3300003791 Bacteria 6309
34 Ga0055530_10005885 3300003791 Bacteria 5665
35 Ga0055531_10000820 3300003794 Bacteria 25755
36 Ga0055531_10001142 3300003794 Bacteria 20555
37 Ga0065165_1000062 3300005262 Bacteria 178885
38 Ga0065165_1000171 3300005262 Bacteria 114917
39 Ga0065165_1001332 3300005262 Bacteria 27434
40 Ga0065165_1001692 3300005262 Bacteria 22261
41 Ga0065165_1019308 3300005262 Bacteria 2439
42 Ga0065165_1019889 3300005262 Bacteria 2382
43 Ga0065704_10011258 3300005289 Bacteria 2172
44 Ga0065704_10072447 3300005289 Bacteria 8513
45 Ga0065704_10145782 3300005289 Bacteria 1452
46 Ga0065712_10089656 3300005290 Bacteria 2460
47 Ga0065715_10017061 3300005293 Unclassified 1968
48 Ga0070658_10010617 3300005327 Bacteria 7378
49 Ga0070658_10020815 3300005327 Bacteria 5256
50 Ga0070683_100092955 3300005329 Bacteria 2833
51 Ga0070683_100164806 3300005329 Bacteria 2103
52 Ga0070683_100173143 3300005329 Bacteria 2049
53 Ga0070670_100000128 3300005331 Bacteria 71585
54 Ga0070670_100005254 3300005331 Bacteria 10909
55 Ga0070670_100101569 3300005331 Unclassified 2476
56 Ga0070670_100184868 3300005331 Bacteria 1810
57 Ga0070666_10062863 3300005335 Bacteria 2516
58 Ga0070680_100000264 3300005336 Bacteria 34683
59 Ga0070680_100016723 3300005336 Bacteria 5775
60 Ga0070680_100026049 3300005336 Bacteria 4676
61 Ga0070680_100027191 3300005336 Bacteria 4581
62 Ga0070680_100160063 3300005336 Bacteria 1892
63 Ga0070680_100263208 3300005336 Bacteria 1459
64 Ga0068868_100008896 3300005338 Bacteria 7197
65 Ga0068868_100152170 3300005338 Bacteria 1906
66 Ga0070660_100011131 3300005339 Bacteria 6380
67 Ga0070660_100068056 3300005339 Bacteria 2775
68 Ga0070661_100038900 3300005344 Bacteria 3464
69 Ga0070668_100000584 3300005347 Bacteria 24454
70 Ga0070668_100001376 3300005347 Bacteria 17440
71 Ga0070668_100001584 3300005347 Bacteria 16459
72 Ga0070668_100004146 3300005347 Bacteria 10732
73 Ga0070668_100006149 3300005347 Bacteria 8894
74 Ga0070668_100007411 3300005347 Bacteria 8143
75 Ga0070668_100009650 3300005347 Bacteria 7160
76 Ga0070668_100011336 3300005347 Bacteria 6641
77 Ga0070669_100039331 3300005353 Bacteria 3436
78 Ga0070669_100056464 3300005353 Bacteria 2879
79 Ga0070669_100101527 3300005353 Bacteria 2171
80 Ga0070671_100000209 3300005355 Bacteria 38883
81 Ga0070671_100002549 3300005355 Bacteria 14119
82 Ga0070671_100206807 3300005355 Bacteria 1664
83 Ga0070674_100005598 3300005356 Bacteria 7272
84 Ga0070673_100081992 3300005364 Bacteria 2617
85 Ga0070688_100003954 3300005365 Bacteria 7686
86 Ga0070667_100000169 3300005367 Bacteria 81539
87 Ga0070667_100004942 3300005367 Bacteria 11168
88 Ga0070667_100027219 3300005367 Bacteria 4757
89 Ga0070714_100001181 3300005435 Bacteria 18803
90 Ga0070714_100033522 3300005435 Bacteria 4293
91 Ga0070714_100067083 3300005435 Bacteria 3093
92 Ga0070714_100186792 3300005435 Bacteria 1889
93 Ga0070714_100223090 3300005435 Bacteria 1733
94 Ga0070713_100010091 3300005436 Bacteria 6810
95 Ga0070713_100014715 3300005436 Bacteria 5821
96 Ga0070713_100037311 3300005436 Bacteria 3928
97 Ga0070713_100075374 3300005436 Bacteria 2861
98 Ga0070713_100096823 3300005436 Bacteria 2548
99 Ga0070713_100165154 3300005436 Bacteria 1979
100 Ga0070710_10006545 3300005437 Bacteria 5600
101 Ga0070711_100009694 3300005439 Bacteria 5933
102 Ga0070711_100012222 3300005439 Bacteria 5358
103 Ga0070711_100023880 3300005439 Bacteria 3982
104 Ga0070711_100053079 3300005439 Bacteria 2792
105 Ga0070708_100115632 3300005445 Bacteria 2469
106 Ga0070663_100199956 3300005455 Bacteria 1559
107 Ga0070678_100029192 3300005456 Bacteria 3774
108 Ga0070662_100008266 3300005457 Bacteria 6778
109 Ga0070662_100016079 3300005457 Bacteria 5020
110 Ga0070662_100100099 3300005457 Bacteria 2192
111 Ga0070681_10000213 3300005458 Bacteria 45271
112 Ga0070681_10016080 3300005458 Bacteria 7458
113 Ga0070681_10020990 3300005458 Bacteria 6544
114 Ga0070681_10058541 3300005458 Bacteria 3832
115 Ga0070681_10081643 3300005458 Bacteria 3189
116 Ga0070681_10098715 3300005458 Bacteria 2867
117 Ga0070681_10202857 3300005458 Bacteria 1901
118 Ga0070707_100018906 3300005468 Bacteria 6488
119 Ga0070707_100087168 3300005468 Bacteria 3020
120 Ga0070707_100161609 3300005468 Bacteria 2182
121 Ga0070698_100020755 3300005471 Bacteria 6885
122 Ga0070698_100049414 3300005471 Bacteria 4293
123 Ga0070698_100066969 3300005471 Bacteria 3612
124 Ga0070698_100249573 3300005471 Bacteria 1708
125 Ga0070699_100044333 3300005518 Bacteria 3851
126 Ga0070699_100137617 3300005518 Bacteria 2155
127 Ga0070699_100239284 3300005518 Bacteria 1620
128 Ga0070679_100001596 3300005530 Bacteria 20324
129 Ga0070679_100003428 3300005530 Bacteria 14519
130 Ga0070679_100058571 3300005530 Bacteria 3838
131 Ga0070679_100145365 3300005530 Bacteria 2349
132 Ga0068853_100051683 3300005539 Bacteria 3538
133 Ga0068853_100054797 3300005539 Bacteria 3437
134 Ga0068853_100115687 3300005539 Bacteria 2387
135 Ga0068853_100261827 3300005539 Bacteria 1590
136 Ga0070695_100067300 3300005545 Bacteria 2336
137 Ga0070696_100013231 3300005546 Bacteria 5537
138 Ga0070696_100056823 3300005546 Bacteria 2730
139 Ga0070665_100000610 3300005548 Bacteria 49084
140 Ga0070665_100002779 3300005548 Bacteria 18970
141 Ga0070665_100069536 3300005548 Bacteria 3529
142 Ga0070665_100096303 3300005548 Bacteria 2964
143 Ga0070665_100168980 3300005548 Bacteria 2188
144 Ga0070704_100002436 3300005549 Bacteria 10439
145 Ga0070704_100069692 3300005549 Bacteria 2549
146 Ga0070704_100163512 3300005549 Bacteria 1763
147 Ga0068855_100000267 3300005563 Bacteria 64909
148 Ga0068855_100001693 3300005563 Bacteria 27587
149 Ga0068855_100016855 3300005563 Bacteria 8788
150 Ga0068855_100088405 3300005563 Bacteria 3579
151 Ga0070664_100187562 3300005564 Bacteria 1841
152 Ga0068857_100074831 3300005577 Bacteria 3019
153 Ga0068856_100012963 3300005614 Bacteria 8071
154 Ga0068856_100027948 3300005614 Bacteria 5504
155 Ga0068856_100030161 3300005614 Bacteria 5301
156 Ga0068852_100011907 3300005616 Bacteria 6577
157 Ga0068852_100119430 3300005616 Bacteria 2410
158 Ga0068859_100005908 3300005617 Bacteria 12424
159 Ga0068859_100021915 3300005617 Bacteria 6405
160 Ga0068859_100156163 3300005617 Bacteria 2359
161 Ga0068859_100468035 3300005617 Bacteria 1356
162 Ga0068864_100000284 3300005618 Bacteria 45254
163 Ga0068864_100000461 3300005618 Bacteria 35261
164 Ga0068864_100026541 3300005618 Bacteria 4885
165 Ga0068864_100145254 3300005618 Unclassified 2144
166 Ga0068851_10009846 3300005834 Bacteria 4452
167 Ga0068863_100000101 3300005841 Bacteria 92384
168 Ga0068863_100000185 3300005841 Bacteria 66169
169 Ga0068863_100004288 3300005841 Bacteria 14042
170 Ga0068863_100013552 3300005841 Bacteria 7866
171 Ga0068863_100071333 3300005841 Bacteria 3286
172 Ga0068863_100100629 3300005841 Bacteria 2747
173 Ga0068858_100000271 3300005842 Bacteria 55626
174 Ga0068858_100006545 3300005842 Bacteria 11329
175 Ga0068858_100009567 3300005842 Bacteria 9247
176 Ga0068860_100000051 3300005843 Bacteria 208179
177 Ga0068860_100000211 3300005843 Bacteria 91286
178 Ga0068860_100006897 3300005843 Bacteria 11391
179 Ga0068860_100009534 3300005843 Bacteria 9644
180 Ga0068860_100023514 3300005843 Bacteria 5955
181 Ga0068860_100038489 3300005843 Bacteria 4575
182 Ga0068860_100076811 3300005843 Bacteria 3176
183 Ga0068862_100002355 3300005844 Bacteria 16829
184 Ga0068862_100018741 3300005844 Bacteria 5765
185 Ga0068862_100053014 3300005844 Bacteria 3472
186 Ga0068862_100088048 3300005844 Bacteria 2701
187 Ga0081455_10008107 3300005937 Bacteria 10963
188 Ga0081455_10026716 3300005937 Bacteria 5301
189 Ga0081538_10006460 3300005981 Bacteria 10317
190 Ga0081540_1019744 3300005983 Bacteria 4082
191 Ga0081539_10001888 3300005985 Bacteria 32580
192 Ga0081539_10015621 3300005985 Bacteria 5504
193 Ga0070717_10000290 3300006028 Bacteria 33745
194 Ga0070717_10017976 3300006028 Bacteria 5515
195 Ga0070717_10065502 3300006028 Bacteria 3021
196 Ga0075365_10026026 3300006038 Bacteria 3709
197 Ga0075365_10042899 3300006038 Bacteria 2959
198 Ga0075365_10059534 3300006038 Bacteria 2546
199 Ga0075368_10010676 3300006042 Bacteria 3325
200 Ga0075368_10074008 3300006042 Bacteria 1379
201 Ga0075363_100005046 3300006048 Bacteria 5840
202 Ga0075363_100090541 3300006048 Bacteria 1683
203 Ga0075364_10007544 3300006051 Bacteria 6467
204 Ga0075364_10009110 3300006051 Bacteria 5945
205 Ga0075364_10047139 3300006051 Bacteria 2806
206 Ga0070712_100002544 3300006175 Bacteria 11264
207 Ga0070712_100074225 3300006175 Bacteria 2443
208 Ga0075362_10000564 3300006177 Bacteria 10793
209 Ga0075362_10002519 3300006177 Bacteria 6169
210 Ga0075362_10003140 3300006177 Bacteria 5706
211 Ga0075362_10008081 3300006177 Bacteria 4010
212 Ga0075362_10034628 3300006177 Bacteria 2202
213 Ga0075367_10000028 3300006178 Bacteria 31226
214 Ga0075367_10000812 3300006178 Bacteria 12330
215 Ga0075367_10002060 3300006178 Bacteria 8998
216 Ga0075367_10007484 3300006178 Bacteria 5594
217 Ga0075367_10014633 3300006178 Bacteria 4249
218 Ga0075367_10015872 3300006178 Bacteria 4104
219 Ga0075367_10036221 3300006178 Bacteria 2860
220 Ga0075369_10000566 3300006186 Bacteria 11697
221 Ga0075369_10013908 3300006186 Bacteria 3205
222 Ga0075369_10027042 3300006186 Bacteria 2396
223 Ga0075366_10004811 3300006195 Bacteria 7284
224 Ga0075366_10016899 3300006195 Bacteria 4193
225 Ga0075366_10022022 3300006195 Bacteria 3705
226 Ga0097621_100092973 3300006237 Bacteria 2527
227 Ga0075370_10109241 3300006353 Bacteria 1605
228 Ga0075428_100111725 3300006844 Bacteria 2977
229 Ga0075430_100007703 3300006846 Bacteria 9096
230 Ga0075430_100164948 3300006846 Bacteria 1843
231 Ga0075433_10024821 3300006852 Bacteria 5064
232 Ga0075434_100162133 3300006871 Bacteria 2256
233 Ga0075434_100322164 3300006871 Bacteria 1566
234 Ga0075429_100051899 3300006880 Bacteria 3567
235 Ga0075429_100115094 3300006880 Bacteria 2351
236 Ga0075436_100024956 3300006914 Bacteria 4110
237 Ga0075436_100033782 3300006914 Bacteria 3525
238 Ga0075436_100098073 3300006914 Bacteria 2039
239 Ga0097620_100005908 3300006931 Bacteria 12424
240 Ga0097620_100021915 3300006931 Bacteria 6405
241 Ga0097620_100156153 3300006931 Bacteria 2359
242 Ga0097620_100467967 3300006931 Bacteria 1356
243 Ga0099824_1027176 3300006942 Bacteria 2812
244 Ga0075435_100144345 3300007076 Bacteria 1998
245 Ga0099795_10005208 3300007788 Bacteria 3435
246 Ga0099795_10059757 3300007788 Bacteria 1411
247 Ga0105240_10000287 3300009093 Bacteria 98443
248 Ga0105240_10000874 3300009093 Bacteria 54221
249 Ga0105240_10001197 3300009093 Bacteria 45241
250 Ga0105240_10103180 3300009093 Bacteria 3465
251 Ga0105240_10121211 3300009093 Bacteria 3149
252 Ga0105240_10141508 3300009093 Bacteria 2876
253 Ga0105240_10424181 3300009093 Bacteria 1494
254 Ga0111539_10000041 3300009094 Bacteria 131679
255 Ga0111539_10005028 3300009094 Bacteria 17187
256 Ga0111539_10043198 3300009094 Bacteria 5405
257 Ga0111539_10100322 3300009094 Bacteria 3400
258 Ga0105245_10156045 3300009098 Bacteria 2162
259 Ga0105247_10031668 3300009101 Bacteria 3210
260 Ga0114129_10009933 3300009147 Bacteria 13566
261 Ga0114129_10058588 3300009147 Bacteria 5387
262 Ga0114129_10125067 3300009147 Bacteria 3536
263 Ga0114129_10168313 3300009147 Bacteria 2989
264 Ga0114129_10301951 3300009147 Bacteria 2133
265 Ga0114129_10388447 3300009147 Bacteria 1841
266 Ga0105243_10055150 3300009148 Bacteria 3157
267 Ga0105241_10009670 3300009174 Bacteria 7086
268 Ga0105242_10223647 3300009176 Bacteria 1684
269 Ga0105248_10000349 3300009177 Bacteria 54104
270 Ga0105248_10001964 3300009177 Bacteria 22859
271 Ga0105248_10027599 3300009177 Bacteria 6322
272 Ga0105248_10053132 3300009177 Bacteria 4546
273 Ga0105248_10062788 3300009177 Bacteria 4171
274 Ga0105248_10162713 3300009177 Bacteria 2516
275 Ga0105248_10177416 3300009177 Bacteria 2401
276 Ga0105248_10345857 3300009177 Bacteria 1674
277 Ga0105237_10002777 3300009545 Bacteria 21277
278 Ga0105237_10190789 3300009545 Bacteria 2049
279 Ga0105237_10244215 3300009545 Bacteria 1797
280 Ga0105238_10003746 3300009551 Bacteria 15114
281 Ga0105238_10005330 3300009551 Bacteria 12704
282 Ga0105238_10051165 3300009551 Bacteria 4155
283 Ga0105238_10119769 3300009551 Bacteria 2612
284 Ga0105238_10211098 3300009551 Bacteria 1917
285 Ga0105238_10356358 3300009551 Bacteria 1452
286 Ga0105249_10001221 3300009553 Bacteria 22640
287 Ga0105249_10157607 3300009553 Bacteria 2191
288 Ga0105148_100001 3300009978 Bacteria 58900
289 Ga0105033_100251 3300009986 Bacteria 4205
290 Ga0105239_10001954 3300010375 Bacteria 26883
291 Ga0105239_10003114 3300010375 Bacteria 20575
292 Ga0105239_10012735 3300010375 Bacteria 9357
293 Ga0105239_10032508 3300010375 Bacteria 5732
294 Ga0105239_10102494 3300010375 Bacteria 3167
295 Ga0105239_10158045 3300010375 Bacteria 2532
296 Ga0105239_10170963 3300010375 Bacteria 2430
297 Ga0157373_10018656 3300013100 Bacteria 5049
298 Ga0157370_10010836 3300013104 Bacteria 9576
299 Ga0157370_10011034 3300013104 Bacteria 9476
300 Ga0157369_10020792 3300013105 Bacteria 7335
301 Ga0157369_10122712 3300013105 Bacteria 2756
302 Ga0157369_10335420 3300013105 Bacteria 1571
303 Ga0171462_1009 3300013250 Bacteria 344993
304 Ga0157378_10046086 3300013297 Bacteria 3876
305 Ga0163162_10101686 3300013306 Bacteria 2967
306 Ga0163162_10118704 3300013306 Bacteria 2747
307 Ga0163162_10293934 3300013306 Bacteria 1756
308 Ga0157372_10011020 3300013307 Bacteria 9623
309 Ga0157372_10069791 3300013307 Bacteria 3952
310 Ga0157372_10074817 3300013307 Bacteria 3820
311 Ga0157375_10549956 3300013308 Bacteria 1316
312 Ga0163163_10038387 3300014325 Bacteria 4668
313 Ga0163163_10151940 3300014325 Bacteria 2359
314 Ga0163163_10156415 3300014325 Bacteria 2324
315 Ga0163163_10157466 3300014325 Bacteria 2316
316 Ga0163163_10223001 3300014325 Bacteria 1934
317 Ga0163163_10347325 3300014325 Bacteria 1539
318 Ga0157380_10157152 3300014326 Bacteria 1972
319 Ga0182008_10011892 3300014497 Bacteria 4612
320 Ga0182008_10034895 3300014497 Bacteria 2521
321 Ga0182008_10048830 3300014497 Bacteria 2101
322 Ga0157379_10000119 3300014968 Bacteria 54670
323 Ga0157379_10010097 3300014968 Bacteria 8231
324 Ga0157379_10066237 3300014968 Bacteria 3229
325 Ga0157379_10079688 3300014968 Bacteria 2933
326 Ga0163161_10009072 3300017792 Bacteria 6879
327 Ga0206350_11260676 3300020080 Bacteria 1450
328 Ga0214544_1000002 3300021320 Bacteria 753857
329 Ga0214542_1000001 3300021321 Bacteria 1018696
330 Ga0214545_1000001 3300021324 Bacteria 1092817
331 Ga0214543_1000001 3300021327 Bacteria 776921
332 Ga0213872_10015277 3300021361 Bacteria 3573
333 Ga0213872_10016262 3300021361 Bacteria 3454
334 Ga0213875_10000132 3300021388 Bacteria 82929
335 Ga0213875_10000451 3300021388 Bacteria 35624
336 Ga0213875_10000936 3300021388 Bacteria 20989
337 Ga0213875_10001552 3300021388 Bacteria 14716
338 Ga0213875_10001756 3300021388 Bacteria 13594
339 Ga0213871_10000041 3300021441 Bacteria 9498
340 Ga0224712_10012001 3300022467 Bacteria 2709
341 Ga0224712_10071142 3300022467 Bacteria 1412
342 Ga0209147_100894 3300025229 Bacteria 13651
343 Ga0209026_1001299 3300025250 Bacteria 11295
344 Ga0209148_1000732 3300025254 Bacteria 25625
345 Ga0209565_1000183 3300025263 Bacteria 76983
346 Ga0209455_1000572 3300025272 Bacteria 24133
347 Ga0209673_1001029 3300025273 Bacteria 33050
348 Ga0209673_1006747 3300025273 Bacteria 5462
349 Ga0209130_1000235 3300025284 Bacteria 71379
350 Ga0209130_1004232 3300025284 Bacteria 5578
351 Ga0209675_1000239 3300025291 Bacteria 54796
352 Ga0209675_1003504 3300025291 Bacteria 7419
353 Ga0209675_1015088 3300025291 Bacteria 2314
354 Ga0209676_1000169 3300025292 Bacteria 155600
355 Ga0209676_1000284 3300025292 Bacteria 104999
356 Ga0209676_1000319 3300025292 Bacteria 93542
357 Ga0209676_1008945 3300025292 Bacteria 4395
358 Ga0209025_1000010 3300025294 Bacteria 986612
359 Ga0209025_1000146 3300025294 Bacteria 180022
360 Ga0209025_1000149 3300025294 Bacteria 173393
361 Ga0209025_1020824 3300025294 Bacteria 3563
362 Ga0209025_1037455 3300025294 Bacteria 2152
363 Ga0209025_1038926 3300025294 Bacteria 2083
364 Ga0209564_1000019 3300025295 Bacteria 573686
365 Ga0209564_1000034 3300025295 Bacteria 444284
366 Ga0209564_1018697 3300025295 Bacteria 2628
367 Ga0209758_1000029 3300025297 Bacteria 520787
368 Ga0209758_1000252 3300025297 Bacteria 108214
369 Ga0209758_1001837 3300025297 Bacteria 23337
370 Ga0209758_1002076 3300025297 Bacteria 21317
371 Ga0209758_1005157 3300025297 Bacteria 10288
372 Ga0209758_1007713 3300025297 Bacteria 7227
373 Ga0209758_1011627 3300025297 Bacteria 5066
374 Ga0209050_1000095 3300025298 Bacteria 242722
375 Ga0209050_1000737 3300025298 Bacteria 47468
376 Ga0209050_1001426 3300025298 Bacteria 25794
377 Ga0209050_1005949 3300025298 Bacteria 7418
378 Ga0209050_1011618 3300025298 Bacteria 4148
379 Ga0209050_1011818 3300025298 Bacteria 4086
380 Ga0209256_1000026 3300025299 Bacteria 432835
381 Ga0209256_1000182 3300025299 Bacteria 122471
382 Ga0209256_1000694 3300025299 Bacteria 44757
383 Ga0209256_1015406 3300025299 Bacteria 2676
384 Ga0207426_1000046 3300025302 Bacteria 422271
385 Ga0207426_1000626 3300025302 Bacteria 44875
386 Ga0209051_1001836 3300025303 Bacteria 16785
387 Ga0209257_1000106 3300025304 Bacteria 242634
388 Ga0209257_1000352 3300025304 Bacteria 94530
389 Ga0209257_1000743 3300025304 Bacteria 49251
390 Ga0209257_1001595 3300025304 Bacteria 25963
391 Ga0209257_1016114 3300025304 Bacteria 3049
392 Ga0207682_10003431 3300025893 Bacteria 6894
393 Ga0207692_10004177 3300025898 Bacteria 5701
394 Ga0207692_10022843 3300025898 Bacteria 2885
395 Ga0207710_10012358 3300025900 Bacteria 3593
396 Ga0207680_10023407 3300025903 Bacteria 3373
397 Ga0207647_10001677 3300025904 Bacteria 17048
398 Ga0207647_10004458 3300025904 Bacteria 10378
399 Ga0207645_10049491 3300025907 Bacteria 2683
400 Ga0207705_10006356 3300025909 Bacteria 8763
401 Ga0207654_10008215 3300025911 Bacteria 5267
402 Ga0207654_10032342 3300025911 Bacteria 2890
403 Ga0207707_10006168 3300025912 Bacteria 10474
404 Ga0207707_10016865 3300025912 Bacteria 6362
405 Ga0207707_10023011 3300025912 Bacteria 5450
406 Ga0207707_10049183 3300025912 Bacteria 3673
407 Ga0207707_10180922 3300025912 Bacteria 1841
408 Ga0207707_10199761 3300025912 Bacteria 1743
409 Ga0207695_10000012 3300025913 Bacteria 840961
410 Ga0207695_10001005 3300025913 Bacteria 49964
411 Ga0207695_10006511 3300025913 Bacteria 15126
412 Ga0207695_10028663 3300025913 Bacteria 6165
413 Ga0207695_10081855 3300025913 Bacteria 3266
414 Ga0207695_10152083 3300025913 Bacteria 2253
415 Ga0207695_10279054 3300025913 Bacteria 1565
416 Ga0207671_10002149 3300025914 Bacteria 21495
417 Ga0207671_10088695 3300025914 Bacteria 2327
418 Ga0207671_10130797 3300025914 Bacteria 1926
419 Ga0207693_10009794 3300025915 Bacteria 7799
420 Ga0207693_10207502 3300025915 Bacteria 1540
421 Ga0207663_10014871 3300025916 Bacteria 4276
422 Ga0207660_10003027 3300025917 Bacteria 11000
423 Ga0207660_10034296 3300025917 Bacteria 3517
424 Ga0207660_10047791 3300025917 Bacteria 3027
425 Ga0207657_10077580 3300025919 Bacteria 2799
426 Ga0207652_10006822 3300025921 Bacteria 9200
427 Ga0207652_10008514 3300025921 Bacteria 8255
428 Ga0207652_10018920 3300025921 Bacteria 5655
429 Ga0207652_10033786 3300025921 Bacteria 4308
430 Ga0207652_10075431 3300025921 Bacteria 2939
431 Ga0207652_10131431 3300025921 Bacteria 2233
432 Ga0207652_10132720 3300025921 Bacteria 2222
433 Ga0207646_10020030 3300025922 Bacteria 6204
434 Ga0207681_10027788 3300025923 Bacteria 3661
435 Ga0207681_10031848 3300025923 Bacteria 3447
436 Ga0207694_10000156 3300025924 Bacteria 70186
437 Ga0207694_10040185 3300025924 Bacteria 3601
438 Ga0207694_10061926 3300025924 Bacteria 2912
439 Ga0207694_10169746 3300025924 Bacteria 1766
440 Ga0207650_10000315 3300025925 Bacteria 47489
441 Ga0207659_10020609 3300025926 Bacteria 4361
442 Ga0207659_10095584 3300025926 Bacteria 2229
443 Ga0207687_10191253 3300025927 Bacteria 1593
444 Ga0207687_10262125 3300025927 Bacteria 1378
445 Ga0207700_10043519 3300025928 Bacteria 3298
446 Ga0207700_10051190 3300025928 Bacteria 3081
447 Ga0207700_10116473 3300025928 Bacteria 2159
448 Ga0207664_10000344 3300025929 Bacteria 34246
449 Ga0207664_10102963 3300025929 Bacteria 2361
450 Ga0207644_10000679 3300025931 Bacteria 21492
451 Ga0207644_10044716 3300025931 Bacteria 3147
452 Ga0207690_10130557 3300025932 Bacteria 1838
453 Ga0207706_10041661 3300025933 Bacteria 4070
454 Ga0207706_10045644 3300025933 Bacteria 3881
455 Ga0207706_10049658 3300025933 Bacteria 3707
456 Ga0207686_10230674 3300025934 Bacteria 1342
457 Ga0207665_10055663 3300025939 Bacteria 2669
458 Ga0207691_10014107 3300025940 Bacteria 7622
459 Ga0207711_10001341 3300025941 Bacteria 23240
460 Ga0207711_10002092 3300025941 Bacteria 18020
461 Ga0207711_10022190 3300025941 Bacteria 5308
462 Ga0207711_10025515 3300025941 Bacteria 4957
463 Ga0207679_10045212 3300025945 Bacteria 3183
464 Ga0207667_10000068 3300025949 Bacteria 180716
465 Ga0207667_10016842 3300025949 Bacteria 8246
466 Ga0207667_10024236 3300025949 Bacteria 6667
467 Ga0207667_10123693 3300025949 Bacteria 2665
468 Ga0207712_10000203 3300025961 Bacteria 59867
469 Ga0207712_10196656 3300025961 Bacteria 1595
470 Ga0207668_10000007 3300025972 Bacteria 190613
471 Ga0207668_10000427 3300025972 Bacteria 26560
472 Ga0207668_10001120 3300025972 Bacteria 15979
473 Ga0207668_10002487 3300025972 Bacteria 10758
474 Ga0207668_10027033 3300025972 Bacteria 3734
475 Ga0207668_10032299 3300025972 Bacteria 3457
476 Ga0207668_10065961 3300025972 Bacteria 2564
477 Ga0207668_10101201 3300025972 Bacteria 2141
478 Ga0207658_10001368 3300025986 Bacteria 19037
479 Ga0207658_10001403 3300025986 Bacteria 18780
480 Ga0207658_10008299 3300025986 Bacteria 7074
481 Ga0207677_10137945 3300026023 Bacteria 1863
482 Ga0207703_10000105 3300026035 Bacteria 99702
483 Ga0207703_10003669 3300026035 Bacteria 12795
484 Ga0207703_10011130 3300026035 Bacteria 7005
485 Ga0207639_10001279 3300026041 Bacteria 16988
486 Ga0207639_10020905 3300026041 Bacteria 4695
487 Ga0207639_10064567 3300026041 Bacteria 2838
488 Ga0207678_10000402 3300026067 Bacteria 39370
489 Ga0207678_10132688 3300026067 Bacteria 2125
490 Ga0207708_10024701 3300026075 Bacteria 4545
491 Ga0207702_10004355 3300026078 Bacteria 12623
492 Ga0207702_10010520 3300026078 Bacteria 7738
493 Ga0207641_10000109 3300026088 Bacteria 121126
494 Ga0207641_10001763 3300026088 Bacteria 20861
495 Ga0207641_10002034 3300026088 Bacteria 19258
496 Ga0207641_10030198 3300026088 Bacteria 4487
497 Ga0207676_10000159 3300026095 Bacteria 59242
498 Ga0207676_10001888 3300026095 Bacteria 15316
499 Ga0207676_10017898 3300026095 Bacteria 5142
500 Ga0207674_10010437 3300026116 Bacteria 10520
501 Ga0207674_10016891 3300026116 Bacteria 7974
502 Ga0207674_10083288 3300026116 Bacteria 3198
503 Ga0207675_100448159 3300026118 Bacteria 1279
504 Ga0207683_10008376 3300026121 Bacteria 8843
505 Ga0207683_10025859 3300026121 Bacteria 5065
506 Ga0207683_10348770 3300026121 Bacteria 1358
507 Ga0207698_10028109 3300026142 Bacteria 4005
508 Ga0207698_10046813 3300026142 Bacteria 3270
509 Ga0207698_10084003 3300026142 Bacteria 2579
510 Ga0207698_10159691 3300026142 Bacteria 1969
511 Ga0209813_10000019 3300027866 Bacteria 75575
512 Ga0207428_10001809 3300027907 Bacteria 21897
513 Ga0268266_10001260 3300028379 Bacteria 30951
514 Ga0268266_10006212 3300028379 Bacteria 10972
515 Ga0268266_10013295 3300028379 Bacteria 7094
516 Ga0268266_10224025 3300028379 Bacteria 1730
517 Ga0268265_10002114 3300028380 Bacteria 15413
518 Ga0268265_10002154 3300028380 Bacteria 15249
519 Ga0268265_10003045 3300028380 Bacteria 12224
520 Ga0268265_10010280 3300028380 Bacteria 6321
521 Ga0268264_10000021 3300028381 Bacteria 481580
522 Ga0268264_10000270 3300028381 Bacteria 90954
523 Ga0268264_10003426 3300028381 Bacteria 13679
524 Ga0268264_10009573 3300028381 Bacteria 8022
525 Ga0265334_10001920 3300028573 Bacteria 9868
526 Ga0265318_10005668 3300028577 Bacteria 5843
527 Ga0307517_10000714 3300028786 Bacteria 57225
528 Ga0307517_10018527 3300028786 Bacteria 8998
529 Ga0307515_10003572 3300028794 Bacteria 32658
530 Ga0307515_10008637 3300028794 Bacteria 19826
531 Ga0307515_10040608 3300028794 Bacteria 7351
532 Ga0307515_10155748 3300028794 Bacteria 2359
533 Ga0265338_10004430 3300028800 Bacteria 18977
534 Ga0265338_10026563 3300028800 Bacteria 5835
535 Ga0265338_10045536 3300028800 Bacteria 4031
536 Ga0265324_10001398 3300029957 Bacteria 13930
537 Ga0307511_10015070 3300030521 Bacteria 7500
538 Ga0265330_10041268 3300031235 Bacteria 2046
539 Ga0265332_10065927 3300031238 Bacteria 1546
540 Ga0265325_10003952 3300031241 Bacteria 9485
541 Ga0265325_10011897 3300031241 Bacteria 4989
542 Ga0265325_10023938 3300031241 Bacteria 3327
543 Ga0265340_10015778 3300031247 Bacteria 3919
544 Ga0265340_10024189 3300031247 Bacteria 3087
545 Ga0265340_10030478 3300031247 Bacteria 2702
546 Ga0265339_10000024 3300031249 Bacteria 169774
547 Ga0265331_10000162 3300031250 Bacteria 84055
548 Ga0265331_10063233 3300031250 Unclassified 1744
549 Ga0265327_10011785 3300031251 Bacteria 5980
550 Ga0265327_10039006 3300031251 Bacteria 2584
551 Ga0265316_10040642 3300031344 Bacteria 3727
552 Ga0265316_10086217 3300031344 Bacteria 2401
553 Ga0307513_10000063 3300031456 Bacteria 142538
554 Ga0307513_10007717 3300031456 Bacteria 13899
555 Ga0307513_10009979 3300031456 Bacteria 11979
556 Ga0307513_10017608 3300031456 Bacteria 8564
557 Ga0307513_10115642 3300031456 Bacteria 2664
558 Ga0307513_10196494 3300031456 Bacteria 1863
559 Ga0265313_10000006 3300031595 Bacteria 183184
560 Ga0265313_10000839 3300031595 Bacteria 30966
561 Ga0265313_10032122 3300031595 Bacteria 2685
562 Ga0307508_10111558 3300031616 Bacteria 2335
563 Ga0265314_10010786 3300031711 Bacteria 7597
564 Ga0265342_10040177 3300031712 Bacteria 2838
565 Ga0265342_10072636 3300031712 Bacteria 2002
566 Ga0316576_10010072 3300031727 Bacteria 6123
567 Ga0316578_10039845 3300031728 Bacteria 2714
568 Ga0307405_10005099 3300031731 Bacteria 6289
569 Ga0307413_10034611 3300031824 Bacteria 2889
570 Ga0307410_10058026 3300031852 Bacteria 2638
571 Ga0307409_100094808 3300031995 Bacteria 2457
572 Ga0307416_100016945 3300032002 Bacteria 5081
573 Ga0307510_10002995 3300033180 Bacteria 19438
574 Ga0373936_0022443 3300035113 Bacteria 2458
575 Ga0373939_0000982 3300035114 Bacteria 7076
576 Ga0373941_0027967 3300035115 Bacteria 1651
577 Ga0373943_0015678 3300035170 Bacteria 3446
578 Ga0373943_0136432 3300035170 Bacteria 1318
579 Ga0373955_0013635 3300035172 Bacteria 3937
580 Ga0373961_0006992 3300035241 Bacteria 2717
581 Ga0316574_0054878 3300035398 Bacteria 2489
582 Ga0316574_0056685 3300035398 Bacteria 2452
583 Ga0373931_0010799 3300035691 Bacteria 4397
584 Ga0373931_0036668 3300035691 Bacteria 2557
585 Ga0373931_0074602 3300035691 Bacteria 1858
586 Ga0373931_0210880 3300035691 Bacteria 1165
587 Ga0373935_0010737 3300035692 Bacteria 5502
588 Ga0373935_0030455 3300035692 Bacteria 3345
589 Ga0373935_0036814 3300035692 Bacteria 3061
590 Ga0373927_0000925 3300035695 Bacteria 22236
591 Ga0373927_0060216 3300035695 Bacteria 2456
592 Ga0373947_0009938 3300035725 Bacteria 5466
593 Ga0373947_0022783 3300035725 Bacteria 3635
594 Ga0373947_0068438 3300035725 Bacteria 2171
595 Ga0373947_0090168 3300035725 Bacteria 1910
596 Ga0373947_0094826 3300035725 Bacteria 1867
597 Ga0373937_0003803 3300036401 Bacteria 12752
598 Ga0373937_0005722 3300036401 Bacteria 10677
599 Ga0373937_0008212 3300036401 Bacteria 9066
600 Ga0373937_0025405 3300036401 Bacteria 5347
601 Ga0373937_0068094 3300036401 Bacteria 3281
602 Ga0373937_0146539 3300036401 Bacteria 2210
603 Ga0373937_0215721 3300036401 Bacteria 1806
604 Ga0316582_0084657 3300036647 Bacteria 2076
605 Ga0316584_0042846 3300036712 Bacteria 3374
606 Ga0316584_0082630 3300036712 Bacteria 2406
607 Ga0316584_0191992 3300036712 Bacteria 1509
608 Ga0373925_0007893 3300037068 Bacteria 7751
609 Ga0373925_0023328 3300037068 Bacteria 4515
610 Ga0373925_0106217 3300037068 Bacteria 2164
611 Ga0373925_0151637 3300037068 Bacteria 1820
612 Ga0373925_0250306 3300037068 Bacteria 1421
613 Ga0395899_0002095 3300037312 Bacteria 16380
614 Ga0395899_0008589 3300037312 Bacteria 7865
615 Ga0395899_0022653 3300037312 Bacteria 4758
616 Ga0395900_0002747 3300037418 Bacteria 19217
617 Ga0395900_0004161 3300037418 Bacteria 15398
618 Ga0395900_0025037 3300037418 Bacteria 6108
619 Ga0395900_0059962 3300037418 Bacteria 3916
620 Ga0395900_0377084 3300037418 Bacteria 1387
621 Ga0395900_0505181 3300037418 Bacteria 1159
622 Ga0395898_0020728 3300037466 Bacteria 6674
623 Ga0395898_0119465 3300037466 Bacteria 2525
624 Ga0395905_0000174 3300037471 Bacteria 104301
625 Ga0395905_0000711 3300037471 Bacteria 44086
626 Ga0395905_0022173 3300037471 Bacteria 6008
627 Ga0395905_0029294 3300037471 Bacteria 5187
628 Ga0436364_0179869 3300037853 Bacteria 1908
629 Ga0436364_0717863 3300037853 Bacteria 145182
630 Ga0436364_0810561 3300037853 Bacteria 34372
631 Ga0436364_0956907 3300037853 Bacteria 10485
632 Ga0436364_0992577 3300037853 Bacteria 61189
633 Ga0436364_1161582 3300037853 Bacteria 4717
634 Ga0436364_1279775 3300037853 Bacteria 2908
635 Ga0436364_1305431 3300037853 Bacteria 36077
636 Ga0436364_1401862 3300037853 Bacteria 3526
637 Ga0436364_1451573 3300037853 Bacteria 15638
638 Ga0395901_0001835 3300038443 Bacteria 21949
639 Ga0395901_0003662 3300038443 Bacteria 15497
640 Ga0395901_0007828 3300038443 Bacteria 10783
641 Ga0395901_0028623 3300038443 Bacteria 5730
642 Ga0395901_0034805 3300038443 Bacteria 5202
643 Ga0395901_0169614 3300038443 Bacteria 2290
644 Ga0436365_0578833 3300039437 Bacteria 16736
645 Ga0436365_1543965 3300039437 Bacteria 1516
646 Ga0436365_1878082 3300039437 Bacteria 4023
647 Ga0436360_0157856 3300039438 Bacteria 21123
648 Ga0436360_0998447 3300039438 Bacteria 2093
649 Ga0436360_1052754 3300039438 Bacteria 4290
650 Ga0436360_1359148 3300039438 Bacteria 7070
651 Ga0436361_0060422 3300039447 Bacteria 3458
652 Ga0436361_0106319 3300039447 Bacteria 3166
653 Ga0436361_0211622 3300039447 Bacteria 7071
654 Ga0436361_0409735 3300039447 Bacteria 8288
655 Ga0436361_0480426 3300039447 Bacteria 1647
656 Ga0436361_0574409 3300039447 Bacteria 2999
657 Ga0436361_0909929 3300039447 Bacteria 3694
658 Ga0436361_0996213 3300039447 Bacteria 28534
659 Ga0436361_1100325 3300039447 Bacteria 14756
660 Ga0436363_0278096 3300039450 Bacteria 3303
661 Ga0436363_0405125 3300039450 Bacteria 7901
662 Ga0436363_0514829 3300039450 Bacteria 1475
663 Ga0436363_1198557 3300039450 Bacteria 2576
664 Ga0436363_1681949 3300039450 Bacteria 34688
665 Ga0436362_0536913 3300039453 Bacteria 6058
666 Ga0436362_0548901 3300039453 Bacteria 2259
667 Ga0436362_0729911 3300039453 Bacteria 3390
668 Ga0451853_1379231 3300041512 Bacteria 3276
669 Ga0439441_006883 3300042001 Bacteria 1815
670 Ga0439446_0021669 3300042156 Bacteria 1817
671 Ga0466963_0067164 3300044694 Bacteria 2406
672 Ga0466959_0122789 3300045049 Bacteria 1845
673 Ga0451576_0002320 3300045051 Bacteria 28818
674 Ga0466967_0037584 3300045976 Bacteria 4145
675 Ga0466967_0053041 3300045976 Bacteria 3563
676 Ga0495617_011202 3300046452 Bacteria 3063
677 Ga0495627_000112 3300046453 Bacteria 101337
678 Ga0495627_000206 3300046453 Bacteria 63802
679 Ga0495627_000654 3300046453 Bacteria 26690
680 Ga0495592_0035657 3300046454 Bacteria 3749
681 Ga0495629_0038576 3300046459 Bacteria 3364
682 Ga0495629_0052952 3300046459 Bacteria 2840
683 Ga0495638_0000230 3300046460 Bacteria 76565
684 Ga0495638_0000688 3300046460 Bacteria 36751
685 Ga0495638_0002300 3300046460 Bacteria 15755
686 Ga0495638_0021896 3300046460 Bacteria 4201
687 Ga0495638_0025076 3300046460 Bacteria 3880
688 Ga0495638_0034944 3300046460 Bacteria 3206
689 Ga0495638_0037556 3300046460 Bacteria 3080
690 Ga0495638_0116647 3300046460 Bacteria 1581
691 Ga0495651_0021640 3300046462 Bacteria 4999
692 Ga0495651_0073840 3300046462 Bacteria 2588
693 Ga0495653_0029597 3300046463 Bacteria 4370
694 Ga0495653_0084457 3300046463 Bacteria 2338
695 Ga0495650_0000207 3300046471 Bacteria 127568
696 Ga0495580_0005218 3300046472 Bacteria 10792
697 Ga0495580_0023817 3300046472 Bacteria 4490
698 Ga0495664_0003101 3300046477 Bacteria 9010
699 Ga0495664_0158121 3300046477 Bacteria 1375
700 Ga0495584_0030416 3300046491 Bacteria 2735
701 Ga0495607_0033225 3300046501 Bacteria 3140
702 Ga0495583_0000025 3300046506 Bacteria 263775
703 Ga0495606_0016964 3300046507 Bacteria 5526
704 Ga0495608_0010439 3300046511 Bacteria 6481
705 Ga0495608_0012618 3300046511 Bacteria 5863
706 Ga0495610_0000085 3300046512 Bacteria 112390
707 Ga0495610_0000794 3300046512 Bacteria 29605
708 Ga0495610_0003006 3300046512 Bacteria 13537
709 Ga0495610_0003243 3300046512 Bacteria 12868
710 Ga0495610_0003341 3300046512 Bacteria 12593
711 Ga0495610_0069311 3300046512 Bacteria 1651
712 Ga0495616_0000461 3300046513 Bacteria 30938
713 Ga0495616_0001257 3300046513 Bacteria 17834
714 Ga0495616_0037938 3300046513 Bacteria 2476
715 Ga0495618_0008723 3300046514 Bacteria 6126
716 Ga0495620_0009408 3300046515 Bacteria 5199
717 Ga0495620_0042212 3300046515 Bacteria 1994
718 Ga0495628_0046984 3300046516 Bacteria 3427
719 Ga0495628_0050079 3300046516 Bacteria 3305
720 Ga0495632_0000095 3300046519 Bacteria 89499
721 Ga0495632_0000380 3300046519 Bacteria 42320
722 Ga0495632_0000545 3300046519 Bacteria 35398
723 Ga0495632_0000761 3300046519 Bacteria 28951
724 Ga0495632_0064485 3300046519 Bacteria 1771
725 Ga0495637_0001011 3300046520 Bacteria 17698
726 Ga0495637_0010056 3300046520 Bacteria 4593
727 Ga0495637_0022075 3300046520 Bacteria 2908
728 Ga0495643_0000038 3300046522 Bacteria 236010
729 Ga0495643_0040613 3300046522 Bacteria 2540
730 Ga0495648_0000039 3300046524 Bacteria 185430
731 Ga0495663_0000028 3300046525 Bacteria 89526
732 Ga0495663_0001633 3300046525 Bacteria 7010
733 Ga0495642_0003816 3300046528 Bacteria 5905
734 Ga0495642_0067624 3300046528 Bacteria 1490
735 Ga0495652_0027554 3300046529 Bacteria 5004
736 Ga0495654_0000016 3300046530 Bacteria 306416
737 Ga0495654_0050754 3300046530 Bacteria 2026
738 Ga0495640_0007595 3300046533 Bacteria 8519
739 Ga0495640_0078034 3300046533 Bacteria 2207
740 Ga0495587_0006694 3300046536 Bacteria 7506
741 Ga0495587_0012147 3300046536 Bacteria 5436
742 Ga0495597_0010529 3300046542 Bacteria 4513
743 Ga0495597_0020822 3300046542 Bacteria 3051
744 Ga0495645_0033050 3300046543 Bacteria 3773
745 Ga0495633_0000136 3300046558 Bacteria 97314
746 Ga0495633_0001114 3300046558 Bacteria 21590
747 Ga0495633_0058417 3300046558 Bacteria 1811
748 Ga0495667_0055344 3300046559 Bacteria 2609
749 Ga0495668_0000040 3300046616 Bacteria 230681
750 Ga0495668_0001804 3300046616 Bacteria 19521
751 Ga0495668_0002079 3300046616 Bacteria 17342
752 Ga0495668_0011857 3300046616 Bacteria 5195
753 Ga0495668_0012223 3300046616 Bacteria 5101
754 Ga0495668_0035955 3300046616 Bacteria 2776
755 Ga0495668_0058151 3300046616 Bacteria 2134
756 Ga0495668_0077410 3300046616 Bacteria 1826
757 Ga0495634_0037347 3300046642 Bacteria 3319
758 Ga0495611_0007116 3300046648 Bacteria 4752
759 Ga0495625_0000043 3300046660 Bacteria 205715
760 Ga0495625_0002055 3300046660 Bacteria 22587
761 Ga0495625_0008772 3300046660 Bacteria 8567
762 Ga0495625_0014285 3300046660 Bacteria 6344
763 Ga0495625_0042371 3300046660 Bacteria 3309
764 Ga0495625_0056351 3300046660 Bacteria 2798
765 Ga0495625_0115003 3300046660 Bacteria 1836
766 Ga0495635_0174088 3300046663 Bacteria 1463
767 Ga0495657_0135188 3300046675 Bacteria 1541
768 Ga0495599_0006566 3300046678 Bacteria 7017
769 Ga0495599_0054218 3300046678 Bacteria 2512
770 Ga0495623_0047042 3300046679 Bacteria 2738
771 Ga0495623_0082523 3300046679 Bacteria 1986
772 Ga0495646_0010821 3300046680 Bacteria 5796
773 Ga0495646_0039710 3300046680 Bacteria 2901
774 Ga0495658_0001976 3300046683 Bacteria 10451
775 Ga0495658_0017515 3300046683 Bacteria 3703
776 Ga0495613_0129630 3300046689 Bacteria 1807
777 Ga0495624_0038255 3300046690 Bacteria 3083
778 Ga0495671_0000027 3300046692 Bacteria 236011
779 Ga0495589_0000982 3300046794 Bacteria 17349
780 Ga0495600_0006058 3300046809 Bacteria 7326
781 Ga0495660_0091121 3300046810 Bacteria 1584
782 Ga0495604_0006924 3300047317 Bacteria 8986
783 Ga0495604_0033817 3300047317 Bacteria 4046
784 Ga0495674_0014792 3300047319 Bacteria 7300
785 Ga0495672_0001651 3300047320 Bacteria 21680
786 Ga0495672_0003346 3300047320 Bacteria 13811
787 Ga0495672_0007502 3300047320 Bacteria 8196
788 Ga0495672_0023601 3300047320 Bacteria 3978
789 Ga0495672_0027507 3300047320 Bacteria 3613
790 Ga0495680_0012308 3300047322 Bacteria 7538
791 Ga0495680_0035999 3300047322 Bacteria 3980
792 Ga0495680_0039121 3300047322 Bacteria 3785
793 Ga0495687_020767 3300047443 Bacteria 3195
794 Ga0495679_001492 3300047446 Bacteria 13209
795 Ga0495673_0001020 3300047469 Bacteria 24700
796 Ga0495673_0004053 3300047469 Bacteria 9335
797 Ga0495681_0000013 3300047470 Bacteria 189155
798 Ga0495681_0001132 3300047470 Bacteria 20269
799 Ga0495681_0031256 3300047470 Bacteria 2698
800 Ga0495681_0041565 3300047470 Bacteria 2231
801 Ga0495681_0064193 3300047470 Bacteria 1683
802 Ga0495681_0086906 3300047470 Bacteria 1387
803 Ga0495684_0230238 3300047471 Bacteria 1356
804 Ga0495686_0002348 3300047472 Bacteria 18058
805 Ga0495686_0005443 3300047472 Bacteria 10042
806 Ga0495686_0005745 3300047472 Bacteria 9697
807 Ga0495686_0024572 3300047472 Bacteria 3957
808 Ga0495686_0031218 3300047472 Bacteria 3456
809 Ga0495686_0035025 3300047472 Bacteria 3230
810 Ga0495686_0077292 3300047472 Bacteria 2039
811 Ga0495686_0086892 3300047472 Bacteria 1903
812 Ga0495686_0114194 3300047472 Bacteria 1617
813 Ga0495686_0145124 3300047472 Bacteria 1397
814 Ga0495593_0068247 3300047673 Bacteria 1850
815 Ga0495602_0000162 3300048088 Bacteria 62143
816 Ga0495602_0021910 3300048088 Bacteria 6272
817 Ga0495602_0056209 3300048088 Bacteria 3462
818 Ga0496100_0124502 3300048903 Bacteria 1808
819 Ga0496102_0000575 3300048905 Bacteria 39009
820 Ga0496102_0183359 3300048905 Bacteria 1972
821 Ga0496103_0018338 3300048906 Bacteria 4198
822 Ga0496103_0161582 3300048906 Bacteria 1437
823 Ga0496104_0021209 3300048907 Bacteria 5962
824 Ga0496104_0257053 3300048907 Bacteria 1659
825 Ga0496105_0036935 3300048908 Bacteria 4025
826 Ga0496105_0071626 3300048908 Bacteria 2864
827 Ga0496106_0002493 3300048909 Bacteria 13699
828 Ga0496106_0006998 3300048909 Bacteria 8331
829 Ga0496106_0007733 3300048909 Bacteria 7956
830 Ga0496106_0076960 3300048909 Bacteria 2558
831 Ga0496106_0121952 3300048909 Bacteria 2038
832 Ga0496106_0204425 3300048909 Bacteria 1572
833 Ga0496107_0000029 3300048910 Bacteria 102345
834 Ga0496107_0000086 3300048910 Bacteria 44285
835 Ga0496108_0241207 3300048911 Bacteria 1572
836 Ga0496108_0248373 3300048911 Bacteria 1548
837 Ga0496109_0079402 3300048912 Bacteria 3023
838 Ga0496109_0116756 3300048912 Bacteria 2484
839 Ga0496110_0055094 3300048913 Bacteria 3499
840 Ga0496110_0061792 3300048913 Bacteria 3307
841 Ga0496110_0108936 3300048913 Bacteria 2487
842 Ga0496110_0197205 3300048913 Bacteria 1829
843 Ga0496111_0046698 3300048914 Bacteria 3118
844 Ga0496111_0197461 3300048914 Bacteria 1496
845 Ga0496112_0098221 3300048915 Bacteria 2898
846 Ga0496112_0167113 3300048915 Bacteria 2166
847 Ga0496112_0170214 3300048915 Bacteria 2143
848 Ga0496113_0122192 3300048916 Bacteria 2037
849 Ga0496113_0130843 3300048916 Bacteria 1969
850 Ga0496114_0016149 3300048917 Bacteria 6008
851 Ga0496115_0002259 3300048918 Bacteria 13788
852 Ga0496115_0315072 3300048918 Bacteria 1280
853 Ga0496116_0002427 3300048919 Bacteria 19634
854 Ga0496117_0002946 3300048920 Bacteria 20582
855 Ga0496117_0007358 3300048920 Bacteria 10779
856 Ga0496117_0023559 3300048920 Bacteria 4900
857 Ga0496117_0047413 3300048920 Bacteria 3081
858 Ga0496118_0003282 3300048921 Bacteria 20581
859 Ga0496118_0038502 3300048921 Bacteria 3831
860 Ga0496118_0070650 3300048921 Bacteria 2519
861 Ga0496119_0002396 3300048922 Bacteria 20582
862 Ga0496119_0034571 3300048922 Bacteria 3325
863 Ga0496120_0002204 3300048923 Bacteria 20582
864 Ga0496121_0000009 3300048924 Bacteria 836971
865 Ga0496121_0001387 3300048924 Bacteria 41011
866 Ga0496121_0001426 3300048924 Bacteria 40386
867 Ga0496121_0002142 3300048924 Bacteria 31007
868 Ga0496121_0003931 3300048924 Bacteria 20582
869 Ga0496121_0061574 3300048924 Bacteria 3079
870 Ga0496122_0000492 3300048925 Bacteria 82125
871 Ga0496122_0011807 3300048925 Bacteria 8785
872 Ga0496122_0036836 3300048925 Bacteria 3948
873 Ga0496123_0000460 3300048926 Bacteria 71476
874 Ga0496123_0016176 3300048926 Bacteria 6072
875 Ga0496123_0025859 3300048926 Bacteria 4412
876 Ga0496123_0081718 3300048926 Bacteria 1962
877 Ga0496124_0003112 3300048927 Bacteria 20582
878 Ga0496124_0005670 3300048927 Bacteria 13923
879 Ga0496124_0019516 3300048927 Bacteria 6306
880 Ga0496124_0024037 3300048927 Bacteria 5548
881 Ga0496125_0000425 3300048928 Bacteria 78294
882 Ga0496125_0004516 3300048928 Bacteria 15997
883 Ga0496125_0027998 3300048928 Bacteria 5097
884 Ga0496125_0029758 3300048928 Bacteria 4901
885 Ga0496125_0101775 3300048928 Bacteria 2113
886 Ga0496126_0001886 3300048929 Bacteria 30413
887 Ga0496126_0010007 3300048929 Bacteria 10006
888 Ga0496126_0020076 3300048929 Bacteria 6560
889 Ga0496126_0036098 3300048929 Bacteria 4625
890 Ga0496126_0051648 3300048929 Bacteria 3741
891 Ga0496126_0129679 3300048929 Bacteria 2180
892 Ga0496126_0167025 3300048929 Bacteria 1877
893 Ga0495678_001042 3300049459 Bacteria 23497
894 Ga0495678_033410 3300049459 Bacteria 2124
895 Ga0495682_0031217 3300049460 Bacteria 1969
896 Ga0501031_0052216 3300049568 Bacteria 2663
897 Ga0501032_0004270 3300049569 Bacteria 10790
898 Ga0501032_0009315 3300049569 Bacteria 7111
899 Ga0501032_0013530 3300049569 Bacteria 5800
900 Ga0501032_0034120 3300049569 Bacteria 3484
901 Ga0501033_0000145 3300049570 Bacteria 68524
902 Ga0501033_0000231 3300049570 Bacteria 53855
903 Ga0501033_0001382 3300049570 Bacteria 21599
904 Ga0501033_0047724 3300049570 Bacteria 3183
905 Ga0501033_0120784 3300049570 Bacteria 1902
906 Ga0501034_0006983 3300049571 Bacteria 12057
907 Ga0501034_0012828 3300049571 Bacteria 8642
908 Ga0501034_0021114 3300049571 Bacteria 6643
909 Ga0501034_0070227 3300049571 Bacteria 3514
910 Ga0501034_0115466 3300049571 Bacteria 2673
911 Ga0501034_0134764 3300049571 Bacteria 2451
912 Ga0501034_0160395 3300049571 Bacteria 2220
913 Ga0501034_0293009 3300049571 Bacteria 1565
914 Ga0501036_0010628 3300049572 Bacteria 7605
915 Ga0501036_0087767 3300049572 Bacteria 2629
916 Ga0501037_0004264 3300049573 Bacteria 10366
917 Ga0501037_0059306 3300049573 Bacteria 2792
918 Ga0501037_0153173 3300049573 Bacteria 1647
919 Ga0501038_0017376 3300049574 Bacteria 6501
920 Ga0501039_0010777 3300049575 Bacteria 6962
921 Ga0501039_0110785 3300049575 Bacteria 2146
922 Ga0501040_0038620 3300049576 Bacteria 3246
923 Ga0501040_0078756 3300049576 Bacteria 2281
924 Ga0501041_0195377 3300049577 Bacteria 1268
925 Ga0501042_0012026 3300049578 Bacteria 5853
926 Ga0501042_0123361 3300049578 Bacteria 1865
927 Ga0501043_0005887 3300049579 Bacteria 9864
928 Ga0501043_0010684 3300049579 Bacteria 7192
929 Ga0501043_0014846 3300049579 Bacteria 6099
930 Ga0501043_0016044 3300049579 Bacteria 5873
931 Ga0501046_0000948 3300049580 Bacteria 28442
932 Ga0501046_0047396 3300049580 Bacteria 3407
933 Ga0501047_0001771 3300049581 Bacteria 20857
934 Ga0501047_0005393 3300049581 Bacteria 12020
935 Ga0501047_0072931 3300049581 Bacteria 3305
936 Ga0501047_0073199 3300049581 Bacteria 3299
937 Ga0501047_0134586 3300049581 Bacteria 2352
938 Ga0501047_0346955 3300049581 Bacteria 1321
939 Ga0501048_0029797 3300049582 Bacteria 3953
940 Ga0501067_0019975 3300049583 Bacteria 3707
941 Ga0501068_0027343 3300049584 Bacteria 3368
942 Ga0501069_0002003 3300049585 Bacteria 10200
943 Ga0501069_0044271 3300049585 Bacteria 2464
944 Ga0501070_0001431 3300049586 Bacteria 21359
945 Ga0501070_0016838 3300049586 Bacteria 6136
946 Ga0501070_0025713 3300049586 Bacteria 4938
947 Ga0501070_0058955 3300049586 Bacteria 3182
948 Ga0501070_0059337 3300049586 Bacteria 3172
949 Ga0501070_0123279 3300049586 Bacteria 2142
950 Ga0501070_0149969 3300049586 Bacteria 1924
951 Ga0501070_0176023 3300049586 Bacteria 1761
952 Ga0501070_0179033 3300049586 Bacteria 1745
953 Ga0501070_0323910 3300049586 Bacteria 1253
954 Ga0501072_0015036 3300049588 Bacteria 5934
955 Ga0501072_0026730 3300049588 Bacteria 4501
956 Ga0501073_0003268 3300049589 Bacteria 12167
957 Ga0501073_0005127 3300049589 Bacteria 9830
958 Ga0501073_0019107 3300049589 Bacteria 4950
959 Ga0501073_0088314 3300049589 Bacteria 2155
960 Ga0501074_0130528 3300049590 Bacteria 1798
961 Ga0501077_0033850 3300049593 Bacteria 3253
962 Ga0501211_001280 3300049658 Bacteria 2690
963 Ga0501223_000080 3300049663 Bacteria 28958
964 Ga0501235_000785 3300049669 Bacteria 6473
965 Ga0501235_013853 3300049669 Bacteria 1776
966 Ga0501236_004335 3300049670 Bacteria 1680
967 Ga0501225_0000092 3300049705 Bacteria 28671
968 Ga0501225_0004314 3300049705 Bacteria 4251
969 Ga0501245_000399 3300049708 Bacteria 5242
970 Ga0501079_0215911 3300049741 Bacteria 1498
971 Ga0501080_0000595 3300049742 Bacteria 28622
972 Ga0501080_0019288 3300049742 Bacteria 6318
973 Ga0501080_0024273 3300049742 Bacteria 5621
974 Ga0501080_0026922 3300049742 Bacteria 5347
975 Ga0501080_0027791 3300049742 Bacteria 5260
976 Ga0501080_0036930 3300049742 Bacteria 4561
977 Ga0501080_0099180 3300049742 Bacteria 2703
978 Ga0501080_0136102 3300049742 Bacteria 2273
979 Ga0501081_0027872 3300049743 Bacteria 3809
980 Ga0501083_0012128 3300049744 Bacteria 6033
981 Ga0501083_0015362 3300049744 Bacteria 5363
982 Ga0501083_0016788 3300049744 Bacteria 5113
983 Ga0501083_0017777 3300049744 Bacteria 4960
984 Ga0501083_0045421 3300049744 Bacteria 2972
985 Ga0501083_0046972 3300049744 Bacteria 2919
986 Ga0501083_0060986 3300049744 Bacteria 2519
987 Ga0501083_0082138 3300049744 Bacteria 2135
988 Ga0501264_002384 3300049761 Bacteria 1764
989 Ga0501035_0001815 3300049822 Bacteria 21593
990 Ga0501035_0003515 3300049822 Bacteria 14978
991 Ga0501035_0044098 3300049822 Bacteria 4017
992 Ga0501035_0088420 3300049822 Bacteria 2730
993 Ga0501035_0094603 3300049822 Bacteria 2627
994 Ga0501044_0000453 3300049823 Bacteria 49990
995 Ga0501044_0003187 3300049823 Bacteria 18514
996 Ga0501044_0007461 3300049823 Bacteria 12027
997 Ga0501044_0019892 3300049823 Bacteria 7171
998 Ga0501044_0027392 3300049823 Bacteria 6024
999 Ga0501044_0033888 3300049823 Bacteria 5362
1000 Ga0501044_0042745 3300049823 Bacteria 4712
1001 Ga0501044_0092981 3300049823 Bacteria 3041
1002 Ga0501044_0101527 3300049823 Bacteria 2894
1003 Ga0501044_0220284 3300049823 Bacteria 1848
1004 Ga0501044_0269483 3300049823 Bacteria 1639
1005 Ga0501045_0093119 3300049824 Bacteria 2229
1006 nmdc:mga03683_18911_c1 3300050489 Bacteria 2172
1007 nmdc:mga03683_2194_c1 3300050489 Bacteria 6028
1008 nmdc:mga03683_36907_c1 3300050489 Bacteria 1584
1009 nmdc:mga03683_5373_c1 3300050489 Bacteria 4324
1010 nmdc:mga03683_55976_c1 3300050489 Bacteria 1657
1011 nmdc:mga03683_6375_c1 3300050489 Bacteria 4035
1012 nmdc:mga03683_739_c1 3300050489 Bacteria 9349
1013 nmdc:mga03n38_31224_c1 3300050490 Bacteria 2246
1014 nmdc:mga00v17_13036_c1 3300050491 Bacteria 4605
1015 nmdc:mga00v17_393_c1 3300050491 Bacteria 13156
1016 nmdc:mga0yw44_135714_c1 3300050492 Bacteria 1596
1017 nmdc:mga0k408_11574_c1 3300050493 Bacteria 4808
1018 nmdc:mga0k408_23263_c1 3300050493 Bacteria 3494
1019 nmdc:mga0k408_37533_c1 3300050493 Bacteria 2782
1020 nmdc:mga06z11_101703_c1 3300050494 Bacteria 1578
1021 nmdc:mga06z11_255_c1 3300050494 Bacteria 20756
1022 nmdc:mga06z11_571_c1 3300050494 Bacteria 13469
1023 nmdc:mga04h51_62_c1 3300050495 Bacteria 34326
1024 nmdc:mga07m45_44858_c1 3300050496 Bacteria 1667
1025 nmdc:mga05p37_115069_c1 3300050507 Bacteria 3306
1026 nmdc:mga05p37_2869_c1 3300050507 Bacteria 8026
1027 nmdc:mga05p37_62352_c1 3300050507 Bacteria 4588
1028 nmdc:mga0qj67_3611_c1 3300050509 Bacteria 11162
1029 nmdc:mga08y16_167771_c1 3300050511 Bacteria 2281
1030 nmdc:mga08y16_179940_c1 3300050511 Bacteria 2195
1031 nmdc:mga08y16_25630_c1 3300050511 Bacteria 6221
1032 nmdc:mga08y16_279_c1 3300050511 Bacteria 46569
1033 nmdc:mga08y16_28162_c1 3300050511 Bacteria 5922
1034 nmdc:mga0n895_59450_c1 3300050512 Bacteria 3770
1035 nmdc:mga0rr50_41064_c1 3300050513 Bacteria 3368
1036 nmdc:mga0rr50_45155_c1 3300050513 Bacteria 3236
1037 nmdc:mga0rr50_73300_c1 3300050513 Bacteria 2617
1038 nmdc:mga08x19_193398_c1 3300050514 Bacteria 1392
1039 nmdc:mga08x19_46408_c1 3300050514 Bacteria 2778
1040 nmdc:mga08x19_4_c2 3300050514 Bacteria 202063
1041 nmdc:mga0a205_165544_c1 3300050515 Bacteria 2106
1042 nmdc:mga0a205_189724_c1 3300050515 Bacteria 1948
1043 nmdc:mga0a205_56508_c1 3300050515 Bacteria 3789
1044 nmdc:mga0a205_70422_c1 3300050515 Bacteria 3376
1045 nmdc:mga0sz30_1132_c1 3300050516 Bacteria 9563
1046 nmdc:mga0sz30_1334_c1 3300050516 Bacteria 8798
1047 Ga0495612_0003425 3300053078 Bacteria 6575
1048 Ga0500635_0000052 3300053080 Bacteria 75372
1049 Ga0495595_0002120 3300053084 Bacteria 7703
1050 Ga0495595_0006813 3300053084 Bacteria 4664
1051 Ga0495619_0011297 3300053085 Bacteria 5618
1052 Ga0495619_0036027 3300053085 Bacteria 3221
1053 Ga0500578_0000041 3300053086 Bacteria 129580
1054 Ga0500643_002829 3300053087 Bacteria 8671
1055 Ga0500643_010631 3300053087 Bacteria 3412
1056 Ga0500644_0004719 3300053088 Bacteria 3419
1057 Ga0500644_0011737 3300053088 Bacteria 2403
1058 Ga0500644_0020003 3300053088 Bacteria 1984
1059 Ga0500644_0040340 3300053088 Bacteria 1544
1060 Ga0500646_0029951 3300053090 Bacteria 1492
1061 Ga0500651_0014192 3300053093 Bacteria 4872
1062 Ga0500566_0006891 3300053094 Bacteria 6727
1063 Ga0500641_0000152 3300053096 Bacteria 25722
1064 Ga0500641_0003048 3300053096 Bacteria 5940
1065 Ga0500555_010770 3300053103 Bacteria 2625
1066 Ga0500556_0003307 3300053104 Bacteria 4775
1067 Ga0500556_0003699 3300053104 Bacteria 4443
1068 Ga0500562_000213 3300053108 Bacteria 15703
1069 Ga0500562_002691 3300053108 Bacteria 4418
1070 Ga0500562_024015 3300053108 Bacteria 1593
1071 Ga0500569_002082 3300053109 Bacteria 3896
1072 Ga0500595_000107 3300053119 Bacteria 56944
1073 Ga0500595_000667 3300053119 Bacteria 20599
1074 Ga0500608_000105 3300053122 Bacteria 34366
1075 Ga0500608_011759 3300053122 Bacteria 3813
1076 Ga0500608_088158 3300053122 Bacteria 1454
1077 Ga0500614_002523 3300053123 Bacteria 4060
1078 Ga0500614_006378 3300053123 Bacteria 2479
1079 Ga0500618_000022 3300053125 Bacteria 157907
1080 Ga0500618_000053 3300053125 Bacteria 101079
1081 Ga0500642_0058659 3300053130 Bacteria 1721
1082 Ga0500655_003142 3300053133 Bacteria 2994
1083 Ga0500658_0009137 3300053134 Bacteria 3657
1084 Ga0500559_0000005 3300053136 Bacteria 230231
1085 Ga0500559_0000054 3300053136 Bacteria 90695
1086 Ga0500559_0003825 3300053136 Bacteria 7284
1087 Ga0500559_0025855 3300053136 Bacteria 2499
1088 Ga0500564_003005 3300053138 Bacteria 6423
1089 Ga0500577_0001675 3300053142 Bacteria 5673
1090 Ga0500577_0012279 3300053142 Bacteria 2583
1091 Ga0500590_000472 3300053148 Bacteria 13775
1092 Ga0500616_0000501 3300053153 Bacteria 50041
1093 Ga0500616_0000555 3300053153 Bacteria 46139
1094 Ga0500616_0016047 3300053153 Bacteria 4273
1095 Ga0500616_0030438 3300053153 Bacteria 2964
1096 Ga0500616_0044667 3300053153 Bacteria 2363
1097 Ga0500619_031333 3300053154 Bacteria 1622
1098 Ga0500622_0000695 3300053156 Bacteria 29628
1099 Ga0500622_0004581 3300053156 Bacteria 8610
1100 Ga0500622_0005841 3300053156 Bacteria 7287
1101 Ga0500622_0006217 3300053156 Bacteria 6987
1102 Ga0500622_0008629 3300053156 Bacteria 5689
1103 Ga0500622_0017312 3300053156 Bacteria 3835
1104 Ga0500622_0030266 3300053156 Bacteria 2843
1105 Ga0500624_000028 3300053157 Bacteria 106675
1106 Ga0500634_0051614 3300053161 Bacteria 2212
1107 Ga0500636_0040124 3300053177 Bacteria 2768
1108 Ga0500636_0057228 3300053177 Bacteria 2282
1109 Ga0500637_0000212 3300053178 Bacteria 21766
1110 Ga0500645_000519 3300053730 Bacteria 25756
1111 Ga0500645_000893 3300053730 Bacteria 17254
1112 Ga0500645_014346 3300053730 Bacteria 2525
1113 Ga0500609_002360 3300053731 Bacteria 2699
1114 Ga0500596_007021 3300053735 Bacteria 1865
1115 Ga0501084_0026997 3300054114 Bacteria 4797
1116 Ga0501082_0005314 3300060353 Bacteria 11193
1117 Ga0501082_0070736 3300060353 Bacteria 3004
1118 Ga0501082_0109910 3300060353 Bacteria 2386
1119 Ga0501082_0220088 3300060353 Bacteria 1652
1120 Ga0530510_0045413 3300061734 Bacteria 3174

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_10223647 Ga0105242_102236472 322
2 3300025934 Ga0207686_10230674 Ga0207686_102306742 324
3 3300005618 Ga0068864_100145254 Ga0068864_1001452542 330
4 3300046675 Ga0495657_0135188 Ga0495657_0135188_450_1514 334
5 3300035115 Ga0373941_0027967 Ga0373941_0027967_579_1625 336
6 3300049593 Ga0501077_0033850 Ga0501077_0033850_22_1065 336
7 3300026121 Ga0207683_10348770 Ga0207683_103487702 337
8 3300037418 Ga0395900_0505181 Ga0395900_0505181_58_1128 337
9 3300048924 Ga0496121_0061574 Ga0496121_0061574_1874_3031 341
10 3300037312 Ga0395899_0022653 Ga0395899_0022653_11_1156 345
11 3300038443 Ga0395901_0028623 Ga0395901_0028623_12_1157 345
12 iso_pu_bacteria 2841760612 2841763818 345
13 iso_pu_bacteria 2844104063 2844109278 345
14 iso_pu_bacteria 2851182111 2851183071 345
15 iso_pu_bacteria 2851246043 2851251385 345
16 3300046663 Ga0495635_0174088 Ga0495635_0174088_27_1127 346
17 3300047322 Ga0495680_0012308 Ga0495680_0012308_6356_7456 346
18 3300049577 Ga0501041_0195377 Ga0501041_0195377_107_1204 347
19 3300046528 Ga0495642_0067624 Ga0495642_0067624_43_1152 348
20 3300048912 Ga0496109_0116756 Ga0496109_0116756_1243_2346 348
21 3300035691 Ga0373931_0210880 Ga0373931_0210880_14_1120 349
22 3300053161 Ga0500634_0051614 Ga0500634_0051614_223_1293 349
23 3300046519 Ga0495632_0064485 Ga0495632_0064485_672_1748 352
24 3300035170 Ga0373943_0136432 Ga0373943_0136432_41_1177 353
25 3300035725 Ga0373947_0094826 Ga0373947_0094826_653_1759 353
26 3300046810 Ga0495660_0091121 Ga0495660_0091121_478_1557 353
27 3300049578 Ga0501042_0123361 Ga0501042_0123361_30_1160 353
28 3300039450 Ga0436363_1198557 Ga0436363_1198557_1392_2513 362
29 3300049822 Ga0501035_0088420 Ga0501035_0088420_1543_2688 362
30 3300053108 Ga0500562_002691 Ga0500562_002691_2270_3451 362
31 3300053153 Ga0500616_0044667 Ga0500616_0044667_50_1231 363
32 3300047472 Ga0495686_0086892 Ga0495686_0086892_32_1189 364
33 3300049571 Ga0501034_0134764 Ga0501034_0134764_810_2009 364
34 3300005546 Ga0070696_100056823 Ga0070696_1000568233 367
35 3300005617 Ga0068859_100156163 Ga0068859_1001561632 367
36 3300006931 Ga0097620_100156153 Ga0097620_1001561532 367
37 3300049581 Ga0501047_0001771 Ga0501047_0001771_2414_3610 367
38 3300053108 Ga0500562_024015 Ga0500562_024015_31_1212 367
39 3300053156 Ga0500622_0004581 Ga0500622_0004581_55_1236 367
40 3300005843 Ga0068860_100076811 Ga0068860_1000768112 368
41 3300003322 rootL2_10076554 rootL2_100765542 369
42 3300037853 Ga0436364_1305431 Ga0436364_1305431_27451_28653 370
43 iso_pu_bacteria 8054563764 8054566196 370
44 3300031824 Ga0307413_10034611 Ga0307413_100346112 371
45 3300031852 Ga0307410_10058026 Ga0307410_100580263 371
46 3300037853 Ga0436364_1161582 Ga0436364_1161582_3382_4572 372
47 3300039437 Ga0436365_1878082 Ga0436365_1878082_1426_2679 372
48 3300049585 Ga0501069_0044271 Ga0501069_0044271_243_1502 372
49 3300049586 Ga0501070_0323910 Ga0501070_0323910_61_1236 373
50 3300005262 Ga0065165_1019308 Ga0065165_10193084 374
51 3300047472 Ga0495686_0035025 Ga0495686_0035025_239_1363 374
52 3300049586 Ga0501070_0016838 Ga0501070_0016838_3113_4357 374
53 3300053730 Ga0500645_014346 Ga0500645_014346_469_1683 374
54 3300046477 Ga0495664_0158121 Ga0495664_0158121_170_1354 375
55 3300046512 Ga0495610_0069311 Ga0495610_0069311_251_1495 375
56 3300049586 Ga0501070_0059337 Ga0501070_0059337_1803_3047 375
57 3300028794 Ga0307515_10008637 Ga0307515_1000863721 376
58 3300039447 Ga0436361_0480426 Ga0436361_0480426_265_1461 376
59 3300049586 Ga0501070_0149969 Ga0501070_0149969_385_1635 376
60 3300049586 Ga0501070_0176023 Ga0501070_0176023_32_1294 376
61 3300049744 Ga0501083_0016788 Ga0501083_0016788_257_1519 376
62 3300060353 Ga0501082_0109910 Ga0501082_0109910_653_1915 376
63 3300005347 Ga0070668_100001584 Ga0070668_1000015842 377
64 3300005355 Ga0070671_100002549 Ga0070671_10000254916 377
65 3300005548 Ga0070665_100168980 Ga0070665_1001689802 377
66 3300005841 Ga0068863_100013552 Ga0068863_1000135523 377
67 3300005843 Ga0068860_100009534 Ga0068860_1000095343 377
68 3300025931 Ga0207644_10044716 Ga0207644_100447163 377
69 3300025972 Ga0207668_10001120 Ga0207668_1000112016 377
70 3300026088 Ga0207641_10001763 Ga0207641_100017632 377
71 3300050489 nmdc:mga03683_36907_c1 nmdc:mga03683_36907_c1_251_1459 378
72 3300050494 nmdc:mga06z11_101703_c1 nmdc:mga06z11_101703_c1_296_1504 378
73 3300049570 Ga0501033_0120784 Ga0501033_0120784_415_1668 379
74 3300049742 Ga0501080_0024273 Ga0501080_0024273_1811_3073 379
75 3300053096 Ga0500641_0000152 Ga0500641_0000152_18970_20151 379
76 3300053104 Ga0500556_0003307 Ga0500556_0003307_1256_2437 379
77 3300053153 Ga0500616_0016047 Ga0500616_0016047_1769_2950 379
78 3300053156 Ga0500622_0017312 Ga0500622_0017312_1255_2436 379
79 3300053730 Ga0500645_000519 Ga0500645_000519_13465_14646 379
80 iso_pu_bacteria 2884960567 2884963727 380
81 3300006048 Ga0075363_100005046 Ga0075363_1000050465 381
82 3300006051 Ga0075364_10009110 Ga0075364_100091104 381
83 3300006177 Ga0075362_10002519 Ga0075362_100025194 381
84 3300006178 Ga0075367_10015872 Ga0075367_100158723 381
85 3300013306 Ga0163162_10293934 Ga0163162_102939341 381
86 3300036712 Ga0316584_0191992 Ga0316584_0191992_140_1390 381
87 3300049586 Ga0501070_0179033 Ga0501070_0179033_323_1546 381
88 3300050489 nmdc:mga03683_6375_c1 nmdc:mga03683_6375_c1_1137_2393 381
89 3300050490 nmdc:mga03n38_31224_c1 nmdc:mga03n38_31224_c1_184_1440 381
90 3300050491 nmdc:mga00v17_13036_c1 nmdc:mga00v17_13036_c1_515_1771 381
91 3300050493 nmdc:mga0k408_11574_c1 nmdc:mga0k408_11574_c1_119_1375 381
92 iso_pu_bacteria 2585428106 2587919816 381
93 iso_pu_bacteria 2643221640 2644223556 381
94 iso_pu_bacteria 2643221642 2644236354 381
95 3300035725 Ga0373947_0022783 Ga0373947_0022783_31_1203 382
96 3300036712 Ga0316584_0042846 Ga0316584_0042846_1340_2569 382
97 3300047472 Ga0495686_0114194 Ga0495686_0114194_155_1366 382
98 iso_pu_bacteria 2582581279 2585150173 382
99 iso_pu_bacteria 2857504554 2857505917 382
100 iso_pu_bacteria 2928531327 2928531976 382
101 3300053177 Ga0500636_0040124 Ga0500636_0040124_1382_2554 383
102 iso_pu_bacteria 2643221736 2644742393 383
103 iso_pu_bacteria 2818991435 2819538340 383
104 iso_pu_bacteria 2818991454 2819649410 383
105 iso_pu_bacteria 8057529695 8057534255 383
106 3300002987 JGI25159J45721_1002192 JGI25159J45721_10021922 384
107 3300003771 Ga0055526_1001056 Ga0055526_100105611 384
108 3300005262 Ga0065165_1000062 Ga0065165_100006227 384
109 3300025284 Ga0209130_1000235 Ga0209130_100023560 384
110 3300025294 Ga0209025_1037455 Ga0209025_10374552 384
111 3300025295 Ga0209564_1000019 Ga0209564_1000019296 384
112 3300046512 Ga0495610_0003006 Ga0495610_0003006_9745_10920 384
113 3300046524 Ga0495648_0000039 Ga0495648_0000039_161878_163053 384
114 3300047470 Ga0495681_0086906 Ga0495681_0086906_125_1300 384
115 3300048906 Ga0496103_0161582 Ga0496103_0161582_186_1418 384
116 3300049459 Ga0495678_001042 Ga0495678_001042_9377_10552 384
117 3300049569 Ga0501032_0034120 Ga0501032_0034120_858_2051 384
118 3300049571 Ga0501034_0115466 Ga0501034_0115466_1143_2336 384
119 3300049572 Ga0501036_0087767 Ga0501036_0087767_979_2172 384
120 3300049581 Ga0501047_0346955 Ga0501047_0346955_110_1303 384
121 3300049589 Ga0501073_0019107 Ga0501073_0019107_3506_4699 384
122 3300049742 Ga0501080_0136102 Ga0501080_0136102_447_1640 384
123 3300049822 Ga0501035_0094603 Ga0501035_0094603_153_1346 384
124 3300050496 nmdc:mga07m45_44858_c1 nmdc:mga07m45_44858_c1_66_1241 384
125 3300053086 Ga0500578_0000041 Ga0500578_0000041_21013_22188 384
126 3300053088 Ga0500644_0004719 Ga0500644_0004719_2159_3334 384
127 3300053088 Ga0500644_0011737 Ga0500644_0011737_1158_2333 384
128 3300053138 Ga0500564_003005 Ga0500564_003005_217_1392 384
129 3300053153 Ga0500616_0000501 Ga0500616_0000501_23437_24642 384
130 3300053156 Ga0500622_0005841 Ga0500622_0005841_60_1235 384
131 3300053156 Ga0500622_0008629 Ga0500622_0008629_4444_5619 384
132 3300054114 Ga0501084_0026997 Ga0501084_0026997_2954_4147 384
133 iso_pu_bacteria 2643221552 2643780049 384
134 iso_pu_bacteria 2643221584 2643932104 384
135 iso_pu_bacteria 2841911363 2841916892 384
136 iso_pu_bacteria 2841917233 2841917604 384
137 3300005331 Ga0070670_100005254 Ga0070670_1000052546 385
138 3300005347 Ga0070668_100007411 Ga0070668_1000074113 385
139 3300005367 Ga0070667_100027219 Ga0070667_1000272194 385
140 3300005617 Ga0068859_100021915 Ga0068859_1000219152 385
141 3300005841 Ga0068863_100071333 Ga0068863_1000713333 385
142 3300006931 Ga0097620_100021915 Ga0097620_1000219152 385
143 3300010375 Ga0105239_10032508 Ga0105239_100325086 385
144 3300025294 Ga0209025_1038926 Ga0209025_10389261 385
145 3300025295 Ga0209564_1018697 Ga0209564_10186973 385
146 3300025986 Ga0207658_10008299 Ga0207658_100082997 385
147 3300026118 Ga0207675_100448159 Ga0207675_1004481591 385
148 3300028381 Ga0268264_10003426 Ga0268264_100034263 385
149 3300046460 Ga0495638_0000688 Ga0495638_0000688_23584_24762 385
150 3300046460 Ga0495638_0034944 Ga0495638_0034944_1046_2224 385
151 3300047469 Ga0495673_0001020 Ga0495673_0001020_23379_24557 385
152 3300048905 Ga0496102_0183359 Ga0496102_0183359_431_1639 385
153 3300048909 Ga0496106_0006998 Ga0496106_0006998_44_1252 385
154 3300048915 Ga0496112_0098221 Ga0496112_0098221_1564_2772 385
155 3300048928 Ga0496125_0101775 Ga0496125_0101775_733_1911 385
156 3300048929 Ga0496126_0036098 Ga0496126_0036098_833_2011 385
157 3300049742 Ga0501080_0019288 Ga0501080_0019288_2911_4107 385
158 3300049744 Ga0501083_0015362 Ga0501083_0015362_1527_2723 385
159 3300050513 nmdc:mga0rr50_45155_c1 nmdc:mga0rr50_45155_c1_318_1517 385
160 3300050515 nmdc:mga0a205_189724_c1 nmdc:mga0a205_189724_c1_154_1362 385
161 3300053156 Ga0500622_0030266 Ga0500622_0030266_304_1482 385
162 iso_pu_bacteria 2643221545 2643750370 385
163 iso_pu_bacteria 2643221691 2644507259 385
164 3300003781 Ga0055536_1001392 Ga0055536_100139212 386
165 3300003781 Ga0055536_1003842 Ga0055536_10038424 386
166 3300003791 Ga0055530_10005206 Ga0055530_100052063 386
167 3300003791 Ga0055530_10005885 Ga0055530_100058854 386
168 3300003794 Ga0055531_10000820 Ga0055531_1000082025 386
169 3300005293 Ga0065715_10017061 Ga0065715_100170612 386
170 3300005331 Ga0070670_100000128 Ga0070670_10000012811 386
171 3300005331 Ga0070670_100101569 Ga0070670_1001015692 386
172 3300005331 Ga0070670_100184868 Ga0070670_1001848682 386
173 3300005335 Ga0070666_10062863 Ga0070666_100628632 386
174 3300005338 Ga0068868_100152170 Ga0068868_1001521701 386
175 3300005347 Ga0070668_100000584 Ga0070668_1000005849 386
176 3300005347 Ga0070668_100001376 Ga0070668_1000013767 386
177 3300005347 Ga0070668_100004146 Ga0070668_1000041466 386
178 3300005355 Ga0070671_100000209 Ga0070671_10000020910 386
179 3300005355 Ga0070671_100206807 Ga0070671_1002068072 386
180 3300005367 Ga0070667_100000169 Ga0070667_10000016949 386
181 3300005367 Ga0070667_100004942 Ga0070667_10000494210 386
182 3300005435 Ga0070714_100223090 Ga0070714_1002230901 386
183 3300005545 Ga0070695_100067300 Ga0070695_1000673002 386
184 3300005548 Ga0070665_100000610 Ga0070665_1000006102 386
185 3300005548 Ga0070665_100002779 Ga0070665_10000277911 386
186 3300005617 Ga0068859_100005908 Ga0068859_1000059086 386
187 3300005618 Ga0068864_100000284 Ga0068864_1000002842 386
188 3300005618 Ga0068864_100000461 Ga0068864_10000046124 386
189 3300005841 Ga0068863_100000101 Ga0068863_10000010139 386
190 3300005841 Ga0068863_100000185 Ga0068863_10000018525 386
191 3300005841 Ga0068863_100004288 Ga0068863_1000042889 386
192 3300005841 Ga0068863_100100629 Ga0068863_1001006292 386
193 3300005842 Ga0068858_100000271 Ga0068858_10000027113 386
194 3300005842 Ga0068858_100006545 Ga0068858_10000654511 386
195 3300005842 Ga0068858_100009567 Ga0068858_1000095673 386
196 3300005843 Ga0068860_100000211 Ga0068860_10000021152 386
197 3300005843 Ga0068860_100006897 Ga0068860_10000689711 386
198 3300005843 Ga0068860_100023514 Ga0068860_1000235145 386
199 3300005844 Ga0068862_100002355 Ga0068862_10000235510 386
200 3300005844 Ga0068862_100053014 Ga0068862_1000530143 386
201 3300005844 Ga0068862_100088048 Ga0068862_1000880482 386
202 3300006042 Ga0075368_10010676 Ga0075368_100106764 386
203 3300006048 Ga0075363_100090541 Ga0075363_1000905412 386
204 3300006051 Ga0075364_10007544 Ga0075364_100075448 386
205 3300006178 Ga0075367_10000812 Ga0075367_100008121 386
206 3300006195 Ga0075366_10016899 Ga0075366_100168995 386
207 3300006195 Ga0075366_10022022 Ga0075366_100220222 386
208 3300006931 Ga0097620_100005908 Ga0097620_10000590810 386
209 3300009177 Ga0105248_10000349 Ga0105248_1000034943 386
210 3300009177 Ga0105248_10001964 Ga0105248_100019649 386
211 3300009177 Ga0105248_10027599 Ga0105248_100275992 386
212 3300009553 Ga0105249_10001221 Ga0105249_100012218 386
213 3300009553 Ga0105249_10157607 Ga0105249_101576073 386
214 3300010375 Ga0105239_10170963 Ga0105239_101709632 386
215 3300013306 Ga0163162_10101686 Ga0163162_101016862 386
216 3300013306 Ga0163162_10118704 Ga0163162_101187042 386
217 3300014325 Ga0163163_10151940 Ga0163163_101519402 386
218 3300014325 Ga0163163_10156415 Ga0163163_101564152 386
219 3300014325 Ga0163163_10157466 Ga0163163_101574662 386
220 3300014968 Ga0157379_10000119 Ga0157379_1000011932 386
221 3300014968 Ga0157379_10010097 Ga0157379_100100972 386
222 3300014968 Ga0157379_10079688 Ga0157379_100796884 386
223 3300025292 Ga0209676_1000169 Ga0209676_1000169150 386
224 3300025292 Ga0209676_1000319 Ga0209676_100031936 386
225 3300025298 Ga0209050_1000737 Ga0209050_100073740 386
226 3300025298 Ga0209050_1001426 Ga0209050_10014264 386
227 3300025303 Ga0209051_1001836 Ga0209051_10018365 386
228 3300025304 Ga0209257_1001595 Ga0209257_100159526 386
229 3300025304 Ga0209257_1016114 Ga0209257_10161143 386
230 3300025893 Ga0207682_10003431 Ga0207682_100034312 386
231 3300025903 Ga0207680_10023407 Ga0207680_100234072 386
232 3300025923 Ga0207681_10027788 Ga0207681_100277882 386
233 3300025925 Ga0207650_10000315 Ga0207650_1000031536 386
234 3300025931 Ga0207644_10000679 Ga0207644_100006793 386
235 3300025940 Ga0207691_10014107 Ga0207691_100141075 386
236 3300025941 Ga0207711_10001341 Ga0207711_1000134128 386
237 3300025941 Ga0207711_10002092 Ga0207711_100020925 386
238 3300025941 Ga0207711_10022190 Ga0207711_100221902 386
239 3300025961 Ga0207712_10000203 Ga0207712_1000020315 386
240 3300025961 Ga0207712_10196656 Ga0207712_101966562 386
241 3300025972 Ga0207668_10000007 Ga0207668_10000007160 386
242 3300025972 Ga0207668_10000427 Ga0207668_1000042715 386
243 3300025972 Ga0207668_10002487 Ga0207668_100024879 386
244 3300025986 Ga0207658_10001368 Ga0207658_1000136810 386
245 3300025986 Ga0207658_10001403 Ga0207658_100014038 386
246 3300026035 Ga0207703_10000105 Ga0207703_100001054 386
247 3300026035 Ga0207703_10003669 Ga0207703_100036698 386
248 3300026035 Ga0207703_10011130 Ga0207703_100111302 386
249 3300026088 Ga0207641_10000109 Ga0207641_10000109112 386
250 3300026088 Ga0207641_10002034 Ga0207641_1000203410 386
251 3300026088 Ga0207641_10030198 Ga0207641_100301983 386
252 3300026095 Ga0207676_10000159 Ga0207676_1000015948 386
253 3300026095 Ga0207676_10001888 Ga0207676_100018888 386
254 3300026121 Ga0207683_10008376 Ga0207683_100083765 386
255 3300028379 Ga0268266_10001260 Ga0268266_100012606 386
256 3300028379 Ga0268266_10006212 Ga0268266_100062122 386
257 3300028380 Ga0268265_10002154 Ga0268265_100021542 386
258 3300028380 Ga0268265_10010280 Ga0268265_100102803 386
259 3300028381 Ga0268264_10000270 Ga0268264_1000027040 386
260 3300028381 Ga0268264_10009573 Ga0268264_100095733 386
261 3300031456 Ga0307513_10007717 Ga0307513_100077177 386
262 3300036401 Ga0373937_0146539 Ga0373937_0146539_569_1813 386
263 3300039450 Ga0436363_0514829 Ga0436363_0514829_165_1397 386
264 3300046459 Ga0495629_0038576 Ga0495629_0038576_328_1509 386
265 3300046515 Ga0495620_0009408 Ga0495620_0009408_3547_4728 386
266 3300046522 Ga0495643_0040613 Ga0495643_0040613_1220_2401 386
267 3300046528 Ga0495642_0003816 Ga0495642_0003816_494_1681 386
268 3300046542 Ga0495597_0010529 Ga0495597_0010529_1462_2643 386
269 3300046616 Ga0495668_0000040 Ga0495668_0000040_183429_184610 386
270 3300046616 Ga0495668_0001804 Ga0495668_0001804_2562_3743 386
271 3300046648 Ga0495611_0007116 Ga0495611_0007116_813_2000 386
272 3300046660 Ga0495625_0042371 Ga0495625_0042371_121_1302 386
273 3300046689 Ga0495613_0129630 Ga0495613_0129630_520_1719 386
274 3300047320 Ga0495672_0027507 Ga0495672_0027507_581_1768 386
275 3300047443 Ga0495687_020767 Ga0495687_020767_196_1377 386
276 3300047472 Ga0495686_0002348 Ga0495686_0002348_14565_15746 386
277 3300047472 Ga0495686_0077292 Ga0495686_0077292_695_1876 386
278 3300047673 Ga0495593_0068247 Ga0495593_0068247_201_1382 386
279 3300048903 Ga0496100_0124502 Ga0496100_0124502_173_1360 386
280 3300048911 Ga0496108_0241207 Ga0496108_0241207_196_1383 386
281 3300048918 Ga0496115_0315072 Ga0496115_0315072_49_1269 386
282 3300048921 Ga0496118_0070650 Ga0496118_0070650_145_1344 386
283 3300048922 Ga0496119_0034571 Ga0496119_0034571_663_1862 386
284 3300048924 Ga0496121_0000009 Ga0496121_0000009_495526_496725 386
285 3300048927 Ga0496124_0024037 Ga0496124_0024037_2335_3516 386
286 3300050491 nmdc:mga00v17_393_c1 nmdc:mga00v17_393_c1_86_1267 386
287 3300050493 nmdc:mga0k408_23263_c1 nmdc:mga0k408_23263_c1_1890_3071 386
288 3300050511 nmdc:mga08y16_179940_c1 nmdc:mga08y16_179940_c1_338_1612 386
289 3300050516 nmdc:mga0sz30_1132_c1 nmdc:mga0sz30_1132_c1_332_1513 386
290 3300053080 Ga0500635_0000052 Ga0500635_0000052_38278_39459 386
291 3300053087 Ga0500643_010631 Ga0500643_010631_1461_2657 386
292 3300053094 Ga0500566_0006891 Ga0500566_0006891_51_1250 386
293 3300053108 Ga0500562_000213 Ga0500562_000213_5577_6758 386
294 3300053109 Ga0500569_002082 Ga0500569_002082_2198_3379 386
295 3300053119 Ga0500595_000667 Ga0500595_000667_3437_4618 386
296 3300053122 Ga0500608_000105 Ga0500608_000105_112_1293 386
297 3300053122 Ga0500608_011759 Ga0500608_011759_2238_3419 386
298 3300053123 Ga0500614_002523 Ga0500614_002523_710_1891 386
299 3300053154 Ga0500619_031333 Ga0500619_031333_138_1319 386
300 3300053735 Ga0500596_007021 Ga0500596_007021_512_1693 386
301 3300060353 Ga0501082_0220088 Ga0501082_0220088_81_1286 386
302 iso_pu_bacteria 2643221583 2643926952 386
303 3300001989 JGI24739J22299_10010844 JGI24739J22299_100108444 387
304 3300003215 JGI25153J46596_10019572 JGI25153J46596_100195721 387
305 3300005539 Ga0068853_100115687 Ga0068853_1001156871 387
306 3300005546 Ga0070696_100013231 Ga0070696_1000132316 387
307 3300005549 Ga0070704_100002436 Ga0070704_1000024367 387
308 3300006038 Ga0075365_10042899 Ga0075365_100428992 387
309 3300006177 Ga0075362_10034628 Ga0075362_100346282 387
310 3300006178 Ga0075367_10002060 Ga0075367_100020601 387
311 3300009545 Ga0105237_10002777 Ga0105237_100027779 387
312 3300010375 Ga0105239_10003114 Ga0105239_100031149 387
313 3300010375 Ga0105239_10012735 Ga0105239_100127356 387
314 3300025297 Ga0209758_1011627 Ga0209758_10116273 387
315 3300025304 Ga0209257_1000352 Ga0209257_100035286 387
316 3300025904 Ga0207647_10001677 Ga0207647_1000167722 387
317 3300025914 Ga0207671_10002149 Ga0207671_1000214912 387
318 3300028786 Ga0307517_10018527 Ga0307517_100185279 387
319 3300028794 Ga0307515_10155748 Ga0307515_101557483 387
320 3300029957 Ga0265324_10001398 Ga0265324_100013989 387
321 3300031250 Ga0265331_10000162 Ga0265331_1000016216 387
322 3300037068 Ga0373925_0151637 Ga0373925_0151637_14_1258 387
323 3300037312 Ga0395899_0008589 Ga0395899_0008589_2589_3935 387
324 3300037418 Ga0395900_0004161 Ga0395900_0004161_8152_9498 387
325 3300038443 Ga0395901_0007828 Ga0395901_0007828_5530_6876 387
326 3300042156 Ga0439446_0021669 Ga0439446_0021669_193_1377 387
327 3300046460 Ga0495638_0000230 Ga0495638_0000230_38958_40142 387
328 3300046460 Ga0495638_0021896 Ga0495638_0021896_238_1422 387
329 3300046471 Ga0495650_0000207 Ga0495650_0000207_86415_87599 387
330 3300046515 Ga0495620_0042212 Ga0495620_0042212_738_1922 387
331 3300046520 Ga0495637_0022075 Ga0495637_0022075_642_1826 387
332 3300046530 Ga0495654_0000016 Ga0495654_0000016_219776_220960 387
333 3300046660 Ga0495625_0000043 Ga0495625_0000043_9287_10471 387
334 3300046660 Ga0495625_0002055 Ga0495625_0002055_3207_4391 387
335 3300046660 Ga0495625_0014285 Ga0495625_0014285_202_1386 387
336 3300046660 Ga0495625_0056351 Ga0495625_0056351_291_1475 387
337 3300047470 Ga0495681_0031256 Ga0495681_0031256_329_1513 387
338 3300047470 Ga0495681_0064193 Ga0495681_0064193_424_1608 387
339 3300048905 Ga0496102_0000575 Ga0496102_0000575_13922_15154 387
340 3300048906 Ga0496103_0018338 Ga0496103_0018338_1954_3186 387
341 3300048919 Ga0496116_0002427 Ga0496116_0002427_10530_11762 387
342 3300048920 Ga0496117_0002946 Ga0496117_0002946_5429_6661 387
343 3300048921 Ga0496118_0003282 Ga0496118_0003282_5428_6660 387
344 3300048922 Ga0496119_0002396 Ga0496119_0002396_5429_6661 387
345 3300048923 Ga0496120_0002204 Ga0496120_0002204_5429_6661 387
346 3300048924 Ga0496121_0003931 Ga0496121_0003931_5429_6661 387
347 3300048927 Ga0496124_0003112 Ga0496124_0003112_13922_15154 387
348 3300049742 Ga0501080_0036930 Ga0501080_0036930_1816_3042 387
349 3300049744 Ga0501083_0045421 Ga0501083_0045421_1261_2487 387
350 3300049823 Ga0501044_0000453 Ga0501044_0000453_8253_9551 387
351 3300049823 Ga0501044_0269483 Ga0501044_0269483_55_1263 387
352 3300053104 Ga0500556_0003699 Ga0500556_0003699_1240_2424 387
353 3300053136 Ga0500559_0025855 Ga0500559_0025855_326_1510 387
354 3300053730 Ga0500645_000893 Ga0500645_000893_13306_14490 387
355 3300053731 Ga0500609_002360 Ga0500609_002360_140_1324 387
356 iso_pu_bacteria 2510917020 2511122314 387
357 iso_pu_bacteria 2582581280 2585154548 387
358 iso_pu_bacteria 2582581293 2585198563 387
359 iso_pu_bacteria 2684623219 2687240501 387
360 iso_pu_bacteria 2844533157 2844539046 387
361 3300003773 Ga0055537_1001474 Ga0055537_10014746 388
362 3300003775 Ga0055524_1003107 Ga0055524_10031076 388
363 3300003775 Ga0055524_1006095 Ga0055524_10060955 388
364 3300005262 Ga0065165_1001692 Ga0065165_100169213 388
365 3300005347 Ga0070668_100011336 Ga0070668_1000113362 388
366 3300005455 Ga0070663_100199956 Ga0070663_1001999561 388
367 3300005468 Ga0070707_100087168 Ga0070707_1000871681 388
368 3300005518 Ga0070699_100137617 Ga0070699_1001376172 388
369 3300009148 Ga0105243_10055150 Ga0105243_100551503 388
370 3300021361 Ga0213872_10016262 Ga0213872_100162622 388
371 3300025263 Ga0209565_1000183 Ga0209565_10001835 388
372 3300025273 Ga0209673_1001029 Ga0209673_100102922 388
373 3300025291 Ga0209675_1015088 Ga0209675_10150882 388
374 3300025297 Ga0209758_1001837 Ga0209758_10018374 388
375 3300025299 Ga0209256_1000694 Ga0209256_100069411 388
376 3300025299 Ga0209256_1015406 Ga0209256_10154062 388
377 3300025907 Ga0207645_10049491 Ga0207645_100494912 388
378 3300025922 Ga0207646_10020030 Ga0207646_100200304 388
379 3300025972 Ga0207668_10065961 Ga0207668_100659612 388
380 3300033180 Ga0307510_10002995 Ga0307510_100029952 388
381 3300035398 Ga0316574_0056685 Ga0316574_0056685_235_1461 388
382 3300039447 Ga0436361_0409735 Ga0436361_0409735_2892_4109 388
383 3300046453 Ga0495627_000654 Ga0495627_000654_2215_3402 388
384 3300046460 Ga0495638_0037556 Ga0495638_0037556_596_1783 388
385 3300046501 Ga0495607_0033225 Ga0495607_0033225_1471_2658 388
386 3300046507 Ga0495606_0016964 Ga0495606_0016964_1028_2227 388
387 3300046512 Ga0495610_0000794 Ga0495610_0000794_21208_22395 388
388 3300046512 Ga0495610_0003341 Ga0495610_0003341_5729_6916 388
389 3300046513 Ga0495616_0037938 Ga0495616_0037938_481_1668 388
390 3300046616 Ga0495668_0002079 Ga0495668_0002079_5364_6551 388
391 3300046616 Ga0495668_0035955 Ga0495668_0035955_1148_2335 388
392 3300046660 Ga0495625_0008772 Ga0495625_0008772_2321_3508 388
393 3300047320 Ga0495672_0001651 Ga0495672_0001651_14460_15647 388
394 3300047446 Ga0495679_001492 Ga0495679_001492_1331_2518 388
395 3300047469 Ga0495673_0004053 Ga0495673_0004053_5712_6899 388
396 3300047472 Ga0495686_0024572 Ga0495686_0024572_1098_2297 388
397 3300047472 Ga0495686_0031218 Ga0495686_0031218_628_1815 388
398 3300048920 Ga0496117_0047413 Ga0496117_0047413_529_1749 388
399 3300048925 Ga0496122_0036836 Ga0496122_0036836_968_2185 388
400 3300048926 Ga0496123_0081718 Ga0496123_0081718_443_1660 388
401 3300053123 Ga0500614_006378 Ga0500614_006378_719_1906 388
402 3300053125 Ga0500618_000022 Ga0500618_000022_6671_7858 388
403 3300053134 Ga0500658_0009137 Ga0500658_0009137_1931_3118 388
404 3300053136 Ga0500559_0000054 Ga0500559_0000054_40679_41866 388
405 3300053156 Ga0500622_0006217 Ga0500622_0006217_2223_3410 388
406 3300003781 Ga0055536_1005608 Ga0055536_10056083 389
407 3300005262 Ga0065165_1019889 Ga0065165_10198891 389
408 3300009147 Ga0114129_10301951 Ga0114129_103019512 389
409 3300013307 Ga0157372_10069791 Ga0157372_100697912 389
410 3300021388 Ga0213875_10000451 Ga0213875_1000045114 389
411 3300025292 Ga0209676_1000284 Ga0209676_100028412 389
412 3300025298 Ga0209050_1011818 Ga0209050_10118184 389
413 3300028794 Ga0307515_10040608 Ga0307515_100406083 389
414 3300030521 Ga0307511_10015070 Ga0307511_100150703 389
415 3300031456 Ga0307513_10000063 Ga0307513_1000006372 389
416 3300031456 Ga0307513_10115642 Ga0307513_101156422 389
417 3300035691 Ga0373931_0074602 Ga0373931_0074602_601_1821 389
418 3300037853 Ga0436364_0810561 Ga0436364_0810561_9965_11203 389
419 3300038443 Ga0395901_0169614 Ga0395901_0169614_811_2049 389
420 3300039438 Ga0436360_0998447 Ga0436360_0998447_612_1829 389
421 3300039447 Ga0436361_0574409 Ga0436361_0574409_649_1866 389
422 3300046506 Ga0495583_0000025 Ga0495583_0000025_251297_252487 389
423 3300048918 Ga0496115_0002259 Ga0496115_0002259_8084_9274 389
424 3300049568 Ga0501031_0052216 Ga0501031_0052216_525_1811 389
425 3300049569 Ga0501032_0013530 Ga0501032_0013530_915_2201 389
426 3300049571 Ga0501034_0070227 Ga0501034_0070227_489_1733 389
427 3300049573 Ga0501037_0059306 Ga0501037_0059306_819_2105 389
428 3300049579 Ga0501043_0016044 Ga0501043_0016044_3668_4954 389
429 3300049581 Ga0501047_0072931 Ga0501047_0072931_571_1815 389
430 3300049583 Ga0501067_0019975 Ga0501067_0019975_2342_3586 389
431 3300049586 Ga0501070_0025713 Ga0501070_0025713_2490_3734 389
432 3300049588 Ga0501072_0026730 Ga0501072_0026730_1123_2367 389
433 3300049589 Ga0501073_0088314 Ga0501073_0088314_190_1434 389
434 3300049741 Ga0501079_0215911 Ga0501079_0215911_47_1291 389
435 3300049823 Ga0501044_0027392 Ga0501044_0027392_3440_4726 389
436 3300049823 Ga0501044_0042745 Ga0501044_0042745_2688_3932 389
437 3300053103 Ga0500555_010770 Ga0500555_010770_1112_2326 389
438 3300053148 Ga0500590_000472 Ga0500590_000472_6824_8050 389
439 3300003791 Ga0055530_10000337 Ga0055530_1000033752 390
440 3300003794 Ga0055531_10001142 Ga0055531_1000114227 390
441 3300005262 Ga0065165_1000171 Ga0065165_10001714 390
442 3300009551 Ga0105238_10051165 Ga0105238_100511653 390
443 3300025250 Ga0209026_1001299 Ga0209026_10012997 390
444 3300025297 Ga0209758_1005157 Ga0209758_100515711 390
445 3300025298 Ga0209050_1000095 Ga0209050_1000095238 390
446 3300025304 Ga0209257_1000106 Ga0209257_100010615 390
447 3300025911 Ga0207654_10032342 Ga0207654_100323423 390
448 3300031595 Ga0265313_10000839 Ga0265313_1000083922 390
449 3300046460 Ga0495638_0025076 Ga0495638_0025076_2587_3780 390
450 3300046460 Ga0495638_0116647 Ga0495638_0116647_33_1226 390
451 3300046513 Ga0495616_0001257 Ga0495616_0001257_1237_2433 390
452 3300046519 Ga0495632_0000545 Ga0495632_0000545_16949_18145 390
453 3300046530 Ga0495654_0050754 Ga0495654_0050754_26_1222 390
454 3300046616 Ga0495668_0077410 Ga0495668_0077410_525_1739 390
455 3300046794 Ga0495589_0000982 Ga0495589_0000982_2299_3492 390
456 3300047472 Ga0495686_0005443 Ga0495686_0005443_7843_9057 390
457 3300002987 JGI25159J45721_1015584 JGI25159J45721_10155842 391
458 3300003187 JGI25151J46595_10000268 JGI25151J46595_1000026831 391
459 3300003354 JGI25160J50197_1009821 JGI25160J50197_10098212 391
460 3300005336 Ga0070680_100016723 Ga0070680_1000167232 391
461 3300005336 Ga0070680_100026049 Ga0070680_1000260492 391
462 3300005458 Ga0070681_10058541 Ga0070681_100585414 391
463 3300005530 Ga0070679_100058571 Ga0070679_1000585714 391
464 3300009986 Ga0105033_100251 Ga0105033_1002513 391
465 3300013104 Ga0157370_10011034 Ga0157370_100110348 391
466 3300021388 Ga0213875_10000936 Ga0213875_100009363 391
467 3300025284 Ga0209130_1004232 Ga0209130_10042325 391
468 3300025294 Ga0209025_1000146 Ga0209025_1000146113 391
469 3300025297 Ga0209758_1002076 Ga0209758_100207611 391
470 3300025302 Ga0207426_1000046 Ga0207426_1000046274 391
471 3300025912 Ga0207707_10006168 Ga0207707_100061682 391
472 3300025917 Ga0207660_10034296 Ga0207660_100342964 391
473 3300025917 Ga0207660_10047791 Ga0207660_100477912 391
474 3300025921 Ga0207652_10008514 Ga0207652_100085144 391
475 3300025921 Ga0207652_10018920 Ga0207652_100189204 391
476 3300028800 Ga0265338_10026563 Ga0265338_100265632 391
477 3300037853 Ga0436364_0992577 Ga0436364_0992577_17501_18721 391
478 3300046512 Ga0495610_0003243 Ga0495610_0003243_8057_9301 391
479 iso_pu_bacteria 2643221733 2644728094 391
480 iso_pu_bacteria 2643221734 2644733876 391
481 iso_pu_bacteria 2883291878 2883293459 391
482 iso_pu_bacteria 2883354860 2883357960 391
483 iso_pu_bacteria 2917699015 2917701650 391
484 3300003187 JGI25151J46595_10000018 JGI25151J46595_10000018111 392
485 3300003320 rootH2_10104849 rootH2_101048492 392
486 3300003771 Ga0055526_1002567 Ga0055526_10025676 392
487 3300003775 Ga0055524_1000048 Ga0055524_100004819 392
488 3300003775 Ga0055524_1006307 Ga0055524_10063074 392
489 3300005347 Ga0070668_100006149 Ga0070668_1000061493 392
490 3300005471 Ga0070698_100249573 Ga0070698_1002495731 392
491 3300005530 Ga0070679_100145365 Ga0070679_1001453652 392
492 3300005617 Ga0068859_100468035 Ga0068859_1004680352 392
493 3300005843 Ga0068860_100000051 Ga0068860_10000005133 392
494 3300005844 Ga0068862_100018741 Ga0068862_1000187412 392
495 3300006042 Ga0075368_10074008 Ga0075368_100740081 392
496 3300006051 Ga0075364_10047139 Ga0075364_100471392 392
497 3300006186 Ga0075369_10027042 Ga0075369_100270422 392
498 3300006914 Ga0075436_100033782 Ga0075436_1000337822 392
499 3300006931 Ga0097620_100467967 Ga0097620_1004679672 392
500 3300013250 Ga0171462_1009 Ga0171462_100913 392
501 3300013308 Ga0157375_10549956 Ga0157375_105499561 392
502 3300025273 Ga0209673_1006747 Ga0209673_10067475 392
503 3300025291 Ga0209675_1000239 Ga0209675_100023947 392
504 3300025294 Ga0209025_1000010 Ga0209025_1000010119 392
505 3300025294 Ga0209025_1020824 Ga0209025_10208242 392
506 3300025295 Ga0209564_1000034 Ga0209564_1000034286 392
507 3300025299 Ga0209256_1000026 Ga0209256_1000026274 392
508 3300025299 Ga0209256_1000182 Ga0209256_100018267 392
509 3300025921 Ga0207652_10132720 Ga0207652_101327202 392
510 3300025972 Ga0207668_10032299 Ga0207668_100322993 392
511 3300025972 Ga0207668_10101201 Ga0207668_101012012 392
512 3300026116 Ga0207674_10016891 Ga0207674_1001689110 392
513 3300028380 Ga0268265_10002114 Ga0268265_100021142 392
514 3300028381 Ga0268264_10000021 Ga0268264_10000021405 392
515 3300028800 Ga0265338_10004430 Ga0265338_100044305 392
516 3300031247 Ga0265340_10024189 Ga0265340_100241892 392
517 3300037068 Ga0373925_0250306 Ga0373925_0250306_97_1329 392
518 3300037471 Ga0395905_0000174 Ga0395905_0000174_68866_70101 392
519 3300045976 Ga0466967_0053041 Ga0466967_0053041_851_2098 392
520 3300048909 Ga0496106_0007733 Ga0496106_0007733_5944_7155 392
521 3300048910 Ga0496107_0000029 Ga0496107_0000029_16229_17440 392
522 3300048924 Ga0496121_0002142 Ga0496121_0002142_21060_22271 392
523 3300048926 Ga0496123_0016176 Ga0496123_0016176_722_2065 392
524 3300048928 Ga0496125_0029758 Ga0496125_0029758_817_2043 392
525 3300048929 Ga0496126_0167025 Ga0496126_0167025_68_1294 392
526 3300049571 Ga0501034_0293009 Ga0501034_0293009_184_1527 392
527 3300049581 Ga0501047_0073199 Ga0501047_0073199_1147_2361 392
528 3300050514 nmdc:mga08x19_46408_c1 nmdc:mga08x19_46408_c1_736_1968 392
529 3300053177 Ga0500636_0057228 Ga0500636_0057228_71_1345 392
530 iso_pu_bacteria 2818991467 2819716836 392
531 iso_pu_bacteria 8024486573 8024488943 392
532 3300005329 Ga0070683_100092955 Ga0070683_1000929553 393
533 3300005329 Ga0070683_100173143 Ga0070683_1001731432 393
534 3300005539 Ga0068853_100051683 Ga0068853_1000516832 393
535 3300005563 Ga0068855_100000267 Ga0068855_10000026712 393
536 3300005577 Ga0068857_100074831 Ga0068857_1000748312 393
537 3300005616 Ga0068852_100119430 Ga0068852_1001194302 393
538 3300005843 Ga0068860_100038489 Ga0068860_1000384892 393
539 3300006844 Ga0075428_100111725 Ga0075428_1001117252 393
540 3300006846 Ga0075430_100164948 Ga0075430_1001649482 393
541 3300006880 Ga0075429_100051899 Ga0075429_1000518992 393
542 3300006914 Ga0075436_100098073 Ga0075436_1000980732 393
543 3300009093 Ga0105240_10001197 Ga0105240_1000119728 393
544 3300009093 Ga0105240_10141508 Ga0105240_101415082 393
545 3300009094 Ga0111539_10000041 Ga0111539_1000004183 393
546 3300009094 Ga0111539_10005028 Ga0111539_100050286 393
547 3300009098 Ga0105245_10156045 Ga0105245_101560452 393
548 3300009101 Ga0105247_10031668 Ga0105247_100316682 393
549 3300009147 Ga0114129_10168313 Ga0114129_101683132 393
550 3300009177 Ga0105248_10162713 Ga0105248_101627132 393
551 3300009177 Ga0105248_10177416 Ga0105248_101774163 393
552 3300009177 Ga0105248_10345857 Ga0105248_103458572 393
553 3300009551 Ga0105238_10003746 Ga0105238_100037468 393
554 3300010375 Ga0105239_10001954 Ga0105239_1000195410 393
555 3300013105 Ga0157369_10020792 Ga0157369_100207926 393
556 3300013297 Ga0157378_10046086 Ga0157378_100460863 393
557 3300014325 Ga0163163_10038387 Ga0163163_100383874 393
558 3300014968 Ga0157379_10066237 Ga0157379_100662372 393
559 3300025900 Ga0207710_10012358 Ga0207710_100123583 393
560 3300025913 Ga0207695_10000012 Ga0207695_10000012716 393
561 3300025913 Ga0207695_10279054 Ga0207695_102790541 393
562 3300025924 Ga0207694_10000156 Ga0207694_1000015636 393
563 3300025924 Ga0207694_10169746 Ga0207694_101697462 393
564 3300025927 Ga0207687_10191253 Ga0207687_101912531 393
565 3300025949 Ga0207667_10000068 Ga0207667_1000006842 393
566 3300025972 Ga0207668_10027033 Ga0207668_100270334 393
567 3300026041 Ga0207639_10020905 Ga0207639_100209053 393
568 3300026067 Ga0207678_10132688 Ga0207678_101326882 393
569 3300026116 Ga0207674_10083288 Ga0207674_100832883 393
570 3300026142 Ga0207698_10028109 Ga0207698_100281094 393
571 3300026142 Ga0207698_10159691 Ga0207698_101596912 393
572 3300027907 Ga0207428_10001809 Ga0207428_1000180918 393
573 3300031250 Ga0265331_10063233 Ga0265331_100632332 393
574 3300031251 Ga0265327_10039006 Ga0265327_100390061 393
575 3300031456 Ga0307513_10009979 Ga0307513_100099799 393
576 3300035113 Ga0373936_0022443 Ga0373936_0022443_630_1865 393
577 3300035725 Ga0373947_0068438 Ga0373947_0068438_196_1461 393
578 3300036401 Ga0373937_0025405 Ga0373937_0025405_1315_2580 393
579 3300037068 Ga0373925_0106217 Ga0373925_0106217_673_1938 393
580 3300037418 Ga0395900_0377084 Ga0395900_0377084_80_1321 393
581 3300037853 Ga0436364_0179869 Ga0436364_0179869_223_1446 393
582 3300038443 Ga0395901_0001835 Ga0395901_0001835_11645_12883 393
583 3300044694 Ga0466963_0067164 Ga0466963_0067164_1133_2368 393
584 3300046519 Ga0495632_0000380 Ga0495632_0000380_7606_8829 393
585 3300046616 Ga0495668_0012223 Ga0495668_0012223_1022_2245 393
586 3300047320 Ga0495672_0007502 Ga0495672_0007502_2993_4249 393
587 3300047320 Ga0495672_0023601 Ga0495672_0023601_1503_2882 393
588 3300047471 Ga0495684_0230238 Ga0495684_0230238_51_1316 393
589 3300048907 Ga0496104_0021209 Ga0496104_0021209_4389_5627 393
590 3300048909 Ga0496106_0076960 Ga0496106_0076960_1071_2309 393
591 3300048913 Ga0496110_0197205 Ga0496110_0197205_431_1669 393
592 3300048915 Ga0496112_0170214 Ga0496112_0170214_703_1941 393
593 3300048916 Ga0496113_0122192 Ga0496113_0122192_526_1773 393
594 3300049460 Ga0495682_0031217 Ga0495682_0031217_362_1600 393
595 3300049581 Ga0501047_0134586 Ga0501047_0134586_136_1362 393
596 3300049586 Ga0501070_0058955 Ga0501070_0058955_1701_2936 393
597 3300049744 Ga0501083_0060986 Ga0501083_0060986_971_2206 393
598 3300050511 nmdc:mga08y16_167771_c1 nmdc:mga08y16_167771_c1_388_1638 393
599 3300050511 nmdc:mga08y16_25630_c1 nmdc:mga08y16_25630_c1_4566_5816 393
600 3300050511 nmdc:mga08y16_279_c1 nmdc:mga08y16_279_c1_4396_5634 393
601 3300050512 nmdc:mga0n895_59450_c1 nmdc:mga0n895_59450_c1_2075_3322 393
602 3300050514 nmdc:mga08x19_193398_c1 nmdc:mga08x19_193398_c1_108_1328 393
603 3300050515 nmdc:mga0a205_70422_c1 nmdc:mga0a205_70422_c1_1141_2388 393
604 3300053085 Ga0495619_0036027 Ga0495619_0036027_425_1663 393
605 3300053087 Ga0500643_002829 Ga0500643_002829_70_1323 393
606 3300053090 Ga0500646_0029951 Ga0500646_0029951_164_1420 393
607 3300053133 Ga0500655_003142 Ga0500655_003142_1270_2508 393
608 3300053178 Ga0500637_0000212 Ga0500637_0000212_15074_16330 393
609 3300060353 Ga0501082_0070736 Ga0501082_0070736_1174_2409 393
610 3300003215 JGI25153J46596_10000062 JGI25153J46596_1000006258 394
611 3300005327 Ga0070658_10010617 Ga0070658_100106177 394
612 3300005336 Ga0070680_100000264 Ga0070680_10000026433 394
613 3300005353 Ga0070669_100039331 Ga0070669_1000393312 394
614 3300005435 Ga0070714_100033522 Ga0070714_1000335224 394
615 3300005435 Ga0070714_100067083 Ga0070714_1000670832 394
616 3300005436 Ga0070713_100010091 Ga0070713_1000100914 394
617 3300005436 Ga0070713_100037311 Ga0070713_1000373112 394
618 3300005436 Ga0070713_100075374 Ga0070713_1000753742 394
619 3300005436 Ga0070713_100096823 Ga0070713_1000968232 394
620 3300005437 Ga0070710_10006545 Ga0070710_100065453 394
621 3300005439 Ga0070711_100009694 Ga0070711_1000096943 394
622 3300005439 Ga0070711_100012222 Ga0070711_1000122222 394
623 3300005439 Ga0070711_100023880 Ga0070711_1000238805 394
624 3300005439 Ga0070711_100053079 Ga0070711_1000530792 394
625 3300005445 Ga0070708_100115632 Ga0070708_1001156322 394
626 3300005457 Ga0070662_100100099 Ga0070662_1001000991 394
627 3300005458 Ga0070681_10000213 Ga0070681_1000021333 394
628 3300005458 Ga0070681_10081643 Ga0070681_100816432 394
629 3300005458 Ga0070681_10098715 Ga0070681_100987151 394
630 3300005458 Ga0070681_10202857 Ga0070681_102028571 394
631 3300005468 Ga0070707_100018906 Ga0070707_1000189065 394
632 3300005468 Ga0070707_100161609 Ga0070707_1001616092 394
633 3300005471 Ga0070698_100020755 Ga0070698_1000207551 394
634 3300005471 Ga0070698_100049414 Ga0070698_1000494146 394
635 3300005471 Ga0070698_100066969 Ga0070698_1000669693 394
636 3300005518 Ga0070699_100044333 Ga0070699_1000443333 394
637 3300005518 Ga0070699_100239284 Ga0070699_1002392842 394
638 3300005530 Ga0070679_100001596 Ga0070679_1000015966 394
639 3300005539 Ga0068853_100054797 Ga0068853_1000547972 394
640 3300005539 Ga0068853_100261827 Ga0068853_1002618271 394
641 3300005548 Ga0070665_100069536 Ga0070665_1000695362 394
642 3300005548 Ga0070665_100096303 Ga0070665_1000963032 394
643 3300005549 Ga0070704_100163512 Ga0070704_1001635121 394
644 3300005563 Ga0068855_100001693 Ga0068855_10000169324 394
645 3300005563 Ga0068855_100088405 Ga0068855_1000884052 394
646 3300005564 Ga0070664_100187562 Ga0070664_1001875622 394
647 3300005614 Ga0068856_100012963 Ga0068856_1000129636 394
648 3300005614 Ga0068856_100030161 Ga0068856_1000301616 394
649 3300005616 Ga0068852_100011907 Ga0068852_1000119072 394
650 3300005983 Ga0081540_1019744 Ga0081540_10197441 394
651 3300005985 Ga0081539_10001888 Ga0081539_1000188811 394
652 3300005985 Ga0081539_10015621 Ga0081539_100156214 394
653 3300006028 Ga0070717_10000290 Ga0070717_100002902 394
654 3300006028 Ga0070717_10017976 Ga0070717_100179765 394
655 3300006038 Ga0075365_10026026 Ga0075365_100260262 394
656 3300006175 Ga0070712_100002544 Ga0070712_1000025443 394
657 3300006175 Ga0070712_100074225 Ga0070712_1000742252 394
658 3300006177 Ga0075362_10000564 Ga0075362_100005646 394
659 3300006177 Ga0075362_10008081 Ga0075362_100080811 394
660 3300006178 Ga0075367_10014633 Ga0075367_100146331 394
661 3300006178 Ga0075367_10036221 Ga0075367_100362212 394
662 3300006186 Ga0075369_10000566 Ga0075369_100005662 394
663 3300006186 Ga0075369_10013908 Ga0075369_100139082 394
664 3300006195 Ga0075366_10004811 Ga0075366_100048117 394
665 3300006353 Ga0075370_10109241 Ga0075370_101092411 394
666 3300006852 Ga0075433_10024821 Ga0075433_100248211 394
667 3300006871 Ga0075434_100322164 Ga0075434_1003221641 394
668 3300006914 Ga0075436_100024956 Ga0075436_1000249562 394
669 3300007788 Ga0099795_10005208 Ga0099795_100052083 394
670 3300007788 Ga0099795_10059757 Ga0099795_100597571 394
671 3300009093 Ga0105240_10424181 Ga0105240_104241811 394
672 3300009147 Ga0114129_10009933 Ga0114129_100099332 394
673 3300009551 Ga0105238_10005330 Ga0105238_100053306 394
674 3300010375 Ga0105239_10102494 Ga0105239_101024942 394
675 3300013307 Ga0157372_10011020 Ga0157372_100110206 394
676 3300013307 Ga0157372_10074817 Ga0157372_100748173 394
677 3300014497 Ga0182008_10011892 Ga0182008_100118923 394
678 3300021388 Ga0213875_10000132 Ga0213875_1000013269 394
679 3300021388 Ga0213875_10001552 Ga0213875_100015527 394
680 3300021441 Ga0213871_10000041 Ga0213871_100000414 394
681 3300025292 Ga0209676_1008945 Ga0209676_10089452 394
682 3300025297 Ga0209758_1000029 Ga0209758_1000029304 394
683 3300025297 Ga0209758_1007713 Ga0209758_10077135 394
684 3300025298 Ga0209050_1005949 Ga0209050_10059492 394
685 3300025304 Ga0209257_1000743 Ga0209257_100074335 394
686 3300025898 Ga0207692_10004177 Ga0207692_100041777 394
687 3300025898 Ga0207692_10022843 Ga0207692_100228433 394
688 3300025909 Ga0207705_10006356 Ga0207705_100063568 394
689 3300025912 Ga0207707_10016865 Ga0207707_100168656 394
690 3300025912 Ga0207707_10049183 Ga0207707_100491832 394
691 3300025912 Ga0207707_10180922 Ga0207707_101809222 394
692 3300025912 Ga0207707_10199761 Ga0207707_101997612 394
693 3300025915 Ga0207693_10009794 Ga0207693_100097947 394
694 3300025915 Ga0207693_10207502 Ga0207693_102075021 394
695 3300025916 Ga0207663_10014871 Ga0207663_100148712 394
696 3300025917 Ga0207660_10003027 Ga0207660_100030272 394
697 3300025921 Ga0207652_10006822 Ga0207652_1000682210 394
698 3300025921 Ga0207652_10131431 Ga0207652_101314312 394
699 3300025924 Ga0207694_10040185 Ga0207694_100401852 394
700 3300025926 Ga0207659_10020609 Ga0207659_100206092 394
701 3300025928 Ga0207700_10043519 Ga0207700_100435192 394
702 3300025928 Ga0207700_10116473 Ga0207700_101164731 394
703 3300025929 Ga0207664_10102963 Ga0207664_101029633 394
704 3300025939 Ga0207665_10055663 Ga0207665_100556632 394
705 3300025945 Ga0207679_10045212 Ga0207679_100452122 394
706 3300025949 Ga0207667_10024236 Ga0207667_100242366 394
707 3300026041 Ga0207639_10064567 Ga0207639_100645671 394
708 3300026078 Ga0207702_10010520 Ga0207702_100105201 394
709 3300026142 Ga0207698_10084003 Ga0207698_100840032 394
710 3300028379 Ga0268266_10013295 Ga0268266_100132955 394
711 3300028380 Ga0268265_10003045 Ga0268265_100030456 394
712 3300028573 Ga0265334_10001920 Ga0265334_100019208 394
713 3300031238 Ga0265332_10065927 Ga0265332_100659271 394
714 3300031251 Ga0265327_10011785 Ga0265327_100117856 394
715 3300031344 Ga0265316_10086217 Ga0265316_100862173 394
716 3300031456 Ga0307513_10196494 Ga0307513_101964941 394
717 3300031616 Ga0307508_10111558 Ga0307508_101115583 394
718 3300031995 Ga0307409_100094808 Ga0307409_1000948082 394
719 3300035170 Ga0373943_0015678 Ga0373943_0015678_2140_3384 394
720 3300035691 Ga0373931_0036668 Ga0373931_0036668_784_2028 394
721 3300035692 Ga0373935_0010737 Ga0373935_0010737_225_1469 394
722 3300035692 Ga0373935_0030455 Ga0373935_0030455_818_2065 394
723 3300035695 Ga0373927_0060216 Ga0373927_0060216_1174_2403 394
724 3300035725 Ga0373947_0009938 Ga0373947_0009938_2791_4035 394
725 3300035725 Ga0373947_0090168 Ga0373947_0090168_198_1427 394
726 3300036401 Ga0373937_0003803 Ga0373937_0003803_5581_6849 394
727 3300036401 Ga0373937_0005722 Ga0373937_0005722_9122_10363 394
728 3300036401 Ga0373937_0008212 Ga0373937_0008212_4219_5475 394
729 3300036401 Ga0373937_0215721 Ga0373937_0215721_366_1592 394
730 3300037068 Ga0373925_0007893 Ga0373925_0007893_4111_5355 394
731 3300037312 Ga0395899_0002095 Ga0395899_0002095_478_1722 394
732 3300037418 Ga0395900_0002747 Ga0395900_0002747_5689_6990 394
733 3300037418 Ga0395900_0025037 Ga0395900_0025037_1570_2814 394
734 3300037418 Ga0395900_0059962 Ga0395900_0059962_1766_3010 394
735 3300037466 Ga0395898_0020728 Ga0395898_0020728_1460_2704 394
736 3300037466 Ga0395898_0119465 Ga0395898_0119465_737_2038 394
737 3300037853 Ga0436364_0717863 Ga0436364_0717863_58298_59530 394
738 3300037853 Ga0436364_1401862 Ga0436364_1401862_1918_3165 394
739 3300037853 Ga0436364_1451573 Ga0436364_1451573_4909_6198 394
740 3300038443 Ga0395901_0003662 Ga0395901_0003662_12684_13928 394
741 3300039437 Ga0436365_0578833 Ga0436365_0578833_9487_10725 394
742 3300039437 Ga0436365_1543965 Ga0436365_1543965_270_1493 394
743 3300039438 Ga0436360_0157856 Ga0436360_0157856_4145_5386 394
744 3300039438 Ga0436360_1359148 Ga0436360_1359148_4904_6130 394
745 3300039447 Ga0436361_0106319 Ga0436361_0106319_305_1546 394
746 3300039450 Ga0436363_0405125 Ga0436363_0405125_5859_7100 394
747 3300039450 Ga0436363_1681949 Ga0436363_1681949_2865_4103 394
748 3300039453 Ga0436362_0536913 Ga0436362_0536913_2909_4147 394
749 3300039453 Ga0436362_0548901 Ga0436362_0548901_576_1802 394
750 3300039453 Ga0436362_0729911 Ga0436362_0729911_2052_3278 394
751 3300042001 Ga0439441_006883 Ga0439441_006883_310_1545 394
752 3300045976 Ga0466967_0037584 Ga0466967_0037584_1849_3156 394
753 3300046454 Ga0495592_0035657 Ga0495592_0035657_2229_3470 394
754 3300046459 Ga0495629_0052952 Ga0495629_0052952_1119_2363 394
755 3300046462 Ga0495651_0021640 Ga0495651_0021640_1029_2285 394
756 3300046463 Ga0495653_0029597 Ga0495653_0029597_2404_3660 394
757 3300046463 Ga0495653_0084457 Ga0495653_0084457_781_2049 394
758 3300046472 Ga0495580_0005218 Ga0495580_0005218_6913_8157 394
759 3300046472 Ga0495580_0023817 Ga0495580_0023817_506_1735 394
760 3300046477 Ga0495664_0003101 Ga0495664_0003101_7128_8396 394
761 3300046511 Ga0495608_0010439 Ga0495608_0010439_3171_4427 394
762 3300046511 Ga0495608_0012618 Ga0495608_0012618_1897_3165 394
763 3300046514 Ga0495618_0008723 Ga0495618_0008723_3823_5079 394
764 3300046516 Ga0495628_0050079 Ga0495628_0050079_120_1376 394
765 3300046529 Ga0495652_0027554 Ga0495652_0027554_2912_4168 394
766 3300046533 Ga0495640_0007595 Ga0495640_0007595_2614_3870 394
767 3300046533 Ga0495640_0078034 Ga0495640_0078034_11_1279 394
768 3300046536 Ga0495587_0006694 Ga0495587_0006694_3121_4377 394
769 3300046536 Ga0495587_0012147 Ga0495587_0012147_1362_2630 394
770 3300046543 Ga0495645_0033050 Ga0495645_0033050_1213_2481 394
771 3300046559 Ga0495667_0055344 Ga0495667_0055344_1066_2307 394
772 3300046642 Ga0495634_0037347 Ga0495634_0037347_837_2093 394
773 3300046678 Ga0495599_0006566 Ga0495599_0006566_1198_2466 394
774 3300046678 Ga0495599_0054218 Ga0495599_0054218_743_1999 394
775 3300046679 Ga0495623_0047042 Ga0495623_0047042_1265_2533 394
776 3300046679 Ga0495623_0082523 Ga0495623_0082523_562_1818 394
777 3300046680 Ga0495646_0010821 Ga0495646_0010821_3657_4925 394
778 3300046680 Ga0495646_0039710 Ga0495646_0039710_1410_2666 394
779 3300046683 Ga0495658_0001976 Ga0495658_0001976_4617_5861 394
780 3300046683 Ga0495658_0017515 Ga0495658_0017515_1735_2976 394
781 3300046690 Ga0495624_0038255 Ga0495624_0038255_1168_2424 394
782 3300046809 Ga0495600_0006058 Ga0495600_0006058_2878_4134 394
783 3300047317 Ga0495604_0006924 Ga0495604_0006924_3677_4933 394
784 3300047317 Ga0495604_0033817 Ga0495604_0033817_217_1485 394
785 3300047319 Ga0495674_0014792 Ga0495674_0014792_1838_3094 394
786 3300047320 Ga0495672_0003346 Ga0495672_0003346_8326_9561 394
787 3300047322 Ga0495680_0035999 Ga0495680_0035999_2368_3609 394
788 3300048088 Ga0495602_0000162 Ga0495602_0000162_57488_58756 394
789 3300048088 Ga0495602_0021910 Ga0495602_0021910_2735_3991 394
790 3300048908 Ga0496105_0036935 Ga0496105_0036935_865_2112 394
791 3300048914 Ga0496111_0197461 Ga0496111_0197461_101_1348 394
792 3300048929 Ga0496126_0020076 Ga0496126_0020076_4482_5723 394
793 3300049569 Ga0501032_0004270 Ga0501032_0004270_6054_7358 394
794 3300049570 Ga0501033_0001382 Ga0501033_0001382_16643_17947 394
795 3300049570 Ga0501033_0047724 Ga0501033_0047724_1569_2813 394
796 3300049571 Ga0501034_0006983 Ga0501034_0006983_2688_3929 394
797 3300049571 Ga0501034_0021114 Ga0501034_0021114_2086_3390 394
798 3300049572 Ga0501036_0010628 Ga0501036_0010628_3019_4323 394
799 3300049573 Ga0501037_0004264 Ga0501037_0004264_2470_3774 394
800 3300049573 Ga0501037_0153173 Ga0501037_0153173_35_1279 394
801 3300049574 Ga0501038_0017376 Ga0501038_0017376_902_2206 394
802 3300049575 Ga0501039_0010777 Ga0501039_0010777_2312_3616 394
803 3300049575 Ga0501039_0110785 Ga0501039_0110785_689_1939 394
804 3300049576 Ga0501040_0038620 Ga0501040_0038620_159_1409 394
805 3300049576 Ga0501040_0078756 Ga0501040_0078756_792_2018 394
806 3300049579 Ga0501043_0005887 Ga0501043_0005887_6603_7907 394
807 3300049579 Ga0501043_0014846 Ga0501043_0014846_2590_3834 394
808 3300049580 Ga0501046_0000948 Ga0501046_0000948_20032_21336 394
809 3300049580 Ga0501046_0047396 Ga0501046_0047396_1129_2376 394
810 3300049581 Ga0501047_0005393 Ga0501047_0005393_8205_9509 394
811 3300049582 Ga0501048_0029797 Ga0501048_0029797_2491_3795 394
812 3300049584 Ga0501068_0027343 Ga0501068_0027343_406_1710 394
813 3300049585 Ga0501069_0002003 Ga0501069_0002003_6385_7689 394
814 3300049586 Ga0501070_0001431 Ga0501070_0001431_3712_5016 394
815 3300049586 Ga0501070_0123279 Ga0501070_0123279_671_1918 394
816 3300049589 Ga0501073_0005127 Ga0501073_0005127_5096_6400 394
817 3300049590 Ga0501074_0130528 Ga0501074_0130528_459_1685 394
818 3300049742 Ga0501080_0000595 Ga0501080_0000595_2722_4026 394
819 3300049742 Ga0501080_0026922 Ga0501080_0026922_2028_3272 394
820 3300049742 Ga0501080_0027791 Ga0501080_0027791_1044_2291 394
821 3300049742 Ga0501080_0099180 Ga0501080_0099180_325_1572 394
822 3300049743 Ga0501081_0027872 Ga0501081_0027872_2071_3297 394
823 3300049744 Ga0501083_0012128 Ga0501083_0012128_2722_4026 394
824 3300049744 Ga0501083_0046972 Ga0501083_0046972_1059_2306 394
825 3300049744 Ga0501083_0082138 Ga0501083_0082138_91_1338 394
826 3300049822 Ga0501035_0003515 Ga0501035_0003515_10307_11611 394
827 3300049823 Ga0501044_0003187 Ga0501044_0003187_13779_15083 394
828 3300049823 Ga0501044_0019892 Ga0501044_0019892_1168_2412 394
829 3300049823 Ga0501044_0033888 Ga0501044_0033888_3735_4982 394
830 3300049823 Ga0501044_0101527 Ga0501044_0101527_254_1501 394
831 3300050489 nmdc:mga03683_18911_c1 nmdc:mga03683_18911_c1_832_2070 394
832 3300050489 nmdc:mga03683_2194_c1 nmdc:mga03683_2194_c1_2232_3470 394
833 3300050489 nmdc:mga03683_55976_c1 nmdc:mga03683_55976_c1_351_1589 394
834 3300050489 nmdc:mga03683_739_c1 nmdc:mga03683_739_c1_6822_8060 394
835 3300050492 nmdc:mga0yw44_135714_c1 nmdc:mga0yw44_135714_c1_118_1356 394
836 3300050493 nmdc:mga0k408_37533_c1 nmdc:mga0k408_37533_c1_1060_2298 394
837 3300050507 nmdc:mga05p37_2869_c1 nmdc:mga05p37_2869_c1_2088_3341 394
838 3300050516 nmdc:mga0sz30_1334_c1 nmdc:mga0sz30_1334_c1_6784_8022 394
839 3300053078 Ga0495612_0003425 Ga0495612_0003425_3315_4583 394
840 3300053084 Ga0495595_0002120 Ga0495595_0002120_3356_4612 394
841 3300053084 Ga0495595_0006813 Ga0495595_0006813_3411_4652 394
842 3300053085 Ga0495619_0011297 Ga0495619_0011297_4219_5475 394
843 3300053088 Ga0500644_0020003 Ga0500644_0020003_66_1313 394
844 3300053088 Ga0500644_0040340 Ga0500644_0040340_67_1305 394
845 3300053096 Ga0500641_0003048 Ga0500641_0003048_1326_2573 394
846 3300053119 Ga0500595_000107 Ga0500595_000107_25501_26748 394
847 3300053130 Ga0500642_0058659 Ga0500642_0058659_303_1595 394
848 3300053142 Ga0500577_0012279 Ga0500577_0012279_328_1575 394
849 3300053153 Ga0500616_0000555 Ga0500616_0000555_11253_12500 394
850 3300053153 Ga0500616_0030438 Ga0500616_0030438_674_1903 394
851 3300060353 Ga0501082_0005314 Ga0501082_0005314_6602_7906 394
852 3300061734 Ga0530510_0045413 Ga0530510_0045413_401_1627 394
853 iso_pu_bacteria 2513237087 2513590203 394
854 iso_pu_bacteria 2617270741 2617375614 394
855 iso_pu_bacteria 2824617872 2824617873 394
856 iso_pu_bacteria 2824679649 2824685166 394
857 iso_pu_bacteria 2824732956 2824738127 394
858 iso_pu_bacteria 2824746037 2824752321 394
859 iso_pu_bacteria 2874612657 2874615065 394
860 iso_pu_bacteria 2891373044 2891374688 394
861 iso_pu_bacteria 2908775508 2908780319 394
862 iso_pu_bacteria 2922393267 2922400659 394
863 iso_pu_bacteria 2935908558 2935908972 394
864 iso_pu_bacteria 2935916978 2935919690 394
865 iso_pu_bacteria 2935926038 2935926454 394
866 iso_pu_bacteria 2935934488 2935934904 394
867 iso_pu_bacteria 2935942939 2935943354 394
868 iso_pu_bacteria 2935951376 2935951792 394
869 iso_pu_bacteria 2935967501 2935967917 394
870 iso_pu_bacteria 2989349275 2989354169 394
871 iso_pu_bacteria 2989771324 2989772060 394
872 iso_pu_bacteria 3003930520 3003932670 394
873 iso_pu_bacteria 3005483717 3005484456 394
874 iso_pu_bacteria 3005587118 3005587901 394
875 iso_pu_bacteria 8019648815 8019658549 394
876 iso_pu_bacteria 8045864390 8045865905 394
877 iso_pu_bacteria 8054558443 8054562959 394
878 3300003215 JGI25153J46596_10004997 JGI25153J46596_100049974 395
879 3300003215 JGI25153J46596_10015785 JGI25153J46596_100157852 395
880 3300003354 JGI25160J50197_1000477 JGI25160J50197_100047721 395
881 3300005262 Ga0065165_1001332 Ga0065165_100133224 395
882 3300005290 Ga0065712_10089656 Ga0065712_100896562 395
883 3300005329 Ga0070683_100164806 Ga0070683_1001648062 395
884 3300005336 Ga0070680_100027191 Ga0070680_1000271912 395
885 3300005336 Ga0070680_100263208 Ga0070680_1002632081 395
886 3300005338 Ga0068868_100008896 Ga0068868_1000088964 395
887 3300005339 Ga0070660_100068056 Ga0070660_1000680562 395
888 3300005353 Ga0070669_100101527 Ga0070669_1001015271 395
889 3300005356 Ga0070674_100005598 Ga0070674_1000055982 395
890 3300005364 Ga0070673_100081992 Ga0070673_1000819923 395
891 3300005365 Ga0070688_100003954 Ga0070688_1000039543 395
892 3300005435 Ga0070714_100186792 Ga0070714_1001867922 395
893 3300005436 Ga0070713_100165154 Ga0070713_1001651541 395
894 3300005456 Ga0070678_100029192 Ga0070678_1000291923 395
895 3300005457 Ga0070662_100016079 Ga0070662_1000160794 395
896 3300005458 Ga0070681_10016080 Ga0070681_100160802 395
897 3300005458 Ga0070681_10020990 Ga0070681_100209906 395
898 3300005530 Ga0070679_100003428 Ga0070679_10000342815 395
899 3300005618 Ga0068864_100026541 Ga0068864_1000265412 395
900 3300005981 Ga0081538_10006460 Ga0081538_100064607 395
901 3300006038 Ga0075365_10059534 Ga0075365_100595344 395
902 3300006177 Ga0075362_10003140 Ga0075362_100031405 395
903 3300006178 Ga0075367_10007484 Ga0075367_100074843 395
904 3300006237 Ga0097621_100092973 Ga0097621_1000929733 395
905 3300006846 Ga0075430_100007703 Ga0075430_1000077032 395
906 3300006871 Ga0075434_100162133 Ga0075434_1001621332 395
907 3300006880 Ga0075429_100115094 Ga0075429_1001150942 395
908 3300006942 Ga0099824_1027176 Ga0099824_10271762 395
909 3300009093 Ga0105240_10103180 Ga0105240_101031802 395
910 3300009093 Ga0105240_10103180 Ga0105240_101031803 395
911 3300009093 Ga0105240_10121211 Ga0105240_101212112 395
912 3300009094 Ga0111539_10043198 Ga0111539_100431984 395
913 3300009094 Ga0111539_10100322 Ga0111539_101003222 395
914 3300009147 Ga0114129_10058588 Ga0114129_100585885 395
915 3300009147 Ga0114129_10125067 Ga0114129_101250673 395
916 3300009147 Ga0114129_10388447 Ga0114129_103884471 395
917 3300009177 Ga0105248_10053132 Ga0105248_100531324 395
918 3300009177 Ga0105248_10062788 Ga0105248_100627885 395
919 3300009545 Ga0105237_10190789 Ga0105237_101907892 395
920 3300009545 Ga0105237_10244215 Ga0105237_102442152 395
921 3300009551 Ga0105238_10119769 Ga0105238_101197692 395
922 3300009551 Ga0105238_10211098 Ga0105238_102110982 395
923 3300010375 Ga0105239_10158045 Ga0105239_101580452 395
924 3300013105 Ga0157369_10122712 Ga0157369_101227122 395
925 3300014325 Ga0163163_10223001 Ga0163163_102230012 395
926 3300014326 Ga0157380_10157152 Ga0157380_101571522 395
927 3300021320 Ga0214544_1000002 Ga0214544_1000002296 395
928 3300021321 Ga0214542_1000001 Ga0214542_1000001646 395
929 3300021324 Ga0214545_1000001 Ga0214545_1000001712 395
930 3300021327 Ga0214543_1000001 Ga0214543_1000001483 395
931 3300021361 Ga0213872_10015277 Ga0213872_100152773 395
932 3300022467 Ga0224712_10071142 Ga0224712_100711421 395
933 3300025254 Ga0209148_1000732 Ga0209148_10007324 395
934 3300025272 Ga0209455_1000572 Ga0209455_100057211 395
935 3300025294 Ga0209025_1000149 Ga0209025_100014971 395
936 3300025297 Ga0209758_1000252 Ga0209758_100025242 395
937 3300025298 Ga0209050_1011618 Ga0209050_10116184 395
938 3300025302 Ga0207426_1000626 Ga0207426_100062634 395
939 3300025912 Ga0207707_10023011 Ga0207707_100230113 395
940 3300025913 Ga0207695_10028663 Ga0207695_100286632 395
941 3300025913 Ga0207695_10028663 Ga0207695_100286633 395
942 3300025913 Ga0207695_10081855 Ga0207695_100818552 395
943 3300025914 Ga0207671_10088695 Ga0207671_100886951 395
944 3300025914 Ga0207671_10130797 Ga0207671_101307971 395
945 3300025919 Ga0207657_10077580 Ga0207657_100775802 395
946 3300025921 Ga0207652_10075431 Ga0207652_100754312 395
947 3300025924 Ga0207694_10061926 Ga0207694_100619262 395
948 3300025926 Ga0207659_10095584 Ga0207659_100955842 395
949 3300025933 Ga0207706_10041661 Ga0207706_100416612 395
950 3300025933 Ga0207706_10049658 Ga0207706_100496581 395
951 3300025941 Ga0207711_10025515 Ga0207711_100255151 395
952 3300026023 Ga0207677_10137945 Ga0207677_101379451 395
953 3300026075 Ga0207708_10024701 Ga0207708_100247012 395
954 3300026095 Ga0207676_10017898 Ga0207676_100178985 395
955 3300026121 Ga0207683_10025859 Ga0207683_100258592 395
956 3300028577 Ga0265318_10005668 Ga0265318_100056688 395
957 3300028786 Ga0307517_10000714 Ga0307517_1000071434 395
958 3300028794 Ga0307515_10003572 Ga0307515_1000357212 395
959 3300028800 Ga0265338_10045536 Ga0265338_100455362 395
960 3300031235 Ga0265330_10041268 Ga0265330_100412681 395
961 3300031241 Ga0265325_10003952 Ga0265325_100039522 395
962 3300031241 Ga0265325_10011897 Ga0265325_100118975 395
963 3300031241 Ga0265325_10023938 Ga0265325_100239381 395
964 3300031247 Ga0265340_10015778 Ga0265340_100157782 395
965 3300031247 Ga0265340_10030478 Ga0265340_100304782 395
966 3300031249 Ga0265339_10000024 Ga0265339_10000024164 395
967 3300031344 Ga0265316_10040642 Ga0265316_100406423 395
968 3300031456 Ga0307513_10017608 Ga0307513_100176089 395
969 3300031595 Ga0265313_10000006 Ga0265313_10000006153 395
970 3300031595 Ga0265313_10032122 Ga0265313_100321222 395
971 3300031711 Ga0265314_10010786 Ga0265314_100107865 395
972 3300031712 Ga0265342_10040177 Ga0265342_100401772 395
973 3300031712 Ga0265342_10072636 Ga0265342_100726362 395
974 3300031727 Ga0316576_10010072 Ga0316576_100100722 395
975 3300031728 Ga0316578_10039845 Ga0316578_100398452 395
976 3300035114 Ga0373939_0000982 Ga0373939_0000982_1263_2528 395
977 3300035241 Ga0373961_0006992 Ga0373961_0006992_522_1778 395
978 3300035398 Ga0316574_0054878 Ga0316574_0054878_262_1572 395
979 3300035691 Ga0373931_0010799 Ga0373931_0010799_885_2141 395
980 3300035692 Ga0373935_0036814 Ga0373935_0036814_964_2241 395
981 3300035695 Ga0373927_0000925 Ga0373927_0000925_19724_21001 395
982 3300036647 Ga0316582_0084657 Ga0316582_0084657_693_1916 395
983 3300036712 Ga0316584_0082630 Ga0316584_0082630_266_1576 395
984 3300037471 Ga0395905_0000711 Ga0395905_0000711_38878_40158 395
985 3300037471 Ga0395905_0022173 Ga0395905_0022173_4628_5884 395
986 3300037471 Ga0395905_0029294 Ga0395905_0029294_2589_3935 395
987 3300039447 Ga0436361_0060422 Ga0436361_0060422_1669_2922 395
988 3300039447 Ga0436361_0211622 Ga0436361_0211622_4426_5676 395
989 3300039447 Ga0436361_0909929 Ga0436361_0909929_1620_2873 395
990 3300039450 Ga0436363_0278096 Ga0436363_0278096_447_1700 395
991 3300041512 Ga0451853_1379231 Ga0451853_1379231_1534_2790 395
992 3300046460 Ga0495638_0002300 Ga0495638_0002300_5511_6743 395
993 3300046513 Ga0495616_0000461 Ga0495616_0000461_17042_18274 395
994 3300046519 Ga0495632_0000761 Ga0495632_0000761_8454_9686 395
995 3300046542 Ga0495597_0020822 Ga0495597_0020822_617_1873 395
996 3300046616 Ga0495668_0011857 Ga0495668_0011857_1252_2484 395
997 3300046616 Ga0495668_0058151 Ga0495668_0058151_460_1716 395
998 3300046660 Ga0495625_0115003 Ga0495625_0115003_251_1579 395
999 3300047470 Ga0495681_0041565 Ga0495681_0041565_308_1540 395
1000 3300048088 Ga0495602_0056209 Ga0495602_0056209_2174_3430 395
1001 3300048907 Ga0496104_0257053 Ga0496104_0257053_270_1526 395
1002 3300048908 Ga0496105_0071626 Ga0496105_0071626_528_1784 395
1003 3300048909 Ga0496106_0002493 Ga0496106_0002493_2114_3352 395
1004 3300048909 Ga0496106_0121952 Ga0496106_0121952_708_1964 395
1005 3300048909 Ga0496106_0204425 Ga0496106_0204425_122_1378 395
1006 3300048910 Ga0496107_0000086 Ga0496107_0000086_13630_14868 395
1007 3300048911 Ga0496108_0248373 Ga0496108_0248373_270_1526 395
1008 3300048912 Ga0496109_0079402 Ga0496109_0079402_447_1703 395
1009 3300048913 Ga0496110_0108936 Ga0496110_0108936_1191_2447 395
1010 3300048914 Ga0496111_0046698 Ga0496111_0046698_1754_3010 395
1011 3300048917 Ga0496114_0016149 Ga0496114_0016149_268_1524 395
1012 3300048920 Ga0496117_0007358 Ga0496117_0007358_5056_6342 395
1013 3300048924 Ga0496121_0001387 Ga0496121_0001387_6657_7895 395
1014 3300048925 Ga0496122_0000492 Ga0496122_0000492_17651_18937 395
1015 3300048926 Ga0496123_0000460 Ga0496123_0000460_502_1788 395
1016 3300048927 Ga0496124_0005670 Ga0496124_0005670_4913_6199 395
1017 3300048928 Ga0496125_0004516 Ga0496125_0004516_2156_3442 395
1018 3300048929 Ga0496126_0001886 Ga0496126_0001886_1514_2800 395
1019 3300048929 Ga0496126_0051648 Ga0496126_0051648_1321_2607 395
1020 3300048929 Ga0496126_0129679 Ga0496126_0129679_266_1498 395
1021 3300049569 Ga0501032_0009315 Ga0501032_0009315_897_2159 395
1022 3300049570 Ga0501033_0000145 Ga0501033_0000145_66456_67712 395
1023 3300049570 Ga0501033_0000231 Ga0501033_0000231_12741_14003 395
1024 3300049571 Ga0501034_0012828 Ga0501034_0012828_1339_2586 395
1025 3300049571 Ga0501034_0160395 Ga0501034_0160395_594_1880 395
1026 3300049578 Ga0501042_0012026 Ga0501042_0012026_3959_5224 395
1027 3300049579 Ga0501043_0010684 Ga0501043_0010684_778_2040 395
1028 3300049588 Ga0501072_0015036 Ga0501072_0015036_2104_3360 395
1029 3300049589 Ga0501073_0003268 Ga0501073_0003268_8193_9455 395
1030 3300049744 Ga0501083_0017777 Ga0501083_0017777_985_2313 395
1031 3300049822 Ga0501035_0001815 Ga0501035_0001815_10013_11269 395
1032 3300049822 Ga0501035_0044098 Ga0501035_0044098_641_1903 395
1033 3300049823 Ga0501044_0007461 Ga0501044_0007461_6717_7991 395
1034 3300049823 Ga0501044_0092981 Ga0501044_0092981_1135_2373 395
1035 3300049824 Ga0501045_0093119 Ga0501045_0093119_529_1818 395
1036 3300050489 nmdc:mga03683_5373_c1 nmdc:mga03683_5373_c1_2737_3984 395
1037 3300050494 nmdc:mga06z11_571_c1 nmdc:mga06z11_571_c1_7793_9061 395
1038 3300050507 nmdc:mga05p37_115069_c1 nmdc:mga05p37_115069_c1_436_1692 395
1039 3300050507 nmdc:mga05p37_62352_c1 nmdc:mga05p37_62352_c1_500_1783 395
1040 3300050509 nmdc:mga0qj67_3611_c1 nmdc:mga0qj67_3611_c1_8389_9630 395
1041 3300050511 nmdc:mga08y16_28162_c1 nmdc:mga08y16_28162_c1_2668_3918 395
1042 3300050513 nmdc:mga0rr50_41064_c1 nmdc:mga0rr50_41064_c1_1942_3192 395
1043 3300050515 nmdc:mga0a205_165544_c1 nmdc:mga0a205_165544_c1_284_1540 395
1044 3300050515 nmdc:mga0a205_56508_c1 nmdc:mga0a205_56508_c1_850_2100 395
1045 3300053093 Ga0500651_0014192 Ga0500651_0014192_1570_2826 395
1046 3300053122 Ga0500608_088158 Ga0500608_088158_31_1311 395
1047 3300053125 Ga0500618_000053 Ga0500618_000053_88074_89342 395
1048 3300053136 Ga0500559_0000005 Ga0500559_0000005_102270_103526 395
1049 3300053136 Ga0500559_0003825 Ga0500559_0003825_1535_2818 395
1050 3300053142 Ga0500577_0001675 Ga0500577_0001675_977_2233 395
1051 3300053156 Ga0500622_0000695 Ga0500622_0000695_27460_28740 395
1052 iso_pu_bacteria 2582581280 2585154225 395
1053 iso_pu_bacteria 2582581293 2585197844 395
1054 3300005435 Ga0070714_100001181 Ga0070714_10000118113 396
1055 3300005549 Ga0070704_100069692 Ga0070704_1000696922 396
1056 3300005937 Ga0081455_10008107 Ga0081455_100081073 396
1057 3300005937 Ga0081455_10026716 Ga0081455_100267164 396
1058 3300007076 Ga0075435_100144345 Ga0075435_1001443452 396
1059 3300009551 Ga0105238_10356358 Ga0105238_103563581 396
1060 3300020080 Ga0206350_11260676 Ga0206350_112606761 396
1061 3300025291 Ga0209675_1003504 Ga0209675_10035042 396
1062 3300025927 Ga0207687_10262125 Ga0207687_102621251 396
1063 3300025929 Ga0207664_10000344 Ga0207664_1000034413 396
1064 3300028379 Ga0268266_10224025 Ga0268266_102240251 396
1065 3300035172 Ga0373955_0013635 Ga0373955_0013635_2538_3794 396
1066 3300036401 Ga0373937_0068094 Ga0373937_0068094_180_1436 396
1067 3300037068 Ga0373925_0023328 Ga0373925_0023328_3184_4440 396
1068 3300038443 Ga0395901_0034805 Ga0395901_0034805_210_1520 396
1069 3300039438 Ga0436360_1052754 Ga0436360_1052754_2407_3645 396
1070 3300046462 Ga0495651_0073840 Ga0495651_0073840_1109_2365 396
1071 3300046516 Ga0495628_0046984 Ga0495628_0046984_2146_3402 396
1072 3300047322 Ga0495680_0039121 Ga0495680_0039121_1168_2424 396
1073 3300049823 Ga0501044_0220284 Ga0501044_0220284_253_1500 396
1074 3300050513 nmdc:mga0rr50_73300_c1 nmdc:mga0rr50_73300_c1_127_1386 396
1075 3300050514 nmdc:mga08x19_4_c2 nmdc:mga08x19_4_c2_126370_127629 396
1076 3300005336 Ga0070680_100160063 Ga0070680_1001600631 397
1077 3300005436 Ga0070713_100014715 Ga0070713_1000147152 397
1078 3300005563 Ga0068855_100016855 Ga0068855_10001685512 397
1079 3300006028 Ga0070717_10065502 Ga0070717_100655022 397
1080 3300009093 Ga0105240_10000287 Ga0105240_1000028733 397
1081 3300009093 Ga0105240_10000874 Ga0105240_100008745 397
1082 3300014325 Ga0163163_10347325 Ga0163163_103473251 397
1083 3300014497 Ga0182008_10034895 Ga0182008_100348952 397
1084 3300014497 Ga0182008_10048830 Ga0182008_100488301 397
1085 3300021388 Ga0213875_10001756 Ga0213875_1000175614 397
1086 3300022467 Ga0224712_10012001 Ga0224712_100120012 397
1087 3300025913 Ga0207695_10001005 Ga0207695_1000100544 397
1088 3300025913 Ga0207695_10006511 Ga0207695_100065115 397
1089 3300025921 Ga0207652_10033786 Ga0207652_100337862 397
1090 3300025928 Ga0207700_10051190 Ga0207700_100511902 397
1091 3300025949 Ga0207667_10016842 Ga0207667_1001684211 397
1092 3300037853 Ga0436364_0956907 Ga0436364_0956907_7956_9311 397
1093 3300037853 Ga0436364_1279775 Ga0436364_1279775_133_1410 397
1094 3300039447 Ga0436361_0996213 Ga0436361_0996213_15715_16947 397
1095 3300039447 Ga0436361_1100325 Ga0436361_1100325_2891_4123 397
1096 3300045049 Ga0466959_0122789 Ga0466959_0122789_574_1809 397
1097 3300045051 Ga0451576_0002320 Ga0451576_0002320_22700_24001 397
1098 3300048915 Ga0496112_0167113 Ga0496112_0167113_108_1376 397
1099 3300013105 Ga0157369_10335420 Ga0157369_103354202 398
1100 3300025904 Ga0207647_10004458 Ga0207647_100044583 398
1101 3300005457 Ga0070662_100008266 Ga0070662_1000082663 400
1102 3300046525 Ga0495663_0001633 Ga0495663_0001633_5363_6616 400
1103 3300046558 Ga0495633_0058417 Ga0495633_0058417_285_1499 400
1104 iso_pu_bacteria 2512564014 2512644446 409
1105 iso_pu_bacteria 2775507255 2778123294 409
1106 iso_pu_bacteria 2808606401 2809063427 409
1107 iso_pu_bacteria 2808606404 2809079137 409
1108 iso_pu_bacteria 2808606405 2809083489 409
1109 iso_pu_bacteria 2880518877 2880520697 409
1110 iso_pu_bacteria 2919709256 2919712435 409
1111 2162886007 SwRhRL2b_contig_1374729 SwRhRL2b_0675.00001340 413
1112 3300001904 JGI24736J21556_1000471 JGI24736J21556_10004717 413
1113 3300001915 JGI24741J21665_1000382 JGI24741J21665_10003822 413
1114 3300001979 JGI24740J21852_10001194 JGI24740J21852_100011943 413
1115 3300001989 JGI24739J22299_10014105 JGI24739J22299_100141053 413
1116 3300001990 JGI24737J22298_10004375 JGI24737J22298_100043753 413
1117 3300002067 JGI24735J21928_10001449 JGI24735J21928_100014493 413
1118 3300002075 JGI24738J21930_10008186 JGI24738J21930_100081861 413
1119 3300005289 Ga0065704_10011258 Ga0065704_100112581 413
1120 3300005289 Ga0065704_10072447 Ga0065704_100724476 413
1121 3300005289 Ga0065704_10145782 Ga0065704_101457821 413
1122 3300005327 Ga0070658_10020815 Ga0070658_100208153 413
1123 3300005339 Ga0070660_100011131 Ga0070660_1000111317 413
1124 3300005344 Ga0070661_100038900 Ga0070661_1000389003 413
1125 3300005347 Ga0070668_100009650 Ga0070668_1000096507 413
1126 3300005353 Ga0070669_100056464 Ga0070669_1000564642 413
1127 3300005614 Ga0068856_100027948 Ga0068856_1000279483 413
1128 3300005834 Ga0068851_10009846 Ga0068851_100098462 413
1129 3300006178 Ga0075367_10000028 Ga0075367_1000002820 413
1130 3300009174 Ga0105241_10009670 Ga0105241_100096706 413
1131 3300009978 Ga0105148_100001 Ga0105148_10000147 413
1132 3300013100 Ga0157373_10018656 Ga0157373_100186563 413
1133 3300013104 Ga0157370_10010836 Ga0157370_100108364 413
1134 3300017792 Ga0163161_10009072 Ga0163161_100090725 413
1135 3300025229 Ga0209147_100894 Ga0209147_10089412 413
1136 3300025911 Ga0207654_10008215 Ga0207654_100082155 413
1137 3300025913 Ga0207695_10152083 Ga0207695_101520833 413
1138 3300025923 Ga0207681_10031848 Ga0207681_100318483 413
1139 3300025932 Ga0207690_10130557 Ga0207690_101305571 413
1140 3300025933 Ga0207706_10045644 Ga0207706_100456442 413
1141 3300025949 Ga0207667_10123693 Ga0207667_101236933 413
1142 3300026041 Ga0207639_10001279 Ga0207639_100012795 413
1143 3300026067 Ga0207678_10000402 Ga0207678_1000040226 413
1144 3300026078 Ga0207702_10004355 Ga0207702_1000435512 413
1145 3300026116 Ga0207674_10010437 Ga0207674_100104378 413
1146 3300026142 Ga0207698_10046813 Ga0207698_100468134 413
1147 3300027866 Ga0209813_10000019 Ga0209813_100000191 413
1148 3300031731 Ga0307405_10005099 Ga0307405_100050996 413
1149 3300032002 Ga0307416_100016945 Ga0307416_1000169456 413
1150 3300046452 Ga0495617_011202 Ga0495617_011202_307_1548 413
1151 3300046453 Ga0495627_000112 Ga0495627_000112_18334_19575 413
1152 3300046453 Ga0495627_000206 Ga0495627_000206_27479_28720 413
1153 3300046491 Ga0495584_0030416 Ga0495584_0030416_744_1985 413
1154 3300046512 Ga0495610_0000085 Ga0495610_0000085_86669_87910 413
1155 3300046519 Ga0495632_0000095 Ga0495632_0000095_76653_77894 413
1156 3300046520 Ga0495637_0001011 Ga0495637_0001011_6978_8219 413
1157 3300046520 Ga0495637_0010056 Ga0495637_0010056_658_1899 413
1158 3300046522 Ga0495643_0000038 Ga0495643_0000038_223132_224373 413
1159 3300046525 Ga0495663_0000028 Ga0495663_0000028_76653_77894 413
1160 3300046558 Ga0495633_0000136 Ga0495633_0000136_32643_33884 413
1161 3300046558 Ga0495633_0001114 Ga0495633_0001114_11633_12874 413
1162 3300046692 Ga0495671_0000027 Ga0495671_0000027_11639_12880 413
1163 3300047470 Ga0495681_0000013 Ga0495681_0000013_89733_90974 413
1164 3300047470 Ga0495681_0001132 Ga0495681_0001132_7614_8855 413
1165 3300047472 Ga0495686_0005745 Ga0495686_0005745_6227_7468 413
1166 3300047472 Ga0495686_0145124 Ga0495686_0145124_98_1339 413
1167 3300048913 Ga0496110_0055094 Ga0496110_0055094_377_1618 413
1168 3300048913 Ga0496110_0061792 Ga0496110_0061792_1260_2501 413
1169 3300048916 Ga0496113_0130843 Ga0496113_0130843_469_1710 413
1170 3300048920 Ga0496117_0023559 Ga0496117_0023559_574_1815 413
1171 3300048921 Ga0496118_0038502 Ga0496118_0038502_774_2015 413
1172 3300048924 Ga0496121_0001426 Ga0496121_0001426_13573_14814 413
1173 3300048925 Ga0496122_0011807 Ga0496122_0011807_6161_7402 413
1174 3300048926 Ga0496123_0025859 Ga0496123_0025859_1787_3028 413
1175 3300048927 Ga0496124_0019516 Ga0496124_0019516_1596_2837 413
1176 3300048928 Ga0496125_0000425 Ga0496125_0000425_73516_74757 413
1177 3300048928 Ga0496125_0027998 Ga0496125_0027998_3172_4413 413
1178 3300048929 Ga0496126_0010007 Ga0496126_0010007_4003_5244 413
1179 3300049459 Ga0495678_033410 Ga0495678_033410_223_1464 413
1180 3300049658 Ga0501211_001280 Ga0501211_001280_420_1661 413
1181 3300049663 Ga0501223_000080 Ga0501223_000080_17765_19006 413
1182 3300049669 Ga0501235_000785 Ga0501235_000785_4288_5529 413
1183 3300049669 Ga0501235_013853 Ga0501235_013853_212_1453 413
1184 3300049670 Ga0501236_004335 Ga0501236_004335_355_1596 413
1185 3300049705 Ga0501225_0000092 Ga0501225_0000092_9837_11078 413
1186 3300049705 Ga0501225_0004314 Ga0501225_0004314_978_2219 413
1187 3300049708 Ga0501245_000399 Ga0501245_000399_293_1534 413
1188 3300049761 Ga0501264_002384 Ga0501264_002384_280_1521 413
1189 3300050494 nmdc:mga06z11_255_c1 nmdc:mga06z11_255_c1_9036_10277 413
1190 3300050495 nmdc:mga04h51_62_c1 nmdc:mga04h51_62_c1_10446_11687 413
1191 3300053157 Ga0500624_000028 Ga0500624_000028_45700_46941 413

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02353

CMAS

Mycolic acid cyclopropane synthetase

188

455

0.98

PF13649

Methyltransf_25

Methyltransferase domain

251

345

0.96

PF08241

Methyltransf_11

Methyltransferase domain

252

349

0.88

PF08242

Methyltransf_12

Methyltransferase domain

252

347

0.88

PF13489

Methyltransf_23

Methyltransferase domain

228

427

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tpy-assembly1.cif.gz_A structure of the cyclopropane synthase mmaa2 from mycobacterium tuberculosis 0.9339 122 390
7qos-assembly2.cif.gz_B cyclopropane fatty acid synthase from aquifex aeolicous with bound ligands 0.9319 3 391
1l1e-assembly2.cif.gz_B crystal structure of mycolic acid cyclopropane synthase pcaa complexed with s-adenosyl-l-homocysteine 0.9298 129 390
3hem-assembly1.cif.gz_A structure of mycobacterium tuberculosis mycolic acid cyclopropane synthase cmaa2 in complex with dioctylamine 0.9277 123 390
1l1e-assembly1.cif.gz_A crystal structure of mycolic acid cyclopropane synthase pcaa complexed with s-adenosyl-l-homocysteine 0.9265 129 390
ID Description Score Start End Superfamily
af_O69687_132_410_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9622 117 390 3.40.50.150
af_Q5APD4_189_477_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9403 117 390 3.40.50.150
af_Q54QG2_134_419_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9366 110 391 3.40.50.150
af_O69687_132_410_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9352 117 390 3.40.50.150
af_Q2QUD2_542_827_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9345 110 391 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1H8W8X6-F1-model_v4 Mycolic acid cyclopropane synthetase 0.9888 213 409
AF-A0A6J4S1F2-F1-model_v4 Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79) 0.9884 209 410 GO:0008610
GO:0008825
GO:0032259
AF-A0A2U8G8I5-F1-model_v4 deleted 0.9853 183 409
AF-A0A353R2W9-F1-model_v4 UvrD-like helicase C-terminal domain-containing protein 0.9831 183 413 GO:0004386
GO:0005524
GO:0016787
AF-A0A259HFD8-F1-model_v4 SAM-dependent methyltransferase 0.9787 284 413 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
90.5 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map