F491164

General Info

Members Datasets Scaffolds Average Seq Length
1171 479 1149 314

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100083474|Ga0070705_1000834742
Length 321
Sequence MIDLSLVEGLSIQASQMLLVLMLSPLLTGLVRKVKALLLRRQGPPILQPYRDLVRLVRKEAVVAHSASWLFRIVPYIVFAATWVAAALVPTFATGLLFSWSADLIVIIALLGSARFFLALAGMDVGTSFGGIGSSREAMIAMLAEPALIMIVFTLALIAGSTQLSTIAAIMLTPGVGLRISLGLALIALIIVAIAENGRIPVDNPATHLELTMVHEAMVLEYSGRHLALIELAAAIKLLLYASLIACVFVPWGMAPAGAPLHVHLIGGVVYIAKLGVAGLLLAVFETTIAKMRVFRVPDLLGAALMLGFLGTLLRFVSRGM

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
6 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
7 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
8 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
9 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
10 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
11 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
12 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
13 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
14 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
15 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
16 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
17 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
18 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
19 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
20 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
21 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
22 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
23 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
24 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
25 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
26 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
27 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
28 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
29 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
30 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
31 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
35 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
36 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
37 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
38 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
39 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
40 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
41 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
42 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
43 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
44 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
48 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
49 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
50 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
66 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
71 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
72 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
73 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
74 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
75 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
79 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
80 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
81 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
82 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
83 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
84 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
85 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
86 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
87 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
88 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
92 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
93 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
94 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
100 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
101 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
102 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
109 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
110 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
113 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
114 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
117 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
118 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
119 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
120 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
121 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
122 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
123 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
124 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
125 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
126 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
129 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
133 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
136 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
137 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
138 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
139 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
140 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
141 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
142 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
143 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
145 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
146 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
147 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
159 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
160 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
161 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
164 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
165 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
166 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
167 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
168 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
169 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
170 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
171 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
172 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
173 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
174 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
248 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
249 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
250 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
255 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
257 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
261 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
262 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
265 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
266 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
267 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
268 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
269 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
270 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
271 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
272 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
273 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
274 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
275 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
276 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
277 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
278 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
279 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
280 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
281 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
282 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
283 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
284 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
285 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
286 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
287 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
288 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
289 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
290 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
291 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
292 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
293 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
294 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
295 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
296 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
298 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
299 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
300 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
301 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
302 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
303 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
304 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
305 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
306 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
307 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
308 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
309 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
310 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
311 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
312 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
313 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
314 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
315 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
316 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
317 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
318 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
319 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
320 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
321 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
322 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
323 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
324 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
325 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
326 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
327 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
328 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
329 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
330 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
331 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
332 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
333 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
334 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
335 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
336 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
337 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
338 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
339 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
340 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
341 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
342 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
343 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
344 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
345 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
346 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
347 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
348 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
349 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
350 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
351 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
352 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
353 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
354 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
355 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
356 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
357 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
358 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
359 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
360 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
361 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
362 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
363 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
364 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
365 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
366 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
367 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
368 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
369 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
370 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
371 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
372 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
373 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
374 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
375 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
376 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
377 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
378 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
379 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
380 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
381 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
382 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
383 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
384 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
385 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
386 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
387 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
388 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
389 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
390 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
391 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
392 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
393 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
394 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
395 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
396 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
397 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
398 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
399 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
400 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
401 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
402 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
403 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
404 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
405 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
406 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
407 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
408 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
409 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
413 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
414 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
415 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
416 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
432 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
433 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
434 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
435 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
436 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
437 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
438 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
439 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
440 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
441 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
442 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
443 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
444 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
445 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
446 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
447 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
448 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
451 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
452 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
453 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
454 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
455 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
456 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
457 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
458 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
459 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
460 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
461 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
462 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
463 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
464 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
465 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
466 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
467 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
468 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
469 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
470 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
471 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
472 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
473 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
474 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
475 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
476 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
477 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
478 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
479 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 0.26
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.59
Nodule 0.77
Rhizoplane 6.4
Rhizosphere 87.79
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C5112 2010549000 Bacteria 1234
2 2214828529 2209111006 Bacteria 9764
3 ARSoilYngRDRAFT_c00827 3300000042 Bacteria 2540
4 ARcpr5yngRDRAFT_c000144 3300000043 Bacteria 11410
5 ARSoilOldRDRAFT_c000792 3300000044 Bacteria 3194
6 ARCol0oldRDRAFT_c00111 3300000045 Bacteria 7051
7 ARCol0yngRDRAFT_1000163 3300000652 Bacteria 11440
8 JGI24752J21851_1001527 3300001976 Bacteria 3118
9 JGI24746J21847_1000023 3300001977 Bacteria 14867
10 JGI24746J21847_1002224 3300001977 Bacteria 3102
11 JGI24739J22299_10000241 3300001989 Bacteria 18446
12 JGI24737J22298_10000224 3300001990 Bacteria 18603
13 JGI24737J22298_10000674 3300001990 Bacteria 12084
14 JGI24743J22301_10003893 3300001991 Bacteria 2392
15 JGI24750J21931_1000337 3300002070 Bacteria 7984
16 JGI24750J21931_1000352 3300002070 Bacteria 7824
17 JGI24750J21931_1001355 3300002070 Bacteria 3076
18 JGI24745J21846_1000775 3300002073 Bacteria 2925
19 JGI24748J21848_1000156 3300002074 Bacteria 10018
20 JGI24738J21930_10000197 3300002075 Bacteria 15932
21 JGI24749J21850_1002812 3300002076 Bacteria 2437
22 JGI24744J21845_10000934 3300002077 Bacteria 5556
23 JGI24035J26624_1000018 3300002126 Bacteria 11637
24 JGI24033J26618_1000741 3300002155 Bacteria 3130
25 JGI24034J26672_10000296 3300002239 Bacteria 6575
26 JGI24742J22300_10000152 3300002244 Bacteria 10183
27 JGI24742J22300_10000424 3300002244 Bacteria 6224
28 JGI25151J46595_10000193 3300003187 Bacteria 75098
29 JGI25406J46586_10004053 3300003203 Bacteria 6850
30 JGI25160J50197_1024073 3300003354 Bacteria 1736
31 Ga0065717_1002094 3300005276 Bacteria 2970
32 Ga0065712_10002365 3300005290 Bacteria 8694
33 Ga0065712_10071985 3300005290 Bacteria 4954
34 Ga0065715_10001277 3300005293 Bacteria 11971
35 Ga0065715_10089028 3300005293 Bacteria 16334
36 Ga0065707_10107876 3300005295 Bacteria 2534
37 Ga0070658_10003962 3300005327 Bacteria 12134
38 Ga0070676_10000629 3300005328 Bacteria 17200
39 Ga0070676_10031955 3300005328 Bacteria 3013
40 Ga0070683_100000240 3300005329 Bacteria 37588
41 Ga0070683_100020152 3300005329 Bacteria 5932
42 Ga0070683_100153286 3300005329 Bacteria 2185
43 Ga0070690_100000264 3300005330 Bacteria 27010
44 Ga0070690_100010416 3300005330 Bacteria 5411
45 Ga0070690_100068744 3300005330 Bacteria 2298
46 Ga0070690_100105533 3300005330 Bacteria 1873
47 Ga0070690_100154275 3300005330 Bacteria 1569
48 Ga0070670_100002399 3300005331 Bacteria 15441
49 Ga0070670_100045914 3300005331 Bacteria 3756
50 Ga0070677_10000507 3300005333 Bacteria 13417
51 Ga0068869_100000189 3300005334 Bacteria 31886
52 Ga0068869_100033165 3300005334 Bacteria 3644
53 Ga0070666_10019187 3300005335 Bacteria 4411
54 Ga0070666_10041895 3300005335 Bacteria 3061
55 Ga0070680_100000210 3300005336 Bacteria 38357
56 Ga0070680_100000706 3300005336 Bacteria 23169
57 Ga0070680_100009451 3300005336 Bacteria 7491
58 Ga0070680_100020964 3300005336 Bacteria 5189
59 Ga0070680_100027458 3300005336 Bacteria 4558
60 Ga0070680_100443725 3300005336 Bacteria 1108
61 Ga0070682_100000202 3300005337 Bacteria 44018
62 Ga0070682_100009990 3300005337 Bacteria 5375
63 Ga0070682_100013606 3300005337 Bacteria 4686
64 Ga0070682_100249014 3300005337 Bacteria 1280
65 Ga0068868_100021910 3300005338 Bacteria 4817
66 Ga0068868_100033405 3300005338 Bacteria 3965
67 Ga0070660_100000223 3300005339 Bacteria 37464
68 Ga0070660_100011386 3300005339 Bacteria 6317
69 Ga0070660_100072810 3300005339 Bacteria 2686
70 Ga0070660_100077113 3300005339 Bacteria 2611
71 Ga0070689_100000187 3300005340 Bacteria 37473
72 Ga0070689_100018460 3300005340 Bacteria 5139
73 Ga0070689_100020568 3300005340 Bacteria 4899
74 Ga0070689_100024256 3300005340 Bacteria 4547
75 Ga0070691_10000236 3300005341 Bacteria 18840
76 Ga0070691_10010464 3300005341 Bacteria 4233
77 Ga0070691_10054149 3300005341 Bacteria 1920
78 Ga0070687_100000306 3300005343 Bacteria 16620
79 Ga0070687_100005837 3300005343 Bacteria 5009
80 Ga0070687_100028601 3300005343 Bacteria 2706
81 Ga0070687_100055735 3300005343 Bacteria 2066
82 Ga0070661_100000298 3300005344 Bacteria 40083
83 Ga0070661_100027242 3300005344 Bacteria 4113
84 Ga0070692_10000016 3300005345 Bacteria 34456
85 Ga0070668_100006404 3300005347 Bacteria 8724
86 Ga0070668_100010470 3300005347 Bacteria 6893
87 Ga0070668_100013411 3300005347 Bacteria 6116
88 Ga0070669_100000959 3300005353 Bacteria 21059
89 Ga0070669_100009625 3300005353 Bacteria 6883
90 Ga0070669_100014612 3300005353 Bacteria 5589
91 Ga0070669_100071006 3300005353 Bacteria 2575
92 Ga0070675_100000215 3300005354 Bacteria 37364
93 Ga0070675_100007433 3300005354 Bacteria 8461
94 Ga0070675_100011271 3300005354 Bacteria 6998
95 Ga0070671_100000402 3300005355 Bacteria 29873
96 Ga0070671_100010939 3300005355 Bacteria 7287
97 Ga0070671_100055232 3300005355 Bacteria 3304
98 Ga0070674_100000709 3300005356 Bacteria 16967
99 Ga0070674_100002281 3300005356 Bacteria 10585
100 Ga0070674_100009356 3300005356 Bacteria 5867
101 Ga0070673_100000035 3300005364 Bacteria 57163
102 Ga0070673_100103748 3300005364 Bacteria 2346
103 Ga0070688_100000130 3300005365 Bacteria 40342
104 Ga0070688_100003918 3300005365 Bacteria 7717
105 Ga0070688_100043003 3300005365 Bacteria 2782
106 Ga0070659_100000583 3300005366 Bacteria 26638
107 Ga0070659_100043211 3300005366 Bacteria 3524
108 Ga0070659_100052526 3300005366 Bacteria 3206
109 Ga0070659_100108502 3300005366 Bacteria 2239
110 Ga0070667_100000712 3300005367 Bacteria 32083
111 Ga0070667_100026753 3300005367 Bacteria 4800
112 Ga0070703_10023357 3300005406 Bacteria 1821
113 Ga0070714_100018802 3300005435 Bacteria 5620
114 Ga0070714_100148792 3300005435 Bacteria 2108
115 Ga0070713_100010347 3300005436 Bacteria 6737
116 Ga0070713_100089294 3300005436 Bacteria 2647
117 Ga0070713_100096688 3300005436 Bacteria 2550
118 Ga0070713_100154538 3300005436 Bacteria 2044
119 Ga0070713_100337383 3300005436 Bacteria 1396
120 Ga0070713_100553933 3300005436 Bacteria 1089
121 Ga0070710_10000656 3300005437 Bacteria 16428
122 Ga0070710_10009990 3300005437 Bacteria 4653
123 Ga0070701_10000081 3300005438 Bacteria 26416
124 Ga0070701_10007943 3300005438 Bacteria 4564
125 Ga0070701_10034214 3300005438 Bacteria 2544
126 Ga0070711_100008844 3300005439 Bacteria 6182
127 Ga0070711_100058616 3300005439 Bacteria 2670
128 Ga0070711_100360424 3300005439 Bacteria 1171
129 Ga0070705_100000911 3300005440 Bacteria 16539
130 Ga0070705_100028423 3300005440 Bacteria 3062
131 Ga0070705_100083474 3300005440 Bacteria 1969
132 Ga0070700_100000393 3300005441 Bacteria 22580
133 Ga0070700_100006267 3300005441 Bacteria 6347
134 Ga0070700_100022752 3300005441 Bacteria 3661
135 Ga0070700_100070463 3300005441 Bacteria 2229
136 Ga0070694_100000129 3300005444 Bacteria 37699
137 Ga0070694_100003990 3300005444 Bacteria 8831
138 Ga0070708_100022564 3300005445 Bacteria 5339
139 Ga0070663_100000746 3300005455 Bacteria 17593
140 Ga0070663_100004572 3300005455 Bacteria 8149
141 Ga0070663_100011714 3300005455 Bacteria 5518
142 Ga0070663_100026948 3300005455 Bacteria 3898
143 Ga0070678_100000399 3300005456 Bacteria 20439
144 Ga0070678_100048917 3300005456 Bacteria 3048
145 Ga0070662_100001543 3300005457 Bacteria 14211
146 Ga0070662_100016757 3300005457 Bacteria 4925
147 Ga0070662_100019314 3300005457 Bacteria 4624
148 Ga0070681_10000001 3300005458 Bacteria 946857
149 Ga0070681_10001286 3300005458 Bacteria 21879
150 Ga0070681_10040205 3300005458 Bacteria 4688
151 Ga0070681_10043290 3300005458 Bacteria 4510
152 Ga0070681_10061642 3300005458 Bacteria 3724
153 Ga0070681_10256287 3300005458 Bacteria 1661
154 Ga0070681_10387420 3300005458 Bacteria 1308
155 Ga0068867_100001770 3300005459 Bacteria 15034
156 Ga0068867_100004534 3300005459 Bacteria 9766
157 Ga0068867_100024994 3300005459 Bacteria 4284
158 Ga0070685_10000490 3300005466 Bacteria 22910
159 Ga0070685_10012931 3300005466 Bacteria 4394
160 Ga0070685_10032047 3300005466 Bacteria 2942
161 Ga0070685_10250085 3300005466 Bacteria 1174
162 Ga0074259_10596474 3300005507 Bacteria 1757
163 Ga0070679_100000037 3300005530 Bacteria 100971
164 Ga0070679_100000553 3300005530 Bacteria 31683
165 Ga0070679_100027141 3300005530 Bacteria 5631
166 Ga0070679_100056209 3300005530 Bacteria 3921
167 Ga0070684_100000246 3300005535 Bacteria 37600
168 Ga0070684_100004789 3300005535 Bacteria 10338
169 Ga0070684_100024430 3300005535 Bacteria 5070
170 Ga0070684_100203065 3300005535 Bacteria 1805
171 Ga0068853_100000243 3300005539 Bacteria 38327
172 Ga0068853_100097710 3300005539 Bacteria 2593
173 Ga0068853_100179302 3300005539 Bacteria 1920
174 Ga0070672_100000157 3300005543 Bacteria 37598
175 Ga0070672_100003221 3300005543 Bacteria 10563
176 Ga0070686_100000260 3300005544 Bacteria 36083
177 Ga0070686_100008427 3300005544 Bacteria 5772
178 Ga0070686_100037335 3300005544 Bacteria 3013
179 Ga0070695_100004051 3300005545 Bacteria 8572
180 Ga0070695_100005692 3300005545 Bacteria 7348
181 Ga0070695_100074049 3300005545 Bacteria 2237
182 Ga0070696_100000970 3300005546 Bacteria 18596
183 Ga0070696_100003815 3300005546 Bacteria 10062
184 Ga0070696_100097933 3300005546 Bacteria 2098
185 Ga0070696_100131855 3300005546 Bacteria 1819
186 Ga0070693_100000925 3300005547 Bacteria 13032
187 Ga0070693_100140556 3300005547 Bacteria 1519
188 Ga0070665_100003075 3300005548 Bacteria 17973
189 Ga0070665_100010001 3300005548 Bacteria 9596
190 Ga0070665_100041633 3300005548 Bacteria 4618
191 Ga0070704_100000171 3300005549 Bacteria 25774
192 Ga0070704_100001307 3300005549 Bacteria 13180
193 Ga0070704_100026429 3300005549 Bacteria 3835
194 Ga0068855_100010157 3300005563 Bacteria 11347
195 Ga0068855_100031343 3300005563 Bacteria 6349
196 Ga0068855_100047138 3300005563 Bacteria 5092
197 Ga0068855_100153394 3300005563 Bacteria 2618
198 Ga0068855_100239024 3300005563 Bacteria 2030
199 Ga0070664_100000269 3300005564 Bacteria 37475
200 Ga0070664_100052826 3300005564 Bacteria 3443
201 Ga0070664_100059585 3300005564 Bacteria 3248
202 Ga0070664_100129446 3300005564 Bacteria 2216
203 Ga0068857_100000174 3300005577 Bacteria 40766
204 Ga0068857_100049341 3300005577 Bacteria 3734
205 Ga0068857_100099316 3300005577 Bacteria 2611
206 Ga0068854_100000211 3300005578 Bacteria 39059
207 Ga0068854_100013937 3300005578 Bacteria 5288
208 Ga0068854_100066678 3300005578 Bacteria 2620
209 Ga0068854_100105533 3300005578 Bacteria 2118
210 Ga0068856_100000600 3300005614 Bacteria 39415
211 Ga0070702_100000654 3300005615 Bacteria 12905
212 Ga0070702_100175884 3300005615 Bacteria 1396
213 Ga0068852_100000629 3300005616 Bacteria 23063
214 Ga0068852_100009156 3300005616 Bacteria 7334
215 Ga0068852_100014841 3300005616 Bacteria 6020
216 Ga0068859_100000894 3300005617 Bacteria 30361
217 Ga0068859_100024112 3300005617 Bacteria 6105
218 Ga0068859_100265007 3300005617 Bacteria 1810
219 Ga0068864_100000329 3300005618 Bacteria 41801
220 Ga0068864_100004704 3300005618 Bacteria 11195
221 Ga0068866_10000177 3300005718 Bacteria 29851
222 Ga0068866_10004095 3300005718 Bacteria 5982
223 Ga0068861_100000329 3300005719 Bacteria 26778
224 Ga0068861_100017474 3300005719 Bacteria 5094
225 Ga0068861_100026049 3300005719 Bacteria 4247
226 Ga0068861_100204819 3300005719 Bacteria 1658
227 Ga0068870_10000056 3300005840 Bacteria 36039
228 Ga0068870_10004328 3300005840 Bacteria 6109
229 Ga0068863_100000278 3300005841 Bacteria 53024
230 Ga0068863_100014875 3300005841 Bacteria 7475
231 Ga0068858_100001048 3300005842 Bacteria 28582
232 Ga0068858_100008255 3300005842 Bacteria 10009
233 Ga0068858_100046045 3300005842 Bacteria 4044
234 Ga0068860_100000985 3300005843 Bacteria 31478
235 Ga0068860_100007113 3300005843 Bacteria 11195
236 Ga0068860_100088750 3300005843 Bacteria 2943
237 Ga0068860_100160849 3300005843 Bacteria 2165
238 Ga0068862_100000593 3300005844 Bacteria 37703
239 Ga0068862_100000775 3300005844 Bacteria 31713
240 Ga0068862_100007625 3300005844 Bacteria 8962
241 Ga0068862_100007945 3300005844 Bacteria 8776
242 Ga0068862_100009498 3300005844 Bacteria 8049
243 Ga0081455_10000051 3300005937 Bacteria 123542
244 Ga0081455_10004739 3300005937 Bacteria 15120
245 Ga0081455_10062668 3300005937 Bacteria 3124
246 Ga0081539_10003785 3300005985 Bacteria 17869
247 Ga0070717_10119137 3300006028 Bacteria 2259
248 Ga0070717_10139812 3300006028 Bacteria 2088
249 Ga0075365_10026618 3300006038 Bacteria 3673
250 Ga0075365_10103766 3300006038 Bacteria 1949
251 Ga0075368_10020359 3300006042 Bacteria 2512
252 Ga0075368_10044879 3300006042 Bacteria 1745
253 Ga0075363_100042317 3300006048 Bacteria 2406
254 Ga0075364_10027444 3300006051 Bacteria 3637
255 Ga0075364_10204264 3300006051 Bacteria 1339
256 Ga0075364_10236647 3300006051 Bacteria 1240
257 Ga0070715_10010214 3300006163 Bacteria 3339
258 Ga0070715_10063916 3300006163 Bacteria 1624
259 Ga0070715_10087304 3300006163 Bacteria 1428
260 Ga0070716_100004545 3300006173 Bacteria 6650
261 Ga0070712_100016638 3300006175 Bacteria 4751
262 Ga0070712_100029533 3300006175 Bacteria 3676
263 Ga0070712_100034712 3300006175 Bacteria 3420
264 Ga0070712_100122234 3300006175 Bacteria 1960
265 Ga0070712_100139359 3300006175 Bacteria 1849
266 Ga0075367_10009838 3300006178 Bacteria 5010
267 Ga0075367_10030759 3300006178 Bacteria 3080
268 Ga0075367_10049575 3300006178 Bacteria 2475
269 Ga0075369_10005713 3300006186 Bacteria 4667
270 Ga0075369_10023201 3300006186 Bacteria 2564
271 Ga0097621_100000504 3300006237 Bacteria 27335
272 Ga0097621_100004513 3300006237 Bacteria 9706
273 Ga0097621_100006326 3300006237 Bacteria 8404
274 Ga0075370_10017676 3300006353 Bacteria 3855
275 Ga0068871_100000815 3300006358 Bacteria 20895
276 Ga0068871_100005880 3300006358 Bacteria 8625
277 Ga0075430_100021821 3300006846 Bacteria 5441
278 Ga0075431_100032372 3300006847 Bacteria 5388
279 Ga0075433_10201376 3300006852 Bacteria 1770
280 Ga0075434_100000244 3300006871 Bacteria 38039
281 Ga0075434_100000519 3300006871 Bacteria 29333
282 Ga0075434_100055241 3300006871 Bacteria 3946
283 Ga0075434_100286440 3300006871 Bacteria 1667
284 Ga0075429_100382428 3300006880 Bacteria 1232
285 Ga0068865_100000332 3300006881 Bacteria 26180
286 Ga0068865_100031851 3300006881 Bacteria 3518
287 Ga0068865_100166946 3300006881 Bacteria 1684
288 Ga0075436_100052430 3300006914 Bacteria 2816
289 Ga0075436_100090108 3300006914 Bacteria 2131
290 Ga0075436_100288125 3300006914 Bacteria 1175
291 Ga0097620_100000894 3300006931 Bacteria 30361
292 Ga0097620_100024111 3300006931 Bacteria 6105
293 Ga0097620_100265007 3300006931 Bacteria 1810
294 Ga0075435_100047561 3300007076 Bacteria 3445
295 Ga0075435_100074514 3300007076 Bacteria 2777
296 Ga0105250_10028955 3300009092 Bacteria 2229
297 Ga0105250_10045782 3300009092 Bacteria 1754
298 Ga0105240_10063893 3300009093 Bacteria 4576
299 Ga0105240_10496464 3300009093 Bacteria 1358
300 Ga0111539_10001076 3300009094 Bacteria 36048
301 Ga0111539_10011662 3300009094 Bacteria 11023
302 Ga0111539_10044669 3300009094 Bacteria 5307
303 Ga0111539_10122649 3300009094 Bacteria 3046
304 Ga0111539_10276631 3300009094 Bacteria 1953
305 Ga0105245_10000451 3300009098 Bacteria 37705
306 Ga0105245_10006657 3300009098 Bacteria 10142
307 Ga0105245_10009909 3300009098 Bacteria 8299
308 Ga0105245_10042174 3300009098 Bacteria 4071
309 Ga0105245_10066551 3300009098 Bacteria 3262
310 Ga0105247_10001553 3300009101 Bacteria 16377
311 Ga0105247_10006039 3300009101 Bacteria 7534
312 Ga0105247_10013787 3300009101 Bacteria 4846
313 Ga0105247_10014447 3300009101 Bacteria 4736
314 Ga0105247_10159304 3300009101 Bacteria 1493
315 Ga0114129_10059574 3300009147 Bacteria 5338
316 Ga0105243_10001205 3300009148 Bacteria 23282
317 Ga0105243_10058461 3300009148 Bacteria 3072
318 Ga0105243_10070118 3300009148 Bacteria 2829
319 Ga0105243_10174090 3300009148 Bacteria 1867
320 Ga0105241_10000515 3300009174 Bacteria 29094
321 Ga0105241_10034338 3300009174 Bacteria 3809
322 Ga0105241_10043489 3300009174 Bacteria 3402
323 Ga0105241_10472669 3300009174 Bacteria 1113
324 Ga0105242_10008078 3300009176 Bacteria 8097
325 Ga0105248_10000837 3300009177 Bacteria 34570
326 Ga0105248_10006976 3300009177 Bacteria 12373
327 Ga0105248_10049463 3300009177 Bacteria 4715
328 Ga0105237_10009856 3300009545 Bacteria 10213
329 Ga0105237_10011688 3300009545 Bacteria 9287
330 Ga0105237_10145521 3300009545 Bacteria 2365
331 Ga0105237_10289614 3300009545 Bacteria 1640
332 Ga0105238_10042052 3300009551 Bacteria 4627
333 Ga0105238_10047430 3300009551 Bacteria 4331
334 Ga0105238_10091379 3300009551 Bacteria 3031
335 Ga0105238_10139584 3300009551 Bacteria 2401
336 Ga0105249_10001556 3300009553 Bacteria 20141
337 Ga0105249_10018383 3300009553 Bacteria 6216
338 Ga0105249_10069863 3300009553 Bacteria 3242
339 Ga0105249_10714840 3300009553 Bacteria 1062
340 Ga0105239_10005157 3300010375 Bacteria 15424
341 Ga0105239_10007246 3300010375 Bacteria 12738
342 Ga0105239_10011420 3300010375 Bacteria 9904
343 Ga0105239_10090414 3300010375 Bacteria 3377
344 Ga0105239_10586312 3300010375 Bacteria 1271
345 Ga0105246_10000100 3300011119 Bacteria 37689
346 Ga0157373_10001937 3300013100 Bacteria 15725
347 Ga0157371_10009263 3300013102 Bacteria 7766
348 Ga0157371_10060791 3300013102 Bacteria 2678
349 Ga0157371_10097175 3300013102 Bacteria 2087
350 Ga0157369_10417137 3300013105 Bacteria 1392
351 Ga0157374_10002520 3300013296 Bacteria 15446
352 Ga0157374_10025843 3300013296 Bacteria 5278
353 Ga0157374_10034810 3300013296 Bacteria 4603
354 Ga0157374_10068867 3300013296 Bacteria 3330
355 Ga0157378_10018104 3300013297 Bacteria 6186
356 Ga0157378_10019279 3300013297 Bacteria 5996
357 Ga0157378_10045210 3300013297 Bacteria 3912
358 Ga0157378_10082672 3300013297 Bacteria 2904
359 Ga0157378_10100682 3300013297 Bacteria 2638
360 Ga0157378_10448060 3300013297 Bacteria 1281
361 Ga0163162_10001003 3300013306 Bacteria 26222
362 Ga0163162_10003466 3300013306 Bacteria 15066
363 Ga0163162_10018542 3300013306 Bacteria 6819
364 Ga0163162_10181962 3300013306 Bacteria 2228
365 Ga0157372_10016087 3300013307 Bacteria 8026
366 Ga0157372_10173542 3300013307 Bacteria 2495
367 Ga0157372_10801752 3300013307 Bacteria 1094
368 Ga0157375_10000464 3300013308 Bacteria 36915
369 Ga0157375_10013321 3300013308 Bacteria 7314
370 Ga0157375_10015123 3300013308 Bacteria 6902
371 Ga0157375_10068458 3300013308 Bacteria 3552
372 Ga0157375_10090970 3300013308 Bacteria 3111
373 Ga0163163_10002284 3300014325 Bacteria 16167
374 Ga0163163_10012670 3300014325 Bacteria 7690
375 Ga0163163_10026554 3300014325 Bacteria 5538
376 Ga0163163_10340687 3300014325 Bacteria 1554
377 Ga0157380_10000145 3300014326 Bacteria 40211
378 Ga0157380_10060588 3300014326 Bacteria 3025
379 Ga0157377_10000179 3300014745 Bacteria 36682
380 Ga0157377_10047136 3300014745 Bacteria 2413
381 Ga0157379_10000067 3300014968 Bacteria 66051
382 Ga0157379_10050135 3300014968 Bacteria 3726
383 Ga0157379_10061245 3300014968 Bacteria 3365
384 Ga0157376_10000864 3300014969 Bacteria 19873
385 Ga0157376_10017983 3300014969 Bacteria 5408
386 Ga0163161_10001641 3300017792 Bacteria 16464
387 Ga0163161_10015441 3300017792 Bacteria 5324
388 Ga0206353_11380251 3300020082 Bacteria 1421
389 Ga0207666_1000002 3300025271 Bacteria 62717
390 Ga0207666_1003664 3300025271 Bacteria 1896
391 Ga0209130_1000389 3300025284 Bacteria 48487
392 Ga0209025_1000061 3300025294 Bacteria 304827
393 Ga0209758_1001864 3300025297 Bacteria 23116
394 Ga0209758_1004355 3300025297 Bacteria 11860
395 Ga0209758_1005524 3300025297 Bacteria 9659
396 Ga0207426_1000361 3300025302 Bacteria 81889
397 Ga0207697_10000113 3300025315 Bacteria 37772
398 Ga0207697_10002993 3300025315 Bacteria 8523
399 Ga0207656_10013388 3300025321 Bacteria 3135
400 Ga0207696_1028356 3300025711 Bacteria 1719
401 Ga0207653_10024269 3300025885 Bacteria 1935
402 Ga0207682_10000094 3300025893 Bacteria 41188
403 Ga0207682_10027480 3300025893 Bacteria 2266
404 Ga0207692_10002667 3300025898 Bacteria 6869
405 Ga0207692_10008058 3300025898 Bacteria 4348
406 Ga0207642_10000106 3300025899 Bacteria 22456
407 Ga0207642_10022206 3300025899 Bacteria 2512
408 Ga0207710_10003537 3300025900 Bacteria 6944
409 Ga0207688_10000074 3300025901 Bacteria 37681
410 Ga0207688_10001906 3300025901 Bacteria 11175
411 Ga0207688_10004875 3300025901 Bacteria 7307
412 Ga0207680_10015416 3300025903 Bacteria 3988
413 Ga0207680_10079461 3300025903 Bacteria 2057
414 Ga0207680_10101587 3300025903 Bacteria 1849
415 Ga0207647_10000218 3300025904 Bacteria 46963
416 Ga0207647_10006609 3300025904 Bacteria 8423
417 Ga0207685_10041604 3300025905 Bacteria 1720
418 Ga0207699_10005568 3300025906 Bacteria 6040
419 Ga0207699_10009762 3300025906 Bacteria 4792
420 Ga0207699_10142546 3300025906 Bacteria 1576
421 Ga0207645_10000247 3300025907 Bacteria 44983
422 Ga0207645_10010970 3300025907 Bacteria 6200
423 Ga0207643_10000004 3300025908 Bacteria 187006
424 Ga0207643_10002034 3300025908 Bacteria 11165
425 Ga0207705_10005512 3300025909 Bacteria 9466
426 Ga0207705_10044014 3300025909 Bacteria 3207
427 Ga0207654_10000408 3300025911 Bacteria 24946
428 Ga0207707_10000001 3300025912 Bacteria 1212482
429 Ga0207707_10000618 3300025912 Bacteria 35350
430 Ga0207707_10009349 3300025912 Bacteria 8502
431 Ga0207707_10017866 3300025912 Bacteria 6185
432 Ga0207707_10186483 3300025912 Bacteria 1810
433 Ga0207707_10420953 3300025912 Bacteria 1145
434 Ga0207695_10082620 3300025913 Bacteria 3246
435 Ga0207695_10352663 3300025913 Bacteria 1358
436 Ga0207671_10006046 3300025914 Bacteria 10917
437 Ga0207671_10051153 3300025914 Bacteria 3061
438 Ga0207671_10080443 3300025914 Bacteria 2442
439 Ga0207671_10193782 3300025914 Bacteria 1585
440 Ga0207693_10002426 3300025915 Bacteria 16193
441 Ga0207693_10037349 3300025915 Bacteria 3828
442 Ga0207693_10045822 3300025915 Bacteria 3435
443 Ga0207693_10162876 3300025915 Bacteria 1755
444 Ga0207663_10021216 3300025916 Bacteria 3695
445 Ga0207663_10028196 3300025916 Bacteria 3284
446 Ga0207663_10226734 3300025916 Bacteria 1363
447 Ga0207660_10000029 3300025917 Bacteria 67115
448 Ga0207660_10000637 3300025917 Bacteria 23600
449 Ga0207660_10023942 3300025917 Bacteria 4129
450 Ga0207660_10033899 3300025917 Bacteria 3535
451 Ga0207662_10000119 3300025918 Bacteria 37770
452 Ga0207662_10004685 3300025918 Bacteria 7219
453 Ga0207662_10005578 3300025918 Bacteria 6724
454 Ga0207662_10012444 3300025918 Bacteria 4740
455 Ga0207657_10000316 3300025919 Bacteria 51145
456 Ga0207657_10006914 3300025919 Bacteria 11704
457 Ga0207657_10029916 3300025919 Bacteria 4950
458 Ga0207657_10063030 3300025919 Bacteria 3172
459 Ga0207649_10000090 3300025920 Bacteria 75387
460 Ga0207652_10000190 3300025921 Bacteria 64841
461 Ga0207652_10010770 3300025921 Bacteria 7365
462 Ga0207652_10022911 3300025921 Bacteria 5173
463 Ga0207652_10025093 3300025921 Bacteria 4953
464 Ga0207652_10077354 3300025921 Bacteria 2903
465 Ga0207652_10077669 3300025921 Bacteria 2897
466 Ga0207681_10000370 3300025923 Bacteria 31836
467 Ga0207681_10035787 3300025923 Bacteria 3273
468 Ga0207681_10051828 3300025923 Bacteria 2781
469 Ga0207694_10096260 3300025924 Bacteria 2341
470 Ga0207694_10287683 3300025924 Bacteria 1351
471 Ga0207650_10015721 3300025925 Bacteria 5275
472 Ga0207659_10000038 3300025926 Bacteria 93848
473 Ga0207659_10015533 3300025926 Bacteria 4936
474 Ga0207687_10000342 3300025927 Bacteria 31186
475 Ga0207687_10043424 3300025927 Bacteria 3097
476 Ga0207687_10111636 3300025927 Bacteria 2030
477 Ga0207700_10102516 3300025928 Bacteria 2286
478 Ga0207700_10123117 3300025928 Bacteria 2106
479 Ga0207700_10208060 3300025928 Bacteria 1652
480 Ga0207664_10091280 3300025929 Bacteria 2497
481 Ga0207664_10157677 3300025929 Bacteria 1933
482 Ga0207644_10000825 3300025931 Bacteria 19709
483 Ga0207644_10012480 3300025931 Bacteria 5645
484 Ga0207644_10015448 3300025931 Bacteria 5124
485 Ga0207690_10000239 3300025932 Bacteria 39850
486 Ga0207690_10002494 3300025932 Bacteria 11127
487 Ga0207690_10031361 3300025932 Bacteria 3400
488 Ga0207706_10000424 3300025933 Bacteria 45410
489 Ga0207706_10001779 3300025933 Bacteria 21159
490 Ga0207706_10006933 3300025933 Bacteria 10478
491 Ga0207686_10001581 3300025934 Bacteria 12802
492 Ga0207686_10005903 3300025934 Bacteria 6575
493 Ga0207709_10000379 3300025935 Bacteria 44189
494 Ga0207709_10134686 3300025935 Bacteria 1689
495 Ga0207670_10000176 3300025936 Bacteria 42483
496 Ga0207670_10008695 3300025936 Bacteria 5749
497 Ga0207670_10029969 3300025936 Bacteria 3472
498 Ga0207669_10000165 3300025937 Bacteria 31741
499 Ga0207669_10005756 3300025937 Bacteria 5595
500 Ga0207704_10001293 3300025938 Bacteria 11185
501 Ga0207704_10010329 3300025938 Bacteria 4549
502 Ga0207704_10011009 3300025938 Bacteria 4438
503 Ga0207704_10119380 3300025938 Bacteria 1801
504 Ga0207665_10007116 3300025939 Bacteria 7407
505 Ga0207691_10000358 3300025940 Bacteria 46095
506 Ga0207691_10273156 3300025940 Bacteria 1455
507 Ga0207711_10000792 3300025941 Bacteria 31089
508 Ga0207711_10182716 3300025941 Bacteria 1908
509 Ga0207689_10000479 3300025942 Bacteria 37696
510 Ga0207689_10008563 3300025942 Bacteria 8915
511 Ga0207661_10001263 3300025944 Bacteria 16914
512 Ga0207661_10001389 3300025944 Bacteria 16260
513 Ga0207661_10057150 3300025944 Bacteria 3136
514 Ga0207661_10146024 3300025944 Bacteria 2041
515 Ga0207679_10000139 3300025945 Bacteria 59804
516 Ga0207679_10014773 3300025945 Bacteria 5143
517 Ga0207679_10085372 3300025945 Bacteria 2425
518 Ga0207667_10003492 3300025949 Bacteria 19417
519 Ga0207667_10071083 3300025949 Bacteria 3620
520 Ga0207651_10000072 3300025960 Bacteria 46009
521 Ga0207651_10009633 3300025960 Bacteria 5305
522 Ga0207712_10001177 3300025961 Bacteria 18108
523 Ga0207712_10019946 3300025961 Bacteria 4385
524 Ga0207712_10260360 3300025961 Bacteria 1406
525 Ga0207668_10000168 3300025972 Bacteria 45205
526 Ga0207640_10000242 3300025981 Bacteria 37007
527 Ga0207640_10048598 3300025981 Bacteria 2743
528 Ga0207658_10000667 3300025986 Bacteria 29975
529 Ga0207658_10079320 3300025986 Bacteria 2511
530 Ga0207677_10003733 3300026023 Bacteria 8082
531 Ga0207677_10046548 3300026023 Bacteria 2905
532 Ga0207703_10000463 3300026035 Bacteria 42725
533 Ga0207703_10026226 3300026035 Bacteria 4585
534 Ga0207639_10000745 3300026041 Bacteria 22238
535 Ga0207639_10054106 3300026041 Bacteria 3066
536 Ga0207678_10000447 3300026067 Bacteria 37597
537 Ga0207678_10004671 3300026067 Bacteria 12299
538 Ga0207678_10005453 3300026067 Bacteria 11377
539 Ga0207678_10005767 3300026067 Bacteria 11038
540 Ga0207678_10027584 3300026067 Bacteria 4955
541 Ga0207708_10000293 3300026075 Bacteria 39298
542 Ga0207708_10001428 3300026075 Bacteria 17910
543 Ga0207708_10003697 3300026075 Bacteria 11292
544 Ga0207708_10094413 3300026075 Bacteria 2309
545 Ga0207702_10001723 3300026078 Bacteria 21539
546 Ga0207641_10000724 3300026088 Bacteria 35413
547 Ga0207641_10017293 3300026088 Bacteria 5902
548 Ga0207648_10000223 3300026089 Bacteria 61064
549 Ga0207648_10010764 3300026089 Bacteria 8642
550 Ga0207648_10011893 3300026089 Bacteria 8178
551 Ga0207648_10474558 3300026089 Bacteria 1142
552 Ga0207676_10000392 3300026095 Bacteria 37207
553 Ga0207676_10010604 3300026095 Bacteria 6568
554 Ga0207676_10357479 3300026095 Bacteria 1352
555 Ga0207674_10000955 3300026116 Bacteria 37769
556 Ga0207674_10051516 3300026116 Bacteria 4201
557 Ga0207674_10060640 3300026116 Bacteria 3824
558 Ga0207675_100000364 3300026118 Bacteria 43420
559 Ga0207675_100001777 3300026118 Bacteria 21552
560 Ga0207675_100002590 3300026118 Bacteria 17909
561 Ga0207675_100005082 3300026118 Bacteria 12662
562 Ga0207675_100185704 3300026118 Bacteria 1993
563 Ga0207683_10000397 3300026121 Bacteria 39911
564 Ga0207683_10003810 3300026121 Bacteria 13064
565 Ga0207683_10010729 3300026121 Bacteria 7811
566 Ga0207698_10000818 3300026142 Bacteria 18058
567 Ga0207698_10005989 3300026142 Bacteria 7558
568 Ga0207698_10101211 3300026142 Bacteria 2389
569 Ga0209389_1000012 3300027296 Bacteria 213243
570 Ga0209489_100019 3300027361 Bacteria 213243
571 Ga0209700_100018 3300027363 Bacteria 238200
572 Ga0209981_1001220 3300027378 Bacteria 3258
573 Ga0210000_1000129 3300027462 Bacteria 10819
574 Ga0209588_1001156 3300027671 Bacteria 6803
575 Ga0209998_10000687 3300027717 Bacteria 9049
576 Ga0209998_10002273 3300027717 Bacteria 4445
577 Ga0209813_10005075 3300027866 Bacteria 3180
578 Ga0209813_10022115 3300027866 Bacteria 1795
579 Ga0209974_10000890 3300027876 Bacteria 10388
580 Ga0209974_10022678 3300027876 Bacteria 2079
581 Ga0207428_10000050 3300027907 Bacteria 177286
582 Ga0207428_10000439 3300027907 Bacteria 50911
583 Ga0207428_10000617 3300027907 Bacteria 42011
584 Ga0268266_10002721 3300028379 Bacteria 18537
585 Ga0268266_10023640 3300028379 Bacteria 5231
586 Ga0268266_10042367 3300028379 Bacteria 3888
587 Ga0268266_10206615 3300028379 Bacteria 1799
588 Ga0268265_10000249 3300028380 Bacteria 61376
589 Ga0268265_10001307 3300028380 Bacteria 21379
590 Ga0268265_10004440 3300028380 Bacteria 9740
591 Ga0268265_10008357 3300028380 Bacteria 6990
592 Ga0268265_10036896 3300028380 Bacteria 3583
593 Ga0268264_10003260 3300028381 Bacteria 14034
594 Ga0268264_10022151 3300028381 Bacteria 5187
595 Ga0268264_10031810 3300028381 Bacteria 4327
596 Ga0268264_10121445 3300028381 Bacteria 2303
597 Ga0268264_10180258 3300028381 Bacteria 1918
598 Ga0265318_10008937 3300028577 Bacteria 4436
599 Ga0265338_10038980 3300028800 Bacteria 4492
600 Ga0265773_1001590 3300031018 Bacteria 1253
601 Ga0265760_10048313 3300031090 Bacteria 1278
602 Ga0265330_10095096 3300031235 Bacteria 1277
603 Ga0265320_10002095 3300031240 Bacteria 14042
604 Ga0265325_10000043 3300031241 Bacteria 89158
605 Ga0265325_10008854 3300031241 Bacteria 5913
606 Ga0265325_10026580 3300031241 Bacteria 3133
607 Ga0265340_10006812 3300031247 Bacteria 6253
608 Ga0265340_10013225 3300031247 Bacteria 4342
609 Ga0265339_10009370 3300031249 Bacteria 6159
610 Ga0265339_10014659 3300031249 Bacteria 4719
611 Ga0265339_10033503 3300031249 Bacteria 2891
612 Ga0265339_10107879 3300031249 Bacteria 1444
613 Ga0265327_10000070 3300031251 Bacteria 217350
614 Ga0265316_10050529 3300031344 Bacteria 3269
615 Ga0265316_10062311 3300031344 Bacteria 2895
616 Ga0265316_10099832 3300031344 Bacteria 2207
617 Ga0265316_10317540 3300031344 Bacteria 1132
618 Ga0307513_10112561 3300031456 Bacteria 2711
619 Ga0265313_10000269 3300031595 Bacteria 56767
620 Ga0265313_10001300 3300031595 Bacteria 23590
621 Ga0265313_10017513 3300031595 Bacteria 4068
622 Ga0265313_10063020 3300031595 Bacteria 1730
623 Ga0265313_10077352 3300031595 Bacteria 1519
624 Ga0265314_10000708 3300031711 Bacteria 40357
625 Ga0265314_10001057 3300031711 Bacteria 32018
626 Ga0265314_10042742 3300031711 Bacteria 3228
627 Ga0265314_10047083 3300031711 Bacteria 3038
628 Ga0265314_10061525 3300031711 Bacteria 2556
629 Ga0265342_10001200 3300031712 Bacteria 24613
630 Ga0265342_10033550 3300031712 Bacteria 3155
631 Ga0265342_10108591 3300031712 Bacteria 1573
632 Ga0307405_10010582 3300031731 Bacteria 4793
633 Ga0307410_10060157 3300031852 Bacteria 2595
634 Ga0307406_10004455 3300031901 Bacteria 7624
635 Ga0307412_10016996 3300031911 Bacteria 4347
636 Ga0307409_100001101 3300031995 Bacteria 12783
637 Ga0307416_100001022 3300032002 Bacteria 14842
638 Ga0307416_100726163 3300032002 Bacteria 1084
639 Ga0307411_10091234 3300032005 Bacteria 2127
640 Ga0316583_10000233 3300032133 Bacteria 15084
641 Ga0373930_0000008 3300034816 Bacteria 20461
642 Ga0373948_0001178 3300034817 Bacteria 3545
643 Ga0373950_0004994 3300034818 Bacteria 1964
644 Ga0373958_0001331 3300034819 Bacteria 3307
645 Ga0373958_0002083 3300034819 Bacteria 2766
646 Ga0373959_0000708 3300034820 Bacteria 5703
647 Ga0373938_0000434 3300034957 Bacteria 6766
648 Ga0373938_0000881 3300034957 Bacteria 4823
649 Ga0373928_0000087 3300035084 Bacteria 16099
650 Ga0373928_0001439 3300035084 Bacteria 4621
651 Ga0373929_0000288 3300035085 Bacteria 9356
652 Ga0373929_0001454 3300035085 Bacteria 4515
653 Ga0373934_0017655 3300035086 Bacteria 2726
654 Ga0373934_0092517 3300035086 Bacteria 1220
655 Ga0373940_0004036 3300035088 Bacteria 3067
656 Ga0373940_0004893 3300035088 Bacteria 2863
657 Ga0373949_0001082 3300035090 Bacteria 8314
658 Ga0373949_0004172 3300035090 Bacteria 3338
659 Ga0373951_0000363 3300035091 Bacteria 13633
660 Ga0373951_0006215 3300035091 Bacteria 2736
661 Ga0373952_0000458 3300035092 Bacteria 7106
662 Ga0373952_0000576 3300035092 Bacteria 6472
663 Ga0373923_0004706 3300035111 Bacteria 4555
664 Ga0373923_0015311 3300035111 Bacteria 2894
665 Ga0373932_0000239 3300035112 Bacteria 16722
666 Ga0373932_0000588 3300035112 Bacteria 11087
667 Ga0373936_0000885 3300035113 Bacteria 10703
668 Ga0373936_0016118 3300035113 Bacteria 2871
669 Ga0373939_0000850 3300035114 Bacteria 7561
670 Ga0373939_0001037 3300035114 Bacteria 6854
671 Ga0373939_0015567 3300035114 Bacteria 1992
672 Ga0373939_0026765 3300035114 Bacteria 1628
673 Ga0373941_0000224 3300035115 Bacteria 10933
674 Ga0373941_0003233 3300035115 Bacteria 3668
675 Ga0373953_0012222 3300035117 Bacteria 3036
676 Ga0373953_0051874 3300035117 Bacteria 1659
677 Ga0373954_0006125 3300035118 Bacteria 5239
678 Ga0373954_0042781 3300035118 Bacteria 2112
679 Ga0373954_0092870 3300035118 Bacteria 1451
680 Ga0373956_0002570 3300035119 Bacteria 7371
681 Ga0373956_0014922 3300035119 Bacteria 3248
682 Ga0373956_0049348 3300035119 Bacteria 1888
683 Ga0373957_0000794 3300035120 Bacteria 8184
684 Ga0373957_0058417 3300035120 Bacteria 1490
685 Ga0373960_0000332 3300035121 Bacteria 9017
686 Ga0373960_0000746 3300035121 Bacteria 6776
687 Ga0373943_0003854 3300035170 Bacteria 6821
688 Ga0373946_0007336 3300035171 Bacteria 4026
689 Ga0373955_0000742 3300035172 Bacteria 14009
690 Ga0373955_0024367 3300035172 Bacteria 3094
691 Ga0373955_0039308 3300035172 Bacteria 2525
692 Ga0373955_0061489 3300035172 Bacteria 2074
693 Ga0373955_0348884 3300035172 Bacteria 896
694 Ga0373942_0001505 3300035207 Bacteria 5990
695 Ga0373942_0003587 3300035207 Bacteria 3640
696 Ga0373942_0006955 3300035207 Bacteria 2614
697 Ga0373961_0008690 3300035241 Bacteria 2473
698 Ga0373961_0015663 3300035241 Bacteria 1942
699 Ga0373962_0009042 3300035242 Bacteria 2460
700 Ga0316574_0022902 3300035398 Bacteria 3725
701 Ga0373924_0018781 3300035410 Bacteria 2670
702 Ga0373931_0000089 3300035691 Bacteria 42136
703 Ga0373931_0008141 3300035691 Bacteria 4966
704 Ga0373931_0257657 3300035691 Bacteria 1063
705 Ga0373935_0028731 3300035692 Bacteria 3437
706 Ga0373935_0107304 3300035692 Bacteria 1849
707 Ga0373927_0000700 3300035695 Bacteria 25687
708 Ga0373927_0029040 3300035695 Bacteria 3605
709 Ga0373927_0059833 3300035695 Bacteria 2464
710 Ga0373933_0001294 3300035724 Bacteria 14734
711 Ga0373933_0008278 3300035724 Bacteria 5678
712 Ga0373933_0081196 3300035724 Bacteria 1989
713 Ga0373933_0158036 3300035724 Bacteria 1438
714 Ga0373947_0000333 3300035725 Bacteria 26541
715 Ga0373947_0026284 3300035725 Bacteria 3401
716 Ga0373947_0029462 3300035725 Bacteria 3221
717 Ga0373947_0034198 3300035725 Bacteria 3005
718 Ga0373947_0091172 3300035725 Bacteria 1901
719 Ga0373937_0001701 3300036401 Bacteria 18497
720 Ga0373937_0012221 3300036401 Bacteria 7540
721 Ga0373937_0077266 3300036401 Bacteria 3076
722 Ga0373937_0137870 3300036401 Bacteria 2281
723 Ga0373937_0373666 3300036401 Bacteria 1352
724 Ga0373925_0004318 3300037068 Bacteria 10760
725 Ga0373925_0262653 3300037068 Bacteria 1387
726 Ga0395900_0008179 3300037418 Bacteria 10764
727 Ga0395905_0006120 3300037471 Bacteria 12156
728 Ga0436365_0677631 3300039437 Bacteria 2144
729 Ga0436361_0740814 3300039447 Bacteria 4372
730 Ga0436361_1002425 3300039447 Bacteria 2703
731 Ga0436361_1023583 3300039447 Bacteria 7107
732 Ga0436362_0138375 3300039453 Bacteria 2240
733 Ga0439441_023442 3300042001 Bacteria 1153
734 Ga0439443_000561 3300042003 Bacteria 3414
735 Ga0439450_026201 3300042008 Bacteria 1283
736 Ga0450920_004614 3300042122 Bacteria 2427
737 Ga0450923_000696 3300042125 Bacteria 3948
738 Ga0450898_003595 3300042134 Bacteria 2236
739 Ga0450906_016085 3300042145 Bacteria 1357
740 Ga0439446_0002955 3300042156 Bacteria 4157
741 Ga0439434_0003139 3300042435 Bacteria 4856
742 Ga0439435_0000874 3300042436 Bacteria 5172
743 Ga0439444_0000136 3300042437 Bacteria 6272
744 Ga0439464_0023204 3300042439 Bacteria 1712
745 Ga0439460_0062529 3300042461 Bacteria 1139
746 Ga0466969_0018218 3300044656 Bacteria 3661
747 Ga0466961_0000138 3300044693 Bacteria 48960
748 Ga0453684_0037507 3300044712 Bacteria 6651
749 Ga0453684_0643545 3300044712 Bacteria 1158
750 Ga0466970_0335631 3300044765 Bacteria 856
751 Ga0466959_0009348 3300045049 Bacteria 6967
752 Ga0451576_0018820 3300045051 Bacteria 7551
753 Ga0466967_0157916 3300045976 Bacteria 2126
754 Ga0495603_0000415 3300046455 Bacteria 23564
755 Ga0495603_0055870 3300046455 Bacteria 2339
756 Ga0495629_0020344 3300046459 Bacteria 4740
757 Ga0495629_0030036 3300046459 Bacteria 3853
758 Ga0495629_0046403 3300046459 Bacteria 3048
759 Ga0495638_0033037 3300046460 Bacteria 3311
760 Ga0495638_0054591 3300046460 Bacteria 2483
761 Ga0495641_0015052 3300046461 Bacteria 4154
762 Ga0495651_0014089 3300046462 Bacteria 6184
763 Ga0495651_0019331 3300046462 Bacteria 5280
764 Ga0495653_0007085 3300046463 Bacteria 9193
765 Ga0495653_0025322 3300046463 Bacteria 4771
766 Ga0495653_0066304 3300046463 Bacteria 2716
767 Ga0495580_0000784 3300046472 Bacteria 27397
768 Ga0495580_0025889 3300046472 Bacteria 4283
769 Ga0495580_0066944 3300046472 Bacteria 2514
770 Ga0495580_0265138 3300046472 Bacteria 1174
771 Ga0495582_0004166 3300046473 Bacteria 8131
772 Ga0495582_0260863 3300046473 Bacteria 994
773 Ga0495639_0001444 3300046475 Bacteria 10615
774 Ga0495639_0049117 3300046475 Bacteria 1915
775 Ga0495662_0022760 3300046476 Bacteria 3025
776 Ga0495664_0003467 3300046477 Bacteria 8586
777 Ga0495664_0003541 3300046477 Bacteria 8516
778 Ga0495664_0014840 3300046477 Bacteria 4422
779 Ga0495584_0054169 3300046491 Bacteria 2019
780 Ga0495594_0000288 3300046499 Bacteria 24905
781 Ga0495596_0035124 3300046500 Bacteria 1989
782 Ga0495608_0004655 3300046511 Bacteria 9808
783 Ga0495608_0058931 3300046511 Bacteria 2530
784 Ga0495618_0000705 3300046514 Bacteria 23292
785 Ga0495618_0008530 3300046514 Bacteria 6194
786 Ga0495618_0008714 3300046514 Bacteria 6129
787 Ga0495628_0015272 3300046516 Bacteria 6415
788 Ga0495630_0004473 3300046517 Bacteria 9800
789 Ga0495630_0009360 3300046517 Bacteria 7042
790 Ga0495630_0019770 3300046517 Bacteria 4955
791 Ga0495630_0084340 3300046517 Bacteria 2399
792 Ga0495637_0046579 3300046520 Bacteria 1834
793 Ga0495652_0002132 3300046529 Bacteria 20866
794 Ga0495652_0026899 3300046529 Bacteria 5075
795 Ga0495640_0002127 3300046533 Bacteria 15810
796 Ga0495640_0013819 3300046533 Bacteria 6132
797 Ga0495640_0023194 3300046533 Bacteria 4529
798 Ga0495586_0031112 3300046535 Bacteria 2857
799 Ga0495586_0041279 3300046535 Bacteria 2484
800 Ga0495587_0001771 3300046536 Bacteria 14440
801 Ga0495587_0047896 3300046536 Bacteria 2533
802 Ga0495587_0052199 3300046536 Bacteria 2413
803 Ga0495587_0138923 3300046536 Bacteria 1387
804 Ga0495598_0064414 3300046537 Bacteria 1139
805 Ga0495645_0007720 3300046543 Bacteria 7486
806 Ga0495645_0019743 3300046543 Bacteria 4855
807 Ga0495622_0059771 3300046557 Bacteria 1764
808 Ga0495667_0008577 3300046559 Bacteria 6936
809 Ga0495667_0009171 3300046559 Bacteria 6720
810 Ga0495667_0013545 3300046559 Bacteria 5516
811 Ga0495668_0011373 3300046616 Bacteria 5334
812 Ga0495668_0015058 3300046616 Bacteria 4524
813 Ga0495634_0012668 3300046642 Bacteria 6104
814 Ga0495634_0013833 3300046642 Bacteria 5829
815 Ga0495634_0015350 3300046642 Bacteria 5505
816 Ga0495634_0035879 3300046642 Bacteria 3393
817 Ga0495634_0129146 3300046642 Bacteria 1612
818 Ga0495635_0001121 3300046663 Bacteria 17818
819 Ga0495635_0056869 3300046663 Bacteria 2692
820 Ga0495635_0061392 3300046663 Bacteria 2582
821 Ga0495635_0088758 3300046663 Bacteria 2115
822 Ga0495588_0001822 3300046674 Bacteria 9083
823 Ga0495657_0037813 3300046675 Bacteria 3324
824 Ga0495657_0051163 3300046675 Bacteria 2774
825 Ga0495657_0056007 3300046675 Bacteria 2628
826 Ga0495599_0074444 3300046678 Bacteria 2120
827 Ga0495623_0000055 3300046679 Bacteria 69548
828 Ga0495623_0006302 3300046679 Bacteria 7714
829 Ga0495623_0056896 3300046679 Bacteria 2461
830 Ga0495623_0106601 3300046679 Bacteria 1702
831 Ga0495646_0006354 3300046680 Bacteria 7493
832 Ga0495647_0005365 3300046681 Bacteria 4200
833 Ga0495647_0054777 3300046681 Bacteria 1559
834 Ga0495658_0004925 3300046683 Bacteria 6551
835 Ga0495658_0045105 3300046683 Bacteria 2473
836 Ga0495669_0043811 3300046684 Bacteria 1993
837 Ga0495669_0062693 3300046684 Bacteria 1685
838 Ga0495669_0111800 3300046684 Bacteria 1276
839 Ga0495613_0001672 3300046689 Bacteria 16893
840 Ga0495624_0009051 3300046690 Bacteria 6912
841 Ga0495671_0200359 3300046692 Bacteria 968
842 Ga0495649_0069278 3300046694 Bacteria 1892
843 Ga0495600_0019135 3300046809 Bacteria 4368
844 Ga0495600_0154296 3300046809 Bacteria 1486
845 Ga0495581_0010457 3300047315 Bacteria 5366
846 Ga0495604_0037784 3300047317 Bacteria 3800
847 Ga0495604_0214483 3300047317 Bacteria 1328
848 Ga0495604_0230201 3300047317 Bacteria 1271
849 Ga0495604_0334707 3300047317 Bacteria 1009
850 Ga0495674_0010267 3300047319 Bacteria 8867
851 Ga0495674_0010269 3300047319 Bacteria 8867
852 Ga0495674_0016713 3300047319 Bacteria 6845
853 Ga0495674_0048516 3300047319 Bacteria 3757
854 Ga0495674_0169082 3300047319 Bacteria 1825
855 Ga0495672_0009172 3300047320 Bacteria 7205
856 Ga0495676_0078332 3300047321 Bacteria 2517
857 Ga0495676_0078890 3300047321 Bacteria 2505
858 Ga0495680_0001836 3300047322 Bacteria 22387
859 Ga0495680_0015898 3300047322 Bacteria 6478
860 Ga0495675_0022095 3300047444 Bacteria 4055
861 Ga0495684_0002670 3300047471 Bacteria 14133
862 Ga0495684_0006327 3300047471 Bacteria 9203
863 Ga0495684_0009509 3300047471 Bacteria 7501
864 Ga0495684_0152417 3300047471 Bacteria 1727
865 Ga0495593_0001141 3300047673 Bacteria 15478
866 Ga0495593_0004434 3300047673 Bacteria 8339
867 Ga0495593_0011395 3300047673 Bacteria 5109
868 Ga0495602_0007511 3300048088 Bacteria 11399
869 Ga0495602_0012226 3300048088 Bacteria 8836
870 Ga0495602_0122305 3300048088 Bacteria 2092
871 Ga0495614_0020350 3300048089 Bacteria 2870
872 Ga0495614_0098525 3300048089 Bacteria 1276
873 Ga0496100_0000200 3300048903 Bacteria 32909
874 Ga0496100_0013332 3300048903 Bacteria 4737
875 Ga0496100_0025238 3300048903 Bacteria 3633
876 Ga0496100_0075923 3300048903 Bacteria 2255
877 Ga0496100_0108676 3300048903 Bacteria 1924
878 Ga0496101_0000339 3300048904 Bacteria 31619
879 Ga0496101_0051165 3300048904 Bacteria 2976
880 Ga0496101_0109216 3300048904 Bacteria 2081
881 Ga0496101_0122835 3300048904 Bacteria 1964
882 Ga0496102_0000729 3300048905 Bacteria 32340
883 Ga0496102_0030139 3300048905 Bacteria 4856
884 Ga0496102_0033365 3300048905 Bacteria 4625
885 Ga0496102_0219837 3300048905 Bacteria 1790
886 Ga0496102_0299934 3300048905 Bacteria 1514
887 Ga0496103_0001522 3300048906 Bacteria 15479
888 Ga0496103_0010791 3300048906 Bacteria 5406
889 Ga0496103_0025697 3300048906 Bacteria 3561
890 Ga0496104_0000903 3300048907 Bacteria 25453
891 Ga0496104_0003346 3300048907 Bacteria 13842
892 Ga0496104_0004368 3300048907 Bacteria 12305
893 Ga0496104_0016056 3300048907 Bacteria 6796
894 Ga0496104_0033068 3300048907 Bacteria 4814
895 Ga0496104_0096038 3300048907 Bacteria 2835
896 Ga0496104_0256901 3300048907 Bacteria 1660
897 Ga0496104_0301658 3300048907 Bacteria 1514
898 Ga0496105_0000246 3300048908 Bacteria 36588
899 Ga0496105_0003097 3300048908 Bacteria 12230
900 Ga0496105_0008077 3300048908 Bacteria 8182
901 Ga0496105_0050267 3300048908 Bacteria 3443
902 Ga0496105_0051291 3300048908 Bacteria 3408
903 Ga0496105_0173568 3300048908 Bacteria 1767
904 Ga0496105_0296251 3300048908 Bacteria 1301
905 Ga0496106_0000202 3300048909 Bacteria 41819
906 Ga0496106_0008382 3300048909 Bacteria 7647
907 Ga0496106_0013666 3300048909 Bacteria 5994
908 Ga0496106_0026406 3300048909 Bacteria 4325
909 Ga0496106_0028487 3300048909 Bacteria 4160
910 Ga0496106_0044542 3300048909 Bacteria 3331
911 Ga0496107_0000066 3300048910 Bacteria 52207
912 Ga0496107_0001145 3300048910 Bacteria 16048
913 Ga0496107_0003363 3300048910 Bacteria 10687
914 Ga0496107_0008683 3300048910 Bacteria 7036
915 Ga0496107_0093329 3300048910 Bacteria 2201
916 Ga0496107_0125460 3300048910 Bacteria 1893
917 Ga0496108_0002149 3300048911 Bacteria 15798
918 Ga0496108_0003262 3300048911 Bacteria 13045
919 Ga0496108_0021443 3300048911 Bacteria 5311
920 Ga0496108_0049775 3300048911 Bacteria 3505
921 Ga0496108_0071579 3300048911 Bacteria 2926
922 Ga0496108_0151779 3300048911 Bacteria 1999
923 Ga0496109_0000595 3300048912 Bacteria 30262
924 Ga0496109_0004441 3300048912 Bacteria 11714
925 Ga0496109_0016322 3300048912 Bacteria 6489
926 Ga0496109_0037214 3300048912 Bacteria 4396
927 Ga0496110_0009554 3300048913 Bacteria 7848
928 Ga0496110_0023133 3300048913 Bacteria 5285
929 Ga0496110_0028722 3300048913 Bacteria 4779
930 Ga0496110_0170770 3300048913 Bacteria 1973
931 Ga0496111_0001165 3300048914 Bacteria 14618
932 Ga0496111_0002426 3300048914 Bacteria 11253
933 Ga0496111_0224273 3300048914 Bacteria 1396
934 Ga0496112_0003171 3300048915 Bacteria 13510
935 Ga0496112_0037794 3300048915 Bacteria 4713
936 Ga0496112_0076859 3300048915 Bacteria 3302
937 Ga0496113_0001173 3300048916 Bacteria 14315
938 Ga0496113_0001893 3300048916 Bacteria 11943
939 Ga0496113_0023186 3300048916 Bacteria 4400
940 Ga0496113_0028364 3300048916 Bacteria 4025
941 Ga0496113_0046176 3300048916 Bacteria 3233
942 Ga0496113_0104806 3300048916 Bacteria 2195
943 Ga0496113_0127502 3300048916 Bacteria 1994
944 Ga0496114_0004800 3300048917 Bacteria 10529
945 Ga0496114_0245387 3300048917 Bacteria 1575
946 Ga0496115_0005426 3300048918 Bacteria 9274
947 Ga0496115_0006200 3300048918 Bacteria 8746
948 Ga0501031_0059602 3300049568 Bacteria 2487
949 Ga0501032_0124188 3300049569 Bacteria 1706
950 Ga0501032_0217131 3300049569 Bacteria 1245
951 Ga0501033_0043838 3300049570 Bacteria 3330
952 Ga0501033_0125578 3300049570 Bacteria 1860
953 Ga0501033_0296836 3300049570 Bacteria 1138
954 Ga0501034_0027442 3300049571 Bacteria 5792
955 Ga0501034_0039803 3300049571 Bacteria 4760
956 Ga0501034_0094303 3300049571 Bacteria 2990
957 Ga0501034_0195413 3300049571 Bacteria 1983
958 Ga0501034_0300725 3300049571 Bacteria 1541
959 Ga0501036_0001395 3300049572 Bacteria 18570
960 Ga0501036_0002481 3300049572 Bacteria 14464
961 Ga0501036_0014064 3300049572 Bacteria 6650
962 Ga0501036_0163069 3300049572 Bacteria 1879
963 Ga0501036_0421305 3300049572 Bacteria 1113
964 Ga0501037_0002025 3300049573 Bacteria 14680
965 Ga0501037_0023005 3300049573 Bacteria 4609
966 Ga0501037_0057904 3300049573 Bacteria 2828
967 Ga0501037_0092496 3300049573 Bacteria 2187
968 Ga0501037_0118529 3300049573 Bacteria 1904
969 Ga0501038_0011597 3300049574 Bacteria 8041
970 Ga0501038_0027715 3300049574 Bacteria 5036
971 Ga0501038_0069081 3300049574 Bacteria 3002
972 Ga0501038_0086625 3300049574 Bacteria 2631
973 Ga0501038_0132211 3300049574 Bacteria 2047
974 Ga0501038_0164254 3300049574 Bacteria 1802
975 Ga0501038_0183510 3300049574 Bacteria 1687
976 Ga0501038_0193860 3300049574 Bacteria 1634
977 Ga0501039_0001680 3300049575 Bacteria 16316
978 Ga0501039_0002776 3300049575 Bacteria 13069
979 Ga0501039_0039106 3300049575 Bacteria 3664
980 Ga0501039_0118181 3300049575 Bacteria 2076
981 Ga0501039_0136582 3300049575 Bacteria 1925
982 Ga0501039_0170263 3300049575 Bacteria 1712
983 Ga0501040_0006653 3300049576 Bacteria 7502
984 Ga0501040_0028999 3300049576 Bacteria 3734
985 Ga0501040_0213065 3300049576 Bacteria 1373
986 Ga0501041_0000497 3300049577 Bacteria 20183
987 Ga0501041_0032605 3300049577 Bacteria 3148
988 Ga0501041_0231903 3300049577 Bacteria 1159
989 Ga0501042_0023281 3300049578 Bacteria 4333
990 Ga0501042_0070215 3300049578 Bacteria 2505
991 Ga0501042_0174775 3300049578 Bacteria 1549
992 Ga0501042_0229747 3300049578 Bacteria 1338
993 Ga0501043_0013780 3300049579 Bacteria 6327
994 Ga0501043_0043922 3300049579 Bacteria 3513
995 Ga0501043_0080598 3300049579 Bacteria 2558
996 Ga0501043_0240449 3300049579 Bacteria 1396
997 Ga0501046_0014727 3300049580 Bacteria 6582
998 Ga0501046_0019015 3300049580 Bacteria 5702
999 Ga0501046_0025386 3300049580 Bacteria 4850
1000 Ga0501046_0043280 3300049580 Bacteria 3585
1001 Ga0501046_0110135 3300049580 Bacteria 2105
1002 Ga0501046_0155019 3300049580 Bacteria 1726
1003 Ga0501046_0168182 3300049580 Bacteria 1646
1004 Ga0501047_0016677 3300049581 Bacteria 7016
1005 Ga0501047_0017879 3300049581 Bacteria 6793
1006 Ga0501047_0051181 3300049581 Bacteria 3989
1007 Ga0501047_0089977 3300049581 Bacteria 2946
1008 Ga0501048_0208082 3300049582 Bacteria 1387
1009 Ga0501048_0212306 3300049582 Bacteria 1372
1010 Ga0501067_0008683 3300049583 Bacteria 5630
1011 Ga0501068_0008094 3300049584 Bacteria 5834
1012 Ga0501068_0076041 3300049584 Bacteria 2054
1013 Ga0501069_0003072 3300049585 Bacteria 8552
1014 Ga0501069_0060890 3300049585 Bacteria 2108
1015 Ga0501070_0021833 3300049586 Bacteria 5364
1016 Ga0501070_0022581 3300049586 Bacteria 5269
1017 Ga0501071_0000766 3300049587 Bacteria 17047
1018 Ga0501071_0007337 3300049587 Bacteria 7227
1019 Ga0501071_0108401 3300049587 Bacteria 2051
1020 Ga0501071_0187708 3300049587 Bacteria 1550
1021 Ga0501072_0009889 3300049588 Bacteria 7254
1022 Ga0501072_0032021 3300049588 Bacteria 4116
1023 Ga0501072_0065633 3300049588 Bacteria 2862
1024 Ga0501072_0095047 3300049588 Bacteria 2368
1025 Ga0501072_0204161 3300049588 Bacteria 1576
1026 Ga0501073_0014409 3300049589 Bacteria 5745
1027 Ga0501073_0019034 3300049589 Bacteria 4962
1028 Ga0501073_0054973 3300049589 Bacteria 2786
1029 Ga0501073_0126900 3300049589 Bacteria 1768
1030 Ga0501073_0221001 3300049589 Bacteria 1308
1031 Ga0501074_0003316 3300049590 Bacteria 11391
1032 Ga0501074_0027303 3300049590 Bacteria 4139
1033 Ga0501074_0033383 3300049590 Bacteria 3729
1034 Ga0501074_0052771 3300049590 Bacteria 2934
1035 Ga0501074_0222848 3300049590 Bacteria 1342
1036 Ga0501075_0099841 3300049591 Bacteria 2204
1037 Ga0501075_0127620 3300049591 Bacteria 1937
1038 Ga0501075_0137648 3300049591 Bacteria 1860
1039 Ga0501076_0007409 3300049592 Bacteria 7985
1040 Ga0501076_0016060 3300049592 Bacteria 5669
1041 Ga0501076_0101972 3300049592 Bacteria 2313
1042 Ga0501076_0311601 3300049592 Bacteria 1291
1043 Ga0501077_0003968 3300049593 Bacteria 8923
1044 Ga0501077_0008803 3300049593 Bacteria 6263
1045 Ga0501077_0012998 3300049593 Bacteria 5215
1046 Ga0501077_0062634 3300049593 Bacteria 2359
1047 Ga0501077_0094388 3300049593 Bacteria 1896
1048 Ga0501257_001114 3300049686 Bacteria 5456
1049 Ga0501225_0055016 3300049705 Bacteria 1113
1050 Ga0501079_0046758 3300049741 Bacteria 3339
1051 Ga0501079_0049659 3300049741 Bacteria 3238
1052 Ga0501079_0150398 3300049741 Bacteria 1815
1053 Ga0501079_0198713 3300049741 Bacteria 1566
1054 Ga0501080_0007750 3300049742 Bacteria 9706
1055 Ga0501080_0016625 3300049742 Bacteria 6796
1056 Ga0501080_0442164 3300049742 Bacteria 1166
1057 Ga0501081_0000349 3300049743 Bacteria 24901
1058 Ga0501081_0016572 3300049743 Bacteria 4873
1059 Ga0501081_0266432 3300049743 Bacteria 1252
1060 Ga0501083_0000450 3300049744 Bacteria 26315
1061 Ga0501083_0009945 3300049744 Bacteria 6715
1062 Ga0501035_0003133 3300049822 Bacteria 15887
1063 Ga0501035_0040480 3300049822 Bacteria 4211
1064 Ga0501035_0050506 3300049822 Bacteria 3727
1065 Ga0501035_0100420 3300049822 Bacteria 2540
1066 Ga0501044_0000212 3300049823 Bacteria 73807
1067 Ga0501044_0016862 3300049823 Bacteria 7837
1068 Ga0501044_0045666 3300049823 Bacteria 4538
1069 Ga0501044_0074734 3300049823 Bacteria 3442
1070 Ga0501044_0186774 3300049823 Bacteria 2037
1071 Ga0501044_0196147 3300049823 Bacteria 1979
1072 Ga0501045_0002138 3300049824 Bacteria 13383
1073 Ga0501045_0003114 3300049824 Bacteria 11344
1074 Ga0501045_0011177 3300049824 Bacteria 6294
1075 Ga0501045_0039471 3300049824 Bacteria 3435
1076 nmdc:mga00v17_27414_c1 3300050491 Bacteria 3326
1077 nmdc:mga0yw44_6715_c1 3300050492 Bacteria 5591
1078 nmdc:mga06z11_10761_c1 3300050494 Bacteria 3913
1079 nmdc:mga06z11_19093_c1 3300050494 Bacteria 3145
1080 nmdc:mga06z11_34462_c1 3300050494 Bacteria 2486
1081 nmdc:mga04h51_13437_c1 3300050495 Bacteria 2318
1082 nmdc:mga04h51_27419_c1 3300050495 Bacteria 1770
1083 nmdc:mga04h51_9859_c1 3300050495 Bacteria 2606
1084 nmdc:mga07m45_146771_c1 3300050496 Bacteria 1367
1085 nmdc:mga07m45_3083_c1 3300050496 Bacteria 7965
1086 nmdc:mga05p37_137815_c1 3300050507 Bacteria 2991
1087 nmdc:mga05p37_200088_c1 3300050507 Bacteria 2420
1088 nmdc:mga05p37_61358_c1 3300050507 Bacteria 4628
1089 nmdc:mga09592_69829_c1 3300050508 Bacteria 2980
1090 nmdc:mga0qj67_387275_c1 3300050509 Bacteria 1129
1091 nmdc:mga0qj67_6651_c1 3300050509 Bacteria 8493
1092 nmdc:mga06r32_29521_c1 3300050510 Bacteria 5141
1093 nmdc:mga08y16_164_c1 3300050511 Bacteria 57736
1094 nmdc:mga08y16_2044_c1 3300050511 Bacteria 20676
1095 nmdc:mga08y16_256078_c1 3300050511 Bacteria 1808
1096 nmdc:mga08y16_5303_c1 3300050511 Bacteria 13483
1097 nmdc:mga0n895_124602_c1 3300050512 Bacteria 2600
1098 nmdc:mga0n895_133195_c1 3300050512 Bacteria 2511
1099 nmdc:mga0n895_190142_c1 3300050512 Bacteria 2084
1100 nmdc:mga0n895_25898_c1 3300050512 Bacteria 5547
1101 nmdc:mga0n895_54579_c1 3300050512 Bacteria 3931
1102 nmdc:mga0rr50_303490_c1 3300050513 Bacteria 1336
1103 nmdc:mga0rr50_40690_c1 3300050513 Bacteria 3381
1104 nmdc:mga08x19_165168_c1 3300050514 Bacteria 1505
1105 nmdc:mga08x19_6247_c1 3300050514 Bacteria 7052
1106 nmdc:mga0a205_202492_c1 3300050515 Bacteria 1875
1107 nmdc:mga0a205_2432_c1 3300050515 Bacteria 16422
1108 nmdc:mga0a205_42460_c2 3300050515 Bacteria 3584
1109 nmdc:mga0a205_47549_c1 3300050515 Bacteria 4140
1110 nmdc:mga0a205_54118_c1 3300050515 Bacteria 3874
1111 nmdc:mga0sz30_34329_c1 3300050516 Bacteria 2111
1112 Ga0495601_0000164 3300053077 Bacteria 35933
1113 Ga0495601_0000473 3300053077 Bacteria 21167
1114 Ga0495601_0002539 3300053077 Bacteria 10378
1115 Ga0495601_0019932 3300053077 Bacteria 4093
1116 Ga0495601_0078493 3300053077 Bacteria 2115
1117 Ga0495612_0000752 3300053078 Bacteria 13204
1118 Ga0495612_0002586 3300053078 Bacteria 7465
1119 Ga0495655_0005113 3300053083 Bacteria 2296
1120 Ga0495595_0000235 3300053084 Bacteria 21997
1121 Ga0495595_0025013 3300053084 Bacteria 2640
1122 Ga0495619_0000414 3300053085 Bacteria 29022
1123 Ga0495619_0002506 3300053085 Bacteria 12028
1124 Ga0495619_0006012 3300053085 Bacteria 7689
1125 Ga0495619_0014748 3300053085 Bacteria 4936
1126 Ga0495619_0015549 3300053085 Bacteria 4815
1127 Ga0495619_0028733 3300053085 Bacteria 3589
1128 Ga0495619_0045584 3300053085 Bacteria 2881
1129 Ga0495619_0187455 3300053085 Bacteria 1432
1130 Ga0500583_0061363 3300053092 Bacteria 1775
1131 Ga0500595_044011 3300053119 Bacteria 1418
1132 Ga0500655_005256 3300053133 Bacteria 2336
1133 Ga0500577_0043084 3300053142 Bacteria 1656
1134 Ga0500624_000092 3300053157 Bacteria 43880
1135 Ga0500645_024186 3300053730 Bacteria 1858
1136 Ga0501084_0028654 3300054114 Bacteria 4656
1137 Ga0501084_0036665 3300054114 Bacteria 4096
1138 Ga0501084_0039306 3300054114 Bacteria 3957
1139 Ga0501084_0079007 3300054114 Bacteria 2757
1140 Ga0501084_0330017 3300054114 Bacteria 1288
1141 Ga0501082_0042865 3300060353 Bacteria 3900
1142 Ga0501082_0109657 3300060353 Bacteria 2389
1143 Ga0501082_0126934 3300060353 Bacteria 2212
1144 Ga0501082_0165655 3300060353 Bacteria 1921
1145 Ga0501082_0181091 3300060353 Bacteria 1833
1146 Ga0501082_0264547 3300060353 Bacteria 1496
1147 Ga0530510_0040645 3300061734 Bacteria 3357
1148 Ga0530510_0061859 3300061734 Bacteria 2710
1149 Ga0530510_0108672 3300061734 Bacteria 2030

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300020082 Ga0206353_11380251 Ga0206353_113802512 248
2 3300005347 Ga0070668_100006404 Ga0070668_1000064043 250
3 3300005844 Ga0068862_100000775 Ga0068862_10000077521 250
4 3300026118 Ga0207675_100185704 Ga0207675_1001857042 250
5 3300028380 Ga0268265_10000249 Ga0268265_1000024911 250
6 3300049569 Ga0501032_0217131 Ga0501032_0217131_156_1121 251
7 3300049570 Ga0501033_0043838 Ga0501033_0043838_951_1916 251
8 3300049573 Ga0501037_0092496 Ga0501037_0092496_685_1650 251
9 3300049574 Ga0501038_0132211 Ga0501038_0132211_398_1363 251
10 3300049575 Ga0501039_0118181 Ga0501039_0118181_649_1614 251
11 3300049578 Ga0501042_0070215 Ga0501042_0070215_491_1456 251
12 3300049579 Ga0501043_0240449 Ga0501043_0240449_324_1289 251
13 3300049580 Ga0501046_0043280 Ga0501046_0043280_670_1635 251
14 3300049584 Ga0501068_0076041 Ga0501068_0076041_59_1024 251
15 3300049588 Ga0501072_0032021 Ga0501072_0032021_2227_3192 251
16 3300049590 Ga0501074_0222848 Ga0501074_0222848_67_1032 251
17 3300049593 Ga0501077_0094388 Ga0501077_0094388_648_1613 251
18 3300049743 Ga0501081_0000349 Ga0501081_0000349_901_1866 251
19 3300049822 Ga0501035_0100420 Ga0501035_0100420_726_1691 251
20 3300049823 Ga0501044_0186774 Ga0501044_0186774_526_1491 251
21 3300049824 Ga0501045_0003114 Ga0501045_0003114_491_1456 251
22 3300054114 Ga0501084_0079007 Ga0501084_0079007_1283_2248 251
23 3300061734 Ga0530510_0108672 Ga0530510_0108672_203_1168 251
24 3300035086 Ga0373934_0092517 Ga0373934_0092517_26_823 256
25 3300046663 Ga0495635_0088758 Ga0495635_0088758_41_838 256
26 3300003187 JGI25151J46595_10000193 JGI25151J46595_1000019324 257
27 3300003354 JGI25160J50197_1024073 JGI25160J50197_10240731 257
28 3300025284 Ga0209130_1000389 Ga0209130_100038914 257
29 3300025294 Ga0209025_1000061 Ga0209025_1000061199 257
30 3300025297 Ga0209758_1005524 Ga0209758_10055245 257
31 3300025302 Ga0207426_1000361 Ga0207426_100036176 257
32 3300049572 Ga0501036_0014064 Ga0501036_0014064_4261_5217 261
33 3300049573 Ga0501037_0002025 Ga0501037_0002025_12737_13693 261
34 3300049575 Ga0501039_0002776 Ga0501039_0002776_3216_4172 261
35 3300049578 Ga0501042_0023281 Ga0501042_0023281_949_1905 261
36 3300049579 Ga0501043_0013780 Ga0501043_0013780_2597_3553 261
37 3300049580 Ga0501046_0014727 Ga0501046_0014727_4373_5329 261
38 3300049583 Ga0501067_0008683 Ga0501067_0008683_4519_5475 261
39 3300049584 Ga0501068_0008094 Ga0501068_0008094_475_1431 261
40 3300049585 Ga0501069_0003072 Ga0501069_0003072_3586_4542 261
41 3300049587 Ga0501071_0007337 Ga0501071_0007337_3529_4485 261
42 3300049588 Ga0501072_0204161 Ga0501072_0204161_559_1515 261
43 3300049590 Ga0501074_0003316 Ga0501074_0003316_5723_6679 261
44 3300049744 Ga0501083_0009945 Ga0501083_0009945_4582_5538 261
45 3300049824 Ga0501045_0011177 Ga0501045_0011177_616_1572 261
46 3300054114 Ga0501084_0028654 Ga0501084_0028654_1930_2886 261
47 3300035118 Ga0373954_0042781 Ga0373954_0042781_268_1065 265
48 3300035410 Ga0373924_0018781 Ga0373924_0018781_1030_1827 265
49 3300035724 Ga0373933_0001294 Ga0373933_0001294_8675_9472 265
50 3300044765 Ga0466970_0335631 Ga0466970_0335631_16_813 265
51 3300046511 Ga0495608_0058931 Ga0495608_0058931_1260_2057 265
52 3300046642 Ga0495634_0129146 Ga0495634_0129146_791_1588 265
53 3300046679 Ga0495623_0106601 Ga0495623_0106601_781_1578 265
54 3300047317 Ga0495604_0214483 Ga0495604_0214483_518_1315 265
55 3300047317 Ga0495604_0230201 Ga0495604_0230201_29_826 265
56 3300049582 Ga0501048_0212306 Ga0501048_0212306_25_822 265
57 3300053077 Ga0495601_0078493 Ga0495601_0078493_84_881 265
58 3300053084 Ga0495595_0025013 Ga0495595_0025013_1224_2021 265
59 3300053085 Ga0495619_0014748 Ga0495619_0014748_2702_3499 265
60 3300054114 Ga0501084_0039306 Ga0501084_0039306_3126_3923 265
61 3300006051 Ga0075364_10204264 Ga0075364_102042642 266
62 3300031240 Ga0265320_10002095 Ga0265320_100020957 269
63 3300031595 Ga0265313_10063020 Ga0265313_100630202 269
64 3300031711 Ga0265314_10001057 Ga0265314_100010576 269
65 3300044712 Ga0453684_0037507 Ga0453684_0037507_4693_5640 269
66 3300005340 Ga0070689_100018460 Ga0070689_1000184604 270
67 3300005343 Ga0070687_100028601 Ga0070687_1000286013 270
68 3300005466 Ga0070685_10250085 Ga0070685_102500851 270
69 3300009098 Ga0105245_10006657 Ga0105245_100066573 270
70 3300013297 Ga0157378_10082672 Ga0157378_100826721 270
71 3300025918 Ga0207662_10005578 Ga0207662_100055786 270
72 3300025927 Ga0207687_10111636 Ga0207687_101116362 270
73 3300025936 Ga0207670_10029969 Ga0207670_100299693 270
74 3300025940 Ga0207691_10273156 Ga0207691_102731562 270
75 3300009094 Ga0111539_10044669 Ga0111539_100446693 271
76 3300027907 Ga0207428_10000050 Ga0207428_10000050122 271
77 3300050511 nmdc:mga08y16_164_c1 nmdc:mga08y16_164_c1_38860_39816 271
78 3300006186 Ga0075369_10023201 Ga0075369_100232012 273
79 3300005549 Ga0070704_100026429 Ga0070704_1000264292 274
80 3300005615 Ga0070702_100175884 Ga0070702_1001758842 274
81 3300006871 Ga0075434_100055241 Ga0075434_1000552414 274
82 3300009147 Ga0114129_10059574 Ga0114129_100595744 274
83 3300009148 Ga0105243_10174090 Ga0105243_101740902 274
84 3300048904 Ga0496101_0109216 Ga0496101_0109216_345_1301 274
85 3300048913 Ga0496110_0170770 Ga0496110_0170770_190_1137 274
86 3300048915 Ga0496112_0076859 Ga0496112_0076859_1571_2518 274
87 3300048916 Ga0496113_0104806 Ga0496113_0104806_632_1579 274
88 3300050507 nmdc:mga05p37_61358_c1 nmdc:mga05p37_61358_c1_1576_2523 274
89 3300050515 nmdc:mga0a205_202492_c1 nmdc:mga0a205_202492_c1_556_1503 274
90 3300005458 Ga0070681_10061642 Ga0070681_100616423 275
91 3300025921 Ga0207652_10025093 Ga0207652_100250932 275
92 3300046536 Ga0495587_0138923 Ga0495587_0138923_523_1350 275
93 3300035172 Ga0373955_0348884 Ga0373955_0348884_19_849 276
94 3300047317 Ga0495604_0334707 Ga0495604_0334707_155_985 276
95 3300027378 Ga0209981_1001220 Ga0209981_10012203 277
96 3300027462 Ga0210000_1000129 Ga0210000_10001299 277
97 3300049587 Ga0501071_0187708 Ga0501071_0187708_15_971 277
98 3300005548 Ga0070665_100003075 Ga0070665_1000030754 278
99 3300006175 Ga0070712_100034712 Ga0070712_1000347122 278
100 3300028379 Ga0268266_10002721 Ga0268266_100027218 278
101 3300046460 Ga0495638_0033037 Ga0495638_0033037_499_1425 278
102 3300053119 Ga0500595_044011 Ga0500595_044011_88_1044 278
103 3300035113 Ga0373936_0016118 Ga0373936_0016118_1251_2207 279
104 3300035171 Ga0373946_0007336 Ga0373946_0007336_107_1063 279
105 3300035172 Ga0373955_0039308 Ga0373955_0039308_100_1056 279
106 3300035695 Ga0373927_0000700 Ga0373927_0000700_8258_9214 279
107 3300035725 Ga0373947_0000333 Ga0373947_0000333_8656_9612 279
108 3300037068 Ga0373925_0004318 Ga0373925_0004318_9509_10465 279
109 3300037418 Ga0395900_0008179 Ga0395900_0008179_6390_7346 279
110 3300037471 Ga0395905_0006120 Ga0395905_0006120_3079_4035 279
111 3300046459 Ga0495629_0046403 Ga0495629_0046403_88_1044 279
112 3300046472 Ga0495580_0025889 Ga0495580_0025889_347_1303 279
113 3300046475 Ga0495639_0049117 Ga0495639_0049117_669_1625 279
114 3300046477 Ga0495664_0003467 Ga0495664_0003467_3758_4714 279
115 3300046514 Ga0495618_0000705 Ga0495618_0000705_5272_6228 279
116 3300046517 Ga0495630_0004473 Ga0495630_0004473_7317_8273 279
117 3300046517 Ga0495630_0009360 Ga0495630_0009360_4855_5811 279
118 3300046533 Ga0495640_0002127 Ga0495640_0002127_11279_12235 279
119 3300046535 Ga0495586_0031112 Ga0495586_0031112_1593_2549 279
120 3300046543 Ga0495645_0019743 Ga0495645_0019743_3217_4173 279
121 3300046642 Ga0495634_0012668 Ga0495634_0012668_5014_5970 279
122 3300046690 Ga0495624_0009051 Ga0495624_0009051_3938_4894 279
123 3300047315 Ga0495581_0010457 Ga0495581_0010457_1348_2304 279
124 3300047319 Ga0495674_0048516 Ga0495674_0048516_2804_3742 279
125 3300047319 Ga0495674_0169082 Ga0495674_0169082_80_1036 279
126 3300047321 Ga0495676_0078890 Ga0495676_0078890_46_1002 279
127 3300047471 Ga0495684_0002670 Ga0495684_0002670_3987_4943 279
128 3300047673 Ga0495593_0004434 Ga0495593_0004434_2351_3307 279
129 3300053077 Ga0495601_0019932 Ga0495601_0019932_2804_3760 279
130 3300053085 Ga0495619_0015549 Ga0495619_0015549_3753_4709 279
131 3300031018 Ga0265773_1001590 Ga0265773_10015902 280
132 3300046642 Ga0495634_0015350 Ga0495634_0015350_3002_3958 280
133 3300047320 Ga0495672_0009172 Ga0495672_0009172_2802_3755 280
134 3300047471 Ga0495684_0006327 Ga0495684_0006327_3987_4943 280
135 3300049572 Ga0501036_0001395 Ga0501036_0001395_8258_9214 280
136 3300049573 Ga0501037_0118529 Ga0501037_0118529_520_1476 280
137 3300049574 Ga0501038_0027715 Ga0501038_0027715_895_1851 280
138 3300049575 Ga0501039_0001680 Ga0501039_0001680_10715_11671 280
139 3300049576 Ga0501040_0028999 Ga0501040_0028999_2504_3460 280
140 3300049577 Ga0501041_0000497 Ga0501041_0000497_5725_6681 280
141 3300049587 Ga0501071_0000766 Ga0501071_0000766_6886_7842 280
142 3300049588 Ga0501072_0009889 Ga0501072_0009889_4617_5573 280
143 3300049590 Ga0501074_0052771 Ga0501074_0052771_1302_2258 280
144 3300049592 Ga0501076_0007409 Ga0501076_0007409_1070_2026 280
145 3300049743 Ga0501081_0016572 Ga0501081_0016572_1022_1978 280
146 3300049822 Ga0501035_0003133 Ga0501035_0003133_8281_9237 280
147 3300049824 Ga0501045_0002138 Ga0501045_0002138_1994_2950 280
148 3300053085 Ga0495619_0045584 Ga0495619_0045584_706_1662 280
149 3300061734 Ga0530510_0040645 Ga0530510_0040645_2308_3264 280
150 3300049686 Ga0501257_001114 Ga0501257_001114_698_1654 281
151 3300006852 Ga0075433_10201376 Ga0075433_102013762 282
152 3300006871 Ga0075434_100000519 Ga0075434_10000051930 282
153 3300006914 Ga0075436_100052430 Ga0075436_1000524302 282
154 3300007076 Ga0075435_100047561 Ga0075435_1000475612 282
155 3300050512 nmdc:mga0n895_124602_c1 nmdc:mga0n895_124602_c1_1612_2568 282
156 3300050513 nmdc:mga0rr50_40690_c1 nmdc:mga0rr50_40690_c1_1300_2256 282
157 3300050514 nmdc:mga08x19_6247_c1 nmdc:mga08x19_6247_c1_2982_3938 282
158 3300050515 nmdc:mga0a205_54118_c1 nmdc:mga0a205_54118_c1_2726_3682 282
159 3300028577 Ga0265318_10008937 Ga0265318_100089373 287
160 3300031235 Ga0265330_10095096 Ga0265330_100950962 287
161 3300031249 Ga0265339_10033503 Ga0265339_100335033 287
162 3300031344 Ga0265316_10062311 Ga0265316_100623112 287
163 3300031344 Ga0265316_10099832 Ga0265316_100998322 287
164 3300031711 Ga0265314_10042742 Ga0265314_100427422 287
165 3300031711 Ga0265314_10047083 Ga0265314_100470832 287
166 3300031712 Ga0265342_10108591 Ga0265342_101085912 287
167 3300035119 Ga0373956_0049348 Ga0373956_0049348_552_1499 287
168 3300035172 Ga0373955_0061489 Ga0373955_0061489_1093_2040 287
169 3300035724 Ga0373933_0081196 Ga0373933_0081196_128_1075 287
170 3300036401 Ga0373937_0137870 Ga0373937_0137870_506_1453 287
171 3300046679 Ga0495623_0056896 Ga0495623_0056896_629_1576 287
172 3300048088 Ga0495602_0122305 Ga0495602_0122305_305_1252 287
173 3300050512 nmdc:mga0n895_190142_c1 nmdc:mga0n895_190142_c1_755_1702 287
174 3300053133 Ga0500655_005256 Ga0500655_005256_834_1796 287
175 3300053157 Ga0500624_000092 Ga0500624_000092_32738_33706 287
176 3300053730 Ga0500645_024186 Ga0500645_024186_143_1105 287
177 3300054114 Ga0501084_0036665 Ga0501084_0036665_952_1899 287
178 3300060353 Ga0501082_0165655 Ga0501082_0165655_765_1718 287
179 iso_pu_bacteria 2891088606 2891090909 287
180 2010549000 RicEn_C5112 RicEn_91050 288
181 2209111006 2214828529 2213866731 288
182 3300000042 ARSoilYngRDRAFT_c00827 ARSoilYngRDRAFT_008273 288
183 3300000043 ARcpr5yngRDRAFT_c000144 ARcpr5yngRDRAFT_0001447 288
184 3300000044 ARSoilOldRDRAFT_c000792 ARSoilOldRDRAFT_0007923 288
185 3300000045 ARCol0oldRDRAFT_c00111 ARCol0oldRDRAFT_001112 288
186 3300000652 ARCol0yngRDRAFT_1000163 ARCol0yngRDRAFT_10001634 288
187 3300001976 JGI24752J21851_1001527 JGI24752J21851_10015272 288
188 3300001977 JGI24746J21847_1000023 JGI24746J21847_10000239 288
189 3300001977 JGI24746J21847_1002224 JGI24746J21847_10022242 288
190 3300001989 JGI24739J22299_10000241 JGI24739J22299_1000024111 288
191 3300001990 JGI24737J22298_10000224 JGI24737J22298_1000022414 288
192 3300001990 JGI24737J22298_10000674 JGI24737J22298_1000067410 288
193 3300001991 JGI24743J22301_10003893 JGI24743J22301_100038932 288
194 3300002070 JGI24750J21931_1000337 JGI24750J21931_10003377 288
195 3300002070 JGI24750J21931_1000352 JGI24750J21931_10003524 288
196 3300002070 JGI24750J21931_1001355 JGI24750J21931_10013552 288
197 3300002073 JGI24745J21846_1000775 JGI24745J21846_10007753 288
198 3300002074 JGI24748J21848_1000156 JGI24748J21848_100015610 288
199 3300002075 JGI24738J21930_10000197 JGI24738J21930_100001978 288
200 3300002076 JGI24749J21850_1002812 JGI24749J21850_10028122 288
201 3300002077 JGI24744J21845_10000934 JGI24744J21845_100009344 288
202 3300002126 JGI24035J26624_1000018 JGI24035J26624_10000189 288
203 3300002155 JGI24033J26618_1000741 JGI24033J26618_10007412 288
204 3300002239 JGI24034J26672_10000296 JGI24034J26672_100002965 288
205 3300002244 JGI24742J22300_10000152 JGI24742J22300_100001522 288
206 3300002244 JGI24742J22300_10000424 JGI24742J22300_100004244 288
207 3300003203 JGI25406J46586_10004053 JGI25406J46586_100040535 288
208 3300005276 Ga0065717_1002094 Ga0065717_10020942 288
209 3300005290 Ga0065712_10002365 Ga0065712_100023659 288
210 3300005290 Ga0065712_10071985 Ga0065712_100719854 288
211 3300005293 Ga0065715_10001277 Ga0065715_1000127713 288
212 3300005293 Ga0065715_10089028 Ga0065715_1008902813 288
213 3300005295 Ga0065707_10107876 Ga0065707_101078762 288
214 3300005327 Ga0070658_10003962 Ga0070658_100039629 288
215 3300005328 Ga0070676_10000629 Ga0070676_1000062913 288
216 3300005328 Ga0070676_10031955 Ga0070676_100319552 288
217 3300005329 Ga0070683_100000240 Ga0070683_10000024031 288
218 3300005329 Ga0070683_100020152 Ga0070683_1000201523 288
219 3300005329 Ga0070683_100153286 Ga0070683_1001532862 288
220 3300005330 Ga0070690_100000264 Ga0070690_10000026426 288
221 3300005330 Ga0070690_100010416 Ga0070690_1000104164 288
222 3300005330 Ga0070690_100068744 Ga0070690_1000687442 288
223 3300005330 Ga0070690_100105533 Ga0070690_1001055332 288
224 3300005330 Ga0070690_100154275 Ga0070690_1001542752 288
225 3300005331 Ga0070670_100002399 Ga0070670_1000023995 288
226 3300005331 Ga0070670_100045914 Ga0070670_1000459144 288
227 3300005333 Ga0070677_10000507 Ga0070677_100005075 288
228 3300005334 Ga0068869_100000189 Ga0068869_10000018920 288
229 3300005334 Ga0068869_100033165 Ga0068869_1000331652 288
230 3300005335 Ga0070666_10019187 Ga0070666_100191874 288
231 3300005335 Ga0070666_10041895 Ga0070666_100418952 288
232 3300005336 Ga0070680_100000210 Ga0070680_10000021028 288
233 3300005336 Ga0070680_100000706 Ga0070680_10000070615 288
234 3300005336 Ga0070680_100009451 Ga0070680_1000094514 288
235 3300005336 Ga0070680_100020964 Ga0070680_1000209645 288
236 3300005336 Ga0070680_100027458 Ga0070680_1000274583 288
237 3300005336 Ga0070680_100443725 Ga0070680_1004437251 288
238 3300005337 Ga0070682_100000202 Ga0070682_10000020240 288
239 3300005337 Ga0070682_100009990 Ga0070682_1000099903 288
240 3300005337 Ga0070682_100013606 Ga0070682_1000136062 288
241 3300005337 Ga0070682_100249014 Ga0070682_1002490141 288
242 3300005338 Ga0068868_100021910 Ga0068868_1000219104 288
243 3300005338 Ga0068868_100033405 Ga0068868_1000334053 288
244 3300005339 Ga0070660_100000223 Ga0070660_10000022331 288
245 3300005339 Ga0070660_100011386 Ga0070660_1000113862 288
246 3300005339 Ga0070660_100072810 Ga0070660_1000728102 288
247 3300005339 Ga0070660_100077113 Ga0070660_1000771133 288
248 3300005340 Ga0070689_100000187 Ga0070689_10000018731 288
249 3300005340 Ga0070689_100020568 Ga0070689_1000205684 288
250 3300005340 Ga0070689_100024256 Ga0070689_1000242564 288
251 3300005341 Ga0070691_10000236 Ga0070691_1000023613 288
252 3300005341 Ga0070691_10010464 Ga0070691_100104643 288
253 3300005341 Ga0070691_10054149 Ga0070691_100541492 288
254 3300005343 Ga0070687_100000306 Ga0070687_10000030613 288
255 3300005343 Ga0070687_100005837 Ga0070687_1000058375 288
256 3300005343 Ga0070687_100055735 Ga0070687_1000557352 288
257 3300005344 Ga0070661_100000298 Ga0070661_10000029813 288
258 3300005344 Ga0070661_100027242 Ga0070661_1000272423 288
259 3300005345 Ga0070692_10000016 Ga0070692_1000001631 288
260 3300005347 Ga0070668_100010470 Ga0070668_1000104704 288
261 3300005347 Ga0070668_100013411 Ga0070668_1000134113 288
262 3300005353 Ga0070669_100000959 Ga0070669_10000095913 288
263 3300005353 Ga0070669_100009625 Ga0070669_1000096253 288
264 3300005353 Ga0070669_100014612 Ga0070669_1000146124 288
265 3300005353 Ga0070669_100071006 Ga0070669_1000710062 288
266 3300005354 Ga0070675_100000215 Ga0070675_10000021512 288
267 3300005354 Ga0070675_100007433 Ga0070675_1000074334 288
268 3300005354 Ga0070675_100011271 Ga0070675_1000112713 288
269 3300005355 Ga0070671_100000402 Ga0070671_1000004023 288
270 3300005355 Ga0070671_100010939 Ga0070671_1000109395 288
271 3300005355 Ga0070671_100055232 Ga0070671_1000552322 288
272 3300005356 Ga0070674_100000709 Ga0070674_1000007097 288
273 3300005356 Ga0070674_100002281 Ga0070674_1000022814 288
274 3300005356 Ga0070674_100009356 Ga0070674_1000093564 288
275 3300005364 Ga0070673_100000035 Ga0070673_10000003529 288
276 3300005364 Ga0070673_100103748 Ga0070673_1001037482 288
277 3300005365 Ga0070688_100000130 Ga0070688_10000013033 288
278 3300005365 Ga0070688_100003918 Ga0070688_1000039187 288
279 3300005365 Ga0070688_100043003 Ga0070688_1000430032 288
280 3300005366 Ga0070659_100000583 Ga0070659_10000058313 288
281 3300005366 Ga0070659_100043211 Ga0070659_1000432112 288
282 3300005366 Ga0070659_100052526 Ga0070659_1000525263 288
283 3300005366 Ga0070659_100108502 Ga0070659_1001085022 288
284 3300005367 Ga0070667_100000712 Ga0070667_10000071228 288
285 3300005367 Ga0070667_100026753 Ga0070667_1000267534 288
286 3300005406 Ga0070703_10023357 Ga0070703_100233572 288
287 3300005435 Ga0070714_100018802 Ga0070714_1000188022 288
288 3300005435 Ga0070714_100148792 Ga0070714_1001487922 288
289 3300005436 Ga0070713_100010347 Ga0070713_1000103476 288
290 3300005436 Ga0070713_100089294 Ga0070713_1000892942 288
291 3300005436 Ga0070713_100096688 Ga0070713_1000966882 288
292 3300005436 Ga0070713_100154538 Ga0070713_1001545382 288
293 3300005436 Ga0070713_100337383 Ga0070713_1003373832 288
294 3300005436 Ga0070713_100553933 Ga0070713_1005539331 288
295 3300005437 Ga0070710_10000656 Ga0070710_1000065610 288
296 3300005437 Ga0070710_10009990 Ga0070710_100099904 288
297 3300005438 Ga0070701_10000081 Ga0070701_1000008126 288
298 3300005438 Ga0070701_10007943 Ga0070701_100079433 288
299 3300005438 Ga0070701_10034214 Ga0070701_100342142 288
300 3300005439 Ga0070711_100008844 Ga0070711_1000088442 288
301 3300005439 Ga0070711_100058616 Ga0070711_1000586162 288
302 3300005439 Ga0070711_100360424 Ga0070711_1003604241 288
303 3300005440 Ga0070705_100000911 Ga0070705_1000009114 288
304 3300005440 Ga0070705_100028423 Ga0070705_1000284233 288
305 3300005440 Ga0070705_100083474 Ga0070705_1000834742 288
306 3300005441 Ga0070700_100000393 Ga0070700_10000039313 288
307 3300005441 Ga0070700_100006267 Ga0070700_1000062677 288
308 3300005441 Ga0070700_100022752 Ga0070700_1000227522 288
309 3300005441 Ga0070700_100070463 Ga0070700_1000704632 288
310 3300005444 Ga0070694_100000129 Ga0070694_10000012912 288
311 3300005444 Ga0070694_100003990 Ga0070694_1000039908 288
312 3300005445 Ga0070708_100022564 Ga0070708_1000225643 288
313 3300005455 Ga0070663_100000746 Ga0070663_1000007466 288
314 3300005455 Ga0070663_100004572 Ga0070663_1000045726 288
315 3300005455 Ga0070663_100011714 Ga0070663_1000117145 288
316 3300005455 Ga0070663_100026948 Ga0070663_1000269483 288
317 3300005456 Ga0070678_100000399 Ga0070678_10000039913 288
318 3300005456 Ga0070678_100048917 Ga0070678_1000489172 288
319 3300005457 Ga0070662_100001543 Ga0070662_10000154311 288
320 3300005457 Ga0070662_100016757 Ga0070662_1000167572 288
321 3300005457 Ga0070662_100019314 Ga0070662_1000193143 288
322 3300005458 Ga0070681_10000001 Ga0070681_10000001714 288
323 3300005458 Ga0070681_10001286 Ga0070681_1000128624 288
324 3300005458 Ga0070681_10040205 Ga0070681_100402054 288
325 3300005458 Ga0070681_10043290 Ga0070681_100432903 288
326 3300005458 Ga0070681_10256287 Ga0070681_102562872 288
327 3300005458 Ga0070681_10387420 Ga0070681_103874202 288
328 3300005459 Ga0068867_100001770 Ga0068867_10000177012 288
329 3300005459 Ga0068867_100004534 Ga0068867_1000045346 288
330 3300005459 Ga0068867_100024994 Ga0068867_1000249943 288
331 3300005466 Ga0070685_10000490 Ga0070685_1000049012 288
332 3300005466 Ga0070685_10012931 Ga0070685_100129314 288
333 3300005466 Ga0070685_10032047 Ga0070685_100320472 288
334 3300005507 Ga0074259_10596474 Ga0074259_105964742 288
335 3300005530 Ga0070679_100000037 Ga0070679_10000003747 288
336 3300005530 Ga0070679_100000553 Ga0070679_10000055330 288
337 3300005530 Ga0070679_100027141 Ga0070679_1000271412 288
338 3300005530 Ga0070679_100056209 Ga0070679_1000562093 288
339 3300005535 Ga0070684_100000246 Ga0070684_10000024631 288
340 3300005535 Ga0070684_100004789 Ga0070684_1000047899 288
341 3300005535 Ga0070684_100024430 Ga0070684_1000244302 288
342 3300005535 Ga0070684_100203065 Ga0070684_1002030652 288
343 3300005539 Ga0068853_100000243 Ga0068853_10000024334 288
344 3300005539 Ga0068853_100097710 Ga0068853_1000977102 288
345 3300005539 Ga0068853_100179302 Ga0068853_1001793022 288
346 3300005543 Ga0070672_100000157 Ga0070672_10000015731 288
347 3300005543 Ga0070672_100003221 Ga0070672_1000032216 288
348 3300005544 Ga0070686_100000260 Ga0070686_10000026033 288
349 3300005544 Ga0070686_100008427 Ga0070686_1000084275 288
350 3300005544 Ga0070686_100037335 Ga0070686_1000373352 288
351 3300005545 Ga0070695_100004051 Ga0070695_1000040515 288
352 3300005545 Ga0070695_100005692 Ga0070695_1000056923 288
353 3300005545 Ga0070695_100074049 Ga0070695_1000740493 288
354 3300005546 Ga0070696_100000970 Ga0070696_10000097010 288
355 3300005546 Ga0070696_100003815 Ga0070696_1000038155 288
356 3300005546 Ga0070696_100097933 Ga0070696_1000979332 288
357 3300005546 Ga0070696_100131855 Ga0070696_1001318552 288
358 3300005547 Ga0070693_100000925 Ga0070693_1000009255 288
359 3300005547 Ga0070693_100140556 Ga0070693_1001405562 288
360 3300005548 Ga0070665_100010001 Ga0070665_1000100019 288
361 3300005548 Ga0070665_100041633 Ga0070665_1000416332 288
362 3300005549 Ga0070704_100000171 Ga0070704_1000001714 288
363 3300005549 Ga0070704_100001307 Ga0070704_1000013074 288
364 3300005563 Ga0068855_100010157 Ga0068855_1000101573 288
365 3300005563 Ga0068855_100031343 Ga0068855_1000313433 288
366 3300005563 Ga0068855_100047138 Ga0068855_1000471385 288
367 3300005563 Ga0068855_100153394 Ga0068855_1001533942 288
368 3300005563 Ga0068855_100239024 Ga0068855_1002390242 288
369 3300005564 Ga0070664_100000269 Ga0070664_10000026931 288
370 3300005564 Ga0070664_100052826 Ga0070664_1000528263 288
371 3300005564 Ga0070664_100059585 Ga0070664_1000595852 288
372 3300005564 Ga0070664_100129446 Ga0070664_1001294462 288
373 3300005577 Ga0068857_100000174 Ga0068857_10000017432 288
374 3300005577 Ga0068857_100049341 Ga0068857_1000493412 288
375 3300005577 Ga0068857_100099316 Ga0068857_1000993163 288
376 3300005578 Ga0068854_100000211 Ga0068854_10000021113 288
377 3300005578 Ga0068854_100013937 Ga0068854_1000139374 288
378 3300005578 Ga0068854_100066678 Ga0068854_1000666783 288
379 3300005578 Ga0068854_100105533 Ga0068854_1001055332 288
380 3300005614 Ga0068856_100000600 Ga0068856_10000060034 288
381 3300005615 Ga0070702_100000654 Ga0070702_1000006543 288
382 3300005616 Ga0068852_100000629 Ga0068852_10000062917 288
383 3300005616 Ga0068852_100009156 Ga0068852_1000091565 288
384 3300005616 Ga0068852_100014841 Ga0068852_1000148412 288
385 3300005617 Ga0068859_100000894 Ga0068859_10000089433 288
386 3300005617 Ga0068859_100024112 Ga0068859_1000241125 288
387 3300005617 Ga0068859_100265007 Ga0068859_1002650072 288
388 3300005618 Ga0068864_100000329 Ga0068864_10000032943 288
389 3300005618 Ga0068864_100004704 Ga0068864_1000047047 288
390 3300005718 Ga0068866_10000177 Ga0068866_1000017723 288
391 3300005718 Ga0068866_10004095 Ga0068866_100040953 288
392 3300005719 Ga0068861_100000329 Ga0068861_10000032923 288
393 3300005719 Ga0068861_100017474 Ga0068861_1000174744 288
394 3300005719 Ga0068861_100026049 Ga0068861_1000260492 288
395 3300005719 Ga0068861_100204819 Ga0068861_1002048192 288
396 3300005840 Ga0068870_10000056 Ga0068870_1000005633 288
397 3300005840 Ga0068870_10004328 Ga0068870_100043283 288
398 3300005841 Ga0068863_100000278 Ga0068863_10000027850 288
399 3300005841 Ga0068863_100014875 Ga0068863_1000148754 288
400 3300005842 Ga0068858_100001048 Ga0068858_10000104823 288
401 3300005842 Ga0068858_100008255 Ga0068858_1000082556 288
402 3300005842 Ga0068858_100046045 Ga0068858_1000460452 288
403 3300005843 Ga0068860_100000985 Ga0068860_1000009854 288
404 3300005843 Ga0068860_100007113 Ga0068860_1000071137 288
405 3300005843 Ga0068860_100088750 Ga0068860_1000887502 288
406 3300005843 Ga0068860_100160849 Ga0068860_1001608492 288
407 3300005844 Ga0068862_100000593 Ga0068862_10000059314 288
408 3300005844 Ga0068862_100007625 Ga0068862_1000076252 288
409 3300005844 Ga0068862_100007945 Ga0068862_1000079455 288
410 3300005844 Ga0068862_100009498 Ga0068862_1000094983 288
411 3300005937 Ga0081455_10000051 Ga0081455_1000005139 288
412 3300005937 Ga0081455_10004739 Ga0081455_1000473913 288
413 3300005937 Ga0081455_10062668 Ga0081455_100626683 288
414 3300005985 Ga0081539_10003785 Ga0081539_1000378518 288
415 3300006028 Ga0070717_10119137 Ga0070717_101191372 288
416 3300006028 Ga0070717_10139812 Ga0070717_101398122 288
417 3300006038 Ga0075365_10026618 Ga0075365_100266184 288
418 3300006038 Ga0075365_10103766 Ga0075365_101037662 288
419 3300006042 Ga0075368_10020359 Ga0075368_100203592 288
420 3300006042 Ga0075368_10044879 Ga0075368_100448792 288
421 3300006048 Ga0075363_100042317 Ga0075363_1000423172 288
422 3300006051 Ga0075364_10027444 Ga0075364_100274443 288
423 3300006051 Ga0075364_10236647 Ga0075364_102366472 288
424 3300006163 Ga0070715_10010214 Ga0070715_100102143 288
425 3300006163 Ga0070715_10063916 Ga0070715_100639162 288
426 3300006163 Ga0070715_10087304 Ga0070715_100873042 288
427 3300006173 Ga0070716_100004545 Ga0070716_1000045452 288
428 3300006175 Ga0070712_100016638 Ga0070712_1000166383 288
429 3300006175 Ga0070712_100029533 Ga0070712_1000295332 288
430 3300006175 Ga0070712_100122234 Ga0070712_1001222343 288
431 3300006175 Ga0070712_100139359 Ga0070712_1001393592 288
432 3300006178 Ga0075367_10009838 Ga0075367_100098384 288
433 3300006178 Ga0075367_10030759 Ga0075367_100307592 288
434 3300006178 Ga0075367_10049575 Ga0075367_100495752 288
435 3300006186 Ga0075369_10005713 Ga0075369_100057132 288
436 3300006237 Ga0097621_100000504 Ga0097621_10000050416 288
437 3300006237 Ga0097621_100004513 Ga0097621_1000045134 288
438 3300006237 Ga0097621_100006326 Ga0097621_1000063264 288
439 3300006353 Ga0075370_10017676 Ga0075370_100176762 288
440 3300006358 Ga0068871_100000815 Ga0068871_1000008154 288
441 3300006358 Ga0068871_100005880 Ga0068871_1000058807 288
442 3300006846 Ga0075430_100021821 Ga0075430_1000218212 288
443 3300006847 Ga0075431_100032372 Ga0075431_1000323724 288
444 3300006871 Ga0075434_100000244 Ga0075434_10000024414 288
445 3300006871 Ga0075434_100286440 Ga0075434_1002864402 288
446 3300006880 Ga0075429_100382428 Ga0075429_1003824282 288
447 3300006881 Ga0068865_100000332 Ga0068865_10000033216 288
448 3300006881 Ga0068865_100031851 Ga0068865_1000318513 288
449 3300006881 Ga0068865_100166946 Ga0068865_1001669462 288
450 3300006914 Ga0075436_100090108 Ga0075436_1000901083 288
451 3300006914 Ga0075436_100288125 Ga0075436_1002881252 288
452 3300006931 Ga0097620_100000894 Ga0097620_1000008942 288
453 3300006931 Ga0097620_100024111 Ga0097620_1000241115 288
454 3300006931 Ga0097620_100265007 Ga0097620_1002650072 288
455 3300007076 Ga0075435_100074514 Ga0075435_1000745143 288
456 3300009092 Ga0105250_10028955 Ga0105250_100289552 288
457 3300009092 Ga0105250_10045782 Ga0105250_100457822 288
458 3300009093 Ga0105240_10063893 Ga0105240_100638933 288
459 3300009093 Ga0105240_10496464 Ga0105240_104964642 288
460 3300009094 Ga0111539_10001076 Ga0111539_1000107614 288
461 3300009094 Ga0111539_10011662 Ga0111539_100116623 288
462 3300009094 Ga0111539_10122649 Ga0111539_101226492 288
463 3300009094 Ga0111539_10276631 Ga0111539_102766312 288
464 3300009098 Ga0105245_10000451 Ga0105245_1000045114 288
465 3300009098 Ga0105245_10009909 Ga0105245_100099094 288
466 3300009098 Ga0105245_10042174 Ga0105245_100421742 288
467 3300009098 Ga0105245_10066551 Ga0105245_100665512 288
468 3300009101 Ga0105247_10001553 Ga0105247_100015532 288
469 3300009101 Ga0105247_10006039 Ga0105247_100060396 288
470 3300009101 Ga0105247_10013787 Ga0105247_100137872 288
471 3300009101 Ga0105247_10014447 Ga0105247_100144472 288
472 3300009101 Ga0105247_10159304 Ga0105247_101593042 288
473 3300009148 Ga0105243_10001205 Ga0105243_1000120514 288
474 3300009148 Ga0105243_10058461 Ga0105243_100584613 288
475 3300009148 Ga0105243_10070118 Ga0105243_100701183 288
476 3300009174 Ga0105241_10000515 Ga0105241_1000051512 288
477 3300009174 Ga0105241_10034338 Ga0105241_100343383 288
478 3300009174 Ga0105241_10043489 Ga0105241_100434893 288
479 3300009174 Ga0105241_10472669 Ga0105241_104726691 288
480 3300009176 Ga0105242_10008078 Ga0105242_100080784 288
481 3300009177 Ga0105248_10000837 Ga0105248_1000083714 288
482 3300009177 Ga0105248_10006976 Ga0105248_100069764 288
483 3300009177 Ga0105248_10049463 Ga0105248_100494632 288
484 3300009545 Ga0105237_10009856 Ga0105237_100098567 288
485 3300009545 Ga0105237_10011688 Ga0105237_100116886 288
486 3300009545 Ga0105237_10145521 Ga0105237_101455213 288
487 3300009545 Ga0105237_10289614 Ga0105237_102896142 288
488 3300009551 Ga0105238_10042052 Ga0105238_100420522 288
489 3300009551 Ga0105238_10047430 Ga0105238_100474303 288
490 3300009551 Ga0105238_10091379 Ga0105238_100913793 288
491 3300009551 Ga0105238_10139584 Ga0105238_101395842 288
492 3300009553 Ga0105249_10001556 Ga0105249_100015565 288
493 3300009553 Ga0105249_10018383 Ga0105249_100183835 288
494 3300009553 Ga0105249_10069863 Ga0105249_100698632 288
495 3300009553 Ga0105249_10714840 Ga0105249_107148402 288
496 3300010375 Ga0105239_10005157 Ga0105239_1000515712 288
497 3300010375 Ga0105239_10007246 Ga0105239_100072463 288
498 3300010375 Ga0105239_10011420 Ga0105239_100114202 288
499 3300010375 Ga0105239_10090414 Ga0105239_100904143 288
500 3300010375 Ga0105239_10586312 Ga0105239_105863121 288
501 3300011119 Ga0105246_10000100 Ga0105246_1000010014 288
502 3300013100 Ga0157373_10001937 Ga0157373_100019376 288
503 3300013102 Ga0157371_10009263 Ga0157371_100092632 288
504 3300013102 Ga0157371_10060791 Ga0157371_100607912 288
505 3300013102 Ga0157371_10097175 Ga0157371_100971752 288
506 3300013105 Ga0157369_10417137 Ga0157369_104171371 288
507 3300013296 Ga0157374_10002520 Ga0157374_1000252014 288
508 3300013296 Ga0157374_10025843 Ga0157374_100258433 288
509 3300013296 Ga0157374_10034810 Ga0157374_100348104 288
510 3300013296 Ga0157374_10068867 Ga0157374_100688672 288
511 3300013297 Ga0157378_10018104 Ga0157378_100181044 288
512 3300013297 Ga0157378_10019279 Ga0157378_100192796 288
513 3300013297 Ga0157378_10045210 Ga0157378_100452103 288
514 3300013297 Ga0157378_10100682 Ga0157378_101006822 288
515 3300013297 Ga0157378_10448060 Ga0157378_104480601 288
516 3300013306 Ga0163162_10001003 Ga0163162_1000100319 288
517 3300013306 Ga0163162_10003466 Ga0163162_100034663 288
518 3300013306 Ga0163162_10018542 Ga0163162_100185426 288
519 3300013306 Ga0163162_10181962 Ga0163162_101819622 288
520 3300013307 Ga0157372_10016087 Ga0157372_100160874 288
521 3300013307 Ga0157372_10173542 Ga0157372_101735422 288
522 3300013307 Ga0157372_10801752 Ga0157372_108017521 288
523 3300013308 Ga0157375_10000464 Ga0157375_1000046422 288
524 3300013308 Ga0157375_10013321 Ga0157375_100133215 288
525 3300013308 Ga0157375_10015123 Ga0157375_100151232 288
526 3300013308 Ga0157375_10068458 Ga0157375_100684583 288
527 3300013308 Ga0157375_10090970 Ga0157375_100909703 288
528 3300014325 Ga0163163_10002284 Ga0163163_1000228420 288
529 3300014325 Ga0163163_10012670 Ga0163163_100126704 288
530 3300014325 Ga0163163_10026554 Ga0163163_100265546 288
531 3300014325 Ga0163163_10340687 Ga0163163_103406871 288
532 3300014326 Ga0157380_10000145 Ga0157380_1000014531 288
533 3300014326 Ga0157380_10060588 Ga0157380_100605882 288
534 3300014745 Ga0157377_10000179 Ga0157377_1000017928 288
535 3300014745 Ga0157377_10047136 Ga0157377_100471362 288
536 3300014968 Ga0157379_10000067 Ga0157379_1000006741 288
537 3300014968 Ga0157379_10050135 Ga0157379_100501352 288
538 3300014968 Ga0157379_10061245 Ga0157379_100612453 288
539 3300014969 Ga0157376_10000864 Ga0157376_1000086414 288
540 3300014969 Ga0157376_10017983 Ga0157376_100179833 288
541 3300017792 Ga0163161_10001641 Ga0163161_1000164114 288
542 3300017792 Ga0163161_10015441 Ga0163161_100154413 288
543 3300025271 Ga0207666_1000002 Ga0207666_100000229 288
544 3300025271 Ga0207666_1003664 Ga0207666_10036642 288
545 3300025297 Ga0209758_1001864 Ga0209758_100186410 288
546 3300025297 Ga0209758_1004355 Ga0209758_10043553 288
547 3300025315 Ga0207697_10000113 Ga0207697_1000011331 288
548 3300025315 Ga0207697_10002993 Ga0207697_100029933 288
549 3300025321 Ga0207656_10013388 Ga0207656_100133883 288
550 3300025711 Ga0207696_1028356 Ga0207696_10283562 288
551 3300025885 Ga0207653_10024269 Ga0207653_100242693 288
552 3300025893 Ga0207682_10000094 Ga0207682_1000009414 288
553 3300025893 Ga0207682_10027480 Ga0207682_100274802 288
554 3300025898 Ga0207692_10002667 Ga0207692_100026674 288
555 3300025898 Ga0207692_10008058 Ga0207692_100080582 288
556 3300025899 Ga0207642_10000106 Ga0207642_1000010614 288
557 3300025899 Ga0207642_10022206 Ga0207642_100222062 288
558 3300025900 Ga0207710_10003537 Ga0207710_100035372 288
559 3300025901 Ga0207688_10000074 Ga0207688_1000007413 288
560 3300025901 Ga0207688_10001906 Ga0207688_1000190612 288
561 3300025901 Ga0207688_10004875 Ga0207688_100048753 288
562 3300025903 Ga0207680_10015416 Ga0207680_100154163 288
563 3300025903 Ga0207680_10079461 Ga0207680_100794612 288
564 3300025903 Ga0207680_10101587 Ga0207680_101015872 288
565 3300025904 Ga0207647_10000218 Ga0207647_1000021843 288
566 3300025904 Ga0207647_10006609 Ga0207647_100066098 288
567 3300025905 Ga0207685_10041604 Ga0207685_100416042 288
568 3300025906 Ga0207699_10005568 Ga0207699_100055683 288
569 3300025906 Ga0207699_10009762 Ga0207699_100097623 288
570 3300025906 Ga0207699_10142546 Ga0207699_101425462 288
571 3300025907 Ga0207645_10000247 Ga0207645_1000024723 288
572 3300025907 Ga0207645_10010970 Ga0207645_100109704 288
573 3300025908 Ga0207643_10000004 Ga0207643_10000004170 288
574 3300025908 Ga0207643_10002034 Ga0207643_1000203412 288
575 3300025909 Ga0207705_10005512 Ga0207705_100055125 288
576 3300025909 Ga0207705_10044014 Ga0207705_100440143 288
577 3300025911 Ga0207654_10000408 Ga0207654_1000040816 288
578 3300025912 Ga0207707_10000001 Ga0207707_10000001398 288
579 3300025912 Ga0207707_10000618 Ga0207707_100006188 288
580 3300025912 Ga0207707_10009349 Ga0207707_100093499 288
581 3300025912 Ga0207707_10017866 Ga0207707_100178662 288
582 3300025912 Ga0207707_10186483 Ga0207707_101864832 288
583 3300025912 Ga0207707_10420953 Ga0207707_104209532 288
584 3300025913 Ga0207695_10082620 Ga0207695_100826203 288
585 3300025913 Ga0207695_10352663 Ga0207695_103526632 288
586 3300025914 Ga0207671_10006046 Ga0207671_100060464 288
587 3300025914 Ga0207671_10051153 Ga0207671_100511532 288
588 3300025914 Ga0207671_10080443 Ga0207671_100804432 288
589 3300025914 Ga0207671_10193782 Ga0207671_101937822 288
590 3300025915 Ga0207693_10002426 Ga0207693_100024264 288
591 3300025915 Ga0207693_10037349 Ga0207693_100373492 288
592 3300025915 Ga0207693_10045822 Ga0207693_100458221 288
593 3300025915 Ga0207693_10162876 Ga0207693_101628762 288
594 3300025916 Ga0207663_10021216 Ga0207663_100212163 288
595 3300025916 Ga0207663_10028196 Ga0207663_100281961 288
596 3300025916 Ga0207663_10226734 Ga0207663_102267342 288
597 3300025917 Ga0207660_10000029 Ga0207660_1000002923 288
598 3300025917 Ga0207660_10000637 Ga0207660_100006376 288
599 3300025917 Ga0207660_10023942 Ga0207660_100239423 288
600 3300025917 Ga0207660_10033899 Ga0207660_100338993 288
601 3300025918 Ga0207662_10000119 Ga0207662_1000011930 288
602 3300025918 Ga0207662_10004685 Ga0207662_100046859 288
603 3300025918 Ga0207662_10012444 Ga0207662_100124443 288
604 3300025919 Ga0207657_10000316 Ga0207657_1000031628 288
605 3300025919 Ga0207657_10006914 Ga0207657_100069149 288
606 3300025919 Ga0207657_10029916 Ga0207657_100299164 288
607 3300025919 Ga0207657_10063030 Ga0207657_100630302 288
608 3300025920 Ga0207649_10000090 Ga0207649_1000009047 288
609 3300025921 Ga0207652_10000190 Ga0207652_1000019036 288
610 3300025921 Ga0207652_10010770 Ga0207652_100107702 288
611 3300025921 Ga0207652_10022911 Ga0207652_100229114 288
612 3300025921 Ga0207652_10077354 Ga0207652_100773542 288
613 3300025921 Ga0207652_10077669 Ga0207652_100776692 288
614 3300025923 Ga0207681_10000370 Ga0207681_1000037026 288
615 3300025923 Ga0207681_10035787 Ga0207681_100357873 288
616 3300025923 Ga0207681_10051828 Ga0207681_100518282 288
617 3300025924 Ga0207694_10096260 Ga0207694_100962603 288
618 3300025924 Ga0207694_10287683 Ga0207694_102876832 288
619 3300025925 Ga0207650_10015721 Ga0207650_100157212 288
620 3300025926 Ga0207659_10000038 Ga0207659_1000003825 288
621 3300025926 Ga0207659_10015533 Ga0207659_100155333 288
622 3300025927 Ga0207687_10000342 Ga0207687_1000034210 288
623 3300025927 Ga0207687_10043424 Ga0207687_100434242 288
624 3300025928 Ga0207700_10102516 Ga0207700_101025162 288
625 3300025928 Ga0207700_10123117 Ga0207700_101231172 288
626 3300025928 Ga0207700_10208060 Ga0207700_102080602 288
627 3300025929 Ga0207664_10091280 Ga0207664_100912802 288
628 3300025929 Ga0207664_10157677 Ga0207664_101576772 288
629 3300025931 Ga0207644_10000825 Ga0207644_1000082514 288
630 3300025931 Ga0207644_10012480 Ga0207644_100124804 288
631 3300025931 Ga0207644_10015448 Ga0207644_100154482 288
632 3300025932 Ga0207690_10000239 Ga0207690_100002398 288
633 3300025932 Ga0207690_10002494 Ga0207690_100024949 288
634 3300025932 Ga0207690_10031361 Ga0207690_100313613 288
635 3300025933 Ga0207706_10000424 Ga0207706_1000042422 288
636 3300025933 Ga0207706_10001779 Ga0207706_1000177911 288
637 3300025933 Ga0207706_10006933 Ga0207706_100069335 288
638 3300025934 Ga0207686_10001581 Ga0207686_100015816 288
639 3300025934 Ga0207686_10005903 Ga0207686_100059032 288
640 3300025935 Ga0207709_10000379 Ga0207709_1000037941 288
641 3300025935 Ga0207709_10134686 Ga0207709_101346862 288
642 3300025936 Ga0207670_10000176 Ga0207670_1000017617 288
643 3300025936 Ga0207670_10008695 Ga0207670_100086957 288
644 3300025937 Ga0207669_10000165 Ga0207669_1000016526 288
645 3300025937 Ga0207669_10005756 Ga0207669_100057562 288
646 3300025938 Ga0207704_10001293 Ga0207704_100012934 288
647 3300025938 Ga0207704_10010329 Ga0207704_100103294 288
648 3300025938 Ga0207704_10011009 Ga0207704_100110092 288
649 3300025938 Ga0207704_10119380 Ga0207704_101193802 288
650 3300025939 Ga0207665_10007116 Ga0207665_100071165 288
651 3300025940 Ga0207691_10000358 Ga0207691_1000035814 288
652 3300025941 Ga0207711_10000792 Ga0207711_1000079234 288
653 3300025941 Ga0207711_10182716 Ga0207711_101827161 288
654 3300025942 Ga0207689_10000479 Ga0207689_1000047931 288
655 3300025942 Ga0207689_10008563 Ga0207689_100085634 288
656 3300025944 Ga0207661_10001263 Ga0207661_100012638 288
657 3300025944 Ga0207661_10001389 Ga0207661_100013897 288
658 3300025944 Ga0207661_10057150 Ga0207661_100571503 288
659 3300025944 Ga0207661_10146024 Ga0207661_101460242 288
660 3300025945 Ga0207679_10000139 Ga0207679_1000013917 288
661 3300025945 Ga0207679_10014773 Ga0207679_100147732 288
662 3300025945 Ga0207679_10085372 Ga0207679_100853722 288
663 3300025949 Ga0207667_10003492 Ga0207667_1000349220 288
664 3300025949 Ga0207667_10071083 Ga0207667_100710833 288
665 3300025960 Ga0207651_10000072 Ga0207651_1000007239 288
666 3300025960 Ga0207651_10009633 Ga0207651_100096334 288
667 3300025961 Ga0207712_10001177 Ga0207712_100011776 288
668 3300025961 Ga0207712_10019946 Ga0207712_100199463 288
669 3300025961 Ga0207712_10260360 Ga0207712_102603602 288
670 3300025972 Ga0207668_10000168 Ga0207668_1000016841 288
671 3300025981 Ga0207640_10000242 Ga0207640_1000024213 288
672 3300025981 Ga0207640_10048598 Ga0207640_100485982 288
673 3300025986 Ga0207658_10000667 Ga0207658_1000066731 288
674 3300025986 Ga0207658_10079320 Ga0207658_100793202 288
675 3300026023 Ga0207677_10003733 Ga0207677_1000373310 288
676 3300026023 Ga0207677_10046548 Ga0207677_100465482 288
677 3300026035 Ga0207703_10000463 Ga0207703_1000046341 288
678 3300026035 Ga0207703_10026226 Ga0207703_100262264 288
679 3300026041 Ga0207639_10000745 Ga0207639_1000074517 288
680 3300026041 Ga0207639_10054106 Ga0207639_100541062 288
681 3300026067 Ga0207678_10000447 Ga0207678_1000044730 288
682 3300026067 Ga0207678_10004671 Ga0207678_100046714 288
683 3300026067 Ga0207678_10005453 Ga0207678_100054536 288
684 3300026067 Ga0207678_10005767 Ga0207678_100057679 288
685 3300026067 Ga0207678_10027584 Ga0207678_100275842 288
686 3300026075 Ga0207708_10000293 Ga0207708_1000029313 288
687 3300026075 Ga0207708_10001428 Ga0207708_1000142812 288
688 3300026075 Ga0207708_10003697 Ga0207708_100036972 288
689 3300026075 Ga0207708_10094413 Ga0207708_100944132 288
690 3300026078 Ga0207702_10001723 Ga0207702_1000172314 288
691 3300026088 Ga0207641_10000724 Ga0207641_100007248 288
692 3300026088 Ga0207641_10017293 Ga0207641_100172934 288
693 3300026089 Ga0207648_10000223 Ga0207648_1000022347 288
694 3300026089 Ga0207648_10010764 Ga0207648_100107643 288
695 3300026089 Ga0207648_10011893 Ga0207648_100118936 288
696 3300026089 Ga0207648_10474558 Ga0207648_104745582 288
697 3300026095 Ga0207676_10000392 Ga0207676_1000039228 288
698 3300026095 Ga0207676_10010604 Ga0207676_100106044 288
699 3300026095 Ga0207676_10357479 Ga0207676_103574792 288
700 3300026116 Ga0207674_10000955 Ga0207674_1000095531 288
701 3300026116 Ga0207674_10051516 Ga0207674_100515163 288
702 3300026116 Ga0207674_10060640 Ga0207674_100606402 288
703 3300026118 Ga0207675_100000364 Ga0207675_10000036439 288
704 3300026118 Ga0207675_100001777 Ga0207675_10000177720 288
705 3300026118 Ga0207675_100002590 Ga0207675_1000025904 288
706 3300026118 Ga0207675_100005082 Ga0207675_1000050824 288
707 3300026121 Ga0207683_10000397 Ga0207683_1000039714 288
708 3300026121 Ga0207683_10003810 Ga0207683_100038106 288
709 3300026121 Ga0207683_10010729 Ga0207683_100107295 288
710 3300026142 Ga0207698_10000818 Ga0207698_1000081812 288
711 3300026142 Ga0207698_10005989 Ga0207698_100059893 288
712 3300026142 Ga0207698_10101211 Ga0207698_101012113 288
713 3300027296 Ga0209389_1000012 Ga0209389_1000012173 288
714 3300027361 Ga0209489_100019 Ga0209489_100019173 288
715 3300027363 Ga0209700_100018 Ga0209700_100018192 288
716 3300027671 Ga0209588_1001156 Ga0209588_10011565 288
717 3300027717 Ga0209998_10000687 Ga0209998_100006873 288
718 3300027717 Ga0209998_10002273 Ga0209998_100022733 288
719 3300027866 Ga0209813_10005075 Ga0209813_100050753 288
720 3300027866 Ga0209813_10022115 Ga0209813_100221152 288
721 3300027876 Ga0209974_10000890 Ga0209974_100008902 288
722 3300027876 Ga0209974_10022678 Ga0209974_100226782 288
723 3300027907 Ga0207428_10000439 Ga0207428_1000043931 288
724 3300027907 Ga0207428_10000617 Ga0207428_1000061731 288
725 3300028379 Ga0268266_10023640 Ga0268266_100236402 288
726 3300028379 Ga0268266_10042367 Ga0268266_100423674 288
727 3300028379 Ga0268266_10206615 Ga0268266_102066152 288
728 3300028380 Ga0268265_10001307 Ga0268265_1000130717 288
729 3300028380 Ga0268265_10004440 Ga0268265_100044408 288
730 3300028380 Ga0268265_10008357 Ga0268265_100083578 288
731 3300028380 Ga0268265_10036896 Ga0268265_100368962 288
732 3300028381 Ga0268264_10003260 Ga0268264_100032605 288
733 3300028381 Ga0268264_10022151 Ga0268264_100221513 288
734 3300028381 Ga0268264_10031810 Ga0268264_100318102 288
735 3300028381 Ga0268264_10121445 Ga0268264_101214452 288
736 3300028381 Ga0268264_10180258 Ga0268264_101802582 288
737 3300028800 Ga0265338_10038980 Ga0265338_100389805 288
738 3300031090 Ga0265760_10048313 Ga0265760_100483132 288
739 3300031241 Ga0265325_10000043 Ga0265325_1000004323 288
740 3300031241 Ga0265325_10008854 Ga0265325_100088545 288
741 3300031241 Ga0265325_10026580 Ga0265325_100265803 288
742 3300031247 Ga0265340_10006812 Ga0265340_100068123 288
743 3300031247 Ga0265340_10013225 Ga0265340_100132253 288
744 3300031249 Ga0265339_10009370 Ga0265339_100093703 288
745 3300031249 Ga0265339_10014659 Ga0265339_100146594 288
746 3300031249 Ga0265339_10107879 Ga0265339_101078792 288
747 3300031251 Ga0265327_10000070 Ga0265327_10000070149 288
748 3300031344 Ga0265316_10050529 Ga0265316_100505292 288
749 3300031344 Ga0265316_10317540 Ga0265316_103175401 288
750 3300031456 Ga0307513_10112561 Ga0307513_101125613 288
751 3300031595 Ga0265313_10000269 Ga0265313_1000026921 288
752 3300031595 Ga0265313_10001300 Ga0265313_1000130022 288
753 3300031595 Ga0265313_10017513 Ga0265313_100175133 288
754 3300031595 Ga0265313_10077352 Ga0265313_100773522 288
755 3300031711 Ga0265314_10000708 Ga0265314_1000070824 288
756 3300031711 Ga0265314_10061525 Ga0265314_100615253 288
757 3300031712 Ga0265342_10001200 Ga0265342_1000120020 288
758 3300031712 Ga0265342_10033550 Ga0265342_100335502 288
759 3300031731 Ga0307405_10010582 Ga0307405_100105823 288
760 3300031852 Ga0307410_10060157 Ga0307410_100601572 288
761 3300031901 Ga0307406_10004455 Ga0307406_100044553 288
762 3300031911 Ga0307412_10016996 Ga0307412_100169962 288
763 3300031995 Ga0307409_100001101 Ga0307409_1000011013 288
764 3300032002 Ga0307416_100001022 Ga0307416_10000102210 288
765 3300032002 Ga0307416_100726163 Ga0307416_1007261632 288
766 3300032005 Ga0307411_10091234 Ga0307411_100912343 288
767 3300032133 Ga0316583_10000233 Ga0316583_100002334 288
768 3300034816 Ga0373930_0000008 Ga0373930_0000008_12424_13380 288
769 3300034817 Ga0373948_0001178 Ga0373948_0001178_36_992 288
770 3300034818 Ga0373950_0004994 Ga0373950_0004994_526_1482 288
771 3300034819 Ga0373958_0001331 Ga0373958_0001331_937_1893 288
772 3300034819 Ga0373958_0002083 Ga0373958_0002083_756_1712 288
773 3300034820 Ga0373959_0000708 Ga0373959_0000708_2460_3416 288
774 3300034957 Ga0373938_0000434 Ga0373938_0000434_4523_5479 288
775 3300034957 Ga0373938_0000881 Ga0373938_0000881_1521_2477 288
776 3300035084 Ga0373928_0000087 Ga0373928_0000087_4330_5286 288
777 3300035084 Ga0373928_0001439 Ga0373928_0001439_1361_2317 288
778 3300035085 Ga0373929_0000288 Ga0373929_0000288_6557_7513 288
779 3300035085 Ga0373929_0001454 Ga0373929_0001454_2680_3636 288
780 3300035086 Ga0373934_0017655 Ga0373934_0017655_1106_2062 288
781 3300035088 Ga0373940_0004036 Ga0373940_0004036_679_1635 288
782 3300035088 Ga0373940_0004893 Ga0373940_0004893_394_1350 288
783 3300035090 Ga0373949_0001082 Ga0373949_0001082_5886_6842 288
784 3300035090 Ga0373949_0004172 Ga0373949_0004172_1713_2669 288
785 3300035091 Ga0373951_0000363 Ga0373951_0000363_8429_9385 288
786 3300035091 Ga0373951_0006215 Ga0373951_0006215_705_1661 288
787 3300035092 Ga0373952_0000458 Ga0373952_0000458_1201_2157 288
788 3300035092 Ga0373952_0000576 Ga0373952_0000576_3096_4052 288
789 3300035111 Ga0373923_0004706 Ga0373923_0004706_1678_2634 288
790 3300035111 Ga0373923_0015311 Ga0373923_0015311_794_1744 288
791 3300035112 Ga0373932_0000239 Ga0373932_0000239_6534_7490 288
792 3300035112 Ga0373932_0000588 Ga0373932_0000588_9560_10516 288
793 3300035113 Ga0373936_0000885 Ga0373936_0000885_8402_9358 288
794 3300035114 Ga0373939_0000850 Ga0373939_0000850_4391_5347 288
795 3300035114 Ga0373939_0001037 Ga0373939_0001037_143_1099 288
796 3300035114 Ga0373939_0015567 Ga0373939_0015567_808_1764 288
797 3300035114 Ga0373939_0026765 Ga0373939_0026765_54_1010 288
798 3300035115 Ga0373941_0000224 Ga0373941_0000224_5764_6720 288
799 3300035115 Ga0373941_0003233 Ga0373941_0003233_963_1919 288
800 3300035117 Ga0373953_0012222 Ga0373953_0012222_213_1163 288
801 3300035117 Ga0373953_0051874 Ga0373953_0051874_676_1632 288
802 3300035118 Ga0373954_0006125 Ga0373954_0006125_573_1529 288
803 3300035118 Ga0373954_0092870 Ga0373954_0092870_130_1086 288
804 3300035119 Ga0373956_0002570 Ga0373956_0002570_1270_2220 288
805 3300035119 Ga0373956_0014922 Ga0373956_0014922_100_1056 288
806 3300035120 Ga0373957_0000794 Ga0373957_0000794_3191_4147 288
807 3300035120 Ga0373957_0058417 Ga0373957_0058417_20_937 288
808 3300035121 Ga0373960_0000332 Ga0373960_0000332_4405_5361 288
809 3300035121 Ga0373960_0000746 Ga0373960_0000746_164_1120 288
810 3300035170 Ga0373943_0003854 Ga0373943_0003854_2631_3578 288
811 3300035172 Ga0373955_0000742 Ga0373955_0000742_3322_4278 288
812 3300035172 Ga0373955_0024367 Ga0373955_0024367_1642_2598 288
813 3300035207 Ga0373942_0001505 Ga0373942_0001505_4267_5223 288
814 3300035207 Ga0373942_0003587 Ga0373942_0003587_2553_3509 288
815 3300035207 Ga0373942_0006955 Ga0373942_0006955_827_1783 288
816 3300035241 Ga0373961_0008690 Ga0373961_0008690_1339_2295 288
817 3300035241 Ga0373961_0015663 Ga0373961_0015663_799_1755 288
818 3300035242 Ga0373962_0009042 Ga0373962_0009042_687_1643 288
819 3300035398 Ga0316574_0022902 Ga0316574_0022902_459_1406 288
820 3300035691 Ga0373931_0000089 Ga0373931_0000089_6043_6999 288
821 3300035691 Ga0373931_0008141 Ga0373931_0008141_2639_3595 288
822 3300035691 Ga0373931_0257657 Ga0373931_0257657_86_1042 288
823 3300035692 Ga0373935_0028731 Ga0373935_0028731_493_1449 288
824 3300035692 Ga0373935_0107304 Ga0373935_0107304_550_1506 288
825 3300035695 Ga0373927_0029040 Ga0373927_0029040_654_1601 288
826 3300035695 Ga0373927_0059833 Ga0373927_0059833_412_1362 288
827 3300035724 Ga0373933_0008278 Ga0373933_0008278_1458_2414 288
828 3300035724 Ga0373933_0158036 Ga0373933_0158036_10_927 288
829 3300035725 Ga0373947_0026284 Ga0373947_0026284_2073_3029 288
830 3300035725 Ga0373947_0029462 Ga0373947_0029462_240_1196 288
831 3300035725 Ga0373947_0034198 Ga0373947_0034198_50_1006 288
832 3300035725 Ga0373947_0091172 Ga0373947_0091172_531_1481 288
833 3300036401 Ga0373937_0001701 Ga0373937_0001701_16267_17223 288
834 3300036401 Ga0373937_0012221 Ga0373937_0012221_2535_3491 288
835 3300036401 Ga0373937_0077266 Ga0373937_0077266_227_1177 288
836 3300036401 Ga0373937_0373666 Ga0373937_0373666_20_982 288
837 3300037068 Ga0373925_0262653 Ga0373925_0262653_17_973 288
838 3300039437 Ga0436365_0677631 Ga0436365_0677631_70_1026 288
839 3300039447 Ga0436361_0740814 Ga0436361_0740814_2480_3430 288
840 3300039447 Ga0436361_1002425 Ga0436361_1002425_1199_2155 288
841 3300039447 Ga0436361_1023583 Ga0436361_1023583_1444_2400 288
842 3300039453 Ga0436362_0138375 Ga0436362_0138375_905_1861 288
843 3300042001 Ga0439441_023442 Ga0439441_023442_95_1051 288
844 3300042003 Ga0439443_000561 Ga0439443_000561_2275_3231 288
845 3300042008 Ga0439450_026201 Ga0439450_026201_145_1101 288
846 3300042122 Ga0450920_004614 Ga0450920_004614_1029_1985 288
847 3300042125 Ga0450923_000696 Ga0450923_000696_825_1781 288
848 3300042134 Ga0450898_003595 Ga0450898_003595_430_1386 288
849 3300042145 Ga0450906_016085 Ga0450906_016085_379_1335 288
850 3300042156 Ga0439446_0002955 Ga0439446_0002955_723_1679 288
851 3300042435 Ga0439434_0003139 Ga0439434_0003139_2837_3793 288
852 3300042436 Ga0439435_0000874 Ga0439435_0000874_323_1279 288
853 3300042437 Ga0439444_0000136 Ga0439444_0000136_846_1802 288
854 3300042439 Ga0439464_0023204 Ga0439464_0023204_519_1475 288
855 3300042461 Ga0439460_0062529 Ga0439460_0062529_145_1101 288
856 3300044656 Ga0466969_0018218 Ga0466969_0018218_2529_3485 288
857 3300044693 Ga0466961_0000138 Ga0466961_0000138_12073_13029 288
858 3300044712 Ga0453684_0643545 Ga0453684_0643545_82_1038 288
859 3300045049 Ga0466959_0009348 Ga0466959_0009348_4219_5175 288
860 3300045051 Ga0451576_0018820 Ga0451576_0018820_5067_6023 288
861 3300045976 Ga0466967_0157916 Ga0466967_0157916_38_994 288
862 3300046455 Ga0495603_0000415 Ga0495603_0000415_14915_15871 288
863 3300046455 Ga0495603_0055870 Ga0495603_0055870_419_1375 288
864 3300046459 Ga0495629_0020344 Ga0495629_0020344_3222_4178 288
865 3300046459 Ga0495629_0030036 Ga0495629_0030036_543_1490 288
866 3300046460 Ga0495638_0054591 Ga0495638_0054591_150_1106 288
867 3300046461 Ga0495641_0015052 Ga0495641_0015052_74_1030 288
868 3300046462 Ga0495651_0014089 Ga0495651_0014089_4783_5739 288
869 3300046462 Ga0495651_0019331 Ga0495651_0019331_1122_2072 288
870 3300046463 Ga0495653_0007085 Ga0495653_0007085_6484_7440 288
871 3300046463 Ga0495653_0025322 Ga0495653_0025322_2270_3226 288
872 3300046463 Ga0495653_0066304 Ga0495653_0066304_713_1663 288
873 3300046472 Ga0495580_0000784 Ga0495580_0000784_13460_14416 288
874 3300046472 Ga0495580_0066944 Ga0495580_0066944_1033_1989 288
875 3300046472 Ga0495580_0265138 Ga0495580_0265138_79_1029 288
876 3300046473 Ga0495582_0004166 Ga0495582_0004166_4665_5621 288
877 3300046473 Ga0495582_0260863 Ga0495582_0260863_16_933 288
878 3300046475 Ga0495639_0001444 Ga0495639_0001444_7049_8005 288
879 3300046476 Ga0495662_0022760 Ga0495662_0022760_573_1529 288
880 3300046477 Ga0495664_0003541 Ga0495664_0003541_4067_5014 288
881 3300046477 Ga0495664_0014840 Ga0495664_0014840_1199_2149 288
882 3300046491 Ga0495584_0054169 Ga0495584_0054169_434_1390 288
883 3300046499 Ga0495594_0000288 Ga0495594_0000288_10265_11221 288
884 3300046500 Ga0495596_0035124 Ga0495596_0035124_808_1764 288
885 3300046511 Ga0495608_0004655 Ga0495608_0004655_6139_7089 288
886 3300046514 Ga0495618_0008530 Ga0495618_0008530_3809_4756 288
887 3300046514 Ga0495618_0008714 Ga0495618_0008714_1312_2268 288
888 3300046516 Ga0495628_0015272 Ga0495628_0015272_3489_4439 288
889 3300046517 Ga0495630_0019770 Ga0495630_0019770_2537_3493 288
890 3300046517 Ga0495630_0084340 Ga0495630_0084340_842_1789 288
891 3300046520 Ga0495637_0046579 Ga0495637_0046579_17_973 288
892 3300046529 Ga0495652_0002132 Ga0495652_0002132_505_1455 288
893 3300046529 Ga0495652_0026899 Ga0495652_0026899_3291_4238 288
894 3300046533 Ga0495640_0013819 Ga0495640_0013819_4819_5775 288
895 3300046533 Ga0495640_0023194 Ga0495640_0023194_2807_3763 288
896 3300046535 Ga0495586_0041279 Ga0495586_0041279_583_1539 288
897 3300046536 Ga0495587_0001771 Ga0495587_0001771_859_1815 288
898 3300046536 Ga0495587_0047896 Ga0495587_0047896_147_1097 288
899 3300046536 Ga0495587_0052199 Ga0495587_0052199_103_1059 288
900 3300046537 Ga0495598_0064414 Ga0495598_0064414_118_1074 288
901 3300046543 Ga0495645_0007720 Ga0495645_0007720_4166_5116 288
902 3300046557 Ga0495622_0059771 Ga0495622_0059771_630_1586 288
903 3300046559 Ga0495667_0008577 Ga0495667_0008577_2722_3678 288
904 3300046559 Ga0495667_0009171 Ga0495667_0009171_2349_3299 288
905 3300046559 Ga0495667_0013545 Ga0495667_0013545_2323_3279 288
906 3300046616 Ga0495668_0011373 Ga0495668_0011373_3492_4448 288
907 3300046616 Ga0495668_0015058 Ga0495668_0015058_1364_2320 288
908 3300046642 Ga0495634_0013833 Ga0495634_0013833_2021_2977 288
909 3300046642 Ga0495634_0035879 Ga0495634_0035879_648_1604 288
910 3300046663 Ga0495635_0001121 Ga0495635_0001121_13203_14159 288
911 3300046663 Ga0495635_0056869 Ga0495635_0056869_73_1023 288
912 3300046663 Ga0495635_0061392 Ga0495635_0061392_1518_2474 288
913 3300046674 Ga0495588_0001822 Ga0495588_0001822_3639_4595 288
914 3300046675 Ga0495657_0037813 Ga0495657_0037813_2045_2995 288
915 3300046675 Ga0495657_0051163 Ga0495657_0051163_492_1448 288
916 3300046675 Ga0495657_0056007 Ga0495657_0056007_472_1428 288
917 3300046678 Ga0495599_0074444 Ga0495599_0074444_974_1924 288
918 3300046679 Ga0495623_0000055 Ga0495623_0000055_48549_49505 288
919 3300046679 Ga0495623_0006302 Ga0495623_0006302_3084_4034 288
920 3300046680 Ga0495646_0006354 Ga0495646_0006354_2513_3469 288
921 3300046681 Ga0495647_0005365 Ga0495647_0005365_1315_2262 288
922 3300046681 Ga0495647_0054777 Ga0495647_0054777_15_971 288
923 3300046683 Ga0495658_0004925 Ga0495658_0004925_3820_4776 288
924 3300046683 Ga0495658_0045105 Ga0495658_0045105_500_1456 288
925 3300046684 Ga0495669_0043811 Ga0495669_0043811_54_1004 288
926 3300046684 Ga0495669_0062693 Ga0495669_0062693_409_1365 288
927 3300046684 Ga0495669_0111800 Ga0495669_0111800_284_1240 288
928 3300046689 Ga0495613_0001672 Ga0495613_0001672_4243_5199 288
929 3300046692 Ga0495671_0200359 Ga0495671_0200359_29_946 288
930 3300046694 Ga0495649_0069278 Ga0495649_0069278_355_1311 288
931 3300046809 Ga0495600_0019135 Ga0495600_0019135_1033_1989 288
932 3300046809 Ga0495600_0154296 Ga0495600_0154296_417_1373 288
933 3300047317 Ga0495604_0037784 Ga0495604_0037784_2292_3242 288
934 3300047319 Ga0495674_0010267 Ga0495674_0010267_7268_8224 288
935 3300047319 Ga0495674_0010269 Ga0495674_0010269_2411_3358 288
936 3300047319 Ga0495674_0016713 Ga0495674_0016713_4658_5614 288
937 3300047321 Ga0495676_0078332 Ga0495676_0078332_868_1824 288
938 3300047322 Ga0495680_0001836 Ga0495680_0001836_1511_2467 288
939 3300047322 Ga0495680_0015898 Ga0495680_0015898_3120_4070 288
940 3300047444 Ga0495675_0022095 Ga0495675_0022095_2687_3637 288
941 3300047471 Ga0495684_0009509 Ga0495684_0009509_3729_4685 288
942 3300047471 Ga0495684_0152417 Ga0495684_0152417_453_1403 288
943 3300047673 Ga0495593_0001141 Ga0495593_0001141_11934_12890 288
944 3300047673 Ga0495593_0011395 Ga0495593_0011395_3526_4482 288
945 3300048088 Ga0495602_0007511 Ga0495602_0007511_6636_7586 288
946 3300048088 Ga0495602_0012226 Ga0495602_0012226_7693_8649 288
947 3300048089 Ga0495614_0020350 Ga0495614_0020350_745_1701 288
948 3300048089 Ga0495614_0098525 Ga0495614_0098525_207_1154 288
949 3300048903 Ga0496100_0000200 Ga0496100_0000200_5102_6058 288
950 3300048903 Ga0496100_0013332 Ga0496100_0013332_1546_2502 288
951 3300048903 Ga0496100_0025238 Ga0496100_0025238_1026_1982 288
952 3300048903 Ga0496100_0075923 Ga0496100_0075923_786_1742 288
953 3300048903 Ga0496100_0108676 Ga0496100_0108676_217_1173 288
954 3300048904 Ga0496101_0000339 Ga0496101_0000339_21538_22494 288
955 3300048904 Ga0496101_0051165 Ga0496101_0051165_968_1918 288
956 3300048904 Ga0496101_0122835 Ga0496101_0122835_930_1886 288
957 3300048905 Ga0496102_0000729 Ga0496102_0000729_11059_12015 288
958 3300048905 Ga0496102_0030139 Ga0496102_0030139_3136_4092 288
959 3300048905 Ga0496102_0033365 Ga0496102_0033365_3179_4135 288
960 3300048905 Ga0496102_0219837 Ga0496102_0219837_26_982 288
961 3300048905 Ga0496102_0299934 Ga0496102_0299934_41_997 288
962 3300048906 Ga0496103_0001522 Ga0496103_0001522_7471_8427 288
963 3300048906 Ga0496103_0010791 Ga0496103_0010791_2019_2975 288
964 3300048906 Ga0496103_0025697 Ga0496103_0025697_1605_2561 288
965 3300048907 Ga0496104_0000903 Ga0496104_0000903_4332_5282 288
966 3300048907 Ga0496104_0003346 Ga0496104_0003346_9737_10687 288
967 3300048907 Ga0496104_0004368 Ga0496104_0004368_6744_7700 288
968 3300048907 Ga0496104_0016056 Ga0496104_0016056_3237_4193 288
969 3300048907 Ga0496104_0033068 Ga0496104_0033068_1154_2110 288
970 3300048907 Ga0496104_0096038 Ga0496104_0096038_1137_2093 288
971 3300048907 Ga0496104_0256901 Ga0496104_0256901_276_1232 288
972 3300048907 Ga0496104_0301658 Ga0496104_0301658_81_1037 288
973 3300048908 Ga0496105_0000246 Ga0496105_0000246_11261_12211 288
974 3300048908 Ga0496105_0003097 Ga0496105_0003097_4328_5284 288
975 3300048908 Ga0496105_0008077 Ga0496105_0008077_2811_3767 288
976 3300048908 Ga0496105_0050267 Ga0496105_0050267_2432_3388 288
977 3300048908 Ga0496105_0051291 Ga0496105_0051291_2473_3390 288
978 3300048908 Ga0496105_0173568 Ga0496105_0173568_737_1693 288
979 3300048908 Ga0496105_0296251 Ga0496105_0296251_300_1256 288
980 3300048909 Ga0496106_0000202 Ga0496106_0000202_34821_35777 288
981 3300048909 Ga0496106_0008382 Ga0496106_0008382_6548_7504 288
982 3300048909 Ga0496106_0013666 Ga0496106_0013666_2462_3418 288
983 3300048909 Ga0496106_0026406 Ga0496106_0026406_1204_2154 288
984 3300048909 Ga0496106_0028487 Ga0496106_0028487_2396_3352 288
985 3300048909 Ga0496106_0044542 Ga0496106_0044542_1791_2747 288
986 3300048910 Ga0496107_0000066 Ga0496107_0000066_30314_31270 288
987 3300048910 Ga0496107_0001145 Ga0496107_0001145_12624_13580 288
988 3300048910 Ga0496107_0003363 Ga0496107_0003363_8823_9779 288
989 3300048910 Ga0496107_0008683 Ga0496107_0008683_1530_2486 288
990 3300048910 Ga0496107_0093329 Ga0496107_0093329_293_1249 288
991 3300048910 Ga0496107_0125460 Ga0496107_0125460_136_1092 288
992 3300048911 Ga0496108_0002149 Ga0496108_0002149_4219_5175 288
993 3300048911 Ga0496108_0003262 Ga0496108_0003262_1094_2050 288
994 3300048911 Ga0496108_0021443 Ga0496108_0021443_1778_2734 288
995 3300048911 Ga0496108_0049775 Ga0496108_0049775_746_1696 288
996 3300048911 Ga0496108_0071579 Ga0496108_0071579_1891_2847 288
997 3300048911 Ga0496108_0151779 Ga0496108_0151779_864_1820 288
998 3300048912 Ga0496109_0000595 Ga0496109_0000595_4129_5085 288
999 3300048912 Ga0496109_0004441 Ga0496109_0004441_1650_2606 288
1000 3300048912 Ga0496109_0016322 Ga0496109_0016322_4201_5157 288
1001 3300048912 Ga0496109_0037214 Ga0496109_0037214_697_1653 288
1002 3300048913 Ga0496110_0009554 Ga0496110_0009554_2499_3455 288
1003 3300048913 Ga0496110_0023133 Ga0496110_0023133_456_1412 288
1004 3300048913 Ga0496110_0028722 Ga0496110_0028722_3312_4268 288
1005 3300048914 Ga0496111_0001165 Ga0496111_0001165_7800_8756 288
1006 3300048914 Ga0496111_0002426 Ga0496111_0002426_6376_7332 288
1007 3300048914 Ga0496111_0224273 Ga0496111_0224273_417_1373 288
1008 3300048915 Ga0496112_0003171 Ga0496112_0003171_3186_4142 288
1009 3300048915 Ga0496112_0037794 Ga0496112_0037794_2554_3510 288
1010 3300048916 Ga0496113_0001173 Ga0496113_0001173_3720_4676 288
1011 3300048916 Ga0496113_0001893 Ga0496113_0001893_3748_4704 288
1012 3300048916 Ga0496113_0023186 Ga0496113_0023186_1831_2787 288
1013 3300048916 Ga0496113_0028364 Ga0496113_0028364_908_1864 288
1014 3300048916 Ga0496113_0046176 Ga0496113_0046176_1825_2781 288
1015 3300048916 Ga0496113_0127502 Ga0496113_0127502_818_1774 288
1016 3300048917 Ga0496114_0004800 Ga0496114_0004800_4947_5903 288
1017 3300048917 Ga0496114_0245387 Ga0496114_0245387_472_1428 288
1018 3300048918 Ga0496115_0005426 Ga0496115_0005426_4589_5539 288
1019 3300048918 Ga0496115_0006200 Ga0496115_0006200_2637_3593 288
1020 3300049568 Ga0501031_0059602 Ga0501031_0059602_1042_1992 288
1021 3300049569 Ga0501032_0124188 Ga0501032_0124188_585_1541 288
1022 3300049570 Ga0501033_0125578 Ga0501033_0125578_337_1293 288
1023 3300049570 Ga0501033_0296836 Ga0501033_0296836_38_988 288
1024 3300049571 Ga0501034_0027442 Ga0501034_0027442_1376_2332 288
1025 3300049571 Ga0501034_0039803 Ga0501034_0039803_2293_3249 288
1026 3300049571 Ga0501034_0094303 Ga0501034_0094303_1614_2570 288
1027 3300049571 Ga0501034_0195413 Ga0501034_0195413_844_1800 288
1028 3300049571 Ga0501034_0300725 Ga0501034_0300725_147_1103 288
1029 3300049572 Ga0501036_0002481 Ga0501036_0002481_8841_9791 288
1030 3300049572 Ga0501036_0163069 Ga0501036_0163069_17_967 288
1031 3300049572 Ga0501036_0421305 Ga0501036_0421305_18_974 288
1032 3300049573 Ga0501037_0023005 Ga0501037_0023005_1554_2504 288
1033 3300049573 Ga0501037_0057904 Ga0501037_0057904_424_1380 288
1034 3300049574 Ga0501038_0011597 Ga0501038_0011597_6371_7321 288
1035 3300049574 Ga0501038_0069081 Ga0501038_0069081_1615_2565 288
1036 3300049574 Ga0501038_0086625 Ga0501038_0086625_385_1341 288
1037 3300049574 Ga0501038_0164254 Ga0501038_0164254_804_1760 288
1038 3300049574 Ga0501038_0183510 Ga0501038_0183510_413_1363 288
1039 3300049574 Ga0501038_0193860 Ga0501038_0193860_178_1128 288
1040 3300049575 Ga0501039_0039106 Ga0501039_0039106_477_1433 288
1041 3300049575 Ga0501039_0136582 Ga0501039_0136582_517_1467 288
1042 3300049575 Ga0501039_0170263 Ga0501039_0170263_299_1255 288
1043 3300049576 Ga0501040_0006653 Ga0501040_0006653_6221_7171 288
1044 3300049576 Ga0501040_0213065 Ga0501040_0213065_16_933 288
1045 3300049577 Ga0501041_0032605 Ga0501041_0032605_1191_2141 288
1046 3300049577 Ga0501041_0231903 Ga0501041_0231903_95_1045 288
1047 3300049578 Ga0501042_0174775 Ga0501042_0174775_484_1440 288
1048 3300049578 Ga0501042_0229747 Ga0501042_0229747_163_1119 288
1049 3300049579 Ga0501043_0043922 Ga0501043_0043922_1666_2622 288
1050 3300049579 Ga0501043_0080598 Ga0501043_0080598_693_1643 288
1051 3300049580 Ga0501046_0019015 Ga0501046_0019015_2739_3689 288
1052 3300049580 Ga0501046_0025386 Ga0501046_0025386_2508_3464 288
1053 3300049580 Ga0501046_0110135 Ga0501046_0110135_1070_2020 288
1054 3300049580 Ga0501046_0155019 Ga0501046_0155019_343_1299 288
1055 3300049580 Ga0501046_0168182 Ga0501046_0168182_79_1035 288
1056 3300049581 Ga0501047_0016677 Ga0501047_0016677_859_1815 288
1057 3300049581 Ga0501047_0017879 Ga0501047_0017879_1302_2258 288
1058 3300049581 Ga0501047_0051181 Ga0501047_0051181_1424_2374 288
1059 3300049581 Ga0501047_0089977 Ga0501047_0089977_752_1708 288
1060 3300049582 Ga0501048_0208082 Ga0501048_0208082_316_1266 288
1061 3300049585 Ga0501069_0060890 Ga0501069_0060890_948_1898 288
1062 3300049586 Ga0501070_0021833 Ga0501070_0021833_1536_2492 288
1063 3300049586 Ga0501070_0022581 Ga0501070_0022581_775_1731 288
1064 3300049587 Ga0501071_0108401 Ga0501071_0108401_588_1538 288
1065 3300049588 Ga0501072_0065633 Ga0501072_0065633_586_1536 288
1066 3300049588 Ga0501072_0095047 Ga0501072_0095047_342_1298 288
1067 3300049589 Ga0501073_0014409 Ga0501073_0014409_527_1483 288
1068 3300049589 Ga0501073_0019034 Ga0501073_0019034_2139_3095 288
1069 3300049589 Ga0501073_0054973 Ga0501073_0054973_1046_2002 288
1070 3300049589 Ga0501073_0126900 Ga0501073_0126900_526_1476 288
1071 3300049589 Ga0501073_0221001 Ga0501073_0221001_10_960 288
1072 3300049590 Ga0501074_0027303 Ga0501074_0027303_964_1920 288
1073 3300049590 Ga0501074_0033383 Ga0501074_0033383_2166_3122 288
1074 3300049591 Ga0501075_0099841 Ga0501075_0099841_662_1612 288
1075 3300049591 Ga0501075_0127620 Ga0501075_0127620_423_1379 288
1076 3300049591 Ga0501075_0137648 Ga0501075_0137648_754_1704 288
1077 3300049592 Ga0501076_0016060 Ga0501076_0016060_3773_4729 288
1078 3300049592 Ga0501076_0101972 Ga0501076_0101972_354_1304 288
1079 3300049592 Ga0501076_0311601 Ga0501076_0311601_51_968 288
1080 3300049593 Ga0501077_0003968 Ga0501077_0003968_826_1782 288
1081 3300049593 Ga0501077_0008803 Ga0501077_0008803_4597_5547 288
1082 3300049593 Ga0501077_0012998 Ga0501077_0012998_4239_5189 288
1083 3300049593 Ga0501077_0062634 Ga0501077_0062634_597_1553 288
1084 3300049705 Ga0501225_0055016 Ga0501225_0055016_144_1094 288
1085 3300049741 Ga0501079_0046758 Ga0501079_0046758_930_1886 288
1086 3300049741 Ga0501079_0049659 Ga0501079_0049659_1164_2114 288
1087 3300049741 Ga0501079_0150398 Ga0501079_0150398_726_1676 288
1088 3300049741 Ga0501079_0198713 Ga0501079_0198713_245_1201 288
1089 3300049742 Ga0501080_0007750 Ga0501080_0007750_4090_5046 288
1090 3300049742 Ga0501080_0016625 Ga0501080_0016625_2754_3710 288
1091 3300049742 Ga0501080_0442164 Ga0501080_0442164_162_1112 288
1092 3300049743 Ga0501081_0266432 Ga0501081_0266432_258_1208 288
1093 3300049744 Ga0501083_0000450 Ga0501083_0000450_8069_9028 288
1094 3300049822 Ga0501035_0040480 Ga0501035_0040480_909_1859 288
1095 3300049822 Ga0501035_0050506 Ga0501035_0050506_315_1271 288
1096 3300049823 Ga0501044_0000212 Ga0501044_0000212_50729_51685 288
1097 3300049823 Ga0501044_0016862 Ga0501044_0016862_4340_5296 288
1098 3300049823 Ga0501044_0045666 Ga0501044_0045666_2108_3064 288
1099 3300049823 Ga0501044_0074734 Ga0501044_0074734_1120_2076 288
1100 3300049823 Ga0501044_0196147 Ga0501044_0196147_450_1406 288
1101 3300049824 Ga0501045_0039471 Ga0501045_0039471_898_1848 288
1102 3300050491 nmdc:mga00v17_27414_c1 nmdc:mga00v17_27414_c1_1178_2134 288
1103 3300050492 nmdc:mga0yw44_6715_c1 nmdc:mga0yw44_6715_c1_3917_4873 288
1104 3300050494 nmdc:mga06z11_10761_c1 nmdc:mga06z11_10761_c1_2391_3347 288
1105 3300050494 nmdc:mga06z11_19093_c1 nmdc:mga06z11_19093_c1_1279_2235 288
1106 3300050494 nmdc:mga06z11_34462_c1 nmdc:mga06z11_34462_c1_1415_2371 288
1107 3300050495 nmdc:mga04h51_13437_c1 nmdc:mga04h51_13437_c1_339_1295 288
1108 3300050495 nmdc:mga04h51_27419_c1 nmdc:mga04h51_27419_c1_26_982 288
1109 3300050495 nmdc:mga04h51_9859_c1 nmdc:mga04h51_9859_c1_210_1166 288
1110 3300050496 nmdc:mga07m45_146771_c1 nmdc:mga07m45_146771_c1_315_1271 288
1111 3300050496 nmdc:mga07m45_3083_c1 nmdc:mga07m45_3083_c1_3427_4383 288
1112 3300050507 nmdc:mga05p37_137815_c1 nmdc:mga05p37_137815_c1_1085_2041 288
1113 3300050507 nmdc:mga05p37_200088_c1 nmdc:mga05p37_200088_c1_1111_2067 288
1114 3300050508 nmdc:mga09592_69829_c1 nmdc:mga09592_69829_c1_1805_2761 288
1115 3300050509 nmdc:mga0qj67_387275_c1 nmdc:mga0qj67_387275_c1_44_994 288
1116 3300050509 nmdc:mga0qj67_6651_c1 nmdc:mga0qj67_6651_c1_1462_2418 288
1117 3300050510 nmdc:mga06r32_29521_c1 nmdc:mga06r32_29521_c1_1560_2516 288
1118 3300050511 nmdc:mga08y16_2044_c1 nmdc:mga08y16_2044_c1_5740_6696 288
1119 3300050511 nmdc:mga08y16_256078_c1 nmdc:mga08y16_256078_c1_754_1710 288
1120 3300050511 nmdc:mga08y16_5303_c1 nmdc:mga08y16_5303_c1_5605_6561 288
1121 3300050512 nmdc:mga0n895_133195_c1 nmdc:mga0n895_133195_c1_1522_2478 288
1122 3300050512 nmdc:mga0n895_25898_c1 nmdc:mga0n895_25898_c1_766_1722 288
1123 3300050512 nmdc:mga0n895_54579_c1 nmdc:mga0n895_54579_c1_1906_2862 288
1124 3300050513 nmdc:mga0rr50_303490_c1 nmdc:mga0rr50_303490_c1_92_1048 288
1125 3300050514 nmdc:mga08x19_165168_c1 nmdc:mga08x19_165168_c1_90_1046 288
1126 3300050515 nmdc:mga0a205_2432_c1 nmdc:mga0a205_2432_c1_883_1839 288
1127 3300050515 nmdc:mga0a205_42460_c2 nmdc:mga0a205_42460_c2_1548_2504 288
1128 3300050515 nmdc:mga0a205_47549_c1 nmdc:mga0a205_47549_c1_2993_3949 288
1129 3300050516 nmdc:mga0sz30_34329_c1 nmdc:mga0sz30_34329_c1_1016_1972 288
1130 3300053077 Ga0495601_0000164 Ga0495601_0000164_29477_30433 288
1131 3300053077 Ga0495601_0000473 Ga0495601_0000473_8847_9794 288
1132 3300053077 Ga0495601_0002539 Ga0495601_0002539_4774_5724 288
1133 3300053078 Ga0495612_0000752 Ga0495612_0000752_130_1080 288
1134 3300053078 Ga0495612_0002586 Ga0495612_0002586_698_1645 288
1135 3300053083 Ga0495655_0005113 Ga0495655_0005113_557_1513 288
1136 3300053084 Ga0495595_0000235 Ga0495595_0000235_1649_2605 288
1137 3300053085 Ga0495619_0000414 Ga0495619_0000414_25236_26186 288
1138 3300053085 Ga0495619_0002506 Ga0495619_0002506_8819_9766 288
1139 3300053085 Ga0495619_0006012 Ga0495619_0006012_1066_2022 288
1140 3300053085 Ga0495619_0028733 Ga0495619_0028733_1297_2253 288
1141 3300053085 Ga0495619_0187455 Ga0495619_0187455_228_1187 288
1142 3300053092 Ga0500583_0061363 Ga0500583_0061363_180_1097 288
1143 3300053142 Ga0500577_0043084 Ga0500577_0043084_634_1551 288
1144 3300054114 Ga0501084_0330017 Ga0501084_0330017_247_1203 288
1145 3300060353 Ga0501082_0042865 Ga0501082_0042865_2207_3163 288
1146 3300060353 Ga0501082_0109657 Ga0501082_0109657_1301_2260 288
1147 3300060353 Ga0501082_0126934 Ga0501082_0126934_194_1144 288
1148 3300060353 Ga0501082_0181091 Ga0501082_0181091_155_1111 288
1149 3300060353 Ga0501082_0264547 Ga0501082_0264547_142_1098 288
1150 3300061734 Ga0530510_0061859 Ga0530510_0061859_473_1423 288
1151 iso_pu_bacteria 2503198000 2503200158 288
1152 iso_pu_bacteria 2508501128 2509151537 288
1153 iso_pu_bacteria 2522572158 2523105859 288
1154 iso_pu_bacteria 2824617872 2824623180 288
1155 iso_pu_bacteria 2824626560 2824627800 288
1156 iso_pu_bacteria 2824635225 2824642670 288
1157 iso_pu_bacteria 2824644064 2824650560 288
1158 iso_pu_bacteria 2824714736 2824720420 288
1159 iso_pu_bacteria 2824723954 2824730645 288
1160 iso_pu_bacteria 2841957949 2841960580 288
1161 iso_pu_bacteria 2847930680 2847939454 288
1162 iso_pu_bacteria 2874612657 2874620234 288
1163 iso_pu_bacteria 2874620515 2874622458 288
1164 iso_pu_bacteria 2876761206 2876761642 288
1165 iso_pu_bacteria 2879083081 2879091104 288
1166 iso_pu_bacteria 2885366525 2885367736 288
1167 iso_pu_bacteria 2885409591 2885418281 288
1168 iso_pu_bacteria 2904666416 2904671535 288
1169 iso_pu_bacteria 2906643746 2906650301 288
1170 iso_pu_bacteria 2929199973 2929205471 288
1171 iso_pu_bacteria 3005594810 3005595845 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00146

NADHdh

NADH dehydrogenase

12

315

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z0t-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) 0.8093 2 282
7z0s-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) 0.7581 2 285
7z0t-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) 0.738 2 282
7z0s-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) 0.735 2 285
6cfw-assembly1.cif.gz_M cryoem structure of a respiratory membrane-bound hydrogenase 0.725 2 279
ID Description Score Start End Superfamily
af_A0A0R4J5Z6_1_230_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4267 9 234 1.20.120.1770
af_A0A0R4J5Z6_1_230_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4206 9 234 1.20.120.1770
af_B5DFI2_7_229_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.3874 10 225 1.20.120.1770
af_B5DFI2_7_229_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.378 10 225 1.20.120.1770
af_Q0JGZ0_269_434_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.3361 92 279 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A379GBP5-F1-model_v4 Hydrogenase-4 component C (EC 1.-.-.-) 0.8661 2 133 GO:0005886
GO:0016491
AF-A0A534DSG4-F1-model_v4 deleted 0.8655 2 123
AF-A0A6N9STR2-F1-model_v4 Formate hydrogenlyase 0.8649 2 133 GO:0005886
GO:0016829
AF-A0A522M4U8-F1-model_v4 Formate hydrogenlyase 0.8566 2 120 GO:0005886
GO:0016829
AF-A0A6N8PNV7-F1-model_v4 deleted 0.8565 2 130

Feature Viewer

pLDDT pTM Quality
67.95 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map