F491164
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1171 | 479 | 1149 | 314 |
Family's Representative Sequence
| Representative Sequence | 3300005440|Ga0070705_100083474|Ga0070705_1000834742 |
| Length | 321 |
| Sequence | MIDLSLVEGLSIQASQMLLVLMLSPLLTGLVRKVKALLLRRQGPPILQPYRDLVRLVRKEAVVAHSASWLFRIVPYIVFAATWVAAALVPTFATGLLFSWSADLIVIIALLGSARFFLALAGMDVGTSFGGIGSSREAMIAMLAEPALIMIVFTLALIAGSTQLSTIAAIMLTPGVGLRISLGLALIALIIVAIAENGRIPVDNPATHLELTMVHEAMVLEYSGRHLALIELAAAIKLLLYASLIACVFVPWGMAPAGAPLHVHLIGGVVYIAKLGVAGLLLAVFETTIAKMRVFRVPDLLGAALMLGFLGTLLRFVSRGM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 6 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 7 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 8 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 9 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 10 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 11 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 12 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 13 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 14 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 15 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 16 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 17 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 18 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 19 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 20 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 21 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 22 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 23 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 24 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 25 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 26 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 27 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 28 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 29 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 30 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 31 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 32 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 33 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 34 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 35 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 36 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 37 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 38 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 39 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 40 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 41 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 42 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 43 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 44 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 45 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 46 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 48 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 49 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 50 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 59 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 63 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 93 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 95 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 106 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 108 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 109 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 110 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 112 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 113 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 114 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 115 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 116 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 117 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 118 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 119 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 120 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 121 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 122 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 123 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 125 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 126 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 127 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 128 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 131 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 132 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 133 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 135 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 136 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 137 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 138 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 139 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 140 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 141 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 142 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 143 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 145 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 248 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 249 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 250 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 257 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 261 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 262 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 265 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 266 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 267 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 268 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 269 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 270 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 271 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 272 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 273 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 274 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 275 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 276 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 277 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 278 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 279 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 280 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 281 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 282 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 283 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 284 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 285 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 286 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 287 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 288 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 289 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 290 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 291 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 292 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 293 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 294 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 296 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 297 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 299 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 300 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 301 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 302 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 303 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 305 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 306 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 307 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 308 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 309 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 311 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 312 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 313 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 314 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 315 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 316 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 317 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 318 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 319 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 320 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 321 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 322 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 323 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 324 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 325 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 326 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 327 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 328 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 329 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 330 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 331 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 332 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 333 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 334 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 335 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 336 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 337 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 338 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 339 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 340 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 341 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 342 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 343 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 344 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 345 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 346 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 403 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 404 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 405 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 406 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 407 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 408 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 411 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 412 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 413 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 414 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 415 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 416 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 443 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 444 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 452 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 453 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 454 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 455 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 456 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 466 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 472 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 473 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 474 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 475 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 476 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 477 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.87 |
| Metatranscriptomes | 0.26 |
| Isolates | 1.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.59 |
| Nodule | 0.77 |
| Rhizoplane | 6.4 |
| Rhizosphere | 87.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C5112 | 2010549000 | Bacteria | 1234 |
| 2 | 2214828529 | 2209111006 | Bacteria | 9764 |
| 3 | ARSoilYngRDRAFT_c00827 | 3300000042 | Bacteria | 2540 |
| 4 | ARcpr5yngRDRAFT_c000144 | 3300000043 | Bacteria | 11410 |
| 5 | ARSoilOldRDRAFT_c000792 | 3300000044 | Bacteria | 3194 |
| 6 | ARCol0oldRDRAFT_c00111 | 3300000045 | Bacteria | 7051 |
| 7 | ARCol0yngRDRAFT_1000163 | 3300000652 | Bacteria | 11440 |
| 8 | JGI24752J21851_1001527 | 3300001976 | Bacteria | 3118 |
| 9 | JGI24746J21847_1000023 | 3300001977 | Bacteria | 14867 |
| 10 | JGI24746J21847_1002224 | 3300001977 | Bacteria | 3102 |
| 11 | JGI24739J22299_10000241 | 3300001989 | Bacteria | 18446 |
| 12 | JGI24737J22298_10000224 | 3300001990 | Bacteria | 18603 |
| 13 | JGI24737J22298_10000674 | 3300001990 | Bacteria | 12084 |
| 14 | JGI24743J22301_10003893 | 3300001991 | Bacteria | 2392 |
| 15 | JGI24750J21931_1000337 | 3300002070 | Bacteria | 7984 |
| 16 | JGI24750J21931_1000352 | 3300002070 | Bacteria | 7824 |
| 17 | JGI24750J21931_1001355 | 3300002070 | Bacteria | 3076 |
| 18 | JGI24745J21846_1000775 | 3300002073 | Bacteria | 2925 |
| 19 | JGI24748J21848_1000156 | 3300002074 | Bacteria | 10018 |
| 20 | JGI24738J21930_10000197 | 3300002075 | Bacteria | 15932 |
| 21 | JGI24749J21850_1002812 | 3300002076 | Bacteria | 2437 |
| 22 | JGI24744J21845_10000934 | 3300002077 | Bacteria | 5556 |
| 23 | JGI24035J26624_1000018 | 3300002126 | Bacteria | 11637 |
| 24 | JGI24033J26618_1000741 | 3300002155 | Bacteria | 3130 |
| 25 | JGI24034J26672_10000296 | 3300002239 | Bacteria | 6575 |
| 26 | JGI24742J22300_10000152 | 3300002244 | Bacteria | 10183 |
| 27 | JGI24742J22300_10000424 | 3300002244 | Bacteria | 6224 |
| 28 | JGI25151J46595_10000193 | 3300003187 | Bacteria | 75098 |
| 29 | JGI25406J46586_10004053 | 3300003203 | Bacteria | 6850 |
| 30 | JGI25160J50197_1024073 | 3300003354 | Bacteria | 1736 |
| 31 | Ga0065717_1002094 | 3300005276 | Bacteria | 2970 |
| 32 | Ga0065712_10002365 | 3300005290 | Bacteria | 8694 |
| 33 | Ga0065712_10071985 | 3300005290 | Bacteria | 4954 |
| 34 | Ga0065715_10001277 | 3300005293 | Bacteria | 11971 |
| 35 | Ga0065715_10089028 | 3300005293 | Bacteria | 16334 |
| 36 | Ga0065707_10107876 | 3300005295 | Bacteria | 2534 |
| 37 | Ga0070658_10003962 | 3300005327 | Bacteria | 12134 |
| 38 | Ga0070676_10000629 | 3300005328 | Bacteria | 17200 |
| 39 | Ga0070676_10031955 | 3300005328 | Bacteria | 3013 |
| 40 | Ga0070683_100000240 | 3300005329 | Bacteria | 37588 |
| 41 | Ga0070683_100020152 | 3300005329 | Bacteria | 5932 |
| 42 | Ga0070683_100153286 | 3300005329 | Bacteria | 2185 |
| 43 | Ga0070690_100000264 | 3300005330 | Bacteria | 27010 |
| 44 | Ga0070690_100010416 | 3300005330 | Bacteria | 5411 |
| 45 | Ga0070690_100068744 | 3300005330 | Bacteria | 2298 |
| 46 | Ga0070690_100105533 | 3300005330 | Bacteria | 1873 |
| 47 | Ga0070690_100154275 | 3300005330 | Bacteria | 1569 |
| 48 | Ga0070670_100002399 | 3300005331 | Bacteria | 15441 |
| 49 | Ga0070670_100045914 | 3300005331 | Bacteria | 3756 |
| 50 | Ga0070677_10000507 | 3300005333 | Bacteria | 13417 |
| 51 | Ga0068869_100000189 | 3300005334 | Bacteria | 31886 |
| 52 | Ga0068869_100033165 | 3300005334 | Bacteria | 3644 |
| 53 | Ga0070666_10019187 | 3300005335 | Bacteria | 4411 |
| 54 | Ga0070666_10041895 | 3300005335 | Bacteria | 3061 |
| 55 | Ga0070680_100000210 | 3300005336 | Bacteria | 38357 |
| 56 | Ga0070680_100000706 | 3300005336 | Bacteria | 23169 |
| 57 | Ga0070680_100009451 | 3300005336 | Bacteria | 7491 |
| 58 | Ga0070680_100020964 | 3300005336 | Bacteria | 5189 |
| 59 | Ga0070680_100027458 | 3300005336 | Bacteria | 4558 |
| 60 | Ga0070680_100443725 | 3300005336 | Bacteria | 1108 |
| 61 | Ga0070682_100000202 | 3300005337 | Bacteria | 44018 |
| 62 | Ga0070682_100009990 | 3300005337 | Bacteria | 5375 |
| 63 | Ga0070682_100013606 | 3300005337 | Bacteria | 4686 |
| 64 | Ga0070682_100249014 | 3300005337 | Bacteria | 1280 |
| 65 | Ga0068868_100021910 | 3300005338 | Bacteria | 4817 |
| 66 | Ga0068868_100033405 | 3300005338 | Bacteria | 3965 |
| 67 | Ga0070660_100000223 | 3300005339 | Bacteria | 37464 |
| 68 | Ga0070660_100011386 | 3300005339 | Bacteria | 6317 |
| 69 | Ga0070660_100072810 | 3300005339 | Bacteria | 2686 |
| 70 | Ga0070660_100077113 | 3300005339 | Bacteria | 2611 |
| 71 | Ga0070689_100000187 | 3300005340 | Bacteria | 37473 |
| 72 | Ga0070689_100018460 | 3300005340 | Bacteria | 5139 |
| 73 | Ga0070689_100020568 | 3300005340 | Bacteria | 4899 |
| 74 | Ga0070689_100024256 | 3300005340 | Bacteria | 4547 |
| 75 | Ga0070691_10000236 | 3300005341 | Bacteria | 18840 |
| 76 | Ga0070691_10010464 | 3300005341 | Bacteria | 4233 |
| 77 | Ga0070691_10054149 | 3300005341 | Bacteria | 1920 |
| 78 | Ga0070687_100000306 | 3300005343 | Bacteria | 16620 |
| 79 | Ga0070687_100005837 | 3300005343 | Bacteria | 5009 |
| 80 | Ga0070687_100028601 | 3300005343 | Bacteria | 2706 |
| 81 | Ga0070687_100055735 | 3300005343 | Bacteria | 2066 |
| 82 | Ga0070661_100000298 | 3300005344 | Bacteria | 40083 |
| 83 | Ga0070661_100027242 | 3300005344 | Bacteria | 4113 |
| 84 | Ga0070692_10000016 | 3300005345 | Bacteria | 34456 |
| 85 | Ga0070668_100006404 | 3300005347 | Bacteria | 8724 |
| 86 | Ga0070668_100010470 | 3300005347 | Bacteria | 6893 |
| 87 | Ga0070668_100013411 | 3300005347 | Bacteria | 6116 |
| 88 | Ga0070669_100000959 | 3300005353 | Bacteria | 21059 |
| 89 | Ga0070669_100009625 | 3300005353 | Bacteria | 6883 |
| 90 | Ga0070669_100014612 | 3300005353 | Bacteria | 5589 |
| 91 | Ga0070669_100071006 | 3300005353 | Bacteria | 2575 |
| 92 | Ga0070675_100000215 | 3300005354 | Bacteria | 37364 |
| 93 | Ga0070675_100007433 | 3300005354 | Bacteria | 8461 |
| 94 | Ga0070675_100011271 | 3300005354 | Bacteria | 6998 |
| 95 | Ga0070671_100000402 | 3300005355 | Bacteria | 29873 |
| 96 | Ga0070671_100010939 | 3300005355 | Bacteria | 7287 |
| 97 | Ga0070671_100055232 | 3300005355 | Bacteria | 3304 |
| 98 | Ga0070674_100000709 | 3300005356 | Bacteria | 16967 |
| 99 | Ga0070674_100002281 | 3300005356 | Bacteria | 10585 |
| 100 | Ga0070674_100009356 | 3300005356 | Bacteria | 5867 |
| 101 | Ga0070673_100000035 | 3300005364 | Bacteria | 57163 |
| 102 | Ga0070673_100103748 | 3300005364 | Bacteria | 2346 |
| 103 | Ga0070688_100000130 | 3300005365 | Bacteria | 40342 |
| 104 | Ga0070688_100003918 | 3300005365 | Bacteria | 7717 |
| 105 | Ga0070688_100043003 | 3300005365 | Bacteria | 2782 |
| 106 | Ga0070659_100000583 | 3300005366 | Bacteria | 26638 |
| 107 | Ga0070659_100043211 | 3300005366 | Bacteria | 3524 |
| 108 | Ga0070659_100052526 | 3300005366 | Bacteria | 3206 |
| 109 | Ga0070659_100108502 | 3300005366 | Bacteria | 2239 |
| 110 | Ga0070667_100000712 | 3300005367 | Bacteria | 32083 |
| 111 | Ga0070667_100026753 | 3300005367 | Bacteria | 4800 |
| 112 | Ga0070703_10023357 | 3300005406 | Bacteria | 1821 |
| 113 | Ga0070714_100018802 | 3300005435 | Bacteria | 5620 |
| 114 | Ga0070714_100148792 | 3300005435 | Bacteria | 2108 |
| 115 | Ga0070713_100010347 | 3300005436 | Bacteria | 6737 |
| 116 | Ga0070713_100089294 | 3300005436 | Bacteria | 2647 |
| 117 | Ga0070713_100096688 | 3300005436 | Bacteria | 2550 |
| 118 | Ga0070713_100154538 | 3300005436 | Bacteria | 2044 |
| 119 | Ga0070713_100337383 | 3300005436 | Bacteria | 1396 |
| 120 | Ga0070713_100553933 | 3300005436 | Bacteria | 1089 |
| 121 | Ga0070710_10000656 | 3300005437 | Bacteria | 16428 |
| 122 | Ga0070710_10009990 | 3300005437 | Bacteria | 4653 |
| 123 | Ga0070701_10000081 | 3300005438 | Bacteria | 26416 |
| 124 | Ga0070701_10007943 | 3300005438 | Bacteria | 4564 |
| 125 | Ga0070701_10034214 | 3300005438 | Bacteria | 2544 |
| 126 | Ga0070711_100008844 | 3300005439 | Bacteria | 6182 |
| 127 | Ga0070711_100058616 | 3300005439 | Bacteria | 2670 |
| 128 | Ga0070711_100360424 | 3300005439 | Bacteria | 1171 |
| 129 | Ga0070705_100000911 | 3300005440 | Bacteria | 16539 |
| 130 | Ga0070705_100028423 | 3300005440 | Bacteria | 3062 |
| 131 | Ga0070705_100083474 | 3300005440 | Bacteria | 1969 |
| 132 | Ga0070700_100000393 | 3300005441 | Bacteria | 22580 |
| 133 | Ga0070700_100006267 | 3300005441 | Bacteria | 6347 |
| 134 | Ga0070700_100022752 | 3300005441 | Bacteria | 3661 |
| 135 | Ga0070700_100070463 | 3300005441 | Bacteria | 2229 |
| 136 | Ga0070694_100000129 | 3300005444 | Bacteria | 37699 |
| 137 | Ga0070694_100003990 | 3300005444 | Bacteria | 8831 |
| 138 | Ga0070708_100022564 | 3300005445 | Bacteria | 5339 |
| 139 | Ga0070663_100000746 | 3300005455 | Bacteria | 17593 |
| 140 | Ga0070663_100004572 | 3300005455 | Bacteria | 8149 |
| 141 | Ga0070663_100011714 | 3300005455 | Bacteria | 5518 |
| 142 | Ga0070663_100026948 | 3300005455 | Bacteria | 3898 |
| 143 | Ga0070678_100000399 | 3300005456 | Bacteria | 20439 |
| 144 | Ga0070678_100048917 | 3300005456 | Bacteria | 3048 |
| 145 | Ga0070662_100001543 | 3300005457 | Bacteria | 14211 |
| 146 | Ga0070662_100016757 | 3300005457 | Bacteria | 4925 |
| 147 | Ga0070662_100019314 | 3300005457 | Bacteria | 4624 |
| 148 | Ga0070681_10000001 | 3300005458 | Bacteria | 946857 |
| 149 | Ga0070681_10001286 | 3300005458 | Bacteria | 21879 |
| 150 | Ga0070681_10040205 | 3300005458 | Bacteria | 4688 |
| 151 | Ga0070681_10043290 | 3300005458 | Bacteria | 4510 |
| 152 | Ga0070681_10061642 | 3300005458 | Bacteria | 3724 |
| 153 | Ga0070681_10256287 | 3300005458 | Bacteria | 1661 |
| 154 | Ga0070681_10387420 | 3300005458 | Bacteria | 1308 |
| 155 | Ga0068867_100001770 | 3300005459 | Bacteria | 15034 |
| 156 | Ga0068867_100004534 | 3300005459 | Bacteria | 9766 |
| 157 | Ga0068867_100024994 | 3300005459 | Bacteria | 4284 |
| 158 | Ga0070685_10000490 | 3300005466 | Bacteria | 22910 |
| 159 | Ga0070685_10012931 | 3300005466 | Bacteria | 4394 |
| 160 | Ga0070685_10032047 | 3300005466 | Bacteria | 2942 |
| 161 | Ga0070685_10250085 | 3300005466 | Bacteria | 1174 |
| 162 | Ga0074259_10596474 | 3300005507 | Bacteria | 1757 |
| 163 | Ga0070679_100000037 | 3300005530 | Bacteria | 100971 |
| 164 | Ga0070679_100000553 | 3300005530 | Bacteria | 31683 |
| 165 | Ga0070679_100027141 | 3300005530 | Bacteria | 5631 |
| 166 | Ga0070679_100056209 | 3300005530 | Bacteria | 3921 |
| 167 | Ga0070684_100000246 | 3300005535 | Bacteria | 37600 |
| 168 | Ga0070684_100004789 | 3300005535 | Bacteria | 10338 |
| 169 | Ga0070684_100024430 | 3300005535 | Bacteria | 5070 |
| 170 | Ga0070684_100203065 | 3300005535 | Bacteria | 1805 |
| 171 | Ga0068853_100000243 | 3300005539 | Bacteria | 38327 |
| 172 | Ga0068853_100097710 | 3300005539 | Bacteria | 2593 |
| 173 | Ga0068853_100179302 | 3300005539 | Bacteria | 1920 |
| 174 | Ga0070672_100000157 | 3300005543 | Bacteria | 37598 |
| 175 | Ga0070672_100003221 | 3300005543 | Bacteria | 10563 |
| 176 | Ga0070686_100000260 | 3300005544 | Bacteria | 36083 |
| 177 | Ga0070686_100008427 | 3300005544 | Bacteria | 5772 |
| 178 | Ga0070686_100037335 | 3300005544 | Bacteria | 3013 |
| 179 | Ga0070695_100004051 | 3300005545 | Bacteria | 8572 |
| 180 | Ga0070695_100005692 | 3300005545 | Bacteria | 7348 |
| 181 | Ga0070695_100074049 | 3300005545 | Bacteria | 2237 |
| 182 | Ga0070696_100000970 | 3300005546 | Bacteria | 18596 |
| 183 | Ga0070696_100003815 | 3300005546 | Bacteria | 10062 |
| 184 | Ga0070696_100097933 | 3300005546 | Bacteria | 2098 |
| 185 | Ga0070696_100131855 | 3300005546 | Bacteria | 1819 |
| 186 | Ga0070693_100000925 | 3300005547 | Bacteria | 13032 |
| 187 | Ga0070693_100140556 | 3300005547 | Bacteria | 1519 |
| 188 | Ga0070665_100003075 | 3300005548 | Bacteria | 17973 |
| 189 | Ga0070665_100010001 | 3300005548 | Bacteria | 9596 |
| 190 | Ga0070665_100041633 | 3300005548 | Bacteria | 4618 |
| 191 | Ga0070704_100000171 | 3300005549 | Bacteria | 25774 |
| 192 | Ga0070704_100001307 | 3300005549 | Bacteria | 13180 |
| 193 | Ga0070704_100026429 | 3300005549 | Bacteria | 3835 |
| 194 | Ga0068855_100010157 | 3300005563 | Bacteria | 11347 |
| 195 | Ga0068855_100031343 | 3300005563 | Bacteria | 6349 |
| 196 | Ga0068855_100047138 | 3300005563 | Bacteria | 5092 |
| 197 | Ga0068855_100153394 | 3300005563 | Bacteria | 2618 |
| 198 | Ga0068855_100239024 | 3300005563 | Bacteria | 2030 |
| 199 | Ga0070664_100000269 | 3300005564 | Bacteria | 37475 |
| 200 | Ga0070664_100052826 | 3300005564 | Bacteria | 3443 |
| 201 | Ga0070664_100059585 | 3300005564 | Bacteria | 3248 |
| 202 | Ga0070664_100129446 | 3300005564 | Bacteria | 2216 |
| 203 | Ga0068857_100000174 | 3300005577 | Bacteria | 40766 |
| 204 | Ga0068857_100049341 | 3300005577 | Bacteria | 3734 |
| 205 | Ga0068857_100099316 | 3300005577 | Bacteria | 2611 |
| 206 | Ga0068854_100000211 | 3300005578 | Bacteria | 39059 |
| 207 | Ga0068854_100013937 | 3300005578 | Bacteria | 5288 |
| 208 | Ga0068854_100066678 | 3300005578 | Bacteria | 2620 |
| 209 | Ga0068854_100105533 | 3300005578 | Bacteria | 2118 |
| 210 | Ga0068856_100000600 | 3300005614 | Bacteria | 39415 |
| 211 | Ga0070702_100000654 | 3300005615 | Bacteria | 12905 |
| 212 | Ga0070702_100175884 | 3300005615 | Bacteria | 1396 |
| 213 | Ga0068852_100000629 | 3300005616 | Bacteria | 23063 |
| 214 | Ga0068852_100009156 | 3300005616 | Bacteria | 7334 |
| 215 | Ga0068852_100014841 | 3300005616 | Bacteria | 6020 |
| 216 | Ga0068859_100000894 | 3300005617 | Bacteria | 30361 |
| 217 | Ga0068859_100024112 | 3300005617 | Bacteria | 6105 |
| 218 | Ga0068859_100265007 | 3300005617 | Bacteria | 1810 |
| 219 | Ga0068864_100000329 | 3300005618 | Bacteria | 41801 |
| 220 | Ga0068864_100004704 | 3300005618 | Bacteria | 11195 |
| 221 | Ga0068866_10000177 | 3300005718 | Bacteria | 29851 |
| 222 | Ga0068866_10004095 | 3300005718 | Bacteria | 5982 |
| 223 | Ga0068861_100000329 | 3300005719 | Bacteria | 26778 |
| 224 | Ga0068861_100017474 | 3300005719 | Bacteria | 5094 |
| 225 | Ga0068861_100026049 | 3300005719 | Bacteria | 4247 |
| 226 | Ga0068861_100204819 | 3300005719 | Bacteria | 1658 |
| 227 | Ga0068870_10000056 | 3300005840 | Bacteria | 36039 |
| 228 | Ga0068870_10004328 | 3300005840 | Bacteria | 6109 |
| 229 | Ga0068863_100000278 | 3300005841 | Bacteria | 53024 |
| 230 | Ga0068863_100014875 | 3300005841 | Bacteria | 7475 |
| 231 | Ga0068858_100001048 | 3300005842 | Bacteria | 28582 |
| 232 | Ga0068858_100008255 | 3300005842 | Bacteria | 10009 |
| 233 | Ga0068858_100046045 | 3300005842 | Bacteria | 4044 |
| 234 | Ga0068860_100000985 | 3300005843 | Bacteria | 31478 |
| 235 | Ga0068860_100007113 | 3300005843 | Bacteria | 11195 |
| 236 | Ga0068860_100088750 | 3300005843 | Bacteria | 2943 |
| 237 | Ga0068860_100160849 | 3300005843 | Bacteria | 2165 |
| 238 | Ga0068862_100000593 | 3300005844 | Bacteria | 37703 |
| 239 | Ga0068862_100000775 | 3300005844 | Bacteria | 31713 |
| 240 | Ga0068862_100007625 | 3300005844 | Bacteria | 8962 |
| 241 | Ga0068862_100007945 | 3300005844 | Bacteria | 8776 |
| 242 | Ga0068862_100009498 | 3300005844 | Bacteria | 8049 |
| 243 | Ga0081455_10000051 | 3300005937 | Bacteria | 123542 |
| 244 | Ga0081455_10004739 | 3300005937 | Bacteria | 15120 |
| 245 | Ga0081455_10062668 | 3300005937 | Bacteria | 3124 |
| 246 | Ga0081539_10003785 | 3300005985 | Bacteria | 17869 |
| 247 | Ga0070717_10119137 | 3300006028 | Bacteria | 2259 |
| 248 | Ga0070717_10139812 | 3300006028 | Bacteria | 2088 |
| 249 | Ga0075365_10026618 | 3300006038 | Bacteria | 3673 |
| 250 | Ga0075365_10103766 | 3300006038 | Bacteria | 1949 |
| 251 | Ga0075368_10020359 | 3300006042 | Bacteria | 2512 |
| 252 | Ga0075368_10044879 | 3300006042 | Bacteria | 1745 |
| 253 | Ga0075363_100042317 | 3300006048 | Bacteria | 2406 |
| 254 | Ga0075364_10027444 | 3300006051 | Bacteria | 3637 |
| 255 | Ga0075364_10204264 | 3300006051 | Bacteria | 1339 |
| 256 | Ga0075364_10236647 | 3300006051 | Bacteria | 1240 |
| 257 | Ga0070715_10010214 | 3300006163 | Bacteria | 3339 |
| 258 | Ga0070715_10063916 | 3300006163 | Bacteria | 1624 |
| 259 | Ga0070715_10087304 | 3300006163 | Bacteria | 1428 |
| 260 | Ga0070716_100004545 | 3300006173 | Bacteria | 6650 |
| 261 | Ga0070712_100016638 | 3300006175 | Bacteria | 4751 |
| 262 | Ga0070712_100029533 | 3300006175 | Bacteria | 3676 |
| 263 | Ga0070712_100034712 | 3300006175 | Bacteria | 3420 |
| 264 | Ga0070712_100122234 | 3300006175 | Bacteria | 1960 |
| 265 | Ga0070712_100139359 | 3300006175 | Bacteria | 1849 |
| 266 | Ga0075367_10009838 | 3300006178 | Bacteria | 5010 |
| 267 | Ga0075367_10030759 | 3300006178 | Bacteria | 3080 |
| 268 | Ga0075367_10049575 | 3300006178 | Bacteria | 2475 |
| 269 | Ga0075369_10005713 | 3300006186 | Bacteria | 4667 |
| 270 | Ga0075369_10023201 | 3300006186 | Bacteria | 2564 |
| 271 | Ga0097621_100000504 | 3300006237 | Bacteria | 27335 |
| 272 | Ga0097621_100004513 | 3300006237 | Bacteria | 9706 |
| 273 | Ga0097621_100006326 | 3300006237 | Bacteria | 8404 |
| 274 | Ga0075370_10017676 | 3300006353 | Bacteria | 3855 |
| 275 | Ga0068871_100000815 | 3300006358 | Bacteria | 20895 |
| 276 | Ga0068871_100005880 | 3300006358 | Bacteria | 8625 |
| 277 | Ga0075430_100021821 | 3300006846 | Bacteria | 5441 |
| 278 | Ga0075431_100032372 | 3300006847 | Bacteria | 5388 |
| 279 | Ga0075433_10201376 | 3300006852 | Bacteria | 1770 |
| 280 | Ga0075434_100000244 | 3300006871 | Bacteria | 38039 |
| 281 | Ga0075434_100000519 | 3300006871 | Bacteria | 29333 |
| 282 | Ga0075434_100055241 | 3300006871 | Bacteria | 3946 |
| 283 | Ga0075434_100286440 | 3300006871 | Bacteria | 1667 |
| 284 | Ga0075429_100382428 | 3300006880 | Bacteria | 1232 |
| 285 | Ga0068865_100000332 | 3300006881 | Bacteria | 26180 |
| 286 | Ga0068865_100031851 | 3300006881 | Bacteria | 3518 |
| 287 | Ga0068865_100166946 | 3300006881 | Bacteria | 1684 |
| 288 | Ga0075436_100052430 | 3300006914 | Bacteria | 2816 |
| 289 | Ga0075436_100090108 | 3300006914 | Bacteria | 2131 |
| 290 | Ga0075436_100288125 | 3300006914 | Bacteria | 1175 |
| 291 | Ga0097620_100000894 | 3300006931 | Bacteria | 30361 |
| 292 | Ga0097620_100024111 | 3300006931 | Bacteria | 6105 |
| 293 | Ga0097620_100265007 | 3300006931 | Bacteria | 1810 |
| 294 | Ga0075435_100047561 | 3300007076 | Bacteria | 3445 |
| 295 | Ga0075435_100074514 | 3300007076 | Bacteria | 2777 |
| 296 | Ga0105250_10028955 | 3300009092 | Bacteria | 2229 |
| 297 | Ga0105250_10045782 | 3300009092 | Bacteria | 1754 |
| 298 | Ga0105240_10063893 | 3300009093 | Bacteria | 4576 |
| 299 | Ga0105240_10496464 | 3300009093 | Bacteria | 1358 |
| 300 | Ga0111539_10001076 | 3300009094 | Bacteria | 36048 |
| 301 | Ga0111539_10011662 | 3300009094 | Bacteria | 11023 |
| 302 | Ga0111539_10044669 | 3300009094 | Bacteria | 5307 |
| 303 | Ga0111539_10122649 | 3300009094 | Bacteria | 3046 |
| 304 | Ga0111539_10276631 | 3300009094 | Bacteria | 1953 |
| 305 | Ga0105245_10000451 | 3300009098 | Bacteria | 37705 |
| 306 | Ga0105245_10006657 | 3300009098 | Bacteria | 10142 |
| 307 | Ga0105245_10009909 | 3300009098 | Bacteria | 8299 |
| 308 | Ga0105245_10042174 | 3300009098 | Bacteria | 4071 |
| 309 | Ga0105245_10066551 | 3300009098 | Bacteria | 3262 |
| 310 | Ga0105247_10001553 | 3300009101 | Bacteria | 16377 |
| 311 | Ga0105247_10006039 | 3300009101 | Bacteria | 7534 |
| 312 | Ga0105247_10013787 | 3300009101 | Bacteria | 4846 |
| 313 | Ga0105247_10014447 | 3300009101 | Bacteria | 4736 |
| 314 | Ga0105247_10159304 | 3300009101 | Bacteria | 1493 |
| 315 | Ga0114129_10059574 | 3300009147 | Bacteria | 5338 |
| 316 | Ga0105243_10001205 | 3300009148 | Bacteria | 23282 |
| 317 | Ga0105243_10058461 | 3300009148 | Bacteria | 3072 |
| 318 | Ga0105243_10070118 | 3300009148 | Bacteria | 2829 |
| 319 | Ga0105243_10174090 | 3300009148 | Bacteria | 1867 |
| 320 | Ga0105241_10000515 | 3300009174 | Bacteria | 29094 |
| 321 | Ga0105241_10034338 | 3300009174 | Bacteria | 3809 |
| 322 | Ga0105241_10043489 | 3300009174 | Bacteria | 3402 |
| 323 | Ga0105241_10472669 | 3300009174 | Bacteria | 1113 |
| 324 | Ga0105242_10008078 | 3300009176 | Bacteria | 8097 |
| 325 | Ga0105248_10000837 | 3300009177 | Bacteria | 34570 |
| 326 | Ga0105248_10006976 | 3300009177 | Bacteria | 12373 |
| 327 | Ga0105248_10049463 | 3300009177 | Bacteria | 4715 |
| 328 | Ga0105237_10009856 | 3300009545 | Bacteria | 10213 |
| 329 | Ga0105237_10011688 | 3300009545 | Bacteria | 9287 |
| 330 | Ga0105237_10145521 | 3300009545 | Bacteria | 2365 |
| 331 | Ga0105237_10289614 | 3300009545 | Bacteria | 1640 |
| 332 | Ga0105238_10042052 | 3300009551 | Bacteria | 4627 |
| 333 | Ga0105238_10047430 | 3300009551 | Bacteria | 4331 |
| 334 | Ga0105238_10091379 | 3300009551 | Bacteria | 3031 |
| 335 | Ga0105238_10139584 | 3300009551 | Bacteria | 2401 |
| 336 | Ga0105249_10001556 | 3300009553 | Bacteria | 20141 |
| 337 | Ga0105249_10018383 | 3300009553 | Bacteria | 6216 |
| 338 | Ga0105249_10069863 | 3300009553 | Bacteria | 3242 |
| 339 | Ga0105249_10714840 | 3300009553 | Bacteria | 1062 |
| 340 | Ga0105239_10005157 | 3300010375 | Bacteria | 15424 |
| 341 | Ga0105239_10007246 | 3300010375 | Bacteria | 12738 |
| 342 | Ga0105239_10011420 | 3300010375 | Bacteria | 9904 |
| 343 | Ga0105239_10090414 | 3300010375 | Bacteria | 3377 |
| 344 | Ga0105239_10586312 | 3300010375 | Bacteria | 1271 |
| 345 | Ga0105246_10000100 | 3300011119 | Bacteria | 37689 |
| 346 | Ga0157373_10001937 | 3300013100 | Bacteria | 15725 |
| 347 | Ga0157371_10009263 | 3300013102 | Bacteria | 7766 |
| 348 | Ga0157371_10060791 | 3300013102 | Bacteria | 2678 |
| 349 | Ga0157371_10097175 | 3300013102 | Bacteria | 2087 |
| 350 | Ga0157369_10417137 | 3300013105 | Bacteria | 1392 |
| 351 | Ga0157374_10002520 | 3300013296 | Bacteria | 15446 |
| 352 | Ga0157374_10025843 | 3300013296 | Bacteria | 5278 |
| 353 | Ga0157374_10034810 | 3300013296 | Bacteria | 4603 |
| 354 | Ga0157374_10068867 | 3300013296 | Bacteria | 3330 |
| 355 | Ga0157378_10018104 | 3300013297 | Bacteria | 6186 |
| 356 | Ga0157378_10019279 | 3300013297 | Bacteria | 5996 |
| 357 | Ga0157378_10045210 | 3300013297 | Bacteria | 3912 |
| 358 | Ga0157378_10082672 | 3300013297 | Bacteria | 2904 |
| 359 | Ga0157378_10100682 | 3300013297 | Bacteria | 2638 |
| 360 | Ga0157378_10448060 | 3300013297 | Bacteria | 1281 |
| 361 | Ga0163162_10001003 | 3300013306 | Bacteria | 26222 |
| 362 | Ga0163162_10003466 | 3300013306 | Bacteria | 15066 |
| 363 | Ga0163162_10018542 | 3300013306 | Bacteria | 6819 |
| 364 | Ga0163162_10181962 | 3300013306 | Bacteria | 2228 |
| 365 | Ga0157372_10016087 | 3300013307 | Bacteria | 8026 |
| 366 | Ga0157372_10173542 | 3300013307 | Bacteria | 2495 |
| 367 | Ga0157372_10801752 | 3300013307 | Bacteria | 1094 |
| 368 | Ga0157375_10000464 | 3300013308 | Bacteria | 36915 |
| 369 | Ga0157375_10013321 | 3300013308 | Bacteria | 7314 |
| 370 | Ga0157375_10015123 | 3300013308 | Bacteria | 6902 |
| 371 | Ga0157375_10068458 | 3300013308 | Bacteria | 3552 |
| 372 | Ga0157375_10090970 | 3300013308 | Bacteria | 3111 |
| 373 | Ga0163163_10002284 | 3300014325 | Bacteria | 16167 |
| 374 | Ga0163163_10012670 | 3300014325 | Bacteria | 7690 |
| 375 | Ga0163163_10026554 | 3300014325 | Bacteria | 5538 |
| 376 | Ga0163163_10340687 | 3300014325 | Bacteria | 1554 |
| 377 | Ga0157380_10000145 | 3300014326 | Bacteria | 40211 |
| 378 | Ga0157380_10060588 | 3300014326 | Bacteria | 3025 |
| 379 | Ga0157377_10000179 | 3300014745 | Bacteria | 36682 |
| 380 | Ga0157377_10047136 | 3300014745 | Bacteria | 2413 |
| 381 | Ga0157379_10000067 | 3300014968 | Bacteria | 66051 |
| 382 | Ga0157379_10050135 | 3300014968 | Bacteria | 3726 |
| 383 | Ga0157379_10061245 | 3300014968 | Bacteria | 3365 |
| 384 | Ga0157376_10000864 | 3300014969 | Bacteria | 19873 |
| 385 | Ga0157376_10017983 | 3300014969 | Bacteria | 5408 |
| 386 | Ga0163161_10001641 | 3300017792 | Bacteria | 16464 |
| 387 | Ga0163161_10015441 | 3300017792 | Bacteria | 5324 |
| 388 | Ga0206353_11380251 | 3300020082 | Bacteria | 1421 |
| 389 | Ga0207666_1000002 | 3300025271 | Bacteria | 62717 |
| 390 | Ga0207666_1003664 | 3300025271 | Bacteria | 1896 |
| 391 | Ga0209130_1000389 | 3300025284 | Bacteria | 48487 |
| 392 | Ga0209025_1000061 | 3300025294 | Bacteria | 304827 |
| 393 | Ga0209758_1001864 | 3300025297 | Bacteria | 23116 |
| 394 | Ga0209758_1004355 | 3300025297 | Bacteria | 11860 |
| 395 | Ga0209758_1005524 | 3300025297 | Bacteria | 9659 |
| 396 | Ga0207426_1000361 | 3300025302 | Bacteria | 81889 |
| 397 | Ga0207697_10000113 | 3300025315 | Bacteria | 37772 |
| 398 | Ga0207697_10002993 | 3300025315 | Bacteria | 8523 |
| 399 | Ga0207656_10013388 | 3300025321 | Bacteria | 3135 |
| 400 | Ga0207696_1028356 | 3300025711 | Bacteria | 1719 |
| 401 | Ga0207653_10024269 | 3300025885 | Bacteria | 1935 |
| 402 | Ga0207682_10000094 | 3300025893 | Bacteria | 41188 |
| 403 | Ga0207682_10027480 | 3300025893 | Bacteria | 2266 |
| 404 | Ga0207692_10002667 | 3300025898 | Bacteria | 6869 |
| 405 | Ga0207692_10008058 | 3300025898 | Bacteria | 4348 |
| 406 | Ga0207642_10000106 | 3300025899 | Bacteria | 22456 |
| 407 | Ga0207642_10022206 | 3300025899 | Bacteria | 2512 |
| 408 | Ga0207710_10003537 | 3300025900 | Bacteria | 6944 |
| 409 | Ga0207688_10000074 | 3300025901 | Bacteria | 37681 |
| 410 | Ga0207688_10001906 | 3300025901 | Bacteria | 11175 |
| 411 | Ga0207688_10004875 | 3300025901 | Bacteria | 7307 |
| 412 | Ga0207680_10015416 | 3300025903 | Bacteria | 3988 |
| 413 | Ga0207680_10079461 | 3300025903 | Bacteria | 2057 |
| 414 | Ga0207680_10101587 | 3300025903 | Bacteria | 1849 |
| 415 | Ga0207647_10000218 | 3300025904 | Bacteria | 46963 |
| 416 | Ga0207647_10006609 | 3300025904 | Bacteria | 8423 |
| 417 | Ga0207685_10041604 | 3300025905 | Bacteria | 1720 |
| 418 | Ga0207699_10005568 | 3300025906 | Bacteria | 6040 |
| 419 | Ga0207699_10009762 | 3300025906 | Bacteria | 4792 |
| 420 | Ga0207699_10142546 | 3300025906 | Bacteria | 1576 |
| 421 | Ga0207645_10000247 | 3300025907 | Bacteria | 44983 |
| 422 | Ga0207645_10010970 | 3300025907 | Bacteria | 6200 |
| 423 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 424 | Ga0207643_10002034 | 3300025908 | Bacteria | 11165 |
| 425 | Ga0207705_10005512 | 3300025909 | Bacteria | 9466 |
| 426 | Ga0207705_10044014 | 3300025909 | Bacteria | 3207 |
| 427 | Ga0207654_10000408 | 3300025911 | Bacteria | 24946 |
| 428 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 429 | Ga0207707_10000618 | 3300025912 | Bacteria | 35350 |
| 430 | Ga0207707_10009349 | 3300025912 | Bacteria | 8502 |
| 431 | Ga0207707_10017866 | 3300025912 | Bacteria | 6185 |
| 432 | Ga0207707_10186483 | 3300025912 | Bacteria | 1810 |
| 433 | Ga0207707_10420953 | 3300025912 | Bacteria | 1145 |
| 434 | Ga0207695_10082620 | 3300025913 | Bacteria | 3246 |
| 435 | Ga0207695_10352663 | 3300025913 | Bacteria | 1358 |
| 436 | Ga0207671_10006046 | 3300025914 | Bacteria | 10917 |
| 437 | Ga0207671_10051153 | 3300025914 | Bacteria | 3061 |
| 438 | Ga0207671_10080443 | 3300025914 | Bacteria | 2442 |
| 439 | Ga0207671_10193782 | 3300025914 | Bacteria | 1585 |
| 440 | Ga0207693_10002426 | 3300025915 | Bacteria | 16193 |
| 441 | Ga0207693_10037349 | 3300025915 | Bacteria | 3828 |
| 442 | Ga0207693_10045822 | 3300025915 | Bacteria | 3435 |
| 443 | Ga0207693_10162876 | 3300025915 | Bacteria | 1755 |
| 444 | Ga0207663_10021216 | 3300025916 | Bacteria | 3695 |
| 445 | Ga0207663_10028196 | 3300025916 | Bacteria | 3284 |
| 446 | Ga0207663_10226734 | 3300025916 | Bacteria | 1363 |
| 447 | Ga0207660_10000029 | 3300025917 | Bacteria | 67115 |
| 448 | Ga0207660_10000637 | 3300025917 | Bacteria | 23600 |
| 449 | Ga0207660_10023942 | 3300025917 | Bacteria | 4129 |
| 450 | Ga0207660_10033899 | 3300025917 | Bacteria | 3535 |
| 451 | Ga0207662_10000119 | 3300025918 | Bacteria | 37770 |
| 452 | Ga0207662_10004685 | 3300025918 | Bacteria | 7219 |
| 453 | Ga0207662_10005578 | 3300025918 | Bacteria | 6724 |
| 454 | Ga0207662_10012444 | 3300025918 | Bacteria | 4740 |
| 455 | Ga0207657_10000316 | 3300025919 | Bacteria | 51145 |
| 456 | Ga0207657_10006914 | 3300025919 | Bacteria | 11704 |
| 457 | Ga0207657_10029916 | 3300025919 | Bacteria | 4950 |
| 458 | Ga0207657_10063030 | 3300025919 | Bacteria | 3172 |
| 459 | Ga0207649_10000090 | 3300025920 | Bacteria | 75387 |
| 460 | Ga0207652_10000190 | 3300025921 | Bacteria | 64841 |
| 461 | Ga0207652_10010770 | 3300025921 | Bacteria | 7365 |
| 462 | Ga0207652_10022911 | 3300025921 | Bacteria | 5173 |
| 463 | Ga0207652_10025093 | 3300025921 | Bacteria | 4953 |
| 464 | Ga0207652_10077354 | 3300025921 | Bacteria | 2903 |
| 465 | Ga0207652_10077669 | 3300025921 | Bacteria | 2897 |
| 466 | Ga0207681_10000370 | 3300025923 | Bacteria | 31836 |
| 467 | Ga0207681_10035787 | 3300025923 | Bacteria | 3273 |
| 468 | Ga0207681_10051828 | 3300025923 | Bacteria | 2781 |
| 469 | Ga0207694_10096260 | 3300025924 | Bacteria | 2341 |
| 470 | Ga0207694_10287683 | 3300025924 | Bacteria | 1351 |
| 471 | Ga0207650_10015721 | 3300025925 | Bacteria | 5275 |
| 472 | Ga0207659_10000038 | 3300025926 | Bacteria | 93848 |
| 473 | Ga0207659_10015533 | 3300025926 | Bacteria | 4936 |
| 474 | Ga0207687_10000342 | 3300025927 | Bacteria | 31186 |
| 475 | Ga0207687_10043424 | 3300025927 | Bacteria | 3097 |
| 476 | Ga0207687_10111636 | 3300025927 | Bacteria | 2030 |
| 477 | Ga0207700_10102516 | 3300025928 | Bacteria | 2286 |
| 478 | Ga0207700_10123117 | 3300025928 | Bacteria | 2106 |
| 479 | Ga0207700_10208060 | 3300025928 | Bacteria | 1652 |
| 480 | Ga0207664_10091280 | 3300025929 | Bacteria | 2497 |
| 481 | Ga0207664_10157677 | 3300025929 | Bacteria | 1933 |
| 482 | Ga0207644_10000825 | 3300025931 | Bacteria | 19709 |
| 483 | Ga0207644_10012480 | 3300025931 | Bacteria | 5645 |
| 484 | Ga0207644_10015448 | 3300025931 | Bacteria | 5124 |
| 485 | Ga0207690_10000239 | 3300025932 | Bacteria | 39850 |
| 486 | Ga0207690_10002494 | 3300025932 | Bacteria | 11127 |
| 487 | Ga0207690_10031361 | 3300025932 | Bacteria | 3400 |
| 488 | Ga0207706_10000424 | 3300025933 | Bacteria | 45410 |
| 489 | Ga0207706_10001779 | 3300025933 | Bacteria | 21159 |
| 490 | Ga0207706_10006933 | 3300025933 | Bacteria | 10478 |
| 491 | Ga0207686_10001581 | 3300025934 | Bacteria | 12802 |
| 492 | Ga0207686_10005903 | 3300025934 | Bacteria | 6575 |
| 493 | Ga0207709_10000379 | 3300025935 | Bacteria | 44189 |
| 494 | Ga0207709_10134686 | 3300025935 | Bacteria | 1689 |
| 495 | Ga0207670_10000176 | 3300025936 | Bacteria | 42483 |
| 496 | Ga0207670_10008695 | 3300025936 | Bacteria | 5749 |
| 497 | Ga0207670_10029969 | 3300025936 | Bacteria | 3472 |
| 498 | Ga0207669_10000165 | 3300025937 | Bacteria | 31741 |
| 499 | Ga0207669_10005756 | 3300025937 | Bacteria | 5595 |
| 500 | Ga0207704_10001293 | 3300025938 | Bacteria | 11185 |
| 501 | Ga0207704_10010329 | 3300025938 | Bacteria | 4549 |
| 502 | Ga0207704_10011009 | 3300025938 | Bacteria | 4438 |
| 503 | Ga0207704_10119380 | 3300025938 | Bacteria | 1801 |
| 504 | Ga0207665_10007116 | 3300025939 | Bacteria | 7407 |
| 505 | Ga0207691_10000358 | 3300025940 | Bacteria | 46095 |
| 506 | Ga0207691_10273156 | 3300025940 | Bacteria | 1455 |
| 507 | Ga0207711_10000792 | 3300025941 | Bacteria | 31089 |
| 508 | Ga0207711_10182716 | 3300025941 | Bacteria | 1908 |
| 509 | Ga0207689_10000479 | 3300025942 | Bacteria | 37696 |
| 510 | Ga0207689_10008563 | 3300025942 | Bacteria | 8915 |
| 511 | Ga0207661_10001263 | 3300025944 | Bacteria | 16914 |
| 512 | Ga0207661_10001389 | 3300025944 | Bacteria | 16260 |
| 513 | Ga0207661_10057150 | 3300025944 | Bacteria | 3136 |
| 514 | Ga0207661_10146024 | 3300025944 | Bacteria | 2041 |
| 515 | Ga0207679_10000139 | 3300025945 | Bacteria | 59804 |
| 516 | Ga0207679_10014773 | 3300025945 | Bacteria | 5143 |
| 517 | Ga0207679_10085372 | 3300025945 | Bacteria | 2425 |
| 518 | Ga0207667_10003492 | 3300025949 | Bacteria | 19417 |
| 519 | Ga0207667_10071083 | 3300025949 | Bacteria | 3620 |
| 520 | Ga0207651_10000072 | 3300025960 | Bacteria | 46009 |
| 521 | Ga0207651_10009633 | 3300025960 | Bacteria | 5305 |
| 522 | Ga0207712_10001177 | 3300025961 | Bacteria | 18108 |
| 523 | Ga0207712_10019946 | 3300025961 | Bacteria | 4385 |
| 524 | Ga0207712_10260360 | 3300025961 | Bacteria | 1406 |
| 525 | Ga0207668_10000168 | 3300025972 | Bacteria | 45205 |
| 526 | Ga0207640_10000242 | 3300025981 | Bacteria | 37007 |
| 527 | Ga0207640_10048598 | 3300025981 | Bacteria | 2743 |
| 528 | Ga0207658_10000667 | 3300025986 | Bacteria | 29975 |
| 529 | Ga0207658_10079320 | 3300025986 | Bacteria | 2511 |
| 530 | Ga0207677_10003733 | 3300026023 | Bacteria | 8082 |
| 531 | Ga0207677_10046548 | 3300026023 | Bacteria | 2905 |
| 532 | Ga0207703_10000463 | 3300026035 | Bacteria | 42725 |
| 533 | Ga0207703_10026226 | 3300026035 | Bacteria | 4585 |
| 534 | Ga0207639_10000745 | 3300026041 | Bacteria | 22238 |
| 535 | Ga0207639_10054106 | 3300026041 | Bacteria | 3066 |
| 536 | Ga0207678_10000447 | 3300026067 | Bacteria | 37597 |
| 537 | Ga0207678_10004671 | 3300026067 | Bacteria | 12299 |
| 538 | Ga0207678_10005453 | 3300026067 | Bacteria | 11377 |
| 539 | Ga0207678_10005767 | 3300026067 | Bacteria | 11038 |
| 540 | Ga0207678_10027584 | 3300026067 | Bacteria | 4955 |
| 541 | Ga0207708_10000293 | 3300026075 | Bacteria | 39298 |
| 542 | Ga0207708_10001428 | 3300026075 | Bacteria | 17910 |
| 543 | Ga0207708_10003697 | 3300026075 | Bacteria | 11292 |
| 544 | Ga0207708_10094413 | 3300026075 | Bacteria | 2309 |
| 545 | Ga0207702_10001723 | 3300026078 | Bacteria | 21539 |
| 546 | Ga0207641_10000724 | 3300026088 | Bacteria | 35413 |
| 547 | Ga0207641_10017293 | 3300026088 | Bacteria | 5902 |
| 548 | Ga0207648_10000223 | 3300026089 | Bacteria | 61064 |
| 549 | Ga0207648_10010764 | 3300026089 | Bacteria | 8642 |
| 550 | Ga0207648_10011893 | 3300026089 | Bacteria | 8178 |
| 551 | Ga0207648_10474558 | 3300026089 | Bacteria | 1142 |
| 552 | Ga0207676_10000392 | 3300026095 | Bacteria | 37207 |
| 553 | Ga0207676_10010604 | 3300026095 | Bacteria | 6568 |
| 554 | Ga0207676_10357479 | 3300026095 | Bacteria | 1352 |
| 555 | Ga0207674_10000955 | 3300026116 | Bacteria | 37769 |
| 556 | Ga0207674_10051516 | 3300026116 | Bacteria | 4201 |
| 557 | Ga0207674_10060640 | 3300026116 | Bacteria | 3824 |
| 558 | Ga0207675_100000364 | 3300026118 | Bacteria | 43420 |
| 559 | Ga0207675_100001777 | 3300026118 | Bacteria | 21552 |
| 560 | Ga0207675_100002590 | 3300026118 | Bacteria | 17909 |
| 561 | Ga0207675_100005082 | 3300026118 | Bacteria | 12662 |
| 562 | Ga0207675_100185704 | 3300026118 | Bacteria | 1993 |
| 563 | Ga0207683_10000397 | 3300026121 | Bacteria | 39911 |
| 564 | Ga0207683_10003810 | 3300026121 | Bacteria | 13064 |
| 565 | Ga0207683_10010729 | 3300026121 | Bacteria | 7811 |
| 566 | Ga0207698_10000818 | 3300026142 | Bacteria | 18058 |
| 567 | Ga0207698_10005989 | 3300026142 | Bacteria | 7558 |
| 568 | Ga0207698_10101211 | 3300026142 | Bacteria | 2389 |
| 569 | Ga0209389_1000012 | 3300027296 | Bacteria | 213243 |
| 570 | Ga0209489_100019 | 3300027361 | Bacteria | 213243 |
| 571 | Ga0209700_100018 | 3300027363 | Bacteria | 238200 |
| 572 | Ga0209981_1001220 | 3300027378 | Bacteria | 3258 |
| 573 | Ga0210000_1000129 | 3300027462 | Bacteria | 10819 |
| 574 | Ga0209588_1001156 | 3300027671 | Bacteria | 6803 |
| 575 | Ga0209998_10000687 | 3300027717 | Bacteria | 9049 |
| 576 | Ga0209998_10002273 | 3300027717 | Bacteria | 4445 |
| 577 | Ga0209813_10005075 | 3300027866 | Bacteria | 3180 |
| 578 | Ga0209813_10022115 | 3300027866 | Bacteria | 1795 |
| 579 | Ga0209974_10000890 | 3300027876 | Bacteria | 10388 |
| 580 | Ga0209974_10022678 | 3300027876 | Bacteria | 2079 |
| 581 | Ga0207428_10000050 | 3300027907 | Bacteria | 177286 |
| 582 | Ga0207428_10000439 | 3300027907 | Bacteria | 50911 |
| 583 | Ga0207428_10000617 | 3300027907 | Bacteria | 42011 |
| 584 | Ga0268266_10002721 | 3300028379 | Bacteria | 18537 |
| 585 | Ga0268266_10023640 | 3300028379 | Bacteria | 5231 |
| 586 | Ga0268266_10042367 | 3300028379 | Bacteria | 3888 |
| 587 | Ga0268266_10206615 | 3300028379 | Bacteria | 1799 |
| 588 | Ga0268265_10000249 | 3300028380 | Bacteria | 61376 |
| 589 | Ga0268265_10001307 | 3300028380 | Bacteria | 21379 |
| 590 | Ga0268265_10004440 | 3300028380 | Bacteria | 9740 |
| 591 | Ga0268265_10008357 | 3300028380 | Bacteria | 6990 |
| 592 | Ga0268265_10036896 | 3300028380 | Bacteria | 3583 |
| 593 | Ga0268264_10003260 | 3300028381 | Bacteria | 14034 |
| 594 | Ga0268264_10022151 | 3300028381 | Bacteria | 5187 |
| 595 | Ga0268264_10031810 | 3300028381 | Bacteria | 4327 |
| 596 | Ga0268264_10121445 | 3300028381 | Bacteria | 2303 |
| 597 | Ga0268264_10180258 | 3300028381 | Bacteria | 1918 |
| 598 | Ga0265318_10008937 | 3300028577 | Bacteria | 4436 |
| 599 | Ga0265338_10038980 | 3300028800 | Bacteria | 4492 |
| 600 | Ga0265773_1001590 | 3300031018 | Bacteria | 1253 |
| 601 | Ga0265760_10048313 | 3300031090 | Bacteria | 1278 |
| 602 | Ga0265330_10095096 | 3300031235 | Bacteria | 1277 |
| 603 | Ga0265320_10002095 | 3300031240 | Bacteria | 14042 |
| 604 | Ga0265325_10000043 | 3300031241 | Bacteria | 89158 |
| 605 | Ga0265325_10008854 | 3300031241 | Bacteria | 5913 |
| 606 | Ga0265325_10026580 | 3300031241 | Bacteria | 3133 |
| 607 | Ga0265340_10006812 | 3300031247 | Bacteria | 6253 |
| 608 | Ga0265340_10013225 | 3300031247 | Bacteria | 4342 |
| 609 | Ga0265339_10009370 | 3300031249 | Bacteria | 6159 |
| 610 | Ga0265339_10014659 | 3300031249 | Bacteria | 4719 |
| 611 | Ga0265339_10033503 | 3300031249 | Bacteria | 2891 |
| 612 | Ga0265339_10107879 | 3300031249 | Bacteria | 1444 |
| 613 | Ga0265327_10000070 | 3300031251 | Bacteria | 217350 |
| 614 | Ga0265316_10050529 | 3300031344 | Bacteria | 3269 |
| 615 | Ga0265316_10062311 | 3300031344 | Bacteria | 2895 |
| 616 | Ga0265316_10099832 | 3300031344 | Bacteria | 2207 |
| 617 | Ga0265316_10317540 | 3300031344 | Bacteria | 1132 |
| 618 | Ga0307513_10112561 | 3300031456 | Bacteria | 2711 |
| 619 | Ga0265313_10000269 | 3300031595 | Bacteria | 56767 |
| 620 | Ga0265313_10001300 | 3300031595 | Bacteria | 23590 |
| 621 | Ga0265313_10017513 | 3300031595 | Bacteria | 4068 |
| 622 | Ga0265313_10063020 | 3300031595 | Bacteria | 1730 |
| 623 | Ga0265313_10077352 | 3300031595 | Bacteria | 1519 |
| 624 | Ga0265314_10000708 | 3300031711 | Bacteria | 40357 |
| 625 | Ga0265314_10001057 | 3300031711 | Bacteria | 32018 |
| 626 | Ga0265314_10042742 | 3300031711 | Bacteria | 3228 |
| 627 | Ga0265314_10047083 | 3300031711 | Bacteria | 3038 |
| 628 | Ga0265314_10061525 | 3300031711 | Bacteria | 2556 |
| 629 | Ga0265342_10001200 | 3300031712 | Bacteria | 24613 |
| 630 | Ga0265342_10033550 | 3300031712 | Bacteria | 3155 |
| 631 | Ga0265342_10108591 | 3300031712 | Bacteria | 1573 |
| 632 | Ga0307405_10010582 | 3300031731 | Bacteria | 4793 |
| 633 | Ga0307410_10060157 | 3300031852 | Bacteria | 2595 |
| 634 | Ga0307406_10004455 | 3300031901 | Bacteria | 7624 |
| 635 | Ga0307412_10016996 | 3300031911 | Bacteria | 4347 |
| 636 | Ga0307409_100001101 | 3300031995 | Bacteria | 12783 |
| 637 | Ga0307416_100001022 | 3300032002 | Bacteria | 14842 |
| 638 | Ga0307416_100726163 | 3300032002 | Bacteria | 1084 |
| 639 | Ga0307411_10091234 | 3300032005 | Bacteria | 2127 |
| 640 | Ga0316583_10000233 | 3300032133 | Bacteria | 15084 |
| 641 | Ga0373930_0000008 | 3300034816 | Bacteria | 20461 |
| 642 | Ga0373948_0001178 | 3300034817 | Bacteria | 3545 |
| 643 | Ga0373950_0004994 | 3300034818 | Bacteria | 1964 |
| 644 | Ga0373958_0001331 | 3300034819 | Bacteria | 3307 |
| 645 | Ga0373958_0002083 | 3300034819 | Bacteria | 2766 |
| 646 | Ga0373959_0000708 | 3300034820 | Bacteria | 5703 |
| 647 | Ga0373938_0000434 | 3300034957 | Bacteria | 6766 |
| 648 | Ga0373938_0000881 | 3300034957 | Bacteria | 4823 |
| 649 | Ga0373928_0000087 | 3300035084 | Bacteria | 16099 |
| 650 | Ga0373928_0001439 | 3300035084 | Bacteria | 4621 |
| 651 | Ga0373929_0000288 | 3300035085 | Bacteria | 9356 |
| 652 | Ga0373929_0001454 | 3300035085 | Bacteria | 4515 |
| 653 | Ga0373934_0017655 | 3300035086 | Bacteria | 2726 |
| 654 | Ga0373934_0092517 | 3300035086 | Bacteria | 1220 |
| 655 | Ga0373940_0004036 | 3300035088 | Bacteria | 3067 |
| 656 | Ga0373940_0004893 | 3300035088 | Bacteria | 2863 |
| 657 | Ga0373949_0001082 | 3300035090 | Bacteria | 8314 |
| 658 | Ga0373949_0004172 | 3300035090 | Bacteria | 3338 |
| 659 | Ga0373951_0000363 | 3300035091 | Bacteria | 13633 |
| 660 | Ga0373951_0006215 | 3300035091 | Bacteria | 2736 |
| 661 | Ga0373952_0000458 | 3300035092 | Bacteria | 7106 |
| 662 | Ga0373952_0000576 | 3300035092 | Bacteria | 6472 |
| 663 | Ga0373923_0004706 | 3300035111 | Bacteria | 4555 |
| 664 | Ga0373923_0015311 | 3300035111 | Bacteria | 2894 |
| 665 | Ga0373932_0000239 | 3300035112 | Bacteria | 16722 |
| 666 | Ga0373932_0000588 | 3300035112 | Bacteria | 11087 |
| 667 | Ga0373936_0000885 | 3300035113 | Bacteria | 10703 |
| 668 | Ga0373936_0016118 | 3300035113 | Bacteria | 2871 |
| 669 | Ga0373939_0000850 | 3300035114 | Bacteria | 7561 |
| 670 | Ga0373939_0001037 | 3300035114 | Bacteria | 6854 |
| 671 | Ga0373939_0015567 | 3300035114 | Bacteria | 1992 |
| 672 | Ga0373939_0026765 | 3300035114 | Bacteria | 1628 |
| 673 | Ga0373941_0000224 | 3300035115 | Bacteria | 10933 |
| 674 | Ga0373941_0003233 | 3300035115 | Bacteria | 3668 |
| 675 | Ga0373953_0012222 | 3300035117 | Bacteria | 3036 |
| 676 | Ga0373953_0051874 | 3300035117 | Bacteria | 1659 |
| 677 | Ga0373954_0006125 | 3300035118 | Bacteria | 5239 |
| 678 | Ga0373954_0042781 | 3300035118 | Bacteria | 2112 |
| 679 | Ga0373954_0092870 | 3300035118 | Bacteria | 1451 |
| 680 | Ga0373956_0002570 | 3300035119 | Bacteria | 7371 |
| 681 | Ga0373956_0014922 | 3300035119 | Bacteria | 3248 |
| 682 | Ga0373956_0049348 | 3300035119 | Bacteria | 1888 |
| 683 | Ga0373957_0000794 | 3300035120 | Bacteria | 8184 |
| 684 | Ga0373957_0058417 | 3300035120 | Bacteria | 1490 |
| 685 | Ga0373960_0000332 | 3300035121 | Bacteria | 9017 |
| 686 | Ga0373960_0000746 | 3300035121 | Bacteria | 6776 |
| 687 | Ga0373943_0003854 | 3300035170 | Bacteria | 6821 |
| 688 | Ga0373946_0007336 | 3300035171 | Bacteria | 4026 |
| 689 | Ga0373955_0000742 | 3300035172 | Bacteria | 14009 |
| 690 | Ga0373955_0024367 | 3300035172 | Bacteria | 3094 |
| 691 | Ga0373955_0039308 | 3300035172 | Bacteria | 2525 |
| 692 | Ga0373955_0061489 | 3300035172 | Bacteria | 2074 |
| 693 | Ga0373955_0348884 | 3300035172 | Bacteria | 896 |
| 694 | Ga0373942_0001505 | 3300035207 | Bacteria | 5990 |
| 695 | Ga0373942_0003587 | 3300035207 | Bacteria | 3640 |
| 696 | Ga0373942_0006955 | 3300035207 | Bacteria | 2614 |
| 697 | Ga0373961_0008690 | 3300035241 | Bacteria | 2473 |
| 698 | Ga0373961_0015663 | 3300035241 | Bacteria | 1942 |
| 699 | Ga0373962_0009042 | 3300035242 | Bacteria | 2460 |
| 700 | Ga0316574_0022902 | 3300035398 | Bacteria | 3725 |
| 701 | Ga0373924_0018781 | 3300035410 | Bacteria | 2670 |
| 702 | Ga0373931_0000089 | 3300035691 | Bacteria | 42136 |
| 703 | Ga0373931_0008141 | 3300035691 | Bacteria | 4966 |
| 704 | Ga0373931_0257657 | 3300035691 | Bacteria | 1063 |
| 705 | Ga0373935_0028731 | 3300035692 | Bacteria | 3437 |
| 706 | Ga0373935_0107304 | 3300035692 | Bacteria | 1849 |
| 707 | Ga0373927_0000700 | 3300035695 | Bacteria | 25687 |
| 708 | Ga0373927_0029040 | 3300035695 | Bacteria | 3605 |
| 709 | Ga0373927_0059833 | 3300035695 | Bacteria | 2464 |
| 710 | Ga0373933_0001294 | 3300035724 | Bacteria | 14734 |
| 711 | Ga0373933_0008278 | 3300035724 | Bacteria | 5678 |
| 712 | Ga0373933_0081196 | 3300035724 | Bacteria | 1989 |
| 713 | Ga0373933_0158036 | 3300035724 | Bacteria | 1438 |
| 714 | Ga0373947_0000333 | 3300035725 | Bacteria | 26541 |
| 715 | Ga0373947_0026284 | 3300035725 | Bacteria | 3401 |
| 716 | Ga0373947_0029462 | 3300035725 | Bacteria | 3221 |
| 717 | Ga0373947_0034198 | 3300035725 | Bacteria | 3005 |
| 718 | Ga0373947_0091172 | 3300035725 | Bacteria | 1901 |
| 719 | Ga0373937_0001701 | 3300036401 | Bacteria | 18497 |
| 720 | Ga0373937_0012221 | 3300036401 | Bacteria | 7540 |
| 721 | Ga0373937_0077266 | 3300036401 | Bacteria | 3076 |
| 722 | Ga0373937_0137870 | 3300036401 | Bacteria | 2281 |
| 723 | Ga0373937_0373666 | 3300036401 | Bacteria | 1352 |
| 724 | Ga0373925_0004318 | 3300037068 | Bacteria | 10760 |
| 725 | Ga0373925_0262653 | 3300037068 | Bacteria | 1387 |
| 726 | Ga0395900_0008179 | 3300037418 | Bacteria | 10764 |
| 727 | Ga0395905_0006120 | 3300037471 | Bacteria | 12156 |
| 728 | Ga0436365_0677631 | 3300039437 | Bacteria | 2144 |
| 729 | Ga0436361_0740814 | 3300039447 | Bacteria | 4372 |
| 730 | Ga0436361_1002425 | 3300039447 | Bacteria | 2703 |
| 731 | Ga0436361_1023583 | 3300039447 | Bacteria | 7107 |
| 732 | Ga0436362_0138375 | 3300039453 | Bacteria | 2240 |
| 733 | Ga0439441_023442 | 3300042001 | Bacteria | 1153 |
| 734 | Ga0439443_000561 | 3300042003 | Bacteria | 3414 |
| 735 | Ga0439450_026201 | 3300042008 | Bacteria | 1283 |
| 736 | Ga0450920_004614 | 3300042122 | Bacteria | 2427 |
| 737 | Ga0450923_000696 | 3300042125 | Bacteria | 3948 |
| 738 | Ga0450898_003595 | 3300042134 | Bacteria | 2236 |
| 739 | Ga0450906_016085 | 3300042145 | Bacteria | 1357 |
| 740 | Ga0439446_0002955 | 3300042156 | Bacteria | 4157 |
| 741 | Ga0439434_0003139 | 3300042435 | Bacteria | 4856 |
| 742 | Ga0439435_0000874 | 3300042436 | Bacteria | 5172 |
| 743 | Ga0439444_0000136 | 3300042437 | Bacteria | 6272 |
| 744 | Ga0439464_0023204 | 3300042439 | Bacteria | 1712 |
| 745 | Ga0439460_0062529 | 3300042461 | Bacteria | 1139 |
| 746 | Ga0466969_0018218 | 3300044656 | Bacteria | 3661 |
| 747 | Ga0466961_0000138 | 3300044693 | Bacteria | 48960 |
| 748 | Ga0453684_0037507 | 3300044712 | Bacteria | 6651 |
| 749 | Ga0453684_0643545 | 3300044712 | Bacteria | 1158 |
| 750 | Ga0466970_0335631 | 3300044765 | Bacteria | 856 |
| 751 | Ga0466959_0009348 | 3300045049 | Bacteria | 6967 |
| 752 | Ga0451576_0018820 | 3300045051 | Bacteria | 7551 |
| 753 | Ga0466967_0157916 | 3300045976 | Bacteria | 2126 |
| 754 | Ga0495603_0000415 | 3300046455 | Bacteria | 23564 |
| 755 | Ga0495603_0055870 | 3300046455 | Bacteria | 2339 |
| 756 | Ga0495629_0020344 | 3300046459 | Bacteria | 4740 |
| 757 | Ga0495629_0030036 | 3300046459 | Bacteria | 3853 |
| 758 | Ga0495629_0046403 | 3300046459 | Bacteria | 3048 |
| 759 | Ga0495638_0033037 | 3300046460 | Bacteria | 3311 |
| 760 | Ga0495638_0054591 | 3300046460 | Bacteria | 2483 |
| 761 | Ga0495641_0015052 | 3300046461 | Bacteria | 4154 |
| 762 | Ga0495651_0014089 | 3300046462 | Bacteria | 6184 |
| 763 | Ga0495651_0019331 | 3300046462 | Bacteria | 5280 |
| 764 | Ga0495653_0007085 | 3300046463 | Bacteria | 9193 |
| 765 | Ga0495653_0025322 | 3300046463 | Bacteria | 4771 |
| 766 | Ga0495653_0066304 | 3300046463 | Bacteria | 2716 |
| 767 | Ga0495580_0000784 | 3300046472 | Bacteria | 27397 |
| 768 | Ga0495580_0025889 | 3300046472 | Bacteria | 4283 |
| 769 | Ga0495580_0066944 | 3300046472 | Bacteria | 2514 |
| 770 | Ga0495580_0265138 | 3300046472 | Bacteria | 1174 |
| 771 | Ga0495582_0004166 | 3300046473 | Bacteria | 8131 |
| 772 | Ga0495582_0260863 | 3300046473 | Bacteria | 994 |
| 773 | Ga0495639_0001444 | 3300046475 | Bacteria | 10615 |
| 774 | Ga0495639_0049117 | 3300046475 | Bacteria | 1915 |
| 775 | Ga0495662_0022760 | 3300046476 | Bacteria | 3025 |
| 776 | Ga0495664_0003467 | 3300046477 | Bacteria | 8586 |
| 777 | Ga0495664_0003541 | 3300046477 | Bacteria | 8516 |
| 778 | Ga0495664_0014840 | 3300046477 | Bacteria | 4422 |
| 779 | Ga0495584_0054169 | 3300046491 | Bacteria | 2019 |
| 780 | Ga0495594_0000288 | 3300046499 | Bacteria | 24905 |
| 781 | Ga0495596_0035124 | 3300046500 | Bacteria | 1989 |
| 782 | Ga0495608_0004655 | 3300046511 | Bacteria | 9808 |
| 783 | Ga0495608_0058931 | 3300046511 | Bacteria | 2530 |
| 784 | Ga0495618_0000705 | 3300046514 | Bacteria | 23292 |
| 785 | Ga0495618_0008530 | 3300046514 | Bacteria | 6194 |
| 786 | Ga0495618_0008714 | 3300046514 | Bacteria | 6129 |
| 787 | Ga0495628_0015272 | 3300046516 | Bacteria | 6415 |
| 788 | Ga0495630_0004473 | 3300046517 | Bacteria | 9800 |
| 789 | Ga0495630_0009360 | 3300046517 | Bacteria | 7042 |
| 790 | Ga0495630_0019770 | 3300046517 | Bacteria | 4955 |
| 791 | Ga0495630_0084340 | 3300046517 | Bacteria | 2399 |
| 792 | Ga0495637_0046579 | 3300046520 | Bacteria | 1834 |
| 793 | Ga0495652_0002132 | 3300046529 | Bacteria | 20866 |
| 794 | Ga0495652_0026899 | 3300046529 | Bacteria | 5075 |
| 795 | Ga0495640_0002127 | 3300046533 | Bacteria | 15810 |
| 796 | Ga0495640_0013819 | 3300046533 | Bacteria | 6132 |
| 797 | Ga0495640_0023194 | 3300046533 | Bacteria | 4529 |
| 798 | Ga0495586_0031112 | 3300046535 | Bacteria | 2857 |
| 799 | Ga0495586_0041279 | 3300046535 | Bacteria | 2484 |
| 800 | Ga0495587_0001771 | 3300046536 | Bacteria | 14440 |
| 801 | Ga0495587_0047896 | 3300046536 | Bacteria | 2533 |
| 802 | Ga0495587_0052199 | 3300046536 | Bacteria | 2413 |
| 803 | Ga0495587_0138923 | 3300046536 | Bacteria | 1387 |
| 804 | Ga0495598_0064414 | 3300046537 | Bacteria | 1139 |
| 805 | Ga0495645_0007720 | 3300046543 | Bacteria | 7486 |
| 806 | Ga0495645_0019743 | 3300046543 | Bacteria | 4855 |
| 807 | Ga0495622_0059771 | 3300046557 | Bacteria | 1764 |
| 808 | Ga0495667_0008577 | 3300046559 | Bacteria | 6936 |
| 809 | Ga0495667_0009171 | 3300046559 | Bacteria | 6720 |
| 810 | Ga0495667_0013545 | 3300046559 | Bacteria | 5516 |
| 811 | Ga0495668_0011373 | 3300046616 | Bacteria | 5334 |
| 812 | Ga0495668_0015058 | 3300046616 | Bacteria | 4524 |
| 813 | Ga0495634_0012668 | 3300046642 | Bacteria | 6104 |
| 814 | Ga0495634_0013833 | 3300046642 | Bacteria | 5829 |
| 815 | Ga0495634_0015350 | 3300046642 | Bacteria | 5505 |
| 816 | Ga0495634_0035879 | 3300046642 | Bacteria | 3393 |
| 817 | Ga0495634_0129146 | 3300046642 | Bacteria | 1612 |
| 818 | Ga0495635_0001121 | 3300046663 | Bacteria | 17818 |
| 819 | Ga0495635_0056869 | 3300046663 | Bacteria | 2692 |
| 820 | Ga0495635_0061392 | 3300046663 | Bacteria | 2582 |
| 821 | Ga0495635_0088758 | 3300046663 | Bacteria | 2115 |
| 822 | Ga0495588_0001822 | 3300046674 | Bacteria | 9083 |
| 823 | Ga0495657_0037813 | 3300046675 | Bacteria | 3324 |
| 824 | Ga0495657_0051163 | 3300046675 | Bacteria | 2774 |
| 825 | Ga0495657_0056007 | 3300046675 | Bacteria | 2628 |
| 826 | Ga0495599_0074444 | 3300046678 | Bacteria | 2120 |
| 827 | Ga0495623_0000055 | 3300046679 | Bacteria | 69548 |
| 828 | Ga0495623_0006302 | 3300046679 | Bacteria | 7714 |
| 829 | Ga0495623_0056896 | 3300046679 | Bacteria | 2461 |
| 830 | Ga0495623_0106601 | 3300046679 | Bacteria | 1702 |
| 831 | Ga0495646_0006354 | 3300046680 | Bacteria | 7493 |
| 832 | Ga0495647_0005365 | 3300046681 | Bacteria | 4200 |
| 833 | Ga0495647_0054777 | 3300046681 | Bacteria | 1559 |
| 834 | Ga0495658_0004925 | 3300046683 | Bacteria | 6551 |
| 835 | Ga0495658_0045105 | 3300046683 | Bacteria | 2473 |
| 836 | Ga0495669_0043811 | 3300046684 | Bacteria | 1993 |
| 837 | Ga0495669_0062693 | 3300046684 | Bacteria | 1685 |
| 838 | Ga0495669_0111800 | 3300046684 | Bacteria | 1276 |
| 839 | Ga0495613_0001672 | 3300046689 | Bacteria | 16893 |
| 840 | Ga0495624_0009051 | 3300046690 | Bacteria | 6912 |
| 841 | Ga0495671_0200359 | 3300046692 | Bacteria | 968 |
| 842 | Ga0495649_0069278 | 3300046694 | Bacteria | 1892 |
| 843 | Ga0495600_0019135 | 3300046809 | Bacteria | 4368 |
| 844 | Ga0495600_0154296 | 3300046809 | Bacteria | 1486 |
| 845 | Ga0495581_0010457 | 3300047315 | Bacteria | 5366 |
| 846 | Ga0495604_0037784 | 3300047317 | Bacteria | 3800 |
| 847 | Ga0495604_0214483 | 3300047317 | Bacteria | 1328 |
| 848 | Ga0495604_0230201 | 3300047317 | Bacteria | 1271 |
| 849 | Ga0495604_0334707 | 3300047317 | Bacteria | 1009 |
| 850 | Ga0495674_0010267 | 3300047319 | Bacteria | 8867 |
| 851 | Ga0495674_0010269 | 3300047319 | Bacteria | 8867 |
| 852 | Ga0495674_0016713 | 3300047319 | Bacteria | 6845 |
| 853 | Ga0495674_0048516 | 3300047319 | Bacteria | 3757 |
| 854 | Ga0495674_0169082 | 3300047319 | Bacteria | 1825 |
| 855 | Ga0495672_0009172 | 3300047320 | Bacteria | 7205 |
| 856 | Ga0495676_0078332 | 3300047321 | Bacteria | 2517 |
| 857 | Ga0495676_0078890 | 3300047321 | Bacteria | 2505 |
| 858 | Ga0495680_0001836 | 3300047322 | Bacteria | 22387 |
| 859 | Ga0495680_0015898 | 3300047322 | Bacteria | 6478 |
| 860 | Ga0495675_0022095 | 3300047444 | Bacteria | 4055 |
| 861 | Ga0495684_0002670 | 3300047471 | Bacteria | 14133 |
| 862 | Ga0495684_0006327 | 3300047471 | Bacteria | 9203 |
| 863 | Ga0495684_0009509 | 3300047471 | Bacteria | 7501 |
| 864 | Ga0495684_0152417 | 3300047471 | Bacteria | 1727 |
| 865 | Ga0495593_0001141 | 3300047673 | Bacteria | 15478 |
| 866 | Ga0495593_0004434 | 3300047673 | Bacteria | 8339 |
| 867 | Ga0495593_0011395 | 3300047673 | Bacteria | 5109 |
| 868 | Ga0495602_0007511 | 3300048088 | Bacteria | 11399 |
| 869 | Ga0495602_0012226 | 3300048088 | Bacteria | 8836 |
| 870 | Ga0495602_0122305 | 3300048088 | Bacteria | 2092 |
| 871 | Ga0495614_0020350 | 3300048089 | Bacteria | 2870 |
| 872 | Ga0495614_0098525 | 3300048089 | Bacteria | 1276 |
| 873 | Ga0496100_0000200 | 3300048903 | Bacteria | 32909 |
| 874 | Ga0496100_0013332 | 3300048903 | Bacteria | 4737 |
| 875 | Ga0496100_0025238 | 3300048903 | Bacteria | 3633 |
| 876 | Ga0496100_0075923 | 3300048903 | Bacteria | 2255 |
| 877 | Ga0496100_0108676 | 3300048903 | Bacteria | 1924 |
| 878 | Ga0496101_0000339 | 3300048904 | Bacteria | 31619 |
| 879 | Ga0496101_0051165 | 3300048904 | Bacteria | 2976 |
| 880 | Ga0496101_0109216 | 3300048904 | Bacteria | 2081 |
| 881 | Ga0496101_0122835 | 3300048904 | Bacteria | 1964 |
| 882 | Ga0496102_0000729 | 3300048905 | Bacteria | 32340 |
| 883 | Ga0496102_0030139 | 3300048905 | Bacteria | 4856 |
| 884 | Ga0496102_0033365 | 3300048905 | Bacteria | 4625 |
| 885 | Ga0496102_0219837 | 3300048905 | Bacteria | 1790 |
| 886 | Ga0496102_0299934 | 3300048905 | Bacteria | 1514 |
| 887 | Ga0496103_0001522 | 3300048906 | Bacteria | 15479 |
| 888 | Ga0496103_0010791 | 3300048906 | Bacteria | 5406 |
| 889 | Ga0496103_0025697 | 3300048906 | Bacteria | 3561 |
| 890 | Ga0496104_0000903 | 3300048907 | Bacteria | 25453 |
| 891 | Ga0496104_0003346 | 3300048907 | Bacteria | 13842 |
| 892 | Ga0496104_0004368 | 3300048907 | Bacteria | 12305 |
| 893 | Ga0496104_0016056 | 3300048907 | Bacteria | 6796 |
| 894 | Ga0496104_0033068 | 3300048907 | Bacteria | 4814 |
| 895 | Ga0496104_0096038 | 3300048907 | Bacteria | 2835 |
| 896 | Ga0496104_0256901 | 3300048907 | Bacteria | 1660 |
| 897 | Ga0496104_0301658 | 3300048907 | Bacteria | 1514 |
| 898 | Ga0496105_0000246 | 3300048908 | Bacteria | 36588 |
| 899 | Ga0496105_0003097 | 3300048908 | Bacteria | 12230 |
| 900 | Ga0496105_0008077 | 3300048908 | Bacteria | 8182 |
| 901 | Ga0496105_0050267 | 3300048908 | Bacteria | 3443 |
| 902 | Ga0496105_0051291 | 3300048908 | Bacteria | 3408 |
| 903 | Ga0496105_0173568 | 3300048908 | Bacteria | 1767 |
| 904 | Ga0496105_0296251 | 3300048908 | Bacteria | 1301 |
| 905 | Ga0496106_0000202 | 3300048909 | Bacteria | 41819 |
| 906 | Ga0496106_0008382 | 3300048909 | Bacteria | 7647 |
| 907 | Ga0496106_0013666 | 3300048909 | Bacteria | 5994 |
| 908 | Ga0496106_0026406 | 3300048909 | Bacteria | 4325 |
| 909 | Ga0496106_0028487 | 3300048909 | Bacteria | 4160 |
| 910 | Ga0496106_0044542 | 3300048909 | Bacteria | 3331 |
| 911 | Ga0496107_0000066 | 3300048910 | Bacteria | 52207 |
| 912 | Ga0496107_0001145 | 3300048910 | Bacteria | 16048 |
| 913 | Ga0496107_0003363 | 3300048910 | Bacteria | 10687 |
| 914 | Ga0496107_0008683 | 3300048910 | Bacteria | 7036 |
| 915 | Ga0496107_0093329 | 3300048910 | Bacteria | 2201 |
| 916 | Ga0496107_0125460 | 3300048910 | Bacteria | 1893 |
| 917 | Ga0496108_0002149 | 3300048911 | Bacteria | 15798 |
| 918 | Ga0496108_0003262 | 3300048911 | Bacteria | 13045 |
| 919 | Ga0496108_0021443 | 3300048911 | Bacteria | 5311 |
| 920 | Ga0496108_0049775 | 3300048911 | Bacteria | 3505 |
| 921 | Ga0496108_0071579 | 3300048911 | Bacteria | 2926 |
| 922 | Ga0496108_0151779 | 3300048911 | Bacteria | 1999 |
| 923 | Ga0496109_0000595 | 3300048912 | Bacteria | 30262 |
| 924 | Ga0496109_0004441 | 3300048912 | Bacteria | 11714 |
| 925 | Ga0496109_0016322 | 3300048912 | Bacteria | 6489 |
| 926 | Ga0496109_0037214 | 3300048912 | Bacteria | 4396 |
| 927 | Ga0496110_0009554 | 3300048913 | Bacteria | 7848 |
| 928 | Ga0496110_0023133 | 3300048913 | Bacteria | 5285 |
| 929 | Ga0496110_0028722 | 3300048913 | Bacteria | 4779 |
| 930 | Ga0496110_0170770 | 3300048913 | Bacteria | 1973 |
| 931 | Ga0496111_0001165 | 3300048914 | Bacteria | 14618 |
| 932 | Ga0496111_0002426 | 3300048914 | Bacteria | 11253 |
| 933 | Ga0496111_0224273 | 3300048914 | Bacteria | 1396 |
| 934 | Ga0496112_0003171 | 3300048915 | Bacteria | 13510 |
| 935 | Ga0496112_0037794 | 3300048915 | Bacteria | 4713 |
| 936 | Ga0496112_0076859 | 3300048915 | Bacteria | 3302 |
| 937 | Ga0496113_0001173 | 3300048916 | Bacteria | 14315 |
| 938 | Ga0496113_0001893 | 3300048916 | Bacteria | 11943 |
| 939 | Ga0496113_0023186 | 3300048916 | Bacteria | 4400 |
| 940 | Ga0496113_0028364 | 3300048916 | Bacteria | 4025 |
| 941 | Ga0496113_0046176 | 3300048916 | Bacteria | 3233 |
| 942 | Ga0496113_0104806 | 3300048916 | Bacteria | 2195 |
| 943 | Ga0496113_0127502 | 3300048916 | Bacteria | 1994 |
| 944 | Ga0496114_0004800 | 3300048917 | Bacteria | 10529 |
| 945 | Ga0496114_0245387 | 3300048917 | Bacteria | 1575 |
| 946 | Ga0496115_0005426 | 3300048918 | Bacteria | 9274 |
| 947 | Ga0496115_0006200 | 3300048918 | Bacteria | 8746 |
| 948 | Ga0501031_0059602 | 3300049568 | Bacteria | 2487 |
| 949 | Ga0501032_0124188 | 3300049569 | Bacteria | 1706 |
| 950 | Ga0501032_0217131 | 3300049569 | Bacteria | 1245 |
| 951 | Ga0501033_0043838 | 3300049570 | Bacteria | 3330 |
| 952 | Ga0501033_0125578 | 3300049570 | Bacteria | 1860 |
| 953 | Ga0501033_0296836 | 3300049570 | Bacteria | 1138 |
| 954 | Ga0501034_0027442 | 3300049571 | Bacteria | 5792 |
| 955 | Ga0501034_0039803 | 3300049571 | Bacteria | 4760 |
| 956 | Ga0501034_0094303 | 3300049571 | Bacteria | 2990 |
| 957 | Ga0501034_0195413 | 3300049571 | Bacteria | 1983 |
| 958 | Ga0501034_0300725 | 3300049571 | Bacteria | 1541 |
| 959 | Ga0501036_0001395 | 3300049572 | Bacteria | 18570 |
| 960 | Ga0501036_0002481 | 3300049572 | Bacteria | 14464 |
| 961 | Ga0501036_0014064 | 3300049572 | Bacteria | 6650 |
| 962 | Ga0501036_0163069 | 3300049572 | Bacteria | 1879 |
| 963 | Ga0501036_0421305 | 3300049572 | Bacteria | 1113 |
| 964 | Ga0501037_0002025 | 3300049573 | Bacteria | 14680 |
| 965 | Ga0501037_0023005 | 3300049573 | Bacteria | 4609 |
| 966 | Ga0501037_0057904 | 3300049573 | Bacteria | 2828 |
| 967 | Ga0501037_0092496 | 3300049573 | Bacteria | 2187 |
| 968 | Ga0501037_0118529 | 3300049573 | Bacteria | 1904 |
| 969 | Ga0501038_0011597 | 3300049574 | Bacteria | 8041 |
| 970 | Ga0501038_0027715 | 3300049574 | Bacteria | 5036 |
| 971 | Ga0501038_0069081 | 3300049574 | Bacteria | 3002 |
| 972 | Ga0501038_0086625 | 3300049574 | Bacteria | 2631 |
| 973 | Ga0501038_0132211 | 3300049574 | Bacteria | 2047 |
| 974 | Ga0501038_0164254 | 3300049574 | Bacteria | 1802 |
| 975 | Ga0501038_0183510 | 3300049574 | Bacteria | 1687 |
| 976 | Ga0501038_0193860 | 3300049574 | Bacteria | 1634 |
| 977 | Ga0501039_0001680 | 3300049575 | Bacteria | 16316 |
| 978 | Ga0501039_0002776 | 3300049575 | Bacteria | 13069 |
| 979 | Ga0501039_0039106 | 3300049575 | Bacteria | 3664 |
| 980 | Ga0501039_0118181 | 3300049575 | Bacteria | 2076 |
| 981 | Ga0501039_0136582 | 3300049575 | Bacteria | 1925 |
| 982 | Ga0501039_0170263 | 3300049575 | Bacteria | 1712 |
| 983 | Ga0501040_0006653 | 3300049576 | Bacteria | 7502 |
| 984 | Ga0501040_0028999 | 3300049576 | Bacteria | 3734 |
| 985 | Ga0501040_0213065 | 3300049576 | Bacteria | 1373 |
| 986 | Ga0501041_0000497 | 3300049577 | Bacteria | 20183 |
| 987 | Ga0501041_0032605 | 3300049577 | Bacteria | 3148 |
| 988 | Ga0501041_0231903 | 3300049577 | Bacteria | 1159 |
| 989 | Ga0501042_0023281 | 3300049578 | Bacteria | 4333 |
| 990 | Ga0501042_0070215 | 3300049578 | Bacteria | 2505 |
| 991 | Ga0501042_0174775 | 3300049578 | Bacteria | 1549 |
| 992 | Ga0501042_0229747 | 3300049578 | Bacteria | 1338 |
| 993 | Ga0501043_0013780 | 3300049579 | Bacteria | 6327 |
| 994 | Ga0501043_0043922 | 3300049579 | Bacteria | 3513 |
| 995 | Ga0501043_0080598 | 3300049579 | Bacteria | 2558 |
| 996 | Ga0501043_0240449 | 3300049579 | Bacteria | 1396 |
| 997 | Ga0501046_0014727 | 3300049580 | Bacteria | 6582 |
| 998 | Ga0501046_0019015 | 3300049580 | Bacteria | 5702 |
| 999 | Ga0501046_0025386 | 3300049580 | Bacteria | 4850 |
| 1000 | Ga0501046_0043280 | 3300049580 | Bacteria | 3585 |
| 1001 | Ga0501046_0110135 | 3300049580 | Bacteria | 2105 |
| 1002 | Ga0501046_0155019 | 3300049580 | Bacteria | 1726 |
| 1003 | Ga0501046_0168182 | 3300049580 | Bacteria | 1646 |
| 1004 | Ga0501047_0016677 | 3300049581 | Bacteria | 7016 |
| 1005 | Ga0501047_0017879 | 3300049581 | Bacteria | 6793 |
| 1006 | Ga0501047_0051181 | 3300049581 | Bacteria | 3989 |
| 1007 | Ga0501047_0089977 | 3300049581 | Bacteria | 2946 |
| 1008 | Ga0501048_0208082 | 3300049582 | Bacteria | 1387 |
| 1009 | Ga0501048_0212306 | 3300049582 | Bacteria | 1372 |
| 1010 | Ga0501067_0008683 | 3300049583 | Bacteria | 5630 |
| 1011 | Ga0501068_0008094 | 3300049584 | Bacteria | 5834 |
| 1012 | Ga0501068_0076041 | 3300049584 | Bacteria | 2054 |
| 1013 | Ga0501069_0003072 | 3300049585 | Bacteria | 8552 |
| 1014 | Ga0501069_0060890 | 3300049585 | Bacteria | 2108 |
| 1015 | Ga0501070_0021833 | 3300049586 | Bacteria | 5364 |
| 1016 | Ga0501070_0022581 | 3300049586 | Bacteria | 5269 |
| 1017 | Ga0501071_0000766 | 3300049587 | Bacteria | 17047 |
| 1018 | Ga0501071_0007337 | 3300049587 | Bacteria | 7227 |
| 1019 | Ga0501071_0108401 | 3300049587 | Bacteria | 2051 |
| 1020 | Ga0501071_0187708 | 3300049587 | Bacteria | 1550 |
| 1021 | Ga0501072_0009889 | 3300049588 | Bacteria | 7254 |
| 1022 | Ga0501072_0032021 | 3300049588 | Bacteria | 4116 |
| 1023 | Ga0501072_0065633 | 3300049588 | Bacteria | 2862 |
| 1024 | Ga0501072_0095047 | 3300049588 | Bacteria | 2368 |
| 1025 | Ga0501072_0204161 | 3300049588 | Bacteria | 1576 |
| 1026 | Ga0501073_0014409 | 3300049589 | Bacteria | 5745 |
| 1027 | Ga0501073_0019034 | 3300049589 | Bacteria | 4962 |
| 1028 | Ga0501073_0054973 | 3300049589 | Bacteria | 2786 |
| 1029 | Ga0501073_0126900 | 3300049589 | Bacteria | 1768 |
| 1030 | Ga0501073_0221001 | 3300049589 | Bacteria | 1308 |
| 1031 | Ga0501074_0003316 | 3300049590 | Bacteria | 11391 |
| 1032 | Ga0501074_0027303 | 3300049590 | Bacteria | 4139 |
| 1033 | Ga0501074_0033383 | 3300049590 | Bacteria | 3729 |
| 1034 | Ga0501074_0052771 | 3300049590 | Bacteria | 2934 |
| 1035 | Ga0501074_0222848 | 3300049590 | Bacteria | 1342 |
| 1036 | Ga0501075_0099841 | 3300049591 | Bacteria | 2204 |
| 1037 | Ga0501075_0127620 | 3300049591 | Bacteria | 1937 |
| 1038 | Ga0501075_0137648 | 3300049591 | Bacteria | 1860 |
| 1039 | Ga0501076_0007409 | 3300049592 | Bacteria | 7985 |
| 1040 | Ga0501076_0016060 | 3300049592 | Bacteria | 5669 |
| 1041 | Ga0501076_0101972 | 3300049592 | Bacteria | 2313 |
| 1042 | Ga0501076_0311601 | 3300049592 | Bacteria | 1291 |
| 1043 | Ga0501077_0003968 | 3300049593 | Bacteria | 8923 |
| 1044 | Ga0501077_0008803 | 3300049593 | Bacteria | 6263 |
| 1045 | Ga0501077_0012998 | 3300049593 | Bacteria | 5215 |
| 1046 | Ga0501077_0062634 | 3300049593 | Bacteria | 2359 |
| 1047 | Ga0501077_0094388 | 3300049593 | Bacteria | 1896 |
| 1048 | Ga0501257_001114 | 3300049686 | Bacteria | 5456 |
| 1049 | Ga0501225_0055016 | 3300049705 | Bacteria | 1113 |
| 1050 | Ga0501079_0046758 | 3300049741 | Bacteria | 3339 |
| 1051 | Ga0501079_0049659 | 3300049741 | Bacteria | 3238 |
| 1052 | Ga0501079_0150398 | 3300049741 | Bacteria | 1815 |
| 1053 | Ga0501079_0198713 | 3300049741 | Bacteria | 1566 |
| 1054 | Ga0501080_0007750 | 3300049742 | Bacteria | 9706 |
| 1055 | Ga0501080_0016625 | 3300049742 | Bacteria | 6796 |
| 1056 | Ga0501080_0442164 | 3300049742 | Bacteria | 1166 |
| 1057 | Ga0501081_0000349 | 3300049743 | Bacteria | 24901 |
| 1058 | Ga0501081_0016572 | 3300049743 | Bacteria | 4873 |
| 1059 | Ga0501081_0266432 | 3300049743 | Bacteria | 1252 |
| 1060 | Ga0501083_0000450 | 3300049744 | Bacteria | 26315 |
| 1061 | Ga0501083_0009945 | 3300049744 | Bacteria | 6715 |
| 1062 | Ga0501035_0003133 | 3300049822 | Bacteria | 15887 |
| 1063 | Ga0501035_0040480 | 3300049822 | Bacteria | 4211 |
| 1064 | Ga0501035_0050506 | 3300049822 | Bacteria | 3727 |
| 1065 | Ga0501035_0100420 | 3300049822 | Bacteria | 2540 |
| 1066 | Ga0501044_0000212 | 3300049823 | Bacteria | 73807 |
| 1067 | Ga0501044_0016862 | 3300049823 | Bacteria | 7837 |
| 1068 | Ga0501044_0045666 | 3300049823 | Bacteria | 4538 |
| 1069 | Ga0501044_0074734 | 3300049823 | Bacteria | 3442 |
| 1070 | Ga0501044_0186774 | 3300049823 | Bacteria | 2037 |
| 1071 | Ga0501044_0196147 | 3300049823 | Bacteria | 1979 |
| 1072 | Ga0501045_0002138 | 3300049824 | Bacteria | 13383 |
| 1073 | Ga0501045_0003114 | 3300049824 | Bacteria | 11344 |
| 1074 | Ga0501045_0011177 | 3300049824 | Bacteria | 6294 |
| 1075 | Ga0501045_0039471 | 3300049824 | Bacteria | 3435 |
| 1076 | nmdc:mga00v17_27414_c1 | 3300050491 | Bacteria | 3326 |
| 1077 | nmdc:mga0yw44_6715_c1 | 3300050492 | Bacteria | 5591 |
| 1078 | nmdc:mga06z11_10761_c1 | 3300050494 | Bacteria | 3913 |
| 1079 | nmdc:mga06z11_19093_c1 | 3300050494 | Bacteria | 3145 |
| 1080 | nmdc:mga06z11_34462_c1 | 3300050494 | Bacteria | 2486 |
| 1081 | nmdc:mga04h51_13437_c1 | 3300050495 | Bacteria | 2318 |
| 1082 | nmdc:mga04h51_27419_c1 | 3300050495 | Bacteria | 1770 |
| 1083 | nmdc:mga04h51_9859_c1 | 3300050495 | Bacteria | 2606 |
| 1084 | nmdc:mga07m45_146771_c1 | 3300050496 | Bacteria | 1367 |
| 1085 | nmdc:mga07m45_3083_c1 | 3300050496 | Bacteria | 7965 |
| 1086 | nmdc:mga05p37_137815_c1 | 3300050507 | Bacteria | 2991 |
| 1087 | nmdc:mga05p37_200088_c1 | 3300050507 | Bacteria | 2420 |
| 1088 | nmdc:mga05p37_61358_c1 | 3300050507 | Bacteria | 4628 |
| 1089 | nmdc:mga09592_69829_c1 | 3300050508 | Bacteria | 2980 |
| 1090 | nmdc:mga0qj67_387275_c1 | 3300050509 | Bacteria | 1129 |
| 1091 | nmdc:mga0qj67_6651_c1 | 3300050509 | Bacteria | 8493 |
| 1092 | nmdc:mga06r32_29521_c1 | 3300050510 | Bacteria | 5141 |
| 1093 | nmdc:mga08y16_164_c1 | 3300050511 | Bacteria | 57736 |
| 1094 | nmdc:mga08y16_2044_c1 | 3300050511 | Bacteria | 20676 |
| 1095 | nmdc:mga08y16_256078_c1 | 3300050511 | Bacteria | 1808 |
| 1096 | nmdc:mga08y16_5303_c1 | 3300050511 | Bacteria | 13483 |
| 1097 | nmdc:mga0n895_124602_c1 | 3300050512 | Bacteria | 2600 |
| 1098 | nmdc:mga0n895_133195_c1 | 3300050512 | Bacteria | 2511 |
| 1099 | nmdc:mga0n895_190142_c1 | 3300050512 | Bacteria | 2084 |
| 1100 | nmdc:mga0n895_25898_c1 | 3300050512 | Bacteria | 5547 |
| 1101 | nmdc:mga0n895_54579_c1 | 3300050512 | Bacteria | 3931 |
| 1102 | nmdc:mga0rr50_303490_c1 | 3300050513 | Bacteria | 1336 |
| 1103 | nmdc:mga0rr50_40690_c1 | 3300050513 | Bacteria | 3381 |
| 1104 | nmdc:mga08x19_165168_c1 | 3300050514 | Bacteria | 1505 |
| 1105 | nmdc:mga08x19_6247_c1 | 3300050514 | Bacteria | 7052 |
| 1106 | nmdc:mga0a205_202492_c1 | 3300050515 | Bacteria | 1875 |
| 1107 | nmdc:mga0a205_2432_c1 | 3300050515 | Bacteria | 16422 |
| 1108 | nmdc:mga0a205_42460_c2 | 3300050515 | Bacteria | 3584 |
| 1109 | nmdc:mga0a205_47549_c1 | 3300050515 | Bacteria | 4140 |
| 1110 | nmdc:mga0a205_54118_c1 | 3300050515 | Bacteria | 3874 |
| 1111 | nmdc:mga0sz30_34329_c1 | 3300050516 | Bacteria | 2111 |
| 1112 | Ga0495601_0000164 | 3300053077 | Bacteria | 35933 |
| 1113 | Ga0495601_0000473 | 3300053077 | Bacteria | 21167 |
| 1114 | Ga0495601_0002539 | 3300053077 | Bacteria | 10378 |
| 1115 | Ga0495601_0019932 | 3300053077 | Bacteria | 4093 |
| 1116 | Ga0495601_0078493 | 3300053077 | Bacteria | 2115 |
| 1117 | Ga0495612_0000752 | 3300053078 | Bacteria | 13204 |
| 1118 | Ga0495612_0002586 | 3300053078 | Bacteria | 7465 |
| 1119 | Ga0495655_0005113 | 3300053083 | Bacteria | 2296 |
| 1120 | Ga0495595_0000235 | 3300053084 | Bacteria | 21997 |
| 1121 | Ga0495595_0025013 | 3300053084 | Bacteria | 2640 |
| 1122 | Ga0495619_0000414 | 3300053085 | Bacteria | 29022 |
| 1123 | Ga0495619_0002506 | 3300053085 | Bacteria | 12028 |
| 1124 | Ga0495619_0006012 | 3300053085 | Bacteria | 7689 |
| 1125 | Ga0495619_0014748 | 3300053085 | Bacteria | 4936 |
| 1126 | Ga0495619_0015549 | 3300053085 | Bacteria | 4815 |
| 1127 | Ga0495619_0028733 | 3300053085 | Bacteria | 3589 |
| 1128 | Ga0495619_0045584 | 3300053085 | Bacteria | 2881 |
| 1129 | Ga0495619_0187455 | 3300053085 | Bacteria | 1432 |
| 1130 | Ga0500583_0061363 | 3300053092 | Bacteria | 1775 |
| 1131 | Ga0500595_044011 | 3300053119 | Bacteria | 1418 |
| 1132 | Ga0500655_005256 | 3300053133 | Bacteria | 2336 |
| 1133 | Ga0500577_0043084 | 3300053142 | Bacteria | 1656 |
| 1134 | Ga0500624_000092 | 3300053157 | Bacteria | 43880 |
| 1135 | Ga0500645_024186 | 3300053730 | Bacteria | 1858 |
| 1136 | Ga0501084_0028654 | 3300054114 | Bacteria | 4656 |
| 1137 | Ga0501084_0036665 | 3300054114 | Bacteria | 4096 |
| 1138 | Ga0501084_0039306 | 3300054114 | Bacteria | 3957 |
| 1139 | Ga0501084_0079007 | 3300054114 | Bacteria | 2757 |
| 1140 | Ga0501084_0330017 | 3300054114 | Bacteria | 1288 |
| 1141 | Ga0501082_0042865 | 3300060353 | Bacteria | 3900 |
| 1142 | Ga0501082_0109657 | 3300060353 | Bacteria | 2389 |
| 1143 | Ga0501082_0126934 | 3300060353 | Bacteria | 2212 |
| 1144 | Ga0501082_0165655 | 3300060353 | Bacteria | 1921 |
| 1145 | Ga0501082_0181091 | 3300060353 | Bacteria | 1833 |
| 1146 | Ga0501082_0264547 | 3300060353 | Bacteria | 1496 |
| 1147 | Ga0530510_0040645 | 3300061734 | Bacteria | 3357 |
| 1148 | Ga0530510_0061859 | 3300061734 | Bacteria | 2710 |
| 1149 | Ga0530510_0108672 | 3300061734 | Bacteria | 2030 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300020082 | Ga0206353_11380251 | Ga0206353_113802512 | 248 |
| 2 | 3300005347 | Ga0070668_100006404 | Ga0070668_1000064043 | 250 |
| 3 | 3300005844 | Ga0068862_100000775 | Ga0068862_10000077521 | 250 |
| 4 | 3300026118 | Ga0207675_100185704 | Ga0207675_1001857042 | 250 |
| 5 | 3300028380 | Ga0268265_10000249 | Ga0268265_1000024911 | 250 |
| 6 | 3300049569 | Ga0501032_0217131 | Ga0501032_0217131_156_1121 | 251 |
| 7 | 3300049570 | Ga0501033_0043838 | Ga0501033_0043838_951_1916 | 251 |
| 8 | 3300049573 | Ga0501037_0092496 | Ga0501037_0092496_685_1650 | 251 |
| 9 | 3300049574 | Ga0501038_0132211 | Ga0501038_0132211_398_1363 | 251 |
| 10 | 3300049575 | Ga0501039_0118181 | Ga0501039_0118181_649_1614 | 251 |
| 11 | 3300049578 | Ga0501042_0070215 | Ga0501042_0070215_491_1456 | 251 |
| 12 | 3300049579 | Ga0501043_0240449 | Ga0501043_0240449_324_1289 | 251 |
| 13 | 3300049580 | Ga0501046_0043280 | Ga0501046_0043280_670_1635 | 251 |
| 14 | 3300049584 | Ga0501068_0076041 | Ga0501068_0076041_59_1024 | 251 |
| 15 | 3300049588 | Ga0501072_0032021 | Ga0501072_0032021_2227_3192 | 251 |
| 16 | 3300049590 | Ga0501074_0222848 | Ga0501074_0222848_67_1032 | 251 |
| 17 | 3300049593 | Ga0501077_0094388 | Ga0501077_0094388_648_1613 | 251 |
| 18 | 3300049743 | Ga0501081_0000349 | Ga0501081_0000349_901_1866 | 251 |
| 19 | 3300049822 | Ga0501035_0100420 | Ga0501035_0100420_726_1691 | 251 |
| 20 | 3300049823 | Ga0501044_0186774 | Ga0501044_0186774_526_1491 | 251 |
| 21 | 3300049824 | Ga0501045_0003114 | Ga0501045_0003114_491_1456 | 251 |
| 22 | 3300054114 | Ga0501084_0079007 | Ga0501084_0079007_1283_2248 | 251 |
| 23 | 3300061734 | Ga0530510_0108672 | Ga0530510_0108672_203_1168 | 251 |
| 24 | 3300035086 | Ga0373934_0092517 | Ga0373934_0092517_26_823 | 256 |
| 25 | 3300046663 | Ga0495635_0088758 | Ga0495635_0088758_41_838 | 256 |
| 26 | 3300003187 | JGI25151J46595_10000193 | JGI25151J46595_1000019324 | 257 |
| 27 | 3300003354 | JGI25160J50197_1024073 | JGI25160J50197_10240731 | 257 |
| 28 | 3300025284 | Ga0209130_1000389 | Ga0209130_100038914 | 257 |
| 29 | 3300025294 | Ga0209025_1000061 | Ga0209025_1000061199 | 257 |
| 30 | 3300025297 | Ga0209758_1005524 | Ga0209758_10055245 | 257 |
| 31 | 3300025302 | Ga0207426_1000361 | Ga0207426_100036176 | 257 |
| 32 | 3300049572 | Ga0501036_0014064 | Ga0501036_0014064_4261_5217 | 261 |
| 33 | 3300049573 | Ga0501037_0002025 | Ga0501037_0002025_12737_13693 | 261 |
| 34 | 3300049575 | Ga0501039_0002776 | Ga0501039_0002776_3216_4172 | 261 |
| 35 | 3300049578 | Ga0501042_0023281 | Ga0501042_0023281_949_1905 | 261 |
| 36 | 3300049579 | Ga0501043_0013780 | Ga0501043_0013780_2597_3553 | 261 |
| 37 | 3300049580 | Ga0501046_0014727 | Ga0501046_0014727_4373_5329 | 261 |
| 38 | 3300049583 | Ga0501067_0008683 | Ga0501067_0008683_4519_5475 | 261 |
| 39 | 3300049584 | Ga0501068_0008094 | Ga0501068_0008094_475_1431 | 261 |
| 40 | 3300049585 | Ga0501069_0003072 | Ga0501069_0003072_3586_4542 | 261 |
| 41 | 3300049587 | Ga0501071_0007337 | Ga0501071_0007337_3529_4485 | 261 |
| 42 | 3300049588 | Ga0501072_0204161 | Ga0501072_0204161_559_1515 | 261 |
| 43 | 3300049590 | Ga0501074_0003316 | Ga0501074_0003316_5723_6679 | 261 |
| 44 | 3300049744 | Ga0501083_0009945 | Ga0501083_0009945_4582_5538 | 261 |
| 45 | 3300049824 | Ga0501045_0011177 | Ga0501045_0011177_616_1572 | 261 |
| 46 | 3300054114 | Ga0501084_0028654 | Ga0501084_0028654_1930_2886 | 261 |
| 47 | 3300035118 | Ga0373954_0042781 | Ga0373954_0042781_268_1065 | 265 |
| 48 | 3300035410 | Ga0373924_0018781 | Ga0373924_0018781_1030_1827 | 265 |
| 49 | 3300035724 | Ga0373933_0001294 | Ga0373933_0001294_8675_9472 | 265 |
| 50 | 3300044765 | Ga0466970_0335631 | Ga0466970_0335631_16_813 | 265 |
| 51 | 3300046511 | Ga0495608_0058931 | Ga0495608_0058931_1260_2057 | 265 |
| 52 | 3300046642 | Ga0495634_0129146 | Ga0495634_0129146_791_1588 | 265 |
| 53 | 3300046679 | Ga0495623_0106601 | Ga0495623_0106601_781_1578 | 265 |
| 54 | 3300047317 | Ga0495604_0214483 | Ga0495604_0214483_518_1315 | 265 |
| 55 | 3300047317 | Ga0495604_0230201 | Ga0495604_0230201_29_826 | 265 |
| 56 | 3300049582 | Ga0501048_0212306 | Ga0501048_0212306_25_822 | 265 |
| 57 | 3300053077 | Ga0495601_0078493 | Ga0495601_0078493_84_881 | 265 |
| 58 | 3300053084 | Ga0495595_0025013 | Ga0495595_0025013_1224_2021 | 265 |
| 59 | 3300053085 | Ga0495619_0014748 | Ga0495619_0014748_2702_3499 | 265 |
| 60 | 3300054114 | Ga0501084_0039306 | Ga0501084_0039306_3126_3923 | 265 |
| 61 | 3300006051 | Ga0075364_10204264 | Ga0075364_102042642 | 266 |
| 62 | 3300031240 | Ga0265320_10002095 | Ga0265320_100020957 | 269 |
| 63 | 3300031595 | Ga0265313_10063020 | Ga0265313_100630202 | 269 |
| 64 | 3300031711 | Ga0265314_10001057 | Ga0265314_100010576 | 269 |
| 65 | 3300044712 | Ga0453684_0037507 | Ga0453684_0037507_4693_5640 | 269 |
| 66 | 3300005340 | Ga0070689_100018460 | Ga0070689_1000184604 | 270 |
| 67 | 3300005343 | Ga0070687_100028601 | Ga0070687_1000286013 | 270 |
| 68 | 3300005466 | Ga0070685_10250085 | Ga0070685_102500851 | 270 |
| 69 | 3300009098 | Ga0105245_10006657 | Ga0105245_100066573 | 270 |
| 70 | 3300013297 | Ga0157378_10082672 | Ga0157378_100826721 | 270 |
| 71 | 3300025918 | Ga0207662_10005578 | Ga0207662_100055786 | 270 |
| 72 | 3300025927 | Ga0207687_10111636 | Ga0207687_101116362 | 270 |
| 73 | 3300025936 | Ga0207670_10029969 | Ga0207670_100299693 | 270 |
| 74 | 3300025940 | Ga0207691_10273156 | Ga0207691_102731562 | 270 |
| 75 | 3300009094 | Ga0111539_10044669 | Ga0111539_100446693 | 271 |
| 76 | 3300027907 | Ga0207428_10000050 | Ga0207428_10000050122 | 271 |
| 77 | 3300050511 | nmdc:mga08y16_164_c1 | nmdc:mga08y16_164_c1_38860_39816 | 271 |
| 78 | 3300006186 | Ga0075369_10023201 | Ga0075369_100232012 | 273 |
| 79 | 3300005549 | Ga0070704_100026429 | Ga0070704_1000264292 | 274 |
| 80 | 3300005615 | Ga0070702_100175884 | Ga0070702_1001758842 | 274 |
| 81 | 3300006871 | Ga0075434_100055241 | Ga0075434_1000552414 | 274 |
| 82 | 3300009147 | Ga0114129_10059574 | Ga0114129_100595744 | 274 |
| 83 | 3300009148 | Ga0105243_10174090 | Ga0105243_101740902 | 274 |
| 84 | 3300048904 | Ga0496101_0109216 | Ga0496101_0109216_345_1301 | 274 |
| 85 | 3300048913 | Ga0496110_0170770 | Ga0496110_0170770_190_1137 | 274 |
| 86 | 3300048915 | Ga0496112_0076859 | Ga0496112_0076859_1571_2518 | 274 |
| 87 | 3300048916 | Ga0496113_0104806 | Ga0496113_0104806_632_1579 | 274 |
| 88 | 3300050507 | nmdc:mga05p37_61358_c1 | nmdc:mga05p37_61358_c1_1576_2523 | 274 |
| 89 | 3300050515 | nmdc:mga0a205_202492_c1 | nmdc:mga0a205_202492_c1_556_1503 | 274 |
| 90 | 3300005458 | Ga0070681_10061642 | Ga0070681_100616423 | 275 |
| 91 | 3300025921 | Ga0207652_10025093 | Ga0207652_100250932 | 275 |
| 92 | 3300046536 | Ga0495587_0138923 | Ga0495587_0138923_523_1350 | 275 |
| 93 | 3300035172 | Ga0373955_0348884 | Ga0373955_0348884_19_849 | 276 |
| 94 | 3300047317 | Ga0495604_0334707 | Ga0495604_0334707_155_985 | 276 |
| 95 | 3300027378 | Ga0209981_1001220 | Ga0209981_10012203 | 277 |
| 96 | 3300027462 | Ga0210000_1000129 | Ga0210000_10001299 | 277 |
| 97 | 3300049587 | Ga0501071_0187708 | Ga0501071_0187708_15_971 | 277 |
| 98 | 3300005548 | Ga0070665_100003075 | Ga0070665_1000030754 | 278 |
| 99 | 3300006175 | Ga0070712_100034712 | Ga0070712_1000347122 | 278 |
| 100 | 3300028379 | Ga0268266_10002721 | Ga0268266_100027218 | 278 |
| 101 | 3300046460 | Ga0495638_0033037 | Ga0495638_0033037_499_1425 | 278 |
| 102 | 3300053119 | Ga0500595_044011 | Ga0500595_044011_88_1044 | 278 |
| 103 | 3300035113 | Ga0373936_0016118 | Ga0373936_0016118_1251_2207 | 279 |
| 104 | 3300035171 | Ga0373946_0007336 | Ga0373946_0007336_107_1063 | 279 |
| 105 | 3300035172 | Ga0373955_0039308 | Ga0373955_0039308_100_1056 | 279 |
| 106 | 3300035695 | Ga0373927_0000700 | Ga0373927_0000700_8258_9214 | 279 |
| 107 | 3300035725 | Ga0373947_0000333 | Ga0373947_0000333_8656_9612 | 279 |
| 108 | 3300037068 | Ga0373925_0004318 | Ga0373925_0004318_9509_10465 | 279 |
| 109 | 3300037418 | Ga0395900_0008179 | Ga0395900_0008179_6390_7346 | 279 |
| 110 | 3300037471 | Ga0395905_0006120 | Ga0395905_0006120_3079_4035 | 279 |
| 111 | 3300046459 | Ga0495629_0046403 | Ga0495629_0046403_88_1044 | 279 |
| 112 | 3300046472 | Ga0495580_0025889 | Ga0495580_0025889_347_1303 | 279 |
| 113 | 3300046475 | Ga0495639_0049117 | Ga0495639_0049117_669_1625 | 279 |
| 114 | 3300046477 | Ga0495664_0003467 | Ga0495664_0003467_3758_4714 | 279 |
| 115 | 3300046514 | Ga0495618_0000705 | Ga0495618_0000705_5272_6228 | 279 |
| 116 | 3300046517 | Ga0495630_0004473 | Ga0495630_0004473_7317_8273 | 279 |
| 117 | 3300046517 | Ga0495630_0009360 | Ga0495630_0009360_4855_5811 | 279 |
| 118 | 3300046533 | Ga0495640_0002127 | Ga0495640_0002127_11279_12235 | 279 |
| 119 | 3300046535 | Ga0495586_0031112 | Ga0495586_0031112_1593_2549 | 279 |
| 120 | 3300046543 | Ga0495645_0019743 | Ga0495645_0019743_3217_4173 | 279 |
| 121 | 3300046642 | Ga0495634_0012668 | Ga0495634_0012668_5014_5970 | 279 |
| 122 | 3300046690 | Ga0495624_0009051 | Ga0495624_0009051_3938_4894 | 279 |
| 123 | 3300047315 | Ga0495581_0010457 | Ga0495581_0010457_1348_2304 | 279 |
| 124 | 3300047319 | Ga0495674_0048516 | Ga0495674_0048516_2804_3742 | 279 |
| 125 | 3300047319 | Ga0495674_0169082 | Ga0495674_0169082_80_1036 | 279 |
| 126 | 3300047321 | Ga0495676_0078890 | Ga0495676_0078890_46_1002 | 279 |
| 127 | 3300047471 | Ga0495684_0002670 | Ga0495684_0002670_3987_4943 | 279 |
| 128 | 3300047673 | Ga0495593_0004434 | Ga0495593_0004434_2351_3307 | 279 |
| 129 | 3300053077 | Ga0495601_0019932 | Ga0495601_0019932_2804_3760 | 279 |
| 130 | 3300053085 | Ga0495619_0015549 | Ga0495619_0015549_3753_4709 | 279 |
| 131 | 3300031018 | Ga0265773_1001590 | Ga0265773_10015902 | 280 |
| 132 | 3300046642 | Ga0495634_0015350 | Ga0495634_0015350_3002_3958 | 280 |
| 133 | 3300047320 | Ga0495672_0009172 | Ga0495672_0009172_2802_3755 | 280 |
| 134 | 3300047471 | Ga0495684_0006327 | Ga0495684_0006327_3987_4943 | 280 |
| 135 | 3300049572 | Ga0501036_0001395 | Ga0501036_0001395_8258_9214 | 280 |
| 136 | 3300049573 | Ga0501037_0118529 | Ga0501037_0118529_520_1476 | 280 |
| 137 | 3300049574 | Ga0501038_0027715 | Ga0501038_0027715_895_1851 | 280 |
| 138 | 3300049575 | Ga0501039_0001680 | Ga0501039_0001680_10715_11671 | 280 |
| 139 | 3300049576 | Ga0501040_0028999 | Ga0501040_0028999_2504_3460 | 280 |
| 140 | 3300049577 | Ga0501041_0000497 | Ga0501041_0000497_5725_6681 | 280 |
| 141 | 3300049587 | Ga0501071_0000766 | Ga0501071_0000766_6886_7842 | 280 |
| 142 | 3300049588 | Ga0501072_0009889 | Ga0501072_0009889_4617_5573 | 280 |
| 143 | 3300049590 | Ga0501074_0052771 | Ga0501074_0052771_1302_2258 | 280 |
| 144 | 3300049592 | Ga0501076_0007409 | Ga0501076_0007409_1070_2026 | 280 |
| 145 | 3300049743 | Ga0501081_0016572 | Ga0501081_0016572_1022_1978 | 280 |
| 146 | 3300049822 | Ga0501035_0003133 | Ga0501035_0003133_8281_9237 | 280 |
| 147 | 3300049824 | Ga0501045_0002138 | Ga0501045_0002138_1994_2950 | 280 |
| 148 | 3300053085 | Ga0495619_0045584 | Ga0495619_0045584_706_1662 | 280 |
| 149 | 3300061734 | Ga0530510_0040645 | Ga0530510_0040645_2308_3264 | 280 |
| 150 | 3300049686 | Ga0501257_001114 | Ga0501257_001114_698_1654 | 281 |
| 151 | 3300006852 | Ga0075433_10201376 | Ga0075433_102013762 | 282 |
| 152 | 3300006871 | Ga0075434_100000519 | Ga0075434_10000051930 | 282 |
| 153 | 3300006914 | Ga0075436_100052430 | Ga0075436_1000524302 | 282 |
| 154 | 3300007076 | Ga0075435_100047561 | Ga0075435_1000475612 | 282 |
| 155 | 3300050512 | nmdc:mga0n895_124602_c1 | nmdc:mga0n895_124602_c1_1612_2568 | 282 |
| 156 | 3300050513 | nmdc:mga0rr50_40690_c1 | nmdc:mga0rr50_40690_c1_1300_2256 | 282 |
| 157 | 3300050514 | nmdc:mga08x19_6247_c1 | nmdc:mga08x19_6247_c1_2982_3938 | 282 |
| 158 | 3300050515 | nmdc:mga0a205_54118_c1 | nmdc:mga0a205_54118_c1_2726_3682 | 282 |
| 159 | 3300028577 | Ga0265318_10008937 | Ga0265318_100089373 | 287 |
| 160 | 3300031235 | Ga0265330_10095096 | Ga0265330_100950962 | 287 |
| 161 | 3300031249 | Ga0265339_10033503 | Ga0265339_100335033 | 287 |
| 162 | 3300031344 | Ga0265316_10062311 | Ga0265316_100623112 | 287 |
| 163 | 3300031344 | Ga0265316_10099832 | Ga0265316_100998322 | 287 |
| 164 | 3300031711 | Ga0265314_10042742 | Ga0265314_100427422 | 287 |
| 165 | 3300031711 | Ga0265314_10047083 | Ga0265314_100470832 | 287 |
| 166 | 3300031712 | Ga0265342_10108591 | Ga0265342_101085912 | 287 |
| 167 | 3300035119 | Ga0373956_0049348 | Ga0373956_0049348_552_1499 | 287 |
| 168 | 3300035172 | Ga0373955_0061489 | Ga0373955_0061489_1093_2040 | 287 |
| 169 | 3300035724 | Ga0373933_0081196 | Ga0373933_0081196_128_1075 | 287 |
| 170 | 3300036401 | Ga0373937_0137870 | Ga0373937_0137870_506_1453 | 287 |
| 171 | 3300046679 | Ga0495623_0056896 | Ga0495623_0056896_629_1576 | 287 |
| 172 | 3300048088 | Ga0495602_0122305 | Ga0495602_0122305_305_1252 | 287 |
| 173 | 3300050512 | nmdc:mga0n895_190142_c1 | nmdc:mga0n895_190142_c1_755_1702 | 287 |
| 174 | 3300053133 | Ga0500655_005256 | Ga0500655_005256_834_1796 | 287 |
| 175 | 3300053157 | Ga0500624_000092 | Ga0500624_000092_32738_33706 | 287 |
| 176 | 3300053730 | Ga0500645_024186 | Ga0500645_024186_143_1105 | 287 |
| 177 | 3300054114 | Ga0501084_0036665 | Ga0501084_0036665_952_1899 | 287 |
| 178 | 3300060353 | Ga0501082_0165655 | Ga0501082_0165655_765_1718 | 287 |
| 179 | iso_pu_bacteria | 2891088606 | 2891090909 | 287 |
| 180 | 2010549000 | RicEn_C5112 | RicEn_91050 | 288 |
| 181 | 2209111006 | 2214828529 | 2213866731 | 288 |
| 182 | 3300000042 | ARSoilYngRDRAFT_c00827 | ARSoilYngRDRAFT_008273 | 288 |
| 183 | 3300000043 | ARcpr5yngRDRAFT_c000144 | ARcpr5yngRDRAFT_0001447 | 288 |
| 184 | 3300000044 | ARSoilOldRDRAFT_c000792 | ARSoilOldRDRAFT_0007923 | 288 |
| 185 | 3300000045 | ARCol0oldRDRAFT_c00111 | ARCol0oldRDRAFT_001112 | 288 |
| 186 | 3300000652 | ARCol0yngRDRAFT_1000163 | ARCol0yngRDRAFT_10001634 | 288 |
| 187 | 3300001976 | JGI24752J21851_1001527 | JGI24752J21851_10015272 | 288 |
| 188 | 3300001977 | JGI24746J21847_1000023 | JGI24746J21847_10000239 | 288 |
| 189 | 3300001977 | JGI24746J21847_1002224 | JGI24746J21847_10022242 | 288 |
| 190 | 3300001989 | JGI24739J22299_10000241 | JGI24739J22299_1000024111 | 288 |
| 191 | 3300001990 | JGI24737J22298_10000224 | JGI24737J22298_1000022414 | 288 |
| 192 | 3300001990 | JGI24737J22298_10000674 | JGI24737J22298_1000067410 | 288 |
| 193 | 3300001991 | JGI24743J22301_10003893 | JGI24743J22301_100038932 | 288 |
| 194 | 3300002070 | JGI24750J21931_1000337 | JGI24750J21931_10003377 | 288 |
| 195 | 3300002070 | JGI24750J21931_1000352 | JGI24750J21931_10003524 | 288 |
| 196 | 3300002070 | JGI24750J21931_1001355 | JGI24750J21931_10013552 | 288 |
| 197 | 3300002073 | JGI24745J21846_1000775 | JGI24745J21846_10007753 | 288 |
| 198 | 3300002074 | JGI24748J21848_1000156 | JGI24748J21848_100015610 | 288 |
| 199 | 3300002075 | JGI24738J21930_10000197 | JGI24738J21930_100001978 | 288 |
| 200 | 3300002076 | JGI24749J21850_1002812 | JGI24749J21850_10028122 | 288 |
| 201 | 3300002077 | JGI24744J21845_10000934 | JGI24744J21845_100009344 | 288 |
| 202 | 3300002126 | JGI24035J26624_1000018 | JGI24035J26624_10000189 | 288 |
| 203 | 3300002155 | JGI24033J26618_1000741 | JGI24033J26618_10007412 | 288 |
| 204 | 3300002239 | JGI24034J26672_10000296 | JGI24034J26672_100002965 | 288 |
| 205 | 3300002244 | JGI24742J22300_10000152 | JGI24742J22300_100001522 | 288 |
| 206 | 3300002244 | JGI24742J22300_10000424 | JGI24742J22300_100004244 | 288 |
| 207 | 3300003203 | JGI25406J46586_10004053 | JGI25406J46586_100040535 | 288 |
| 208 | 3300005276 | Ga0065717_1002094 | Ga0065717_10020942 | 288 |
| 209 | 3300005290 | Ga0065712_10002365 | Ga0065712_100023659 | 288 |
| 210 | 3300005290 | Ga0065712_10071985 | Ga0065712_100719854 | 288 |
| 211 | 3300005293 | Ga0065715_10001277 | Ga0065715_1000127713 | 288 |
| 212 | 3300005293 | Ga0065715_10089028 | Ga0065715_1008902813 | 288 |
| 213 | 3300005295 | Ga0065707_10107876 | Ga0065707_101078762 | 288 |
| 214 | 3300005327 | Ga0070658_10003962 | Ga0070658_100039629 | 288 |
| 215 | 3300005328 | Ga0070676_10000629 | Ga0070676_1000062913 | 288 |
| 216 | 3300005328 | Ga0070676_10031955 | Ga0070676_100319552 | 288 |
| 217 | 3300005329 | Ga0070683_100000240 | Ga0070683_10000024031 | 288 |
| 218 | 3300005329 | Ga0070683_100020152 | Ga0070683_1000201523 | 288 |
| 219 | 3300005329 | Ga0070683_100153286 | Ga0070683_1001532862 | 288 |
| 220 | 3300005330 | Ga0070690_100000264 | Ga0070690_10000026426 | 288 |
| 221 | 3300005330 | Ga0070690_100010416 | Ga0070690_1000104164 | 288 |
| 222 | 3300005330 | Ga0070690_100068744 | Ga0070690_1000687442 | 288 |
| 223 | 3300005330 | Ga0070690_100105533 | Ga0070690_1001055332 | 288 |
| 224 | 3300005330 | Ga0070690_100154275 | Ga0070690_1001542752 | 288 |
| 225 | 3300005331 | Ga0070670_100002399 | Ga0070670_1000023995 | 288 |
| 226 | 3300005331 | Ga0070670_100045914 | Ga0070670_1000459144 | 288 |
| 227 | 3300005333 | Ga0070677_10000507 | Ga0070677_100005075 | 288 |
| 228 | 3300005334 | Ga0068869_100000189 | Ga0068869_10000018920 | 288 |
| 229 | 3300005334 | Ga0068869_100033165 | Ga0068869_1000331652 | 288 |
| 230 | 3300005335 | Ga0070666_10019187 | Ga0070666_100191874 | 288 |
| 231 | 3300005335 | Ga0070666_10041895 | Ga0070666_100418952 | 288 |
| 232 | 3300005336 | Ga0070680_100000210 | Ga0070680_10000021028 | 288 |
| 233 | 3300005336 | Ga0070680_100000706 | Ga0070680_10000070615 | 288 |
| 234 | 3300005336 | Ga0070680_100009451 | Ga0070680_1000094514 | 288 |
| 235 | 3300005336 | Ga0070680_100020964 | Ga0070680_1000209645 | 288 |
| 236 | 3300005336 | Ga0070680_100027458 | Ga0070680_1000274583 | 288 |
| 237 | 3300005336 | Ga0070680_100443725 | Ga0070680_1004437251 | 288 |
| 238 | 3300005337 | Ga0070682_100000202 | Ga0070682_10000020240 | 288 |
| 239 | 3300005337 | Ga0070682_100009990 | Ga0070682_1000099903 | 288 |
| 240 | 3300005337 | Ga0070682_100013606 | Ga0070682_1000136062 | 288 |
| 241 | 3300005337 | Ga0070682_100249014 | Ga0070682_1002490141 | 288 |
| 242 | 3300005338 | Ga0068868_100021910 | Ga0068868_1000219104 | 288 |
| 243 | 3300005338 | Ga0068868_100033405 | Ga0068868_1000334053 | 288 |
| 244 | 3300005339 | Ga0070660_100000223 | Ga0070660_10000022331 | 288 |
| 245 | 3300005339 | Ga0070660_100011386 | Ga0070660_1000113862 | 288 |
| 246 | 3300005339 | Ga0070660_100072810 | Ga0070660_1000728102 | 288 |
| 247 | 3300005339 | Ga0070660_100077113 | Ga0070660_1000771133 | 288 |
| 248 | 3300005340 | Ga0070689_100000187 | Ga0070689_10000018731 | 288 |
| 249 | 3300005340 | Ga0070689_100020568 | Ga0070689_1000205684 | 288 |
| 250 | 3300005340 | Ga0070689_100024256 | Ga0070689_1000242564 | 288 |
| 251 | 3300005341 | Ga0070691_10000236 | Ga0070691_1000023613 | 288 |
| 252 | 3300005341 | Ga0070691_10010464 | Ga0070691_100104643 | 288 |
| 253 | 3300005341 | Ga0070691_10054149 | Ga0070691_100541492 | 288 |
| 254 | 3300005343 | Ga0070687_100000306 | Ga0070687_10000030613 | 288 |
| 255 | 3300005343 | Ga0070687_100005837 | Ga0070687_1000058375 | 288 |
| 256 | 3300005343 | Ga0070687_100055735 | Ga0070687_1000557352 | 288 |
| 257 | 3300005344 | Ga0070661_100000298 | Ga0070661_10000029813 | 288 |
| 258 | 3300005344 | Ga0070661_100027242 | Ga0070661_1000272423 | 288 |
| 259 | 3300005345 | Ga0070692_10000016 | Ga0070692_1000001631 | 288 |
| 260 | 3300005347 | Ga0070668_100010470 | Ga0070668_1000104704 | 288 |
| 261 | 3300005347 | Ga0070668_100013411 | Ga0070668_1000134113 | 288 |
| 262 | 3300005353 | Ga0070669_100000959 | Ga0070669_10000095913 | 288 |
| 263 | 3300005353 | Ga0070669_100009625 | Ga0070669_1000096253 | 288 |
| 264 | 3300005353 | Ga0070669_100014612 | Ga0070669_1000146124 | 288 |
| 265 | 3300005353 | Ga0070669_100071006 | Ga0070669_1000710062 | 288 |
| 266 | 3300005354 | Ga0070675_100000215 | Ga0070675_10000021512 | 288 |
| 267 | 3300005354 | Ga0070675_100007433 | Ga0070675_1000074334 | 288 |
| 268 | 3300005354 | Ga0070675_100011271 | Ga0070675_1000112713 | 288 |
| 269 | 3300005355 | Ga0070671_100000402 | Ga0070671_1000004023 | 288 |
| 270 | 3300005355 | Ga0070671_100010939 | Ga0070671_1000109395 | 288 |
| 271 | 3300005355 | Ga0070671_100055232 | Ga0070671_1000552322 | 288 |
| 272 | 3300005356 | Ga0070674_100000709 | Ga0070674_1000007097 | 288 |
| 273 | 3300005356 | Ga0070674_100002281 | Ga0070674_1000022814 | 288 |
| 274 | 3300005356 | Ga0070674_100009356 | Ga0070674_1000093564 | 288 |
| 275 | 3300005364 | Ga0070673_100000035 | Ga0070673_10000003529 | 288 |
| 276 | 3300005364 | Ga0070673_100103748 | Ga0070673_1001037482 | 288 |
| 277 | 3300005365 | Ga0070688_100000130 | Ga0070688_10000013033 | 288 |
| 278 | 3300005365 | Ga0070688_100003918 | Ga0070688_1000039187 | 288 |
| 279 | 3300005365 | Ga0070688_100043003 | Ga0070688_1000430032 | 288 |
| 280 | 3300005366 | Ga0070659_100000583 | Ga0070659_10000058313 | 288 |
| 281 | 3300005366 | Ga0070659_100043211 | Ga0070659_1000432112 | 288 |
| 282 | 3300005366 | Ga0070659_100052526 | Ga0070659_1000525263 | 288 |
| 283 | 3300005366 | Ga0070659_100108502 | Ga0070659_1001085022 | 288 |
| 284 | 3300005367 | Ga0070667_100000712 | Ga0070667_10000071228 | 288 |
| 285 | 3300005367 | Ga0070667_100026753 | Ga0070667_1000267534 | 288 |
| 286 | 3300005406 | Ga0070703_10023357 | Ga0070703_100233572 | 288 |
| 287 | 3300005435 | Ga0070714_100018802 | Ga0070714_1000188022 | 288 |
| 288 | 3300005435 | Ga0070714_100148792 | Ga0070714_1001487922 | 288 |
| 289 | 3300005436 | Ga0070713_100010347 | Ga0070713_1000103476 | 288 |
| 290 | 3300005436 | Ga0070713_100089294 | Ga0070713_1000892942 | 288 |
| 291 | 3300005436 | Ga0070713_100096688 | Ga0070713_1000966882 | 288 |
| 292 | 3300005436 | Ga0070713_100154538 | Ga0070713_1001545382 | 288 |
| 293 | 3300005436 | Ga0070713_100337383 | Ga0070713_1003373832 | 288 |
| 294 | 3300005436 | Ga0070713_100553933 | Ga0070713_1005539331 | 288 |
| 295 | 3300005437 | Ga0070710_10000656 | Ga0070710_1000065610 | 288 |
| 296 | 3300005437 | Ga0070710_10009990 | Ga0070710_100099904 | 288 |
| 297 | 3300005438 | Ga0070701_10000081 | Ga0070701_1000008126 | 288 |
| 298 | 3300005438 | Ga0070701_10007943 | Ga0070701_100079433 | 288 |
| 299 | 3300005438 | Ga0070701_10034214 | Ga0070701_100342142 | 288 |
| 300 | 3300005439 | Ga0070711_100008844 | Ga0070711_1000088442 | 288 |
| 301 | 3300005439 | Ga0070711_100058616 | Ga0070711_1000586162 | 288 |
| 302 | 3300005439 | Ga0070711_100360424 | Ga0070711_1003604241 | 288 |
| 303 | 3300005440 | Ga0070705_100000911 | Ga0070705_1000009114 | 288 |
| 304 | 3300005440 | Ga0070705_100028423 | Ga0070705_1000284233 | 288 |
| 305 | 3300005440 | Ga0070705_100083474 | Ga0070705_1000834742 | 288 |
| 306 | 3300005441 | Ga0070700_100000393 | Ga0070700_10000039313 | 288 |
| 307 | 3300005441 | Ga0070700_100006267 | Ga0070700_1000062677 | 288 |
| 308 | 3300005441 | Ga0070700_100022752 | Ga0070700_1000227522 | 288 |
| 309 | 3300005441 | Ga0070700_100070463 | Ga0070700_1000704632 | 288 |
| 310 | 3300005444 | Ga0070694_100000129 | Ga0070694_10000012912 | 288 |
| 311 | 3300005444 | Ga0070694_100003990 | Ga0070694_1000039908 | 288 |
| 312 | 3300005445 | Ga0070708_100022564 | Ga0070708_1000225643 | 288 |
| 313 | 3300005455 | Ga0070663_100000746 | Ga0070663_1000007466 | 288 |
| 314 | 3300005455 | Ga0070663_100004572 | Ga0070663_1000045726 | 288 |
| 315 | 3300005455 | Ga0070663_100011714 | Ga0070663_1000117145 | 288 |
| 316 | 3300005455 | Ga0070663_100026948 | Ga0070663_1000269483 | 288 |
| 317 | 3300005456 | Ga0070678_100000399 | Ga0070678_10000039913 | 288 |
| 318 | 3300005456 | Ga0070678_100048917 | Ga0070678_1000489172 | 288 |
| 319 | 3300005457 | Ga0070662_100001543 | Ga0070662_10000154311 | 288 |
| 320 | 3300005457 | Ga0070662_100016757 | Ga0070662_1000167572 | 288 |
| 321 | 3300005457 | Ga0070662_100019314 | Ga0070662_1000193143 | 288 |
| 322 | 3300005458 | Ga0070681_10000001 | Ga0070681_10000001714 | 288 |
| 323 | 3300005458 | Ga0070681_10001286 | Ga0070681_1000128624 | 288 |
| 324 | 3300005458 | Ga0070681_10040205 | Ga0070681_100402054 | 288 |
| 325 | 3300005458 | Ga0070681_10043290 | Ga0070681_100432903 | 288 |
| 326 | 3300005458 | Ga0070681_10256287 | Ga0070681_102562872 | 288 |
| 327 | 3300005458 | Ga0070681_10387420 | Ga0070681_103874202 | 288 |
| 328 | 3300005459 | Ga0068867_100001770 | Ga0068867_10000177012 | 288 |
| 329 | 3300005459 | Ga0068867_100004534 | Ga0068867_1000045346 | 288 |
| 330 | 3300005459 | Ga0068867_100024994 | Ga0068867_1000249943 | 288 |
| 331 | 3300005466 | Ga0070685_10000490 | Ga0070685_1000049012 | 288 |
| 332 | 3300005466 | Ga0070685_10012931 | Ga0070685_100129314 | 288 |
| 333 | 3300005466 | Ga0070685_10032047 | Ga0070685_100320472 | 288 |
| 334 | 3300005507 | Ga0074259_10596474 | Ga0074259_105964742 | 288 |
| 335 | 3300005530 | Ga0070679_100000037 | Ga0070679_10000003747 | 288 |
| 336 | 3300005530 | Ga0070679_100000553 | Ga0070679_10000055330 | 288 |
| 337 | 3300005530 | Ga0070679_100027141 | Ga0070679_1000271412 | 288 |
| 338 | 3300005530 | Ga0070679_100056209 | Ga0070679_1000562093 | 288 |
| 339 | 3300005535 | Ga0070684_100000246 | Ga0070684_10000024631 | 288 |
| 340 | 3300005535 | Ga0070684_100004789 | Ga0070684_1000047899 | 288 |
| 341 | 3300005535 | Ga0070684_100024430 | Ga0070684_1000244302 | 288 |
| 342 | 3300005535 | Ga0070684_100203065 | Ga0070684_1002030652 | 288 |
| 343 | 3300005539 | Ga0068853_100000243 | Ga0068853_10000024334 | 288 |
| 344 | 3300005539 | Ga0068853_100097710 | Ga0068853_1000977102 | 288 |
| 345 | 3300005539 | Ga0068853_100179302 | Ga0068853_1001793022 | 288 |
| 346 | 3300005543 | Ga0070672_100000157 | Ga0070672_10000015731 | 288 |
| 347 | 3300005543 | Ga0070672_100003221 | Ga0070672_1000032216 | 288 |
| 348 | 3300005544 | Ga0070686_100000260 | Ga0070686_10000026033 | 288 |
| 349 | 3300005544 | Ga0070686_100008427 | Ga0070686_1000084275 | 288 |
| 350 | 3300005544 | Ga0070686_100037335 | Ga0070686_1000373352 | 288 |
| 351 | 3300005545 | Ga0070695_100004051 | Ga0070695_1000040515 | 288 |
| 352 | 3300005545 | Ga0070695_100005692 | Ga0070695_1000056923 | 288 |
| 353 | 3300005545 | Ga0070695_100074049 | Ga0070695_1000740493 | 288 |
| 354 | 3300005546 | Ga0070696_100000970 | Ga0070696_10000097010 | 288 |
| 355 | 3300005546 | Ga0070696_100003815 | Ga0070696_1000038155 | 288 |
| 356 | 3300005546 | Ga0070696_100097933 | Ga0070696_1000979332 | 288 |
| 357 | 3300005546 | Ga0070696_100131855 | Ga0070696_1001318552 | 288 |
| 358 | 3300005547 | Ga0070693_100000925 | Ga0070693_1000009255 | 288 |
| 359 | 3300005547 | Ga0070693_100140556 | Ga0070693_1001405562 | 288 |
| 360 | 3300005548 | Ga0070665_100010001 | Ga0070665_1000100019 | 288 |
| 361 | 3300005548 | Ga0070665_100041633 | Ga0070665_1000416332 | 288 |
| 362 | 3300005549 | Ga0070704_100000171 | Ga0070704_1000001714 | 288 |
| 363 | 3300005549 | Ga0070704_100001307 | Ga0070704_1000013074 | 288 |
| 364 | 3300005563 | Ga0068855_100010157 | Ga0068855_1000101573 | 288 |
| 365 | 3300005563 | Ga0068855_100031343 | Ga0068855_1000313433 | 288 |
| 366 | 3300005563 | Ga0068855_100047138 | Ga0068855_1000471385 | 288 |
| 367 | 3300005563 | Ga0068855_100153394 | Ga0068855_1001533942 | 288 |
| 368 | 3300005563 | Ga0068855_100239024 | Ga0068855_1002390242 | 288 |
| 369 | 3300005564 | Ga0070664_100000269 | Ga0070664_10000026931 | 288 |
| 370 | 3300005564 | Ga0070664_100052826 | Ga0070664_1000528263 | 288 |
| 371 | 3300005564 | Ga0070664_100059585 | Ga0070664_1000595852 | 288 |
| 372 | 3300005564 | Ga0070664_100129446 | Ga0070664_1001294462 | 288 |
| 373 | 3300005577 | Ga0068857_100000174 | Ga0068857_10000017432 | 288 |
| 374 | 3300005577 | Ga0068857_100049341 | Ga0068857_1000493412 | 288 |
| 375 | 3300005577 | Ga0068857_100099316 | Ga0068857_1000993163 | 288 |
| 376 | 3300005578 | Ga0068854_100000211 | Ga0068854_10000021113 | 288 |
| 377 | 3300005578 | Ga0068854_100013937 | Ga0068854_1000139374 | 288 |
| 378 | 3300005578 | Ga0068854_100066678 | Ga0068854_1000666783 | 288 |
| 379 | 3300005578 | Ga0068854_100105533 | Ga0068854_1001055332 | 288 |
| 380 | 3300005614 | Ga0068856_100000600 | Ga0068856_10000060034 | 288 |
| 381 | 3300005615 | Ga0070702_100000654 | Ga0070702_1000006543 | 288 |
| 382 | 3300005616 | Ga0068852_100000629 | Ga0068852_10000062917 | 288 |
| 383 | 3300005616 | Ga0068852_100009156 | Ga0068852_1000091565 | 288 |
| 384 | 3300005616 | Ga0068852_100014841 | Ga0068852_1000148412 | 288 |
| 385 | 3300005617 | Ga0068859_100000894 | Ga0068859_10000089433 | 288 |
| 386 | 3300005617 | Ga0068859_100024112 | Ga0068859_1000241125 | 288 |
| 387 | 3300005617 | Ga0068859_100265007 | Ga0068859_1002650072 | 288 |
| 388 | 3300005618 | Ga0068864_100000329 | Ga0068864_10000032943 | 288 |
| 389 | 3300005618 | Ga0068864_100004704 | Ga0068864_1000047047 | 288 |
| 390 | 3300005718 | Ga0068866_10000177 | Ga0068866_1000017723 | 288 |
| 391 | 3300005718 | Ga0068866_10004095 | Ga0068866_100040953 | 288 |
| 392 | 3300005719 | Ga0068861_100000329 | Ga0068861_10000032923 | 288 |
| 393 | 3300005719 | Ga0068861_100017474 | Ga0068861_1000174744 | 288 |
| 394 | 3300005719 | Ga0068861_100026049 | Ga0068861_1000260492 | 288 |
| 395 | 3300005719 | Ga0068861_100204819 | Ga0068861_1002048192 | 288 |
| 396 | 3300005840 | Ga0068870_10000056 | Ga0068870_1000005633 | 288 |
| 397 | 3300005840 | Ga0068870_10004328 | Ga0068870_100043283 | 288 |
| 398 | 3300005841 | Ga0068863_100000278 | Ga0068863_10000027850 | 288 |
| 399 | 3300005841 | Ga0068863_100014875 | Ga0068863_1000148754 | 288 |
| 400 | 3300005842 | Ga0068858_100001048 | Ga0068858_10000104823 | 288 |
| 401 | 3300005842 | Ga0068858_100008255 | Ga0068858_1000082556 | 288 |
| 402 | 3300005842 | Ga0068858_100046045 | Ga0068858_1000460452 | 288 |
| 403 | 3300005843 | Ga0068860_100000985 | Ga0068860_1000009854 | 288 |
| 404 | 3300005843 | Ga0068860_100007113 | Ga0068860_1000071137 | 288 |
| 405 | 3300005843 | Ga0068860_100088750 | Ga0068860_1000887502 | 288 |
| 406 | 3300005843 | Ga0068860_100160849 | Ga0068860_1001608492 | 288 |
| 407 | 3300005844 | Ga0068862_100000593 | Ga0068862_10000059314 | 288 |
| 408 | 3300005844 | Ga0068862_100007625 | Ga0068862_1000076252 | 288 |
| 409 | 3300005844 | Ga0068862_100007945 | Ga0068862_1000079455 | 288 |
| 410 | 3300005844 | Ga0068862_100009498 | Ga0068862_1000094983 | 288 |
| 411 | 3300005937 | Ga0081455_10000051 | Ga0081455_1000005139 | 288 |
| 412 | 3300005937 | Ga0081455_10004739 | Ga0081455_1000473913 | 288 |
| 413 | 3300005937 | Ga0081455_10062668 | Ga0081455_100626683 | 288 |
| 414 | 3300005985 | Ga0081539_10003785 | Ga0081539_1000378518 | 288 |
| 415 | 3300006028 | Ga0070717_10119137 | Ga0070717_101191372 | 288 |
| 416 | 3300006028 | Ga0070717_10139812 | Ga0070717_101398122 | 288 |
| 417 | 3300006038 | Ga0075365_10026618 | Ga0075365_100266184 | 288 |
| 418 | 3300006038 | Ga0075365_10103766 | Ga0075365_101037662 | 288 |
| 419 | 3300006042 | Ga0075368_10020359 | Ga0075368_100203592 | 288 |
| 420 | 3300006042 | Ga0075368_10044879 | Ga0075368_100448792 | 288 |
| 421 | 3300006048 | Ga0075363_100042317 | Ga0075363_1000423172 | 288 |
| 422 | 3300006051 | Ga0075364_10027444 | Ga0075364_100274443 | 288 |
| 423 | 3300006051 | Ga0075364_10236647 | Ga0075364_102366472 | 288 |
| 424 | 3300006163 | Ga0070715_10010214 | Ga0070715_100102143 | 288 |
| 425 | 3300006163 | Ga0070715_10063916 | Ga0070715_100639162 | 288 |
| 426 | 3300006163 | Ga0070715_10087304 | Ga0070715_100873042 | 288 |
| 427 | 3300006173 | Ga0070716_100004545 | Ga0070716_1000045452 | 288 |
| 428 | 3300006175 | Ga0070712_100016638 | Ga0070712_1000166383 | 288 |
| 429 | 3300006175 | Ga0070712_100029533 | Ga0070712_1000295332 | 288 |
| 430 | 3300006175 | Ga0070712_100122234 | Ga0070712_1001222343 | 288 |
| 431 | 3300006175 | Ga0070712_100139359 | Ga0070712_1001393592 | 288 |
| 432 | 3300006178 | Ga0075367_10009838 | Ga0075367_100098384 | 288 |
| 433 | 3300006178 | Ga0075367_10030759 | Ga0075367_100307592 | 288 |
| 434 | 3300006178 | Ga0075367_10049575 | Ga0075367_100495752 | 288 |
| 435 | 3300006186 | Ga0075369_10005713 | Ga0075369_100057132 | 288 |
| 436 | 3300006237 | Ga0097621_100000504 | Ga0097621_10000050416 | 288 |
| 437 | 3300006237 | Ga0097621_100004513 | Ga0097621_1000045134 | 288 |
| 438 | 3300006237 | Ga0097621_100006326 | Ga0097621_1000063264 | 288 |
| 439 | 3300006353 | Ga0075370_10017676 | Ga0075370_100176762 | 288 |
| 440 | 3300006358 | Ga0068871_100000815 | Ga0068871_1000008154 | 288 |
| 441 | 3300006358 | Ga0068871_100005880 | Ga0068871_1000058807 | 288 |
| 442 | 3300006846 | Ga0075430_100021821 | Ga0075430_1000218212 | 288 |
| 443 | 3300006847 | Ga0075431_100032372 | Ga0075431_1000323724 | 288 |
| 444 | 3300006871 | Ga0075434_100000244 | Ga0075434_10000024414 | 288 |
| 445 | 3300006871 | Ga0075434_100286440 | Ga0075434_1002864402 | 288 |
| 446 | 3300006880 | Ga0075429_100382428 | Ga0075429_1003824282 | 288 |
| 447 | 3300006881 | Ga0068865_100000332 | Ga0068865_10000033216 | 288 |
| 448 | 3300006881 | Ga0068865_100031851 | Ga0068865_1000318513 | 288 |
| 449 | 3300006881 | Ga0068865_100166946 | Ga0068865_1001669462 | 288 |
| 450 | 3300006914 | Ga0075436_100090108 | Ga0075436_1000901083 | 288 |
| 451 | 3300006914 | Ga0075436_100288125 | Ga0075436_1002881252 | 288 |
| 452 | 3300006931 | Ga0097620_100000894 | Ga0097620_1000008942 | 288 |
| 453 | 3300006931 | Ga0097620_100024111 | Ga0097620_1000241115 | 288 |
| 454 | 3300006931 | Ga0097620_100265007 | Ga0097620_1002650072 | 288 |
| 455 | 3300007076 | Ga0075435_100074514 | Ga0075435_1000745143 | 288 |
| 456 | 3300009092 | Ga0105250_10028955 | Ga0105250_100289552 | 288 |
| 457 | 3300009092 | Ga0105250_10045782 | Ga0105250_100457822 | 288 |
| 458 | 3300009093 | Ga0105240_10063893 | Ga0105240_100638933 | 288 |
| 459 | 3300009093 | Ga0105240_10496464 | Ga0105240_104964642 | 288 |
| 460 | 3300009094 | Ga0111539_10001076 | Ga0111539_1000107614 | 288 |
| 461 | 3300009094 | Ga0111539_10011662 | Ga0111539_100116623 | 288 |
| 462 | 3300009094 | Ga0111539_10122649 | Ga0111539_101226492 | 288 |
| 463 | 3300009094 | Ga0111539_10276631 | Ga0111539_102766312 | 288 |
| 464 | 3300009098 | Ga0105245_10000451 | Ga0105245_1000045114 | 288 |
| 465 | 3300009098 | Ga0105245_10009909 | Ga0105245_100099094 | 288 |
| 466 | 3300009098 | Ga0105245_10042174 | Ga0105245_100421742 | 288 |
| 467 | 3300009098 | Ga0105245_10066551 | Ga0105245_100665512 | 288 |
| 468 | 3300009101 | Ga0105247_10001553 | Ga0105247_100015532 | 288 |
| 469 | 3300009101 | Ga0105247_10006039 | Ga0105247_100060396 | 288 |
| 470 | 3300009101 | Ga0105247_10013787 | Ga0105247_100137872 | 288 |
| 471 | 3300009101 | Ga0105247_10014447 | Ga0105247_100144472 | 288 |
| 472 | 3300009101 | Ga0105247_10159304 | Ga0105247_101593042 | 288 |
| 473 | 3300009148 | Ga0105243_10001205 | Ga0105243_1000120514 | 288 |
| 474 | 3300009148 | Ga0105243_10058461 | Ga0105243_100584613 | 288 |
| 475 | 3300009148 | Ga0105243_10070118 | Ga0105243_100701183 | 288 |
| 476 | 3300009174 | Ga0105241_10000515 | Ga0105241_1000051512 | 288 |
| 477 | 3300009174 | Ga0105241_10034338 | Ga0105241_100343383 | 288 |
| 478 | 3300009174 | Ga0105241_10043489 | Ga0105241_100434893 | 288 |
| 479 | 3300009174 | Ga0105241_10472669 | Ga0105241_104726691 | 288 |
| 480 | 3300009176 | Ga0105242_10008078 | Ga0105242_100080784 | 288 |
| 481 | 3300009177 | Ga0105248_10000837 | Ga0105248_1000083714 | 288 |
| 482 | 3300009177 | Ga0105248_10006976 | Ga0105248_100069764 | 288 |
| 483 | 3300009177 | Ga0105248_10049463 | Ga0105248_100494632 | 288 |
| 484 | 3300009545 | Ga0105237_10009856 | Ga0105237_100098567 | 288 |
| 485 | 3300009545 | Ga0105237_10011688 | Ga0105237_100116886 | 288 |
| 486 | 3300009545 | Ga0105237_10145521 | Ga0105237_101455213 | 288 |
| 487 | 3300009545 | Ga0105237_10289614 | Ga0105237_102896142 | 288 |
| 488 | 3300009551 | Ga0105238_10042052 | Ga0105238_100420522 | 288 |
| 489 | 3300009551 | Ga0105238_10047430 | Ga0105238_100474303 | 288 |
| 490 | 3300009551 | Ga0105238_10091379 | Ga0105238_100913793 | 288 |
| 491 | 3300009551 | Ga0105238_10139584 | Ga0105238_101395842 | 288 |
| 492 | 3300009553 | Ga0105249_10001556 | Ga0105249_100015565 | 288 |
| 493 | 3300009553 | Ga0105249_10018383 | Ga0105249_100183835 | 288 |
| 494 | 3300009553 | Ga0105249_10069863 | Ga0105249_100698632 | 288 |
| 495 | 3300009553 | Ga0105249_10714840 | Ga0105249_107148402 | 288 |
| 496 | 3300010375 | Ga0105239_10005157 | Ga0105239_1000515712 | 288 |
| 497 | 3300010375 | Ga0105239_10007246 | Ga0105239_100072463 | 288 |
| 498 | 3300010375 | Ga0105239_10011420 | Ga0105239_100114202 | 288 |
| 499 | 3300010375 | Ga0105239_10090414 | Ga0105239_100904143 | 288 |
| 500 | 3300010375 | Ga0105239_10586312 | Ga0105239_105863121 | 288 |
| 501 | 3300011119 | Ga0105246_10000100 | Ga0105246_1000010014 | 288 |
| 502 | 3300013100 | Ga0157373_10001937 | Ga0157373_100019376 | 288 |
| 503 | 3300013102 | Ga0157371_10009263 | Ga0157371_100092632 | 288 |
| 504 | 3300013102 | Ga0157371_10060791 | Ga0157371_100607912 | 288 |
| 505 | 3300013102 | Ga0157371_10097175 | Ga0157371_100971752 | 288 |
| 506 | 3300013105 | Ga0157369_10417137 | Ga0157369_104171371 | 288 |
| 507 | 3300013296 | Ga0157374_10002520 | Ga0157374_1000252014 | 288 |
| 508 | 3300013296 | Ga0157374_10025843 | Ga0157374_100258433 | 288 |
| 509 | 3300013296 | Ga0157374_10034810 | Ga0157374_100348104 | 288 |
| 510 | 3300013296 | Ga0157374_10068867 | Ga0157374_100688672 | 288 |
| 511 | 3300013297 | Ga0157378_10018104 | Ga0157378_100181044 | 288 |
| 512 | 3300013297 | Ga0157378_10019279 | Ga0157378_100192796 | 288 |
| 513 | 3300013297 | Ga0157378_10045210 | Ga0157378_100452103 | 288 |
| 514 | 3300013297 | Ga0157378_10100682 | Ga0157378_101006822 | 288 |
| 515 | 3300013297 | Ga0157378_10448060 | Ga0157378_104480601 | 288 |
| 516 | 3300013306 | Ga0163162_10001003 | Ga0163162_1000100319 | 288 |
| 517 | 3300013306 | Ga0163162_10003466 | Ga0163162_100034663 | 288 |
| 518 | 3300013306 | Ga0163162_10018542 | Ga0163162_100185426 | 288 |
| 519 | 3300013306 | Ga0163162_10181962 | Ga0163162_101819622 | 288 |
| 520 | 3300013307 | Ga0157372_10016087 | Ga0157372_100160874 | 288 |
| 521 | 3300013307 | Ga0157372_10173542 | Ga0157372_101735422 | 288 |
| 522 | 3300013307 | Ga0157372_10801752 | Ga0157372_108017521 | 288 |
| 523 | 3300013308 | Ga0157375_10000464 | Ga0157375_1000046422 | 288 |
| 524 | 3300013308 | Ga0157375_10013321 | Ga0157375_100133215 | 288 |
| 525 | 3300013308 | Ga0157375_10015123 | Ga0157375_100151232 | 288 |
| 526 | 3300013308 | Ga0157375_10068458 | Ga0157375_100684583 | 288 |
| 527 | 3300013308 | Ga0157375_10090970 | Ga0157375_100909703 | 288 |
| 528 | 3300014325 | Ga0163163_10002284 | Ga0163163_1000228420 | 288 |
| 529 | 3300014325 | Ga0163163_10012670 | Ga0163163_100126704 | 288 |
| 530 | 3300014325 | Ga0163163_10026554 | Ga0163163_100265546 | 288 |
| 531 | 3300014325 | Ga0163163_10340687 | Ga0163163_103406871 | 288 |
| 532 | 3300014326 | Ga0157380_10000145 | Ga0157380_1000014531 | 288 |
| 533 | 3300014326 | Ga0157380_10060588 | Ga0157380_100605882 | 288 |
| 534 | 3300014745 | Ga0157377_10000179 | Ga0157377_1000017928 | 288 |
| 535 | 3300014745 | Ga0157377_10047136 | Ga0157377_100471362 | 288 |
| 536 | 3300014968 | Ga0157379_10000067 | Ga0157379_1000006741 | 288 |
| 537 | 3300014968 | Ga0157379_10050135 | Ga0157379_100501352 | 288 |
| 538 | 3300014968 | Ga0157379_10061245 | Ga0157379_100612453 | 288 |
| 539 | 3300014969 | Ga0157376_10000864 | Ga0157376_1000086414 | 288 |
| 540 | 3300014969 | Ga0157376_10017983 | Ga0157376_100179833 | 288 |
| 541 | 3300017792 | Ga0163161_10001641 | Ga0163161_1000164114 | 288 |
| 542 | 3300017792 | Ga0163161_10015441 | Ga0163161_100154413 | 288 |
| 543 | 3300025271 | Ga0207666_1000002 | Ga0207666_100000229 | 288 |
| 544 | 3300025271 | Ga0207666_1003664 | Ga0207666_10036642 | 288 |
| 545 | 3300025297 | Ga0209758_1001864 | Ga0209758_100186410 | 288 |
| 546 | 3300025297 | Ga0209758_1004355 | Ga0209758_10043553 | 288 |
| 547 | 3300025315 | Ga0207697_10000113 | Ga0207697_1000011331 | 288 |
| 548 | 3300025315 | Ga0207697_10002993 | Ga0207697_100029933 | 288 |
| 549 | 3300025321 | Ga0207656_10013388 | Ga0207656_100133883 | 288 |
| 550 | 3300025711 | Ga0207696_1028356 | Ga0207696_10283562 | 288 |
| 551 | 3300025885 | Ga0207653_10024269 | Ga0207653_100242693 | 288 |
| 552 | 3300025893 | Ga0207682_10000094 | Ga0207682_1000009414 | 288 |
| 553 | 3300025893 | Ga0207682_10027480 | Ga0207682_100274802 | 288 |
| 554 | 3300025898 | Ga0207692_10002667 | Ga0207692_100026674 | 288 |
| 555 | 3300025898 | Ga0207692_10008058 | Ga0207692_100080582 | 288 |
| 556 | 3300025899 | Ga0207642_10000106 | Ga0207642_1000010614 | 288 |
| 557 | 3300025899 | Ga0207642_10022206 | Ga0207642_100222062 | 288 |
| 558 | 3300025900 | Ga0207710_10003537 | Ga0207710_100035372 | 288 |
| 559 | 3300025901 | Ga0207688_10000074 | Ga0207688_1000007413 | 288 |
| 560 | 3300025901 | Ga0207688_10001906 | Ga0207688_1000190612 | 288 |
| 561 | 3300025901 | Ga0207688_10004875 | Ga0207688_100048753 | 288 |
| 562 | 3300025903 | Ga0207680_10015416 | Ga0207680_100154163 | 288 |
| 563 | 3300025903 | Ga0207680_10079461 | Ga0207680_100794612 | 288 |
| 564 | 3300025903 | Ga0207680_10101587 | Ga0207680_101015872 | 288 |
| 565 | 3300025904 | Ga0207647_10000218 | Ga0207647_1000021843 | 288 |
| 566 | 3300025904 | Ga0207647_10006609 | Ga0207647_100066098 | 288 |
| 567 | 3300025905 | Ga0207685_10041604 | Ga0207685_100416042 | 288 |
| 568 | 3300025906 | Ga0207699_10005568 | Ga0207699_100055683 | 288 |
| 569 | 3300025906 | Ga0207699_10009762 | Ga0207699_100097623 | 288 |
| 570 | 3300025906 | Ga0207699_10142546 | Ga0207699_101425462 | 288 |
| 571 | 3300025907 | Ga0207645_10000247 | Ga0207645_1000024723 | 288 |
| 572 | 3300025907 | Ga0207645_10010970 | Ga0207645_100109704 | 288 |
| 573 | 3300025908 | Ga0207643_10000004 | Ga0207643_10000004170 | 288 |
| 574 | 3300025908 | Ga0207643_10002034 | Ga0207643_1000203412 | 288 |
| 575 | 3300025909 | Ga0207705_10005512 | Ga0207705_100055125 | 288 |
| 576 | 3300025909 | Ga0207705_10044014 | Ga0207705_100440143 | 288 |
| 577 | 3300025911 | Ga0207654_10000408 | Ga0207654_1000040816 | 288 |
| 578 | 3300025912 | Ga0207707_10000001 | Ga0207707_10000001398 | 288 |
| 579 | 3300025912 | Ga0207707_10000618 | Ga0207707_100006188 | 288 |
| 580 | 3300025912 | Ga0207707_10009349 | Ga0207707_100093499 | 288 |
| 581 | 3300025912 | Ga0207707_10017866 | Ga0207707_100178662 | 288 |
| 582 | 3300025912 | Ga0207707_10186483 | Ga0207707_101864832 | 288 |
| 583 | 3300025912 | Ga0207707_10420953 | Ga0207707_104209532 | 288 |
| 584 | 3300025913 | Ga0207695_10082620 | Ga0207695_100826203 | 288 |
| 585 | 3300025913 | Ga0207695_10352663 | Ga0207695_103526632 | 288 |
| 586 | 3300025914 | Ga0207671_10006046 | Ga0207671_100060464 | 288 |
| 587 | 3300025914 | Ga0207671_10051153 | Ga0207671_100511532 | 288 |
| 588 | 3300025914 | Ga0207671_10080443 | Ga0207671_100804432 | 288 |
| 589 | 3300025914 | Ga0207671_10193782 | Ga0207671_101937822 | 288 |
| 590 | 3300025915 | Ga0207693_10002426 | Ga0207693_100024264 | 288 |
| 591 | 3300025915 | Ga0207693_10037349 | Ga0207693_100373492 | 288 |
| 592 | 3300025915 | Ga0207693_10045822 | Ga0207693_100458221 | 288 |
| 593 | 3300025915 | Ga0207693_10162876 | Ga0207693_101628762 | 288 |
| 594 | 3300025916 | Ga0207663_10021216 | Ga0207663_100212163 | 288 |
| 595 | 3300025916 | Ga0207663_10028196 | Ga0207663_100281961 | 288 |
| 596 | 3300025916 | Ga0207663_10226734 | Ga0207663_102267342 | 288 |
| 597 | 3300025917 | Ga0207660_10000029 | Ga0207660_1000002923 | 288 |
| 598 | 3300025917 | Ga0207660_10000637 | Ga0207660_100006376 | 288 |
| 599 | 3300025917 | Ga0207660_10023942 | Ga0207660_100239423 | 288 |
| 600 | 3300025917 | Ga0207660_10033899 | Ga0207660_100338993 | 288 |
| 601 | 3300025918 | Ga0207662_10000119 | Ga0207662_1000011930 | 288 |
| 602 | 3300025918 | Ga0207662_10004685 | Ga0207662_100046859 | 288 |
| 603 | 3300025918 | Ga0207662_10012444 | Ga0207662_100124443 | 288 |
| 604 | 3300025919 | Ga0207657_10000316 | Ga0207657_1000031628 | 288 |
| 605 | 3300025919 | Ga0207657_10006914 | Ga0207657_100069149 | 288 |
| 606 | 3300025919 | Ga0207657_10029916 | Ga0207657_100299164 | 288 |
| 607 | 3300025919 | Ga0207657_10063030 | Ga0207657_100630302 | 288 |
| 608 | 3300025920 | Ga0207649_10000090 | Ga0207649_1000009047 | 288 |
| 609 | 3300025921 | Ga0207652_10000190 | Ga0207652_1000019036 | 288 |
| 610 | 3300025921 | Ga0207652_10010770 | Ga0207652_100107702 | 288 |
| 611 | 3300025921 | Ga0207652_10022911 | Ga0207652_100229114 | 288 |
| 612 | 3300025921 | Ga0207652_10077354 | Ga0207652_100773542 | 288 |
| 613 | 3300025921 | Ga0207652_10077669 | Ga0207652_100776692 | 288 |
| 614 | 3300025923 | Ga0207681_10000370 | Ga0207681_1000037026 | 288 |
| 615 | 3300025923 | Ga0207681_10035787 | Ga0207681_100357873 | 288 |
| 616 | 3300025923 | Ga0207681_10051828 | Ga0207681_100518282 | 288 |
| 617 | 3300025924 | Ga0207694_10096260 | Ga0207694_100962603 | 288 |
| 618 | 3300025924 | Ga0207694_10287683 | Ga0207694_102876832 | 288 |
| 619 | 3300025925 | Ga0207650_10015721 | Ga0207650_100157212 | 288 |
| 620 | 3300025926 | Ga0207659_10000038 | Ga0207659_1000003825 | 288 |
| 621 | 3300025926 | Ga0207659_10015533 | Ga0207659_100155333 | 288 |
| 622 | 3300025927 | Ga0207687_10000342 | Ga0207687_1000034210 | 288 |
| 623 | 3300025927 | Ga0207687_10043424 | Ga0207687_100434242 | 288 |
| 624 | 3300025928 | Ga0207700_10102516 | Ga0207700_101025162 | 288 |
| 625 | 3300025928 | Ga0207700_10123117 | Ga0207700_101231172 | 288 |
| 626 | 3300025928 | Ga0207700_10208060 | Ga0207700_102080602 | 288 |
| 627 | 3300025929 | Ga0207664_10091280 | Ga0207664_100912802 | 288 |
| 628 | 3300025929 | Ga0207664_10157677 | Ga0207664_101576772 | 288 |
| 629 | 3300025931 | Ga0207644_10000825 | Ga0207644_1000082514 | 288 |
| 630 | 3300025931 | Ga0207644_10012480 | Ga0207644_100124804 | 288 |
| 631 | 3300025931 | Ga0207644_10015448 | Ga0207644_100154482 | 288 |
| 632 | 3300025932 | Ga0207690_10000239 | Ga0207690_100002398 | 288 |
| 633 | 3300025932 | Ga0207690_10002494 | Ga0207690_100024949 | 288 |
| 634 | 3300025932 | Ga0207690_10031361 | Ga0207690_100313613 | 288 |
| 635 | 3300025933 | Ga0207706_10000424 | Ga0207706_1000042422 | 288 |
| 636 | 3300025933 | Ga0207706_10001779 | Ga0207706_1000177911 | 288 |
| 637 | 3300025933 | Ga0207706_10006933 | Ga0207706_100069335 | 288 |
| 638 | 3300025934 | Ga0207686_10001581 | Ga0207686_100015816 | 288 |
| 639 | 3300025934 | Ga0207686_10005903 | Ga0207686_100059032 | 288 |
| 640 | 3300025935 | Ga0207709_10000379 | Ga0207709_1000037941 | 288 |
| 641 | 3300025935 | Ga0207709_10134686 | Ga0207709_101346862 | 288 |
| 642 | 3300025936 | Ga0207670_10000176 | Ga0207670_1000017617 | 288 |
| 643 | 3300025936 | Ga0207670_10008695 | Ga0207670_100086957 | 288 |
| 644 | 3300025937 | Ga0207669_10000165 | Ga0207669_1000016526 | 288 |
| 645 | 3300025937 | Ga0207669_10005756 | Ga0207669_100057562 | 288 |
| 646 | 3300025938 | Ga0207704_10001293 | Ga0207704_100012934 | 288 |
| 647 | 3300025938 | Ga0207704_10010329 | Ga0207704_100103294 | 288 |
| 648 | 3300025938 | Ga0207704_10011009 | Ga0207704_100110092 | 288 |
| 649 | 3300025938 | Ga0207704_10119380 | Ga0207704_101193802 | 288 |
| 650 | 3300025939 | Ga0207665_10007116 | Ga0207665_100071165 | 288 |
| 651 | 3300025940 | Ga0207691_10000358 | Ga0207691_1000035814 | 288 |
| 652 | 3300025941 | Ga0207711_10000792 | Ga0207711_1000079234 | 288 |
| 653 | 3300025941 | Ga0207711_10182716 | Ga0207711_101827161 | 288 |
| 654 | 3300025942 | Ga0207689_10000479 | Ga0207689_1000047931 | 288 |
| 655 | 3300025942 | Ga0207689_10008563 | Ga0207689_100085634 | 288 |
| 656 | 3300025944 | Ga0207661_10001263 | Ga0207661_100012638 | 288 |
| 657 | 3300025944 | Ga0207661_10001389 | Ga0207661_100013897 | 288 |
| 658 | 3300025944 | Ga0207661_10057150 | Ga0207661_100571503 | 288 |
| 659 | 3300025944 | Ga0207661_10146024 | Ga0207661_101460242 | 288 |
| 660 | 3300025945 | Ga0207679_10000139 | Ga0207679_1000013917 | 288 |
| 661 | 3300025945 | Ga0207679_10014773 | Ga0207679_100147732 | 288 |
| 662 | 3300025945 | Ga0207679_10085372 | Ga0207679_100853722 | 288 |
| 663 | 3300025949 | Ga0207667_10003492 | Ga0207667_1000349220 | 288 |
| 664 | 3300025949 | Ga0207667_10071083 | Ga0207667_100710833 | 288 |
| 665 | 3300025960 | Ga0207651_10000072 | Ga0207651_1000007239 | 288 |
| 666 | 3300025960 | Ga0207651_10009633 | Ga0207651_100096334 | 288 |
| 667 | 3300025961 | Ga0207712_10001177 | Ga0207712_100011776 | 288 |
| 668 | 3300025961 | Ga0207712_10019946 | Ga0207712_100199463 | 288 |
| 669 | 3300025961 | Ga0207712_10260360 | Ga0207712_102603602 | 288 |
| 670 | 3300025972 | Ga0207668_10000168 | Ga0207668_1000016841 | 288 |
| 671 | 3300025981 | Ga0207640_10000242 | Ga0207640_1000024213 | 288 |
| 672 | 3300025981 | Ga0207640_10048598 | Ga0207640_100485982 | 288 |
| 673 | 3300025986 | Ga0207658_10000667 | Ga0207658_1000066731 | 288 |
| 674 | 3300025986 | Ga0207658_10079320 | Ga0207658_100793202 | 288 |
| 675 | 3300026023 | Ga0207677_10003733 | Ga0207677_1000373310 | 288 |
| 676 | 3300026023 | Ga0207677_10046548 | Ga0207677_100465482 | 288 |
| 677 | 3300026035 | Ga0207703_10000463 | Ga0207703_1000046341 | 288 |
| 678 | 3300026035 | Ga0207703_10026226 | Ga0207703_100262264 | 288 |
| 679 | 3300026041 | Ga0207639_10000745 | Ga0207639_1000074517 | 288 |
| 680 | 3300026041 | Ga0207639_10054106 | Ga0207639_100541062 | 288 |
| 681 | 3300026067 | Ga0207678_10000447 | Ga0207678_1000044730 | 288 |
| 682 | 3300026067 | Ga0207678_10004671 | Ga0207678_100046714 | 288 |
| 683 | 3300026067 | Ga0207678_10005453 | Ga0207678_100054536 | 288 |
| 684 | 3300026067 | Ga0207678_10005767 | Ga0207678_100057679 | 288 |
| 685 | 3300026067 | Ga0207678_10027584 | Ga0207678_100275842 | 288 |
| 686 | 3300026075 | Ga0207708_10000293 | Ga0207708_1000029313 | 288 |
| 687 | 3300026075 | Ga0207708_10001428 | Ga0207708_1000142812 | 288 |
| 688 | 3300026075 | Ga0207708_10003697 | Ga0207708_100036972 | 288 |
| 689 | 3300026075 | Ga0207708_10094413 | Ga0207708_100944132 | 288 |
| 690 | 3300026078 | Ga0207702_10001723 | Ga0207702_1000172314 | 288 |
| 691 | 3300026088 | Ga0207641_10000724 | Ga0207641_100007248 | 288 |
| 692 | 3300026088 | Ga0207641_10017293 | Ga0207641_100172934 | 288 |
| 693 | 3300026089 | Ga0207648_10000223 | Ga0207648_1000022347 | 288 |
| 694 | 3300026089 | Ga0207648_10010764 | Ga0207648_100107643 | 288 |
| 695 | 3300026089 | Ga0207648_10011893 | Ga0207648_100118936 | 288 |
| 696 | 3300026089 | Ga0207648_10474558 | Ga0207648_104745582 | 288 |
| 697 | 3300026095 | Ga0207676_10000392 | Ga0207676_1000039228 | 288 |
| 698 | 3300026095 | Ga0207676_10010604 | Ga0207676_100106044 | 288 |
| 699 | 3300026095 | Ga0207676_10357479 | Ga0207676_103574792 | 288 |
| 700 | 3300026116 | Ga0207674_10000955 | Ga0207674_1000095531 | 288 |
| 701 | 3300026116 | Ga0207674_10051516 | Ga0207674_100515163 | 288 |
| 702 | 3300026116 | Ga0207674_10060640 | Ga0207674_100606402 | 288 |
| 703 | 3300026118 | Ga0207675_100000364 | Ga0207675_10000036439 | 288 |
| 704 | 3300026118 | Ga0207675_100001777 | Ga0207675_10000177720 | 288 |
| 705 | 3300026118 | Ga0207675_100002590 | Ga0207675_1000025904 | 288 |
| 706 | 3300026118 | Ga0207675_100005082 | Ga0207675_1000050824 | 288 |
| 707 | 3300026121 | Ga0207683_10000397 | Ga0207683_1000039714 | 288 |
| 708 | 3300026121 | Ga0207683_10003810 | Ga0207683_100038106 | 288 |
| 709 | 3300026121 | Ga0207683_10010729 | Ga0207683_100107295 | 288 |
| 710 | 3300026142 | Ga0207698_10000818 | Ga0207698_1000081812 | 288 |
| 711 | 3300026142 | Ga0207698_10005989 | Ga0207698_100059893 | 288 |
| 712 | 3300026142 | Ga0207698_10101211 | Ga0207698_101012113 | 288 |
| 713 | 3300027296 | Ga0209389_1000012 | Ga0209389_1000012173 | 288 |
| 714 | 3300027361 | Ga0209489_100019 | Ga0209489_100019173 | 288 |
| 715 | 3300027363 | Ga0209700_100018 | Ga0209700_100018192 | 288 |
| 716 | 3300027671 | Ga0209588_1001156 | Ga0209588_10011565 | 288 |
| 717 | 3300027717 | Ga0209998_10000687 | Ga0209998_100006873 | 288 |
| 718 | 3300027717 | Ga0209998_10002273 | Ga0209998_100022733 | 288 |
| 719 | 3300027866 | Ga0209813_10005075 | Ga0209813_100050753 | 288 |
| 720 | 3300027866 | Ga0209813_10022115 | Ga0209813_100221152 | 288 |
| 721 | 3300027876 | Ga0209974_10000890 | Ga0209974_100008902 | 288 |
| 722 | 3300027876 | Ga0209974_10022678 | Ga0209974_100226782 | 288 |
| 723 | 3300027907 | Ga0207428_10000439 | Ga0207428_1000043931 | 288 |
| 724 | 3300027907 | Ga0207428_10000617 | Ga0207428_1000061731 | 288 |
| 725 | 3300028379 | Ga0268266_10023640 | Ga0268266_100236402 | 288 |
| 726 | 3300028379 | Ga0268266_10042367 | Ga0268266_100423674 | 288 |
| 727 | 3300028379 | Ga0268266_10206615 | Ga0268266_102066152 | 288 |
| 728 | 3300028380 | Ga0268265_10001307 | Ga0268265_1000130717 | 288 |
| 729 | 3300028380 | Ga0268265_10004440 | Ga0268265_100044408 | 288 |
| 730 | 3300028380 | Ga0268265_10008357 | Ga0268265_100083578 | 288 |
| 731 | 3300028380 | Ga0268265_10036896 | Ga0268265_100368962 | 288 |
| 732 | 3300028381 | Ga0268264_10003260 | Ga0268264_100032605 | 288 |
| 733 | 3300028381 | Ga0268264_10022151 | Ga0268264_100221513 | 288 |
| 734 | 3300028381 | Ga0268264_10031810 | Ga0268264_100318102 | 288 |
| 735 | 3300028381 | Ga0268264_10121445 | Ga0268264_101214452 | 288 |
| 736 | 3300028381 | Ga0268264_10180258 | Ga0268264_101802582 | 288 |
| 737 | 3300028800 | Ga0265338_10038980 | Ga0265338_100389805 | 288 |
| 738 | 3300031090 | Ga0265760_10048313 | Ga0265760_100483132 | 288 |
| 739 | 3300031241 | Ga0265325_10000043 | Ga0265325_1000004323 | 288 |
| 740 | 3300031241 | Ga0265325_10008854 | Ga0265325_100088545 | 288 |
| 741 | 3300031241 | Ga0265325_10026580 | Ga0265325_100265803 | 288 |
| 742 | 3300031247 | Ga0265340_10006812 | Ga0265340_100068123 | 288 |
| 743 | 3300031247 | Ga0265340_10013225 | Ga0265340_100132253 | 288 |
| 744 | 3300031249 | Ga0265339_10009370 | Ga0265339_100093703 | 288 |
| 745 | 3300031249 | Ga0265339_10014659 | Ga0265339_100146594 | 288 |
| 746 | 3300031249 | Ga0265339_10107879 | Ga0265339_101078792 | 288 |
| 747 | 3300031251 | Ga0265327_10000070 | Ga0265327_10000070149 | 288 |
| 748 | 3300031344 | Ga0265316_10050529 | Ga0265316_100505292 | 288 |
| 749 | 3300031344 | Ga0265316_10317540 | Ga0265316_103175401 | 288 |
| 750 | 3300031456 | Ga0307513_10112561 | Ga0307513_101125613 | 288 |
| 751 | 3300031595 | Ga0265313_10000269 | Ga0265313_1000026921 | 288 |
| 752 | 3300031595 | Ga0265313_10001300 | Ga0265313_1000130022 | 288 |
| 753 | 3300031595 | Ga0265313_10017513 | Ga0265313_100175133 | 288 |
| 754 | 3300031595 | Ga0265313_10077352 | Ga0265313_100773522 | 288 |
| 755 | 3300031711 | Ga0265314_10000708 | Ga0265314_1000070824 | 288 |
| 756 | 3300031711 | Ga0265314_10061525 | Ga0265314_100615253 | 288 |
| 757 | 3300031712 | Ga0265342_10001200 | Ga0265342_1000120020 | 288 |
| 758 | 3300031712 | Ga0265342_10033550 | Ga0265342_100335502 | 288 |
| 759 | 3300031731 | Ga0307405_10010582 | Ga0307405_100105823 | 288 |
| 760 | 3300031852 | Ga0307410_10060157 | Ga0307410_100601572 | 288 |
| 761 | 3300031901 | Ga0307406_10004455 | Ga0307406_100044553 | 288 |
| 762 | 3300031911 | Ga0307412_10016996 | Ga0307412_100169962 | 288 |
| 763 | 3300031995 | Ga0307409_100001101 | Ga0307409_1000011013 | 288 |
| 764 | 3300032002 | Ga0307416_100001022 | Ga0307416_10000102210 | 288 |
| 765 | 3300032002 | Ga0307416_100726163 | Ga0307416_1007261632 | 288 |
| 766 | 3300032005 | Ga0307411_10091234 | Ga0307411_100912343 | 288 |
| 767 | 3300032133 | Ga0316583_10000233 | Ga0316583_100002334 | 288 |
| 768 | 3300034816 | Ga0373930_0000008 | Ga0373930_0000008_12424_13380 | 288 |
| 769 | 3300034817 | Ga0373948_0001178 | Ga0373948_0001178_36_992 | 288 |
| 770 | 3300034818 | Ga0373950_0004994 | Ga0373950_0004994_526_1482 | 288 |
| 771 | 3300034819 | Ga0373958_0001331 | Ga0373958_0001331_937_1893 | 288 |
| 772 | 3300034819 | Ga0373958_0002083 | Ga0373958_0002083_756_1712 | 288 |
| 773 | 3300034820 | Ga0373959_0000708 | Ga0373959_0000708_2460_3416 | 288 |
| 774 | 3300034957 | Ga0373938_0000434 | Ga0373938_0000434_4523_5479 | 288 |
| 775 | 3300034957 | Ga0373938_0000881 | Ga0373938_0000881_1521_2477 | 288 |
| 776 | 3300035084 | Ga0373928_0000087 | Ga0373928_0000087_4330_5286 | 288 |
| 777 | 3300035084 | Ga0373928_0001439 | Ga0373928_0001439_1361_2317 | 288 |
| 778 | 3300035085 | Ga0373929_0000288 | Ga0373929_0000288_6557_7513 | 288 |
| 779 | 3300035085 | Ga0373929_0001454 | Ga0373929_0001454_2680_3636 | 288 |
| 780 | 3300035086 | Ga0373934_0017655 | Ga0373934_0017655_1106_2062 | 288 |
| 781 | 3300035088 | Ga0373940_0004036 | Ga0373940_0004036_679_1635 | 288 |
| 782 | 3300035088 | Ga0373940_0004893 | Ga0373940_0004893_394_1350 | 288 |
| 783 | 3300035090 | Ga0373949_0001082 | Ga0373949_0001082_5886_6842 | 288 |
| 784 | 3300035090 | Ga0373949_0004172 | Ga0373949_0004172_1713_2669 | 288 |
| 785 | 3300035091 | Ga0373951_0000363 | Ga0373951_0000363_8429_9385 | 288 |
| 786 | 3300035091 | Ga0373951_0006215 | Ga0373951_0006215_705_1661 | 288 |
| 787 | 3300035092 | Ga0373952_0000458 | Ga0373952_0000458_1201_2157 | 288 |
| 788 | 3300035092 | Ga0373952_0000576 | Ga0373952_0000576_3096_4052 | 288 |
| 789 | 3300035111 | Ga0373923_0004706 | Ga0373923_0004706_1678_2634 | 288 |
| 790 | 3300035111 | Ga0373923_0015311 | Ga0373923_0015311_794_1744 | 288 |
| 791 | 3300035112 | Ga0373932_0000239 | Ga0373932_0000239_6534_7490 | 288 |
| 792 | 3300035112 | Ga0373932_0000588 | Ga0373932_0000588_9560_10516 | 288 |
| 793 | 3300035113 | Ga0373936_0000885 | Ga0373936_0000885_8402_9358 | 288 |
| 794 | 3300035114 | Ga0373939_0000850 | Ga0373939_0000850_4391_5347 | 288 |
| 795 | 3300035114 | Ga0373939_0001037 | Ga0373939_0001037_143_1099 | 288 |
| 796 | 3300035114 | Ga0373939_0015567 | Ga0373939_0015567_808_1764 | 288 |
| 797 | 3300035114 | Ga0373939_0026765 | Ga0373939_0026765_54_1010 | 288 |
| 798 | 3300035115 | Ga0373941_0000224 | Ga0373941_0000224_5764_6720 | 288 |
| 799 | 3300035115 | Ga0373941_0003233 | Ga0373941_0003233_963_1919 | 288 |
| 800 | 3300035117 | Ga0373953_0012222 | Ga0373953_0012222_213_1163 | 288 |
| 801 | 3300035117 | Ga0373953_0051874 | Ga0373953_0051874_676_1632 | 288 |
| 802 | 3300035118 | Ga0373954_0006125 | Ga0373954_0006125_573_1529 | 288 |
| 803 | 3300035118 | Ga0373954_0092870 | Ga0373954_0092870_130_1086 | 288 |
| 804 | 3300035119 | Ga0373956_0002570 | Ga0373956_0002570_1270_2220 | 288 |
| 805 | 3300035119 | Ga0373956_0014922 | Ga0373956_0014922_100_1056 | 288 |
| 806 | 3300035120 | Ga0373957_0000794 | Ga0373957_0000794_3191_4147 | 288 |
| 807 | 3300035120 | Ga0373957_0058417 | Ga0373957_0058417_20_937 | 288 |
| 808 | 3300035121 | Ga0373960_0000332 | Ga0373960_0000332_4405_5361 | 288 |
| 809 | 3300035121 | Ga0373960_0000746 | Ga0373960_0000746_164_1120 | 288 |
| 810 | 3300035170 | Ga0373943_0003854 | Ga0373943_0003854_2631_3578 | 288 |
| 811 | 3300035172 | Ga0373955_0000742 | Ga0373955_0000742_3322_4278 | 288 |
| 812 | 3300035172 | Ga0373955_0024367 | Ga0373955_0024367_1642_2598 | 288 |
| 813 | 3300035207 | Ga0373942_0001505 | Ga0373942_0001505_4267_5223 | 288 |
| 814 | 3300035207 | Ga0373942_0003587 | Ga0373942_0003587_2553_3509 | 288 |
| 815 | 3300035207 | Ga0373942_0006955 | Ga0373942_0006955_827_1783 | 288 |
| 816 | 3300035241 | Ga0373961_0008690 | Ga0373961_0008690_1339_2295 | 288 |
| 817 | 3300035241 | Ga0373961_0015663 | Ga0373961_0015663_799_1755 | 288 |
| 818 | 3300035242 | Ga0373962_0009042 | Ga0373962_0009042_687_1643 | 288 |
| 819 | 3300035398 | Ga0316574_0022902 | Ga0316574_0022902_459_1406 | 288 |
| 820 | 3300035691 | Ga0373931_0000089 | Ga0373931_0000089_6043_6999 | 288 |
| 821 | 3300035691 | Ga0373931_0008141 | Ga0373931_0008141_2639_3595 | 288 |
| 822 | 3300035691 | Ga0373931_0257657 | Ga0373931_0257657_86_1042 | 288 |
| 823 | 3300035692 | Ga0373935_0028731 | Ga0373935_0028731_493_1449 | 288 |
| 824 | 3300035692 | Ga0373935_0107304 | Ga0373935_0107304_550_1506 | 288 |
| 825 | 3300035695 | Ga0373927_0029040 | Ga0373927_0029040_654_1601 | 288 |
| 826 | 3300035695 | Ga0373927_0059833 | Ga0373927_0059833_412_1362 | 288 |
| 827 | 3300035724 | Ga0373933_0008278 | Ga0373933_0008278_1458_2414 | 288 |
| 828 | 3300035724 | Ga0373933_0158036 | Ga0373933_0158036_10_927 | 288 |
| 829 | 3300035725 | Ga0373947_0026284 | Ga0373947_0026284_2073_3029 | 288 |
| 830 | 3300035725 | Ga0373947_0029462 | Ga0373947_0029462_240_1196 | 288 |
| 831 | 3300035725 | Ga0373947_0034198 | Ga0373947_0034198_50_1006 | 288 |
| 832 | 3300035725 | Ga0373947_0091172 | Ga0373947_0091172_531_1481 | 288 |
| 833 | 3300036401 | Ga0373937_0001701 | Ga0373937_0001701_16267_17223 | 288 |
| 834 | 3300036401 | Ga0373937_0012221 | Ga0373937_0012221_2535_3491 | 288 |
| 835 | 3300036401 | Ga0373937_0077266 | Ga0373937_0077266_227_1177 | 288 |
| 836 | 3300036401 | Ga0373937_0373666 | Ga0373937_0373666_20_982 | 288 |
| 837 | 3300037068 | Ga0373925_0262653 | Ga0373925_0262653_17_973 | 288 |
| 838 | 3300039437 | Ga0436365_0677631 | Ga0436365_0677631_70_1026 | 288 |
| 839 | 3300039447 | Ga0436361_0740814 | Ga0436361_0740814_2480_3430 | 288 |
| 840 | 3300039447 | Ga0436361_1002425 | Ga0436361_1002425_1199_2155 | 288 |
| 841 | 3300039447 | Ga0436361_1023583 | Ga0436361_1023583_1444_2400 | 288 |
| 842 | 3300039453 | Ga0436362_0138375 | Ga0436362_0138375_905_1861 | 288 |
| 843 | 3300042001 | Ga0439441_023442 | Ga0439441_023442_95_1051 | 288 |
| 844 | 3300042003 | Ga0439443_000561 | Ga0439443_000561_2275_3231 | 288 |
| 845 | 3300042008 | Ga0439450_026201 | Ga0439450_026201_145_1101 | 288 |
| 846 | 3300042122 | Ga0450920_004614 | Ga0450920_004614_1029_1985 | 288 |
| 847 | 3300042125 | Ga0450923_000696 | Ga0450923_000696_825_1781 | 288 |
| 848 | 3300042134 | Ga0450898_003595 | Ga0450898_003595_430_1386 | 288 |
| 849 | 3300042145 | Ga0450906_016085 | Ga0450906_016085_379_1335 | 288 |
| 850 | 3300042156 | Ga0439446_0002955 | Ga0439446_0002955_723_1679 | 288 |
| 851 | 3300042435 | Ga0439434_0003139 | Ga0439434_0003139_2837_3793 | 288 |
| 852 | 3300042436 | Ga0439435_0000874 | Ga0439435_0000874_323_1279 | 288 |
| 853 | 3300042437 | Ga0439444_0000136 | Ga0439444_0000136_846_1802 | 288 |
| 854 | 3300042439 | Ga0439464_0023204 | Ga0439464_0023204_519_1475 | 288 |
| 855 | 3300042461 | Ga0439460_0062529 | Ga0439460_0062529_145_1101 | 288 |
| 856 | 3300044656 | Ga0466969_0018218 | Ga0466969_0018218_2529_3485 | 288 |
| 857 | 3300044693 | Ga0466961_0000138 | Ga0466961_0000138_12073_13029 | 288 |
| 858 | 3300044712 | Ga0453684_0643545 | Ga0453684_0643545_82_1038 | 288 |
| 859 | 3300045049 | Ga0466959_0009348 | Ga0466959_0009348_4219_5175 | 288 |
| 860 | 3300045051 | Ga0451576_0018820 | Ga0451576_0018820_5067_6023 | 288 |
| 861 | 3300045976 | Ga0466967_0157916 | Ga0466967_0157916_38_994 | 288 |
| 862 | 3300046455 | Ga0495603_0000415 | Ga0495603_0000415_14915_15871 | 288 |
| 863 | 3300046455 | Ga0495603_0055870 | Ga0495603_0055870_419_1375 | 288 |
| 864 | 3300046459 | Ga0495629_0020344 | Ga0495629_0020344_3222_4178 | 288 |
| 865 | 3300046459 | Ga0495629_0030036 | Ga0495629_0030036_543_1490 | 288 |
| 866 | 3300046460 | Ga0495638_0054591 | Ga0495638_0054591_150_1106 | 288 |
| 867 | 3300046461 | Ga0495641_0015052 | Ga0495641_0015052_74_1030 | 288 |
| 868 | 3300046462 | Ga0495651_0014089 | Ga0495651_0014089_4783_5739 | 288 |
| 869 | 3300046462 | Ga0495651_0019331 | Ga0495651_0019331_1122_2072 | 288 |
| 870 | 3300046463 | Ga0495653_0007085 | Ga0495653_0007085_6484_7440 | 288 |
| 871 | 3300046463 | Ga0495653_0025322 | Ga0495653_0025322_2270_3226 | 288 |
| 872 | 3300046463 | Ga0495653_0066304 | Ga0495653_0066304_713_1663 | 288 |
| 873 | 3300046472 | Ga0495580_0000784 | Ga0495580_0000784_13460_14416 | 288 |
| 874 | 3300046472 | Ga0495580_0066944 | Ga0495580_0066944_1033_1989 | 288 |
| 875 | 3300046472 | Ga0495580_0265138 | Ga0495580_0265138_79_1029 | 288 |
| 876 | 3300046473 | Ga0495582_0004166 | Ga0495582_0004166_4665_5621 | 288 |
| 877 | 3300046473 | Ga0495582_0260863 | Ga0495582_0260863_16_933 | 288 |
| 878 | 3300046475 | Ga0495639_0001444 | Ga0495639_0001444_7049_8005 | 288 |
| 879 | 3300046476 | Ga0495662_0022760 | Ga0495662_0022760_573_1529 | 288 |
| 880 | 3300046477 | Ga0495664_0003541 | Ga0495664_0003541_4067_5014 | 288 |
| 881 | 3300046477 | Ga0495664_0014840 | Ga0495664_0014840_1199_2149 | 288 |
| 882 | 3300046491 | Ga0495584_0054169 | Ga0495584_0054169_434_1390 | 288 |
| 883 | 3300046499 | Ga0495594_0000288 | Ga0495594_0000288_10265_11221 | 288 |
| 884 | 3300046500 | Ga0495596_0035124 | Ga0495596_0035124_808_1764 | 288 |
| 885 | 3300046511 | Ga0495608_0004655 | Ga0495608_0004655_6139_7089 | 288 |
| 886 | 3300046514 | Ga0495618_0008530 | Ga0495618_0008530_3809_4756 | 288 |
| 887 | 3300046514 | Ga0495618_0008714 | Ga0495618_0008714_1312_2268 | 288 |
| 888 | 3300046516 | Ga0495628_0015272 | Ga0495628_0015272_3489_4439 | 288 |
| 889 | 3300046517 | Ga0495630_0019770 | Ga0495630_0019770_2537_3493 | 288 |
| 890 | 3300046517 | Ga0495630_0084340 | Ga0495630_0084340_842_1789 | 288 |
| 891 | 3300046520 | Ga0495637_0046579 | Ga0495637_0046579_17_973 | 288 |
| 892 | 3300046529 | Ga0495652_0002132 | Ga0495652_0002132_505_1455 | 288 |
| 893 | 3300046529 | Ga0495652_0026899 | Ga0495652_0026899_3291_4238 | 288 |
| 894 | 3300046533 | Ga0495640_0013819 | Ga0495640_0013819_4819_5775 | 288 |
| 895 | 3300046533 | Ga0495640_0023194 | Ga0495640_0023194_2807_3763 | 288 |
| 896 | 3300046535 | Ga0495586_0041279 | Ga0495586_0041279_583_1539 | 288 |
| 897 | 3300046536 | Ga0495587_0001771 | Ga0495587_0001771_859_1815 | 288 |
| 898 | 3300046536 | Ga0495587_0047896 | Ga0495587_0047896_147_1097 | 288 |
| 899 | 3300046536 | Ga0495587_0052199 | Ga0495587_0052199_103_1059 | 288 |
| 900 | 3300046537 | Ga0495598_0064414 | Ga0495598_0064414_118_1074 | 288 |
| 901 | 3300046543 | Ga0495645_0007720 | Ga0495645_0007720_4166_5116 | 288 |
| 902 | 3300046557 | Ga0495622_0059771 | Ga0495622_0059771_630_1586 | 288 |
| 903 | 3300046559 | Ga0495667_0008577 | Ga0495667_0008577_2722_3678 | 288 |
| 904 | 3300046559 | Ga0495667_0009171 | Ga0495667_0009171_2349_3299 | 288 |
| 905 | 3300046559 | Ga0495667_0013545 | Ga0495667_0013545_2323_3279 | 288 |
| 906 | 3300046616 | Ga0495668_0011373 | Ga0495668_0011373_3492_4448 | 288 |
| 907 | 3300046616 | Ga0495668_0015058 | Ga0495668_0015058_1364_2320 | 288 |
| 908 | 3300046642 | Ga0495634_0013833 | Ga0495634_0013833_2021_2977 | 288 |
| 909 | 3300046642 | Ga0495634_0035879 | Ga0495634_0035879_648_1604 | 288 |
| 910 | 3300046663 | Ga0495635_0001121 | Ga0495635_0001121_13203_14159 | 288 |
| 911 | 3300046663 | Ga0495635_0056869 | Ga0495635_0056869_73_1023 | 288 |
| 912 | 3300046663 | Ga0495635_0061392 | Ga0495635_0061392_1518_2474 | 288 |
| 913 | 3300046674 | Ga0495588_0001822 | Ga0495588_0001822_3639_4595 | 288 |
| 914 | 3300046675 | Ga0495657_0037813 | Ga0495657_0037813_2045_2995 | 288 |
| 915 | 3300046675 | Ga0495657_0051163 | Ga0495657_0051163_492_1448 | 288 |
| 916 | 3300046675 | Ga0495657_0056007 | Ga0495657_0056007_472_1428 | 288 |
| 917 | 3300046678 | Ga0495599_0074444 | Ga0495599_0074444_974_1924 | 288 |
| 918 | 3300046679 | Ga0495623_0000055 | Ga0495623_0000055_48549_49505 | 288 |
| 919 | 3300046679 | Ga0495623_0006302 | Ga0495623_0006302_3084_4034 | 288 |
| 920 | 3300046680 | Ga0495646_0006354 | Ga0495646_0006354_2513_3469 | 288 |
| 921 | 3300046681 | Ga0495647_0005365 | Ga0495647_0005365_1315_2262 | 288 |
| 922 | 3300046681 | Ga0495647_0054777 | Ga0495647_0054777_15_971 | 288 |
| 923 | 3300046683 | Ga0495658_0004925 | Ga0495658_0004925_3820_4776 | 288 |
| 924 | 3300046683 | Ga0495658_0045105 | Ga0495658_0045105_500_1456 | 288 |
| 925 | 3300046684 | Ga0495669_0043811 | Ga0495669_0043811_54_1004 | 288 |
| 926 | 3300046684 | Ga0495669_0062693 | Ga0495669_0062693_409_1365 | 288 |
| 927 | 3300046684 | Ga0495669_0111800 | Ga0495669_0111800_284_1240 | 288 |
| 928 | 3300046689 | Ga0495613_0001672 | Ga0495613_0001672_4243_5199 | 288 |
| 929 | 3300046692 | Ga0495671_0200359 | Ga0495671_0200359_29_946 | 288 |
| 930 | 3300046694 | Ga0495649_0069278 | Ga0495649_0069278_355_1311 | 288 |
| 931 | 3300046809 | Ga0495600_0019135 | Ga0495600_0019135_1033_1989 | 288 |
| 932 | 3300046809 | Ga0495600_0154296 | Ga0495600_0154296_417_1373 | 288 |
| 933 | 3300047317 | Ga0495604_0037784 | Ga0495604_0037784_2292_3242 | 288 |
| 934 | 3300047319 | Ga0495674_0010267 | Ga0495674_0010267_7268_8224 | 288 |
| 935 | 3300047319 | Ga0495674_0010269 | Ga0495674_0010269_2411_3358 | 288 |
| 936 | 3300047319 | Ga0495674_0016713 | Ga0495674_0016713_4658_5614 | 288 |
| 937 | 3300047321 | Ga0495676_0078332 | Ga0495676_0078332_868_1824 | 288 |
| 938 | 3300047322 | Ga0495680_0001836 | Ga0495680_0001836_1511_2467 | 288 |
| 939 | 3300047322 | Ga0495680_0015898 | Ga0495680_0015898_3120_4070 | 288 |
| 940 | 3300047444 | Ga0495675_0022095 | Ga0495675_0022095_2687_3637 | 288 |
| 941 | 3300047471 | Ga0495684_0009509 | Ga0495684_0009509_3729_4685 | 288 |
| 942 | 3300047471 | Ga0495684_0152417 | Ga0495684_0152417_453_1403 | 288 |
| 943 | 3300047673 | Ga0495593_0001141 | Ga0495593_0001141_11934_12890 | 288 |
| 944 | 3300047673 | Ga0495593_0011395 | Ga0495593_0011395_3526_4482 | 288 |
| 945 | 3300048088 | Ga0495602_0007511 | Ga0495602_0007511_6636_7586 | 288 |
| 946 | 3300048088 | Ga0495602_0012226 | Ga0495602_0012226_7693_8649 | 288 |
| 947 | 3300048089 | Ga0495614_0020350 | Ga0495614_0020350_745_1701 | 288 |
| 948 | 3300048089 | Ga0495614_0098525 | Ga0495614_0098525_207_1154 | 288 |
| 949 | 3300048903 | Ga0496100_0000200 | Ga0496100_0000200_5102_6058 | 288 |
| 950 | 3300048903 | Ga0496100_0013332 | Ga0496100_0013332_1546_2502 | 288 |
| 951 | 3300048903 | Ga0496100_0025238 | Ga0496100_0025238_1026_1982 | 288 |
| 952 | 3300048903 | Ga0496100_0075923 | Ga0496100_0075923_786_1742 | 288 |
| 953 | 3300048903 | Ga0496100_0108676 | Ga0496100_0108676_217_1173 | 288 |
| 954 | 3300048904 | Ga0496101_0000339 | Ga0496101_0000339_21538_22494 | 288 |
| 955 | 3300048904 | Ga0496101_0051165 | Ga0496101_0051165_968_1918 | 288 |
| 956 | 3300048904 | Ga0496101_0122835 | Ga0496101_0122835_930_1886 | 288 |
| 957 | 3300048905 | Ga0496102_0000729 | Ga0496102_0000729_11059_12015 | 288 |
| 958 | 3300048905 | Ga0496102_0030139 | Ga0496102_0030139_3136_4092 | 288 |
| 959 | 3300048905 | Ga0496102_0033365 | Ga0496102_0033365_3179_4135 | 288 |
| 960 | 3300048905 | Ga0496102_0219837 | Ga0496102_0219837_26_982 | 288 |
| 961 | 3300048905 | Ga0496102_0299934 | Ga0496102_0299934_41_997 | 288 |
| 962 | 3300048906 | Ga0496103_0001522 | Ga0496103_0001522_7471_8427 | 288 |
| 963 | 3300048906 | Ga0496103_0010791 | Ga0496103_0010791_2019_2975 | 288 |
| 964 | 3300048906 | Ga0496103_0025697 | Ga0496103_0025697_1605_2561 | 288 |
| 965 | 3300048907 | Ga0496104_0000903 | Ga0496104_0000903_4332_5282 | 288 |
| 966 | 3300048907 | Ga0496104_0003346 | Ga0496104_0003346_9737_10687 | 288 |
| 967 | 3300048907 | Ga0496104_0004368 | Ga0496104_0004368_6744_7700 | 288 |
| 968 | 3300048907 | Ga0496104_0016056 | Ga0496104_0016056_3237_4193 | 288 |
| 969 | 3300048907 | Ga0496104_0033068 | Ga0496104_0033068_1154_2110 | 288 |
| 970 | 3300048907 | Ga0496104_0096038 | Ga0496104_0096038_1137_2093 | 288 |
| 971 | 3300048907 | Ga0496104_0256901 | Ga0496104_0256901_276_1232 | 288 |
| 972 | 3300048907 | Ga0496104_0301658 | Ga0496104_0301658_81_1037 | 288 |
| 973 | 3300048908 | Ga0496105_0000246 | Ga0496105_0000246_11261_12211 | 288 |
| 974 | 3300048908 | Ga0496105_0003097 | Ga0496105_0003097_4328_5284 | 288 |
| 975 | 3300048908 | Ga0496105_0008077 | Ga0496105_0008077_2811_3767 | 288 |
| 976 | 3300048908 | Ga0496105_0050267 | Ga0496105_0050267_2432_3388 | 288 |
| 977 | 3300048908 | Ga0496105_0051291 | Ga0496105_0051291_2473_3390 | 288 |
| 978 | 3300048908 | Ga0496105_0173568 | Ga0496105_0173568_737_1693 | 288 |
| 979 | 3300048908 | Ga0496105_0296251 | Ga0496105_0296251_300_1256 | 288 |
| 980 | 3300048909 | Ga0496106_0000202 | Ga0496106_0000202_34821_35777 | 288 |
| 981 | 3300048909 | Ga0496106_0008382 | Ga0496106_0008382_6548_7504 | 288 |
| 982 | 3300048909 | Ga0496106_0013666 | Ga0496106_0013666_2462_3418 | 288 |
| 983 | 3300048909 | Ga0496106_0026406 | Ga0496106_0026406_1204_2154 | 288 |
| 984 | 3300048909 | Ga0496106_0028487 | Ga0496106_0028487_2396_3352 | 288 |
| 985 | 3300048909 | Ga0496106_0044542 | Ga0496106_0044542_1791_2747 | 288 |
| 986 | 3300048910 | Ga0496107_0000066 | Ga0496107_0000066_30314_31270 | 288 |
| 987 | 3300048910 | Ga0496107_0001145 | Ga0496107_0001145_12624_13580 | 288 |
| 988 | 3300048910 | Ga0496107_0003363 | Ga0496107_0003363_8823_9779 | 288 |
| 989 | 3300048910 | Ga0496107_0008683 | Ga0496107_0008683_1530_2486 | 288 |
| 990 | 3300048910 | Ga0496107_0093329 | Ga0496107_0093329_293_1249 | 288 |
| 991 | 3300048910 | Ga0496107_0125460 | Ga0496107_0125460_136_1092 | 288 |
| 992 | 3300048911 | Ga0496108_0002149 | Ga0496108_0002149_4219_5175 | 288 |
| 993 | 3300048911 | Ga0496108_0003262 | Ga0496108_0003262_1094_2050 | 288 |
| 994 | 3300048911 | Ga0496108_0021443 | Ga0496108_0021443_1778_2734 | 288 |
| 995 | 3300048911 | Ga0496108_0049775 | Ga0496108_0049775_746_1696 | 288 |
| 996 | 3300048911 | Ga0496108_0071579 | Ga0496108_0071579_1891_2847 | 288 |
| 997 | 3300048911 | Ga0496108_0151779 | Ga0496108_0151779_864_1820 | 288 |
| 998 | 3300048912 | Ga0496109_0000595 | Ga0496109_0000595_4129_5085 | 288 |
| 999 | 3300048912 | Ga0496109_0004441 | Ga0496109_0004441_1650_2606 | 288 |
| 1000 | 3300048912 | Ga0496109_0016322 | Ga0496109_0016322_4201_5157 | 288 |
| 1001 | 3300048912 | Ga0496109_0037214 | Ga0496109_0037214_697_1653 | 288 |
| 1002 | 3300048913 | Ga0496110_0009554 | Ga0496110_0009554_2499_3455 | 288 |
| 1003 | 3300048913 | Ga0496110_0023133 | Ga0496110_0023133_456_1412 | 288 |
| 1004 | 3300048913 | Ga0496110_0028722 | Ga0496110_0028722_3312_4268 | 288 |
| 1005 | 3300048914 | Ga0496111_0001165 | Ga0496111_0001165_7800_8756 | 288 |
| 1006 | 3300048914 | Ga0496111_0002426 | Ga0496111_0002426_6376_7332 | 288 |
| 1007 | 3300048914 | Ga0496111_0224273 | Ga0496111_0224273_417_1373 | 288 |
| 1008 | 3300048915 | Ga0496112_0003171 | Ga0496112_0003171_3186_4142 | 288 |
| 1009 | 3300048915 | Ga0496112_0037794 | Ga0496112_0037794_2554_3510 | 288 |
| 1010 | 3300048916 | Ga0496113_0001173 | Ga0496113_0001173_3720_4676 | 288 |
| 1011 | 3300048916 | Ga0496113_0001893 | Ga0496113_0001893_3748_4704 | 288 |
| 1012 | 3300048916 | Ga0496113_0023186 | Ga0496113_0023186_1831_2787 | 288 |
| 1013 | 3300048916 | Ga0496113_0028364 | Ga0496113_0028364_908_1864 | 288 |
| 1014 | 3300048916 | Ga0496113_0046176 | Ga0496113_0046176_1825_2781 | 288 |
| 1015 | 3300048916 | Ga0496113_0127502 | Ga0496113_0127502_818_1774 | 288 |
| 1016 | 3300048917 | Ga0496114_0004800 | Ga0496114_0004800_4947_5903 | 288 |
| 1017 | 3300048917 | Ga0496114_0245387 | Ga0496114_0245387_472_1428 | 288 |
| 1018 | 3300048918 | Ga0496115_0005426 | Ga0496115_0005426_4589_5539 | 288 |
| 1019 | 3300048918 | Ga0496115_0006200 | Ga0496115_0006200_2637_3593 | 288 |
| 1020 | 3300049568 | Ga0501031_0059602 | Ga0501031_0059602_1042_1992 | 288 |
| 1021 | 3300049569 | Ga0501032_0124188 | Ga0501032_0124188_585_1541 | 288 |
| 1022 | 3300049570 | Ga0501033_0125578 | Ga0501033_0125578_337_1293 | 288 |
| 1023 | 3300049570 | Ga0501033_0296836 | Ga0501033_0296836_38_988 | 288 |
| 1024 | 3300049571 | Ga0501034_0027442 | Ga0501034_0027442_1376_2332 | 288 |
| 1025 | 3300049571 | Ga0501034_0039803 | Ga0501034_0039803_2293_3249 | 288 |
| 1026 | 3300049571 | Ga0501034_0094303 | Ga0501034_0094303_1614_2570 | 288 |
| 1027 | 3300049571 | Ga0501034_0195413 | Ga0501034_0195413_844_1800 | 288 |
| 1028 | 3300049571 | Ga0501034_0300725 | Ga0501034_0300725_147_1103 | 288 |
| 1029 | 3300049572 | Ga0501036_0002481 | Ga0501036_0002481_8841_9791 | 288 |
| 1030 | 3300049572 | Ga0501036_0163069 | Ga0501036_0163069_17_967 | 288 |
| 1031 | 3300049572 | Ga0501036_0421305 | Ga0501036_0421305_18_974 | 288 |
| 1032 | 3300049573 | Ga0501037_0023005 | Ga0501037_0023005_1554_2504 | 288 |
| 1033 | 3300049573 | Ga0501037_0057904 | Ga0501037_0057904_424_1380 | 288 |
| 1034 | 3300049574 | Ga0501038_0011597 | Ga0501038_0011597_6371_7321 | 288 |
| 1035 | 3300049574 | Ga0501038_0069081 | Ga0501038_0069081_1615_2565 | 288 |
| 1036 | 3300049574 | Ga0501038_0086625 | Ga0501038_0086625_385_1341 | 288 |
| 1037 | 3300049574 | Ga0501038_0164254 | Ga0501038_0164254_804_1760 | 288 |
| 1038 | 3300049574 | Ga0501038_0183510 | Ga0501038_0183510_413_1363 | 288 |
| 1039 | 3300049574 | Ga0501038_0193860 | Ga0501038_0193860_178_1128 | 288 |
| 1040 | 3300049575 | Ga0501039_0039106 | Ga0501039_0039106_477_1433 | 288 |
| 1041 | 3300049575 | Ga0501039_0136582 | Ga0501039_0136582_517_1467 | 288 |
| 1042 | 3300049575 | Ga0501039_0170263 | Ga0501039_0170263_299_1255 | 288 |
| 1043 | 3300049576 | Ga0501040_0006653 | Ga0501040_0006653_6221_7171 | 288 |
| 1044 | 3300049576 | Ga0501040_0213065 | Ga0501040_0213065_16_933 | 288 |
| 1045 | 3300049577 | Ga0501041_0032605 | Ga0501041_0032605_1191_2141 | 288 |
| 1046 | 3300049577 | Ga0501041_0231903 | Ga0501041_0231903_95_1045 | 288 |
| 1047 | 3300049578 | Ga0501042_0174775 | Ga0501042_0174775_484_1440 | 288 |
| 1048 | 3300049578 | Ga0501042_0229747 | Ga0501042_0229747_163_1119 | 288 |
| 1049 | 3300049579 | Ga0501043_0043922 | Ga0501043_0043922_1666_2622 | 288 |
| 1050 | 3300049579 | Ga0501043_0080598 | Ga0501043_0080598_693_1643 | 288 |
| 1051 | 3300049580 | Ga0501046_0019015 | Ga0501046_0019015_2739_3689 | 288 |
| 1052 | 3300049580 | Ga0501046_0025386 | Ga0501046_0025386_2508_3464 | 288 |
| 1053 | 3300049580 | Ga0501046_0110135 | Ga0501046_0110135_1070_2020 | 288 |
| 1054 | 3300049580 | Ga0501046_0155019 | Ga0501046_0155019_343_1299 | 288 |
| 1055 | 3300049580 | Ga0501046_0168182 | Ga0501046_0168182_79_1035 | 288 |
| 1056 | 3300049581 | Ga0501047_0016677 | Ga0501047_0016677_859_1815 | 288 |
| 1057 | 3300049581 | Ga0501047_0017879 | Ga0501047_0017879_1302_2258 | 288 |
| 1058 | 3300049581 | Ga0501047_0051181 | Ga0501047_0051181_1424_2374 | 288 |
| 1059 | 3300049581 | Ga0501047_0089977 | Ga0501047_0089977_752_1708 | 288 |
| 1060 | 3300049582 | Ga0501048_0208082 | Ga0501048_0208082_316_1266 | 288 |
| 1061 | 3300049585 | Ga0501069_0060890 | Ga0501069_0060890_948_1898 | 288 |
| 1062 | 3300049586 | Ga0501070_0021833 | Ga0501070_0021833_1536_2492 | 288 |
| 1063 | 3300049586 | Ga0501070_0022581 | Ga0501070_0022581_775_1731 | 288 |
| 1064 | 3300049587 | Ga0501071_0108401 | Ga0501071_0108401_588_1538 | 288 |
| 1065 | 3300049588 | Ga0501072_0065633 | Ga0501072_0065633_586_1536 | 288 |
| 1066 | 3300049588 | Ga0501072_0095047 | Ga0501072_0095047_342_1298 | 288 |
| 1067 | 3300049589 | Ga0501073_0014409 | Ga0501073_0014409_527_1483 | 288 |
| 1068 | 3300049589 | Ga0501073_0019034 | Ga0501073_0019034_2139_3095 | 288 |
| 1069 | 3300049589 | Ga0501073_0054973 | Ga0501073_0054973_1046_2002 | 288 |
| 1070 | 3300049589 | Ga0501073_0126900 | Ga0501073_0126900_526_1476 | 288 |
| 1071 | 3300049589 | Ga0501073_0221001 | Ga0501073_0221001_10_960 | 288 |
| 1072 | 3300049590 | Ga0501074_0027303 | Ga0501074_0027303_964_1920 | 288 |
| 1073 | 3300049590 | Ga0501074_0033383 | Ga0501074_0033383_2166_3122 | 288 |
| 1074 | 3300049591 | Ga0501075_0099841 | Ga0501075_0099841_662_1612 | 288 |
| 1075 | 3300049591 | Ga0501075_0127620 | Ga0501075_0127620_423_1379 | 288 |
| 1076 | 3300049591 | Ga0501075_0137648 | Ga0501075_0137648_754_1704 | 288 |
| 1077 | 3300049592 | Ga0501076_0016060 | Ga0501076_0016060_3773_4729 | 288 |
| 1078 | 3300049592 | Ga0501076_0101972 | Ga0501076_0101972_354_1304 | 288 |
| 1079 | 3300049592 | Ga0501076_0311601 | Ga0501076_0311601_51_968 | 288 |
| 1080 | 3300049593 | Ga0501077_0003968 | Ga0501077_0003968_826_1782 | 288 |
| 1081 | 3300049593 | Ga0501077_0008803 | Ga0501077_0008803_4597_5547 | 288 |
| 1082 | 3300049593 | Ga0501077_0012998 | Ga0501077_0012998_4239_5189 | 288 |
| 1083 | 3300049593 | Ga0501077_0062634 | Ga0501077_0062634_597_1553 | 288 |
| 1084 | 3300049705 | Ga0501225_0055016 | Ga0501225_0055016_144_1094 | 288 |
| 1085 | 3300049741 | Ga0501079_0046758 | Ga0501079_0046758_930_1886 | 288 |
| 1086 | 3300049741 | Ga0501079_0049659 | Ga0501079_0049659_1164_2114 | 288 |
| 1087 | 3300049741 | Ga0501079_0150398 | Ga0501079_0150398_726_1676 | 288 |
| 1088 | 3300049741 | Ga0501079_0198713 | Ga0501079_0198713_245_1201 | 288 |
| 1089 | 3300049742 | Ga0501080_0007750 | Ga0501080_0007750_4090_5046 | 288 |
| 1090 | 3300049742 | Ga0501080_0016625 | Ga0501080_0016625_2754_3710 | 288 |
| 1091 | 3300049742 | Ga0501080_0442164 | Ga0501080_0442164_162_1112 | 288 |
| 1092 | 3300049743 | Ga0501081_0266432 | Ga0501081_0266432_258_1208 | 288 |
| 1093 | 3300049744 | Ga0501083_0000450 | Ga0501083_0000450_8069_9028 | 288 |
| 1094 | 3300049822 | Ga0501035_0040480 | Ga0501035_0040480_909_1859 | 288 |
| 1095 | 3300049822 | Ga0501035_0050506 | Ga0501035_0050506_315_1271 | 288 |
| 1096 | 3300049823 | Ga0501044_0000212 | Ga0501044_0000212_50729_51685 | 288 |
| 1097 | 3300049823 | Ga0501044_0016862 | Ga0501044_0016862_4340_5296 | 288 |
| 1098 | 3300049823 | Ga0501044_0045666 | Ga0501044_0045666_2108_3064 | 288 |
| 1099 | 3300049823 | Ga0501044_0074734 | Ga0501044_0074734_1120_2076 | 288 |
| 1100 | 3300049823 | Ga0501044_0196147 | Ga0501044_0196147_450_1406 | 288 |
| 1101 | 3300049824 | Ga0501045_0039471 | Ga0501045_0039471_898_1848 | 288 |
| 1102 | 3300050491 | nmdc:mga00v17_27414_c1 | nmdc:mga00v17_27414_c1_1178_2134 | 288 |
| 1103 | 3300050492 | nmdc:mga0yw44_6715_c1 | nmdc:mga0yw44_6715_c1_3917_4873 | 288 |
| 1104 | 3300050494 | nmdc:mga06z11_10761_c1 | nmdc:mga06z11_10761_c1_2391_3347 | 288 |
| 1105 | 3300050494 | nmdc:mga06z11_19093_c1 | nmdc:mga06z11_19093_c1_1279_2235 | 288 |
| 1106 | 3300050494 | nmdc:mga06z11_34462_c1 | nmdc:mga06z11_34462_c1_1415_2371 | 288 |
| 1107 | 3300050495 | nmdc:mga04h51_13437_c1 | nmdc:mga04h51_13437_c1_339_1295 | 288 |
| 1108 | 3300050495 | nmdc:mga04h51_27419_c1 | nmdc:mga04h51_27419_c1_26_982 | 288 |
| 1109 | 3300050495 | nmdc:mga04h51_9859_c1 | nmdc:mga04h51_9859_c1_210_1166 | 288 |
| 1110 | 3300050496 | nmdc:mga07m45_146771_c1 | nmdc:mga07m45_146771_c1_315_1271 | 288 |
| 1111 | 3300050496 | nmdc:mga07m45_3083_c1 | nmdc:mga07m45_3083_c1_3427_4383 | 288 |
| 1112 | 3300050507 | nmdc:mga05p37_137815_c1 | nmdc:mga05p37_137815_c1_1085_2041 | 288 |
| 1113 | 3300050507 | nmdc:mga05p37_200088_c1 | nmdc:mga05p37_200088_c1_1111_2067 | 288 |
| 1114 | 3300050508 | nmdc:mga09592_69829_c1 | nmdc:mga09592_69829_c1_1805_2761 | 288 |
| 1115 | 3300050509 | nmdc:mga0qj67_387275_c1 | nmdc:mga0qj67_387275_c1_44_994 | 288 |
| 1116 | 3300050509 | nmdc:mga0qj67_6651_c1 | nmdc:mga0qj67_6651_c1_1462_2418 | 288 |
| 1117 | 3300050510 | nmdc:mga06r32_29521_c1 | nmdc:mga06r32_29521_c1_1560_2516 | 288 |
| 1118 | 3300050511 | nmdc:mga08y16_2044_c1 | nmdc:mga08y16_2044_c1_5740_6696 | 288 |
| 1119 | 3300050511 | nmdc:mga08y16_256078_c1 | nmdc:mga08y16_256078_c1_754_1710 | 288 |
| 1120 | 3300050511 | nmdc:mga08y16_5303_c1 | nmdc:mga08y16_5303_c1_5605_6561 | 288 |
| 1121 | 3300050512 | nmdc:mga0n895_133195_c1 | nmdc:mga0n895_133195_c1_1522_2478 | 288 |
| 1122 | 3300050512 | nmdc:mga0n895_25898_c1 | nmdc:mga0n895_25898_c1_766_1722 | 288 |
| 1123 | 3300050512 | nmdc:mga0n895_54579_c1 | nmdc:mga0n895_54579_c1_1906_2862 | 288 |
| 1124 | 3300050513 | nmdc:mga0rr50_303490_c1 | nmdc:mga0rr50_303490_c1_92_1048 | 288 |
| 1125 | 3300050514 | nmdc:mga08x19_165168_c1 | nmdc:mga08x19_165168_c1_90_1046 | 288 |
| 1126 | 3300050515 | nmdc:mga0a205_2432_c1 | nmdc:mga0a205_2432_c1_883_1839 | 288 |
| 1127 | 3300050515 | nmdc:mga0a205_42460_c2 | nmdc:mga0a205_42460_c2_1548_2504 | 288 |
| 1128 | 3300050515 | nmdc:mga0a205_47549_c1 | nmdc:mga0a205_47549_c1_2993_3949 | 288 |
| 1129 | 3300050516 | nmdc:mga0sz30_34329_c1 | nmdc:mga0sz30_34329_c1_1016_1972 | 288 |
| 1130 | 3300053077 | Ga0495601_0000164 | Ga0495601_0000164_29477_30433 | 288 |
| 1131 | 3300053077 | Ga0495601_0000473 | Ga0495601_0000473_8847_9794 | 288 |
| 1132 | 3300053077 | Ga0495601_0002539 | Ga0495601_0002539_4774_5724 | 288 |
| 1133 | 3300053078 | Ga0495612_0000752 | Ga0495612_0000752_130_1080 | 288 |
| 1134 | 3300053078 | Ga0495612_0002586 | Ga0495612_0002586_698_1645 | 288 |
| 1135 | 3300053083 | Ga0495655_0005113 | Ga0495655_0005113_557_1513 | 288 |
| 1136 | 3300053084 | Ga0495595_0000235 | Ga0495595_0000235_1649_2605 | 288 |
| 1137 | 3300053085 | Ga0495619_0000414 | Ga0495619_0000414_25236_26186 | 288 |
| 1138 | 3300053085 | Ga0495619_0002506 | Ga0495619_0002506_8819_9766 | 288 |
| 1139 | 3300053085 | Ga0495619_0006012 | Ga0495619_0006012_1066_2022 | 288 |
| 1140 | 3300053085 | Ga0495619_0028733 | Ga0495619_0028733_1297_2253 | 288 |
| 1141 | 3300053085 | Ga0495619_0187455 | Ga0495619_0187455_228_1187 | 288 |
| 1142 | 3300053092 | Ga0500583_0061363 | Ga0500583_0061363_180_1097 | 288 |
| 1143 | 3300053142 | Ga0500577_0043084 | Ga0500577_0043084_634_1551 | 288 |
| 1144 | 3300054114 | Ga0501084_0330017 | Ga0501084_0330017_247_1203 | 288 |
| 1145 | 3300060353 | Ga0501082_0042865 | Ga0501082_0042865_2207_3163 | 288 |
| 1146 | 3300060353 | Ga0501082_0109657 | Ga0501082_0109657_1301_2260 | 288 |
| 1147 | 3300060353 | Ga0501082_0126934 | Ga0501082_0126934_194_1144 | 288 |
| 1148 | 3300060353 | Ga0501082_0181091 | Ga0501082_0181091_155_1111 | 288 |
| 1149 | 3300060353 | Ga0501082_0264547 | Ga0501082_0264547_142_1098 | 288 |
| 1150 | 3300061734 | Ga0530510_0061859 | Ga0530510_0061859_473_1423 | 288 |
| 1151 | iso_pu_bacteria | 2503198000 | 2503200158 | 288 |
| 1152 | iso_pu_bacteria | 2508501128 | 2509151537 | 288 |
| 1153 | iso_pu_bacteria | 2522572158 | 2523105859 | 288 |
| 1154 | iso_pu_bacteria | 2824617872 | 2824623180 | 288 |
| 1155 | iso_pu_bacteria | 2824626560 | 2824627800 | 288 |
| 1156 | iso_pu_bacteria | 2824635225 | 2824642670 | 288 |
| 1157 | iso_pu_bacteria | 2824644064 | 2824650560 | 288 |
| 1158 | iso_pu_bacteria | 2824714736 | 2824720420 | 288 |
| 1159 | iso_pu_bacteria | 2824723954 | 2824730645 | 288 |
| 1160 | iso_pu_bacteria | 2841957949 | 2841960580 | 288 |
| 1161 | iso_pu_bacteria | 2847930680 | 2847939454 | 288 |
| 1162 | iso_pu_bacteria | 2874612657 | 2874620234 | 288 |
| 1163 | iso_pu_bacteria | 2874620515 | 2874622458 | 288 |
| 1164 | iso_pu_bacteria | 2876761206 | 2876761642 | 288 |
| 1165 | iso_pu_bacteria | 2879083081 | 2879091104 | 288 |
| 1166 | iso_pu_bacteria | 2885366525 | 2885367736 | 288 |
| 1167 | iso_pu_bacteria | 2885409591 | 2885418281 | 288 |
| 1168 | iso_pu_bacteria | 2904666416 | 2904671535 | 288 |
| 1169 | iso_pu_bacteria | 2906643746 | 2906650301 | 288 |
| 1170 | iso_pu_bacteria | 2929199973 | 2929205471 | 288 |
| 1171 | iso_pu_bacteria | 3005594810 | 3005595845 | 288 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7z0t-assembly1.cif.gz_D | structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) | 0.8093 | 2 | 282 |
| 7z0s-assembly1.cif.gz_D | structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) | 0.7581 | 2 | 285 |
| 7z0t-assembly1.cif.gz_D | structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) | 0.738 | 2 | 282 |
| 7z0s-assembly1.cif.gz_D | structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) | 0.735 | 2 | 285 |
| 6cfw-assembly1.cif.gz_M | cryoem structure of a respiratory membrane-bound hydrogenase | 0.725 | 2 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4J5Z6_1_230_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.4267 | 9 | 234 | 1.20.120.1770 |
| af_A0A0R4J5Z6_1_230_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.4206 | 9 | 234 | 1.20.120.1770 |
| af_B5DFI2_7_229_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.3874 | 10 | 225 | 1.20.120.1770 |
| af_B5DFI2_7_229_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.378 | 10 | 225 | 1.20.120.1770 |
| af_Q0JGZ0_269_434_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.3361 | 92 | 279 | 1.20.120.1770 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A379GBP5-F1-model_v4 | Hydrogenase-4 component C (EC 1.-.-.-) | 0.8661 | 2 | 133 |
GO:0005886
GO:0016491 |
| AF-A0A534DSG4-F1-model_v4 | deleted | 0.8655 | 2 | 123 |
|
| AF-A0A6N9STR2-F1-model_v4 | Formate hydrogenlyase | 0.8649 | 2 | 133 |
GO:0005886
GO:0016829 |
| AF-A0A522M4U8-F1-model_v4 | Formate hydrogenlyase | 0.8566 | 2 | 120 |
GO:0005886
GO:0016829 |
| AF-A0A6N8PNV7-F1-model_v4 | deleted | 0.8565 | 2 | 130 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar