F491076

General Info

Members Datasets Scaffolds Average Seq Length
1165 435 1118 321

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_39715_c1|nmdc:mga0k408_39715_c1_76_1197
Length 373
Sequence MSRRRELFRLLRLACRPTYEAPVRVSPMARALELRHSRRTPAEHHTIGDFMTNRRTLLRSLVVLALGALAGVAHAAWPDRPITLIVPWGAGGGTDATARIIASLLEKDLGQPINVVNRTGGSGVVGHQAISAAAPDGYTIGLITVEISMMHWQGLTELSGASYTPIGLVNMDPAGLQVRADAPYKNANELVAAIKANPGKFKASGTGQGGIWHLAIAGMLKDLKVDPAAAPWVPSNGAAPGLQDLVAGGVEVVPCSLPEARSLIDAGKVKSLAVMSDAPAALYPNVPTLKAATGSDWKIGAWRGIAAPKNIPAEARDKLVAAIKKIAASKEYTEFMAGRGFGVIYQGPDDFAKFMAKADADLGATMKAVGIAK

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
4 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
5 2643221651 Afipia sp. Root123D2 Isolate Unclassified
6 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
7 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
8 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
9 2773857925 Microvirga vignae BR3299 Isolate Unclassified
10 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
11 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
12 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
13 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
14 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
15 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
16 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
17 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
18 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
19 2842677519 Variovorax sp. R-72495 Isolate Unclassified
20 2842733646 Variovorax sp. R-72446 Isolate Unclassified
21 2842747753 Variovorax sp. R-72060 Isolate Unclassified
22 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
23 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
24 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
25 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
26 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
27 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
28 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
29 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
30 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
31 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
32 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
33 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
34 2904456579 Variovorax sp. 2002 Isolate Unclassified
35 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
36 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
37 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
38 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
39 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
40 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
41 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
42 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
43 2929520902 Variovorax beijingensis 502 Isolate Unclassified
44 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
45 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
46 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
47 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
48 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
49 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
50 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
51 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
52 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
53 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
54 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
55 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
56 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
57 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
59 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
60 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
61 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
62 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
63 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
64 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
67 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
68 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
77 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
78 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
81 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
82 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
83 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
84 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
85 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
86 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
87 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
88 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
89 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
90 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
91 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
92 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
93 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
94 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
95 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
96 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
99 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
103 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
104 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
105 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
110 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
111 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
112 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
113 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
116 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
117 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
118 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
119 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
120 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
121 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
122 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
123 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
124 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
125 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
126 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
127 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
128 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
139 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
140 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
142 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
143 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
144 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
148 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
149 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
153 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
154 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
155 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
156 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
157 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
158 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
159 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
160 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
161 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
162 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
163 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
164 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
165 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
166 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
167 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
168 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
169 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
170 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
171 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
172 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
173 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
174 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
175 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
177 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
179 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
181 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
182 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
183 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
190 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
256 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
257 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
258 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
259 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
260 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
261 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
262 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
263 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
264 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
265 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
266 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
267 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
268 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
269 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
270 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
271 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
272 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
273 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
274 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
275 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
276 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
277 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
278 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
279 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
280 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
281 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
282 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
283 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
284 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
285 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
286 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
288 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
289 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
292 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
293 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
294 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
295 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
296 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
297 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
298 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
299 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
300 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
301 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
302 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
303 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
304 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
305 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
306 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
307 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
308 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
309 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
310 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
311 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
312 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
313 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
314 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
315 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
316 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
317 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
318 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
319 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
320 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
321 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
322 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
323 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
324 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
325 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
326 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
329 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
330 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
331 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
332 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
333 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
334 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
335 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
336 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
337 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
338 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
339 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
340 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
341 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
342 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
343 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
346 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
347 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
348 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
349 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
350 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
351 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
352 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
353 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
354 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
355 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
356 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
357 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
358 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
359 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
360 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
361 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
362 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
363 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
364 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
365 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
366 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
367 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
368 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
369 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
372 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
373 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
388 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
389 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
390 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
391 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
392 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
393 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
394 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
395 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
396 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
397 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
398 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
399 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
400 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
401 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
402 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
403 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
404 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
405 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
408 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
409 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
410 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
411 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
412 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
413 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
414 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
415 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
416 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
417 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
418 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
419 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
420 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
421 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
422 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
423 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
424 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
425 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
426 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
427 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
428 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
429 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
430 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
431 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
432 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
433 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
434 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
435 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.71
Metatranscriptomes 0.26
Isolates 4.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.55
Nodule 0.52
Rhizoplane 2.92
Rhizosphere 83.52
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002519 3300001976 Bacteria 2439
2 JGI24739J22299_10032375 3300001989 Bacteria 1799
3 JGI24743J22301_10006240 3300001991 Bacteria 2024
4 JGI24749J21850_1003366 3300002076 Bacteria 2236
5 JGI24751J29686_10008885 3300002459 Bacteria 2061
6 JGI25155J39150_1000329 3300002704 Bacteria 15508
7 JGI25156J39149_1000675 3300002705 Bacteria 18418
8 JGI25154J39366_1000615 3300002738 Bacteria 17074
9 JGI25157J39369_1000628 3300002741 Bacteria 19825
10 Ga0006562J51391_1111043 3300003578 Bacteria 3980
11 Ga0006562J51391_1111046 3300003578 Bacteria 2950
12 JGI25404J52841_10001225 3300003659 Bacteria 4421
13 Ga0055532_1000157 3300003758 Bacteria 59670
14 Ga0055537_1000988 3300003773 Bacteria 12904
15 Ga0055534_1000238 3300003784 Bacteria 39258
16 Ga0055534_1001423 3300003784 Bacteria 9520
17 Ga0055528_1000455 3300003790 Bacteria 32647
18 Ga0055528_1034568 3300003790 Bacteria 1243
19 Ga0055540_1002490 3300003792 Bacteria 9677
20 Ga0065712_10170837 3300005290 Bacteria 1245
21 Ga0065715_10226844 3300005293 Bacteria 1249
22 Ga0070658_10105595 3300005327 Bacteria 2330
23 Ga0070676_10000072 3300005328 Bacteria 34018
24 Ga0070676_10001469 3300005328 Bacteria 11934
25 Ga0070676_10003857 3300005328 Bacteria 7873
26 Ga0070676_10010873 3300005328 Bacteria 4942
27 Ga0070676_10015869 3300005328 Bacteria 4155
28 Ga0070676_10016798 3300005328 Bacteria 4046
29 Ga0070676_10134569 3300005328 Bacteria 1567
30 Ga0070683_100019115 3300005329 Bacteria 6080
31 Ga0070683_100189547 3300005329 Bacteria 1952
32 Ga0070683_100295914 3300005329 Bacteria 1539
33 Ga0070690_100017328 3300005330 Bacteria 4330
34 Ga0070670_100002700 3300005331 Bacteria 14659
35 Ga0070670_100005878 3300005331 Bacteria 10369
36 Ga0070670_100013736 3300005331 Bacteria 6939
37 Ga0070670_100018322 3300005331 Bacteria 6007
38 Ga0070670_100020534 3300005331 Bacteria 5679
39 Ga0070670_100023320 3300005331 Bacteria 5327
40 Ga0070670_100026539 3300005331 Bacteria 4983
41 Ga0070670_100068892 3300005331 Bacteria 3037
42 Ga0070670_100115483 3300005331 Bacteria 2314
43 Ga0070670_100130154 3300005331 Bacteria 2173
44 Ga0070670_100159406 3300005331 Bacteria 1955
45 Ga0070670_100242235 3300005331 Bacteria 1570
46 Ga0070670_100434692 3300005331 Bacteria 1162
47 Ga0070677_10000616 3300005333 Bacteria 11978
48 Ga0070677_10000865 3300005333 Bacteria 9962
49 Ga0070677_10009003 3300005333 Bacteria 3376
50 Ga0070677_10011153 3300005333 Bacteria 3091
51 Ga0070677_10037771 3300005333 Bacteria 1885
52 Ga0068869_100001166 3300005334 Bacteria 15390
53 Ga0068869_100013966 3300005334 Bacteria 5357
54 Ga0068869_100043093 3300005334 Bacteria 3240
55 Ga0068869_100080969 3300005334 Bacteria 2424
56 Ga0068869_100108550 3300005334 Bacteria 2108
57 Ga0070666_10000519 3300005335 Bacteria 23340
58 Ga0070666_10007582 3300005335 Bacteria 6695
59 Ga0070666_10008460 3300005335 Bacteria 6392
60 Ga0070666_10013992 3300005335 Bacteria 5101
61 Ga0070666_10088756 3300005335 Bacteria 2121
62 Ga0070666_10180616 3300005335 Bacteria 1480
63 Ga0070666_10181372 3300005335 Bacteria 1477
64 Ga0070682_100069593 3300005337 Bacteria 2247
65 Ga0068868_100001393 3300005338 Bacteria 16670
66 Ga0068868_100002158 3300005338 Bacteria 13588
67 Ga0068868_100009557 3300005338 Bacteria 6991
68 Ga0068868_100011920 3300005338 Bacteria 6340
69 Ga0068868_100018728 3300005338 Bacteria 5179
70 Ga0068868_100054771 3300005338 Bacteria 3145
71 Ga0070660_100005630 3300005339 Bacteria 8681
72 Ga0070660_100007902 3300005339 Bacteria 7422
73 Ga0070660_100019317 3300005339 Bacteria 4991
74 Ga0070660_100029916 3300005339 Bacteria 4083
75 Ga0070660_100032256 3300005339 Bacteria 3941
76 Ga0070689_100002746 3300005340 Bacteria 11543
77 Ga0070689_100080341 3300005340 Bacteria 2558
78 Ga0070687_100015439 3300005343 Bacteria 3454
79 Ga0070687_100047387 3300005343 Bacteria 2204
80 Ga0070661_100003514 3300005344 Bacteria 10797
81 Ga0070661_100017793 3300005344 Bacteria 5044
82 Ga0070661_100059804 3300005344 Bacteria 2795
83 Ga0070661_100102158 3300005344 Bacteria 2134
84 Ga0070661_100146395 3300005344 Bacteria 1783
85 Ga0070668_100002017 3300005347 Bacteria 14855
86 Ga0070668_100004555 3300005347 Bacteria 10278
87 Ga0070668_100007990 3300005347 Bacteria 7859
88 Ga0070668_100023897 3300005347 Bacteria 4628
89 Ga0070668_100031308 3300005347 Bacteria 4047
90 Ga0070668_100069350 3300005347 Bacteria 2742
91 Ga0070668_100091961 3300005347 Bacteria 2392
92 Ga0070668_100110555 3300005347 Bacteria 2187
93 Ga0070668_100255202 3300005347 Bacteria 1457
94 Ga0070669_100001262 3300005353 Bacteria 18363
95 Ga0070669_100006690 3300005353 Bacteria 8298
96 Ga0070669_100019592 3300005353 Bacteria 4832
97 Ga0070669_100046877 3300005353 Bacteria 3152
98 Ga0070669_100058270 3300005353 Bacteria 2834
99 Ga0070669_100085877 3300005353 Bacteria 2350
100 Ga0070675_100000476 3300005354 Bacteria 27409
101 Ga0070675_100003131 3300005354 Bacteria 12512
102 Ga0070675_100007384 3300005354 Bacteria 8488
103 Ga0070675_100028275 3300005354 Bacteria 4513
104 Ga0070675_100030103 3300005354 Bacteria 4380
105 Ga0070675_100030147 3300005354 Bacteria 4377
106 Ga0070675_100058110 3300005354 Bacteria 3190
107 Ga0070675_100087079 3300005354 Bacteria 2611
108 Ga0070675_100191571 3300005354 Bacteria 1772
109 Ga0070675_100220284 3300005354 Bacteria 1652
110 Ga0070671_100000154 3300005355 Bacteria 44924
111 Ga0070671_100006308 3300005355 Bacteria 9458
112 Ga0070671_100008085 3300005355 Bacteria 8421
113 Ga0070671_100009602 3300005355 Bacteria 7773
114 Ga0070671_100048136 3300005355 Bacteria 3545
115 Ga0070671_100067489 3300005355 Bacteria 2982
116 Ga0070671_100123270 3300005355 Bacteria 2182
117 Ga0070671_100217506 3300005355 Bacteria 1621
118 Ga0070671_100300035 3300005355 Bacteria 1368
119 Ga0070674_100002257 3300005356 Bacteria 10631
120 Ga0070674_100010524 3300005356 Bacteria 5597
121 Ga0070674_100014457 3300005356 Bacteria 4906
122 Ga0070674_100021330 3300005356 Bacteria 4155
123 Ga0070674_100102600 3300005356 Bacteria 2086
124 Ga0070674_100117326 3300005356 Bacteria 1965
125 Ga0070674_100153958 3300005356 Bacteria 1737
126 Ga0070673_100000208 3300005364 Bacteria 29093
127 Ga0070673_100003413 3300005364 Bacteria 9891
128 Ga0070673_100006079 3300005364 Bacteria 7821
129 Ga0070673_100011947 3300005364 Bacteria 5945
130 Ga0070673_100096066 3300005364 Bacteria 2431
131 Ga0070673_100102535 3300005364 Bacteria 2359
132 Ga0070688_100002922 3300005365 Bacteria 8710
133 Ga0070659_100010715 3300005366 Bacteria 6756
134 Ga0070659_100011894 3300005366 Bacteria 6443
135 Ga0070659_100162178 3300005366 Bacteria 1828
136 Ga0070659_100252295 3300005366 Bacteria 1462
137 Ga0070667_100000550 3300005367 Bacteria 37298
138 Ga0070667_100007175 3300005367 Bacteria 9261
139 Ga0070667_100007586 3300005367 Bacteria 8997
140 Ga0070667_100040646 3300005367 Bacteria 3900
141 Ga0070667_100066358 3300005367 Bacteria 3066
142 Ga0070667_100181955 3300005367 Bacteria 1859
143 Ga0070700_100048995 3300005441 Bacteria 2621
144 Ga0070700_100059678 3300005441 Bacteria 2402
145 Ga0070708_100011872 3300005445 Bacteria 7092
146 Ga0070663_100004102 3300005455 Bacteria 8508
147 Ga0070663_100005729 3300005455 Bacteria 7409
148 Ga0070663_100005811 3300005455 Bacteria 7370
149 Ga0070663_100076951 3300005455 Bacteria 2441
150 Ga0070663_100122614 3300005455 Bacteria 1965
151 Ga0070678_100000370 3300005456 Bacteria 21009
152 Ga0070678_100033269 3300005456 Bacteria 3577
153 Ga0070678_100047664 3300005456 Bacteria 3081
154 Ga0070678_100073750 3300005456 Bacteria 2562
155 Ga0070678_100093135 3300005456 Bacteria 2316
156 Ga0070678_100135141 3300005456 Bacteria 1966
157 Ga0070678_100157255 3300005456 Bacteria 1837
158 Ga0070678_100187000 3300005456 Bacteria 1700
159 Ga0070678_100358664 3300005456 Bacteria 1255
160 Ga0070662_100001776 3300005457 Bacteria 13276
161 Ga0070662_100001865 3300005457 Bacteria 12913
162 Ga0070662_100045744 3300005457 Bacteria 3142
163 Ga0070662_100061168 3300005457 Bacteria 2748
164 Ga0070662_100217151 3300005457 Bacteria 1524
165 Ga0070662_100237134 3300005457 Bacteria 1461
166 Ga0070662_100283851 3300005457 Bacteria 1340
167 Ga0070681_10040512 3300005458 Bacteria 4667
168 Ga0068867_100000873 3300005459 Bacteria 20349
169 Ga0068867_100001303 3300005459 Bacteria 17238
170 Ga0068867_100010420 3300005459 Bacteria 6561
171 Ga0068867_100035490 3300005459 Bacteria 3617
172 Ga0068867_100061816 3300005459 Bacteria 2781
173 Ga0068867_100147320 3300005459 Bacteria 1846
174 Ga0068867_100155115 3300005459 Bacteria 1801
175 Ga0068867_100279973 3300005459 Bacteria 1367
176 Ga0070685_10009131 3300005466 Bacteria 5116
177 Ga0070685_10099095 3300005466 Bacteria 1777
178 Ga0070699_100231453 3300005518 Bacteria 1648
179 Ga0070679_100019303 3300005530 Bacteria 6624
180 Ga0070679_100024460 3300005530 Bacteria 5918
181 Ga0070684_100037632 3300005535 Bacteria 4152
182 Ga0070684_100077603 3300005535 Bacteria 2934
183 Ga0070684_100093087 3300005535 Bacteria 2683
184 Ga0070697_100036554 3300005536 Bacteria 3967
185 Ga0070697_100282602 3300005536 Bacteria 1424
186 Ga0068853_100003859 3300005539 Bacteria 11487
187 Ga0068853_100058065 3300005539 Bacteria 3340
188 Ga0068853_100226518 3300005539 Bacteria 1709
189 Ga0068853_100272097 3300005539 Bacteria 1560
190 Ga0068853_100488126 3300005539 Bacteria 1162
191 Ga0070672_100000521 3300005543 Bacteria 22450
192 Ga0070672_100000757 3300005543 Bacteria 19233
193 Ga0070672_100002814 3300005543 Bacteria 11140
194 Ga0070672_100006010 3300005543 Bacteria 8105
195 Ga0070672_100010245 3300005543 Bacteria 6495
196 Ga0070672_100020888 3300005543 Bacteria 4783
197 Ga0070672_100023965 3300005543 Bacteria 4502
198 Ga0070672_100062338 3300005543 Bacteria 2942
199 Ga0070672_100171986 3300005543 Bacteria 1802
200 Ga0070686_100009145 3300005544 Bacteria 5556
201 Ga0070686_100060748 3300005544 Bacteria 2439
202 Ga0070695_100037763 3300005545 Bacteria 3045
203 Ga0070695_100081924 3300005545 Bacteria 2136
204 Ga0070696_100077803 3300005546 Bacteria 2344
205 Ga0070693_100026183 3300005547 Bacteria 3147
206 Ga0070665_100002350 3300005548 Bacteria 20919
207 Ga0070665_100010072 3300005548 Bacteria 9566
208 Ga0070665_100016840 3300005548 Bacteria 7329
209 Ga0070665_100100839 3300005548 Bacteria 2891
210 Ga0070665_100151448 3300005548 Bacteria 2322
211 Ga0070704_100044993 3300005549 Bacteria 3070
212 Ga0068855_100001489 3300005563 Bacteria 29301
213 Ga0068855_100010124 3300005563 Bacteria 11365
214 Ga0068855_100011080 3300005563 Bacteria 10881
215 Ga0068855_100097584 3300005563 Bacteria 3385
216 Ga0070664_100003967 3300005564 Bacteria 11906
217 Ga0070664_100014861 3300005564 Bacteria 6352
218 Ga0070664_100023132 3300005564 Bacteria 5130
219 Ga0070664_100032971 3300005564 Bacteria 4334
220 Ga0070664_100096818 3300005564 Bacteria 2561
221 Ga0070664_100230374 3300005564 Bacteria 1660
222 Ga0070664_100276429 3300005564 Bacteria 1514
223 Ga0068857_100014884 3300005577 Bacteria 6784
224 Ga0068857_100136285 3300005577 Bacteria 2216
225 Ga0068857_100149978 3300005577 Bacteria 2112
226 Ga0068854_100007738 3300005578 Bacteria 6870
227 Ga0068854_100036357 3300005578 Bacteria 3452
228 Ga0068854_100064284 3300005578 Bacteria 2666
229 Ga0068854_100107203 3300005578 Bacteria 2103
230 Ga0068854_100155817 3300005578 Bacteria 1765
231 Ga0068856_100001185 3300005614 Bacteria 27475
232 Ga0068856_100015944 3300005614 Bacteria 7265
233 Ga0068856_100118186 3300005614 Bacteria 2652
234 Ga0070702_100261315 3300005615 Bacteria 1179
235 Ga0068852_100001729 3300005616 Bacteria 14886
236 Ga0068852_100013463 3300005616 Bacteria 6263
237 Ga0068852_100033932 3300005616 Bacteria 4243
238 Ga0068852_100040670 3300005616 Bacteria 3924
239 Ga0068852_100132919 3300005616 Bacteria 2294
240 Ga0068852_100223705 3300005616 Bacteria 1791
241 Ga0068852_100439372 3300005616 Bacteria 1290
242 Ga0068859_100001157 3300005617 Bacteria 26939
243 Ga0068859_100006747 3300005617 Bacteria 11664
244 Ga0068859_100036604 3300005617 Bacteria 4927
245 Ga0068859_100067612 3300005617 Bacteria 3608
246 Ga0068859_100157504 3300005617 Bacteria 2349
247 Ga0068859_100253657 3300005617 Bacteria 1850
248 Ga0068859_100309004 3300005617 Bacteria 1675
249 Ga0068864_100000432 3300005618 Bacteria 36300
250 Ga0068864_100003750 3300005618 Bacteria 12546
251 Ga0068864_100015226 3300005618 Bacteria 6397
252 Ga0068864_100091336 3300005618 Bacteria 2686
253 Ga0068864_100136322 3300005618 Bacteria 2210
254 Ga0068864_100163541 3300005618 Bacteria 2024
255 Ga0068864_100209738 3300005618 Bacteria 1793
256 Ga0068861_100001603 3300005719 Bacteria 14404
257 Ga0068861_100002030 3300005719 Bacteria 13117
258 Ga0068861_100002402 3300005719 Bacteria 12203
259 Ga0068861_100268065 3300005719 Bacteria 1465
260 Ga0068851_10001475 3300005834 Bacteria 10317
261 Ga0068851_10002802 3300005834 Bacteria 7682
262 Ga0068851_10007813 3300005834 Bacteria 4923
263 Ga0068851_10019905 3300005834 Bacteria 3244
264 Ga0068851_10052393 3300005834 Bacteria 2075
265 Ga0068870_10013314 3300005840 Bacteria 3864
266 Ga0068870_10044132 3300005840 Bacteria 2328
267 Ga0068870_10044695 3300005840 Bacteria 2315
268 Ga0068863_100003841 3300005841 Bacteria 14856
269 Ga0068863_100008368 3300005841 Bacteria 10102
270 Ga0068863_100031131 3300005841 Bacteria 5094
271 Ga0068863_100039133 3300005841 Bacteria 4512
272 Ga0068863_100088048 3300005841 Bacteria 2943
273 Ga0068863_100145646 3300005841 Bacteria 2265
274 Ga0068863_100207969 3300005841 Bacteria 1884
275 Ga0068863_100229961 3300005841 Bacteria 1788
276 Ga0068858_100000549 3300005842 Bacteria 39106
277 Ga0068858_100001243 3300005842 Bacteria 26335
278 Ga0068858_100002158 3300005842 Bacteria 19954
279 Ga0068858_100002523 3300005842 Bacteria 18448
280 Ga0068858_100015242 3300005842 Bacteria 7231
281 Ga0068858_100039347 3300005842 Bacteria 4385
282 Ga0068860_100001806 3300005843 Bacteria 22765
283 Ga0068860_100001951 3300005843 Bacteria 21825
284 Ga0068860_100008919 3300005843 Bacteria 9992
285 Ga0068860_100017241 3300005843 Bacteria 7039
286 Ga0068860_100069571 3300005843 Bacteria 3346
287 Ga0068860_100085144 3300005843 Bacteria 3007
288 Ga0068860_100233824 3300005843 Bacteria 1786
289 Ga0068862_100008420 3300005844 Bacteria 8535
290 Ga0068862_100020263 3300005844 Bacteria 5555
291 Ga0068862_100150186 3300005844 Bacteria 2073
292 Ga0068862_100218301 3300005844 Bacteria 1725
293 Ga0068862_100224885 3300005844 Bacteria 1700
294 Ga0081455_10031721 3300005937 Bacteria 4774
295 Ga0081455_10041760 3300005937 Bacteria 4030
296 Ga0081455_10223856 3300005937 Bacteria 1392
297 Ga0081538_10023874 3300005981 Bacteria 4378
298 Ga0081538_10040377 3300005981 Bacteria 2978
299 Ga0081540_1000140 3300005983 Bacteria 75770
300 Ga0075365_10010813 3300006038 Bacteria 5336
301 Ga0075365_10010993 3300006038 Bacteria 5303
302 Ga0075365_10024084 3300006038 Bacteria 3835
303 Ga0075365_10261103 3300006038 Bacteria 1218
304 Ga0075363_100005387 3300006048 Bacteria 5686
305 Ga0075363_100018976 3300006048 Bacteria 3432
306 Ga0075364_10101939 3300006051 Bacteria 1911
307 Ga0075364_10172596 3300006051 Bacteria 1462
308 Ga0075432_10087465 3300006058 Bacteria 1137
309 Ga0075362_10007830 3300006177 Bacteria 4064
310 Ga0075362_10031856 3300006177 Bacteria 2285
311 Ga0075362_10035913 3300006177 Bacteria 2165
312 Ga0075362_10060680 3300006177 Bacteria 1710
313 Ga0075367_10010266 3300006178 Bacteria 4915
314 Ga0075367_10129930 3300006178 Bacteria 1557
315 Ga0075369_10010388 3300006186 Bacteria 3641
316 Ga0075369_10018149 3300006186 Bacteria 2862
317 Ga0075366_10004464 3300006195 Bacteria 7512
318 Ga0075366_10011543 3300006195 Bacteria 4988
319 Ga0075366_10014442 3300006195 Bacteria 4511
320 Ga0075366_10037733 3300006195 Bacteria 2853
321 Ga0075366_10039484 3300006195 Bacteria 2790
322 Ga0075366_10065523 3300006195 Bacteria 2161
323 Ga0097621_100001254 3300006237 Bacteria 17539
324 Ga0097621_100006981 3300006237 Bacteria 8042
325 Ga0097621_100020573 3300006237 Bacteria 5086
326 Ga0097621_100091265 3300006237 Bacteria 2550
327 Ga0097621_100092310 3300006237 Bacteria 2535
328 Ga0075370_10001723 3300006353 Bacteria 9730
329 Ga0075370_10003842 3300006353 Bacteria 7189
330 Ga0075370_10004947 3300006353 Bacteria 6548
331 Ga0075370_10026591 3300006353 Bacteria 3206
332 Ga0075370_10076194 3300006353 Bacteria 1923
333 Ga0075370_10147823 3300006353 Bacteria 1376
334 Ga0068871_100004365 3300006358 Bacteria 9830
335 Ga0068871_100036282 3300006358 Bacteria 3924
336 Ga0068871_100040447 3300006358 Bacteria 3734
337 Ga0068871_100511317 3300006358 Bacteria 1084
338 Ga0075431_100227061 3300006847 Bacteria 1903
339 Ga0068865_100031574 3300006881 Bacteria 3532
340 Ga0068865_100036388 3300006881 Bacteria 3319
341 Ga0068865_100044433 3300006881 Bacteria 3041
342 Ga0068865_100182377 3300006881 Bacteria 1617
343 Ga0068865_100330694 3300006881 Bacteria 1228
344 Ga0068865_100493602 3300006881 Bacteria 1019
345 Ga0097620_100001157 3300006931 Bacteria 26939
346 Ga0097620_100006747 3300006931 Bacteria 11664
347 Ga0097620_100036607 3300006931 Bacteria 4927
348 Ga0097620_100067615 3300006931 Bacteria 3608
349 Ga0097620_100157509 3300006931 Bacteria 2349
350 Ga0097620_100253655 3300006931 Bacteria 1850
351 Ga0097620_100308999 3300006931 Bacteria 1675
352 Ga0099826_10005293 3300006948 Bacteria 9213
353 Ga0099826_10146050 3300006948 Bacteria 1359
354 Ga0099794_10150737 3300007265 Bacteria 1180
355 Ga0099795_10027120 3300007788 Bacteria 1935
356 Ga0105251_10081813 3300009011 Bacteria 1492
357 Ga0105240_10002015 3300009093 Bacteria 33500
358 Ga0105240_10035036 3300009093 Bacteria 6472
359 Ga0111539_10019093 3300009094 Bacteria 8471
360 Ga0105245_10044681 3300009098 Bacteria 3955
361 Ga0105245_10079495 3300009098 Bacteria 2994
362 Ga0105247_10150864 3300009101 Bacteria 1531
363 Ga0114129_10073089 3300009147 Bacteria 4778
364 Ga0114129_10197819 3300009147 Bacteria 2725
365 Ga0114129_10299060 3300009147 Bacteria 2146
366 Ga0105243_10034087 3300009148 Bacteria 3939
367 Ga0105243_10042603 3300009148 Bacteria 3554
368 Ga0105243_10055467 3300009148 Bacteria 3149
369 Ga0105241_10467482 3300009174 Bacteria 1119
370 Ga0105248_10005363 3300009177 Bacteria 14102
371 Ga0105248_10019965 3300009177 Bacteria 7418
372 Ga0105248_10021059 3300009177 Bacteria 7225
373 Ga0105248_10078918 3300009177 Bacteria 3700
374 Ga0105248_10101795 3300009177 Bacteria 3237
375 Ga0105248_10167569 3300009177 Bacteria 2476
376 Ga0105237_10006741 3300009545 Bacteria 12686
377 Ga0105237_10051752 3300009545 Bacteria 4125
378 Ga0105237_10191488 3300009545 Bacteria 2045
379 Ga0105237_10211301 3300009545 Bacteria 1940
380 Ga0105238_10000712 3300009551 Bacteria 34771
381 Ga0105238_10055872 3300009551 Bacteria 3961
382 Ga0105249_10027806 3300009553 Bacteria 5104
383 Ga0105249_10065042 3300009553 Bacteria 3354
384 Ga0105249_10230085 3300009553 Bacteria 1828
385 Ga0105239_10023554 3300010375 Bacteria 6781
386 Ga0105239_10038511 3300010375 Bacteria 5240
387 Ga0105239_10041873 3300010375 Bacteria 5019
388 Ga0105246_10116927 3300011119 Bacteria 1969
389 Ga0157373_10003497 3300013100 Bacteria 11881
390 Ga0157373_10022410 3300013100 Bacteria 4583
391 Ga0157373_10031344 3300013100 Bacteria 3827
392 Ga0157373_10169208 3300013100 Bacteria 1538
393 Ga0157371_10001965 3300013102 Bacteria 20388
394 Ga0157371_10073766 3300013102 Bacteria 2417
395 Ga0157370_10015402 3300013104 Bacteria 7773
396 Ga0157370_10315503 3300013104 Bacteria 1442
397 Ga0157369_10030173 3300013105 Bacteria 5981
398 Ga0157369_10086176 3300013105 Bacteria 3355
399 Ga0157369_10358477 3300013105 Bacteria 1514
400 Ga0157374_10004611 3300013296 Bacteria 11559
401 Ga0157374_10007785 3300013296 Bacteria 9145
402 Ga0157374_10007802 3300013296 Bacteria 9137
403 Ga0157378_10008972 3300013297 Bacteria 8706
404 Ga0157378_10362704 3300013297 Bacteria 1418
405 Ga0163162_10003382 3300013306 Bacteria 15250
406 Ga0163162_10005117 3300013306 Bacteria 12640
407 Ga0163162_10011482 3300013306 Bacteria 8637
408 Ga0157372_10001631 3300013307 Bacteria 24355
409 Ga0157372_10009644 3300013307 Bacteria 10261
410 Ga0157372_10045912 3300013307 Bacteria 4847
411 Ga0157372_10073342 3300013307 Bacteria 3858
412 Ga0157372_10160432 3300013307 Bacteria 2599
413 Ga0157375_10001432 3300013308 Bacteria 20539
414 Ga0157375_10027008 3300013308 Bacteria 5360
415 Ga0157375_10043974 3300013308 Bacteria 4334
416 Ga0157375_10049211 3300013308 Bacteria 4128
417 Ga0157375_10087332 3300013308 Bacteria 3171
418 Ga0157375_10090945 3300013308 Bacteria 3112
419 Ga0157375_10122509 3300013308 Bacteria 2712
420 Ga0157375_10128234 3300013308 Bacteria 2655
421 Ga0157375_10169220 3300013308 Bacteria 2332
422 Ga0157375_10498317 3300013308 Bacteria 1382
423 Ga0163163_10003225 3300014325 Bacteria 13825
424 Ga0163163_10014223 3300014325 Bacteria 7311
425 Ga0163163_10047954 3300014325 Bacteria 4199
426 Ga0163163_10214618 3300014325 Bacteria 1973
427 Ga0163163_10220438 3300014325 Bacteria 1945
428 Ga0157380_10005916 3300014326 Bacteria 8556
429 Ga0157380_10011972 3300014326 Bacteria 6276
430 Ga0157380_10014102 3300014326 Bacteria 5842
431 Ga0157380_10030668 3300014326 Bacteria 4120
432 Ga0157380_10087581 3300014326 Bacteria 2561
433 Ga0182008_10006784 3300014497 Bacteria 6370
434 Ga0182008_10017118 3300014497 Bacteria 3761
435 Ga0182008_10038992 3300014497 Bacteria 2375
436 Ga0182008_10087307 3300014497 Bacteria 1536
437 Ga0157377_10015987 3300014745 Bacteria 3850
438 Ga0157379_10005600 3300014968 Bacteria 10798
439 Ga0157379_10006927 3300014968 Bacteria 9801
440 Ga0157379_10016501 3300014968 Bacteria 6496
441 Ga0157379_10033673 3300014968 Bacteria 4569
442 Ga0157379_10042801 3300014968 Bacteria 4044
443 Ga0157379_10075638 3300014968 Bacteria 3015
444 Ga0157376_10012394 3300014969 Bacteria 6327
445 Ga0157376_10044805 3300014969 Bacteria 3639
446 Ga0157376_10333533 3300014969 Bacteria 1446
447 Ga0182006_1004396 3300015261 Bacteria 6963
448 Ga0182006_1006282 3300015261 Bacteria 5536
449 Ga0182006_1046531 3300015261 Bacteria 1685
450 Ga0163161_10006381 3300017792 Bacteria 8163
451 Ga0163161_10021826 3300017792 Bacteria 4503
452 Ga0163161_10029199 3300017792 Bacteria 3920
453 Ga0163161_10099500 3300017792 Bacteria 2162
454 Ga0163161_10185113 3300017792 Bacteria 1598
455 Ga0206353_11663169 3300020082 Bacteria 2022
456 Ga0209435_100085 3300025206 Bacteria 45218
457 Ga0209147_100217 3300025229 Bacteria 59789
458 Ga0209437_100549 3300025233 Bacteria 25216
459 Ga0209258_100390 3300025242 Bacteria 55905
460 Ga0209646_1000227 3300025246 Bacteria 59789
461 Ga0209026_1000340 3300025250 Bacteria 45211
462 Ga0209759_1000561 3300025256 Bacteria 37637
463 Ga0209565_1000085 3300025263 Bacteria 153075
464 Ga0209455_1003261 3300025272 Bacteria 5840
465 Ga0209673_1000739 3300025273 Bacteria 45015
466 Ga0209673_1001648 3300025273 Bacteria 19319
467 Ga0209130_1003167 3300025284 Bacteria 7274
468 Ga0209675_1000083 3300025291 Bacteria 153075
469 Ga0209675_1001883 3300025291 Bacteria 11315
470 Ga0209675_1005992 3300025291 Bacteria 4975
471 Ga0209676_1003233 3300025292 Bacteria 10288
472 Ga0209025_1022946 3300025294 Bacteria 3286
473 Ga0209051_1000268 3300025303 Bacteria 87155
474 Ga0209051_1008309 3300025303 Bacteria 5510
475 Ga0209257_1015029 3300025304 Bacteria 3262
476 Ga0207697_10008010 3300025315 Bacteria 4665
477 Ga0207697_10012216 3300025315 Bacteria 3608
478 Ga0207697_10015147 3300025315 Bacteria 3189
479 Ga0207697_10031550 3300025315 Bacteria 2167
480 Ga0207697_10032504 3300025315 Bacteria 2136
481 Ga0207697_10035380 3300025315 Bacteria 2044
482 Ga0207656_10021886 3300025321 Bacteria 2559
483 Ga0207656_10028402 3300025321 Bacteria 2296
484 Ga0207656_10106950 3300025321 Bacteria 1288
485 Ga0207682_10000233 3300025893 Bacteria 24983
486 Ga0207682_10000416 3300025893 Bacteria 19579
487 Ga0207682_10000730 3300025893 Bacteria 15257
488 Ga0207682_10003225 3300025893 Bacteria 7136
489 Ga0207682_10082362 3300025893 Bacteria 1381
490 Ga0207688_10007003 3300025901 Bacteria 6133
491 Ga0207680_10028844 3300025903 Bacteria 3110
492 Ga0207680_10030095 3300025903 Bacteria 3058
493 Ga0207680_10035838 3300025903 Bacteria 2853
494 Ga0207680_10039910 3300025903 Bacteria 2727
495 Ga0207680_10092937 3300025903 Bacteria 1923
496 Ga0207680_10125775 3300025903 Bacteria 1683
497 Ga0207680_10162049 3300025903 Bacteria 1501
498 Ga0207680_10282689 3300025903 Bacteria 1153
499 Ga0207647_10032700 3300025904 Bacteria 3338
500 Ga0207699_10124936 3300025906 Bacteria 1669
501 Ga0207645_10000686 3300025907 Bacteria 28086
502 Ga0207645_10003699 3300025907 Bacteria 11527
503 Ga0207645_10004517 3300025907 Bacteria 10280
504 Ga0207645_10008940 3300025907 Bacteria 6957
505 Ga0207645_10018867 3300025907 Bacteria 4530
506 Ga0207645_10032584 3300025907 Bacteria 3350
507 Ga0207645_10038430 3300025907 Bacteria 3070
508 Ga0207645_10056511 3300025907 Bacteria 2505
509 Ga0207643_10003526 3300025908 Bacteria 8416
510 Ga0207705_10036814 3300025909 Bacteria 3502
511 Ga0207707_10315884 3300025912 Bacteria 1349
512 Ga0207695_10001105 3300025913 Bacteria 46872
513 Ga0207695_10001995 3300025913 Bacteria 31509
514 Ga0207695_10081341 3300025913 Bacteria 3278
515 Ga0207671_10017479 3300025914 Bacteria 5527
516 Ga0207671_10018940 3300025914 Bacteria 5273
517 Ga0207671_10127263 3300025914 Bacteria 1952
518 Ga0207671_10179164 3300025914 Bacteria 1649
519 Ga0207662_10003935 3300025918 Bacteria 7743
520 Ga0207662_10026298 3300025918 Bacteria 3356
521 Ga0207657_10000371 3300025919 Bacteria 47425
522 Ga0207657_10008450 3300025919 Bacteria 10444
523 Ga0207657_10022790 3300025919 Bacteria 5848
524 Ga0207657_10024965 3300025919 Bacteria 5523
525 Ga0207649_10003702 3300025920 Bacteria 8341
526 Ga0207649_10038909 3300025920 Bacteria 2882
527 Ga0207649_10130628 3300025920 Bacteria 1705
528 Ga0207652_10021796 3300025921 Bacteria 5292
529 Ga0207681_10000997 3300025923 Bacteria 18506
530 Ga0207681_10002620 3300025923 Bacteria 11401
531 Ga0207681_10002861 3300025923 Bacteria 10908
532 Ga0207681_10011923 3300025923 Bacteria 5353
533 Ga0207681_10038086 3300025923 Bacteria 3183
534 Ga0207681_10081732 3300025923 Bacteria 2282
535 Ga0207681_10093690 3300025923 Bacteria 2150
536 Ga0207681_10167435 3300025923 Bacteria 1662
537 Ga0207681_10179096 3300025923 Bacteria 1613
538 Ga0207694_10000171 3300025924 Bacteria 66876
539 Ga0207650_10004120 3300025925 Bacteria 9935
540 Ga0207650_10004296 3300025925 Bacteria 9725
541 Ga0207650_10007398 3300025925 Bacteria 7477
542 Ga0207650_10020151 3300025925 Bacteria 4699
543 Ga0207650_10046084 3300025925 Bacteria 3210
544 Ga0207650_10062060 3300025925 Bacteria 2791
545 Ga0207650_10075298 3300025925 Bacteria 2547
546 Ga0207650_10096643 3300025925 Bacteria 2266
547 Ga0207650_10129828 3300025925 Bacteria 1971
548 Ga0207650_10163633 3300025925 Bacteria 1764
549 Ga0207650_10209361 3300025925 Bacteria 1565
550 Ga0207659_10009586 3300025926 Bacteria 6056
551 Ga0207659_10012735 3300025926 Bacteria 5367
552 Ga0207659_10023327 3300025926 Bacteria 4127
553 Ga0207659_10046936 3300025926 Bacteria 3053
554 Ga0207659_10053624 3300025926 Bacteria 2877
555 Ga0207659_10082490 3300025926 Bacteria 2380
556 Ga0207659_10088419 3300025926 Bacteria 2308
557 Ga0207659_10160937 3300025926 Bacteria 1762
558 Ga0207664_10140989 3300025929 Bacteria 2039
559 Ga0207644_10007246 3300025931 Bacteria 7220
560 Ga0207644_10007864 3300025931 Bacteria 6966
561 Ga0207644_10008734 3300025931 Bacteria 6632
562 Ga0207644_10011531 3300025931 Bacteria 5851
563 Ga0207644_10025072 3300025931 Bacteria 4097
564 Ga0207644_10030488 3300025931 Bacteria 3751
565 Ga0207644_10033338 3300025931 Bacteria 3597
566 Ga0207644_10146289 3300025931 Bacteria 1824
567 Ga0207644_10154066 3300025931 Bacteria 1781
568 Ga0207644_10192292 3300025931 Bacteria 1605
569 Ga0207644_10229190 3300025931 Bacteria 1475
570 Ga0207644_10274154 3300025931 Bacteria 1353
571 Ga0207690_10001079 3300025932 Bacteria 17434
572 Ga0207690_10228278 3300025932 Bacteria 1428
573 Ga0207690_10308621 3300025932 Bacteria 1240
574 Ga0207706_10000179 3300025933 Bacteria 70768
575 Ga0207706_10003064 3300025933 Bacteria 16089
576 Ga0207706_10013481 3300025933 Bacteria 7429
577 Ga0207706_10092805 3300025933 Bacteria 2655
578 Ga0207706_10105431 3300025933 Bacteria 2481
579 Ga0207686_10237880 3300025934 Bacteria 1324
580 Ga0207709_10063050 3300025935 Bacteria 2322
581 Ga0207709_10080776 3300025935 Bacteria 2095
582 Ga0207709_10224536 3300025935 Bacteria 1357
583 Ga0207670_10020062 3300025936 Bacteria 4098
584 Ga0207670_10062894 3300025936 Bacteria 2538
585 Ga0207669_10000479 3300025937 Bacteria 17446
586 Ga0207669_10001512 3300025937 Bacteria 9915
587 Ga0207669_10007275 3300025937 Bacteria 5107
588 Ga0207669_10013291 3300025937 Bacteria 4083
589 Ga0207669_10143687 3300025937 Bacteria 1660
590 Ga0207669_10184135 3300025937 Bacteria 1500
591 Ga0207704_10003830 3300025938 Bacteria 6845
592 Ga0207704_10014461 3300025938 Bacteria 3985
593 Ga0207704_10014736 3300025938 Bacteria 3959
594 Ga0207704_10121633 3300025938 Bacteria 1788
595 Ga0207704_10204426 3300025938 Bacteria 1448
596 Ga0207691_10000041 3300025940 Bacteria 106275
597 Ga0207691_10000367 3300025940 Bacteria 45445
598 Ga0207691_10005253 3300025940 Bacteria 12504
599 Ga0207691_10005358 3300025940 Bacteria 12380
600 Ga0207691_10005440 3300025940 Bacteria 12297
601 Ga0207691_10037005 3300025940 Bacteria 4521
602 Ga0207691_10038989 3300025940 Bacteria 4397
603 Ga0207691_10048155 3300025940 Bacteria 3909
604 Ga0207691_10059638 3300025940 Bacteria 3469
605 Ga0207691_10067505 3300025940 Bacteria 3233
606 Ga0207691_10104956 3300025940 Bacteria 2518
607 Ga0207711_10004403 3300025941 Bacteria 12002
608 Ga0207711_10005215 3300025941 Bacteria 11009
609 Ga0207711_10018271 3300025941 Bacteria 5828
610 Ga0207711_10063437 3300025941 Bacteria 3189
611 Ga0207711_10082353 3300025941 Bacteria 2813
612 Ga0207711_10101843 3300025941 Bacteria 2542
613 Ga0207711_10228731 3300025941 Bacteria 1703
614 Ga0207689_10000851 3300025942 Bacteria 29408
615 Ga0207689_10005338 3300025942 Bacteria 11515
616 Ga0207689_10019823 3300025942 Bacteria 5665
617 Ga0207689_10046150 3300025942 Bacteria 3602
618 Ga0207689_10071266 3300025942 Bacteria 2854
619 Ga0207689_10075796 3300025942 Bacteria 2765
620 Ga0207689_10108204 3300025942 Bacteria 2284
621 Ga0207661_10031272 3300025944 Bacteria 4109
622 Ga0207661_10142709 3300025944 Bacteria 2062
623 Ga0207661_10326552 3300025944 Bacteria 1380
624 Ga0207679_10011022 3300025945 Bacteria 5836
625 Ga0207679_10030380 3300025945 Bacteria 3772
626 Ga0207679_10049412 3300025945 Bacteria 3068
627 Ga0207679_10080294 3300025945 Bacteria 2490
628 Ga0207679_10093612 3300025945 Bacteria 2331
629 Ga0207679_10103430 3300025945 Bacteria 2232
630 Ga0207667_10000334 3300025949 Bacteria 64711
631 Ga0207667_10003921 3300025949 Bacteria 18305
632 Ga0207667_10009084 3300025949 Bacteria 11749
633 Ga0207667_10098334 3300025949 Bacteria 3020
634 Ga0207651_10001412 3300025960 Bacteria 10912
635 Ga0207651_10001584 3300025960 Bacteria 10419
636 Ga0207651_10008282 3300025960 Bacteria 5607
637 Ga0207651_10055636 3300025960 Bacteria 2718
638 Ga0207651_10072898 3300025960 Bacteria 2440
639 Ga0207712_10100355 3300025961 Bacteria 2150
640 Ga0207712_10124462 3300025961 Bacteria 1955
641 Ga0207668_10000795 3300025972 Bacteria 19349
642 Ga0207668_10026972 3300025972 Bacteria 3737
643 Ga0207668_10032867 3300025972 Bacteria 3433
644 Ga0207668_10071114 3300025972 Bacteria 2484
645 Ga0207668_10125349 3300025972 Bacteria 1952
646 Ga0207668_10320754 3300025972 Bacteria 1285
647 Ga0207640_10044487 3300025981 Bacteria 2845
648 Ga0207640_10053914 3300025981 Bacteria 2627
649 Ga0207640_10321683 3300025981 Bacteria 1232
650 Ga0207658_10001850 3300025986 Bacteria 15843
651 Ga0207658_10003204 3300025986 Bacteria 11647
652 Ga0207658_10011533 3300025986 Bacteria 6016
653 Ga0207658_10019704 3300025986 Bacteria 4666
654 Ga0207658_10023944 3300025986 Bacteria 4266
655 Ga0207658_10066949 3300025986 Bacteria 2704
656 Ga0207658_10100428 3300025986 Bacteria 2265
657 Ga0207658_10149878 3300025986 Bacteria 1899
658 Ga0207677_10003006 3300026023 Bacteria 8907
659 Ga0207677_10027131 3300026023 Bacteria 3602
660 Ga0207677_10046801 3300026023 Bacteria 2899
661 Ga0207677_10117436 3300026023 Bacteria 1994
662 Ga0207677_10285673 3300026023 Bacteria 1356
663 Ga0207703_10001420 3300026035 Bacteria 21843
664 Ga0207703_10004937 3300026035 Bacteria 10827
665 Ga0207703_10006085 3300026035 Bacteria 9649
666 Ga0207703_10032102 3300026035 Bacteria 4156
667 Ga0207703_10069773 3300026035 Bacteria 2899
668 Ga0207703_10078747 3300026035 Bacteria 2739
669 Ga0207703_10126999 3300026035 Bacteria 2197
670 Ga0207703_10287478 3300026035 Bacteria 1495
671 Ga0207639_10004490 3300026041 Bacteria 9413
672 Ga0207639_10033670 3300026041 Bacteria 3781
673 Ga0207678_10007687 3300026067 Bacteria 9521
674 Ga0207678_10010020 3300026067 Bacteria 8315
675 Ga0207678_10013948 3300026067 Bacteria 7063
676 Ga0207678_10032954 3300026067 Bacteria 4514
677 Ga0207678_10225597 3300026067 Bacteria 1604
678 Ga0207708_10009750 3300026075 Bacteria 7126
679 Ga0207708_10013661 3300026075 Bacteria 6066
680 Ga0207708_10087016 3300026075 Bacteria 2405
681 Ga0207702_10000997 3300026078 Bacteria 29032
682 Ga0207702_10089135 3300026078 Bacteria 2697
683 Ga0207702_10279721 3300026078 Bacteria 1577
684 Ga0207641_10002988 3300026088 Bacteria 15295
685 Ga0207641_10006864 3300026088 Bacteria 9527
686 Ga0207641_10009057 3300026088 Bacteria 8221
687 Ga0207641_10015622 3300026088 Bacteria 6222
688 Ga0207641_10054954 3300026088 Bacteria 3381
689 Ga0207641_10069803 3300026088 Bacteria 3018
690 Ga0207641_10073258 3300026088 Bacteria 2951
691 Ga0207641_10114735 3300026088 Bacteria 2394
692 Ga0207641_10166582 3300026088 Bacteria 2007
693 Ga0207641_10174786 3300026088 Bacteria 1963
694 Ga0207648_10002589 3300026089 Bacteria 19365
695 Ga0207648_10002805 3300026089 Bacteria 18486
696 Ga0207648_10002857 3300026089 Bacteria 18271
697 Ga0207648_10003625 3300026089 Bacteria 16145
698 Ga0207648_10004483 3300026089 Bacteria 14328
699 Ga0207648_10004957 3300026089 Bacteria 13540
700 Ga0207648_10015074 3300026089 Bacteria 7117
701 Ga0207648_10026051 3300026089 Bacteria 5200
702 Ga0207648_10061795 3300026089 Bacteria 3266
703 Ga0207648_10180497 3300026089 Bacteria 1868
704 Ga0207676_10000825 3300026095 Bacteria 24199
705 Ga0207676_10005307 3300026095 Bacteria 9128
706 Ga0207676_10026388 3300026095 Bacteria 4321
707 Ga0207676_10031603 3300026095 Bacteria 3982
708 Ga0207676_10047080 3300026095 Bacteria 3340
709 Ga0207676_10075591 3300026095 Bacteria 2718
710 Ga0207676_10264931 3300026095 Bacteria 1553
711 Ga0207674_10011739 3300026116 Bacteria 9829
712 Ga0207674_10023423 3300026116 Bacteria 6614
713 Ga0207674_10084299 3300026116 Bacteria 3176
714 Ga0207674_10111391 3300026116 Bacteria 2711
715 Ga0207675_100000246 3300026118 Bacteria 51719
716 Ga0207675_100002991 3300026118 Bacteria 16606
717 Ga0207675_100006052 3300026118 Bacteria 11511
718 Ga0207675_100071030 3300026118 Bacteria 3254
719 Ga0207675_100118134 3300026118 Bacteria 2507
720 Ga0207683_10000011 3300026121 Bacteria 140261
721 Ga0207683_10000246 3300026121 Bacteria 48193
722 Ga0207683_10003698 3300026121 Bacteria 13287
723 Ga0207683_10008758 3300026121 Bacteria 8638
724 Ga0207683_10029899 3300026121 Bacteria 4718
725 Ga0207683_10042093 3300026121 Bacteria 3989
726 Ga0207683_10048942 3300026121 Bacteria 3699
727 Ga0207683_10064281 3300026121 Bacteria 3234
728 Ga0207683_10102442 3300026121 Bacteria 2556
729 Ga0207683_10113183 3300026121 Bacteria 2430
730 Ga0207683_10138823 3300026121 Bacteria 2189
731 Ga0207683_10164935 3300026121 Bacteria 2004
732 Ga0207683_10192185 3300026121 Bacteria 1854
733 Ga0207683_10195609 3300026121 Bacteria 1837
734 Ga0207683_10275719 3300026121 Bacteria 1537
735 Ga0207698_10012637 3300026142 Bacteria 5533
736 Ga0207698_10015622 3300026142 Bacteria 5090
737 Ga0207698_10022567 3300026142 Bacteria 4377
738 Ga0207698_10063555 3300026142 Bacteria 2889
739 Ga0207698_10066304 3300026142 Bacteria 2841
740 Ga0209967_1015869 3300027364 Bacteria 1080
741 Ga0209995_1003012 3300027471 Bacteria 2671
742 Ga0209983_1010008 3300027665 Bacteria 1938
743 Ga0209971_1000713 3300027682 Bacteria 8553
744 Ga0209971_1011407 3300027682 Bacteria 2106
745 Ga0209998_10004220 3300027717 Bacteria 3062
746 Ga0209974_10002500 3300027876 Bacteria 6653
747 Ga0209974_10003146 3300027876 Bacteria 5976
748 Ga0268266_10005957 3300028379 Bacteria 11271
749 Ga0268266_10013255 3300028379 Bacteria 7106
750 Ga0268266_10020786 3300028379 Bacteria 5597
751 Ga0268266_10074066 3300028379 Bacteria 2956
752 Ga0268266_10426849 3300028379 Bacteria 1257
753 Ga0268265_10048618 3300028380 Bacteria 3185
754 Ga0268265_10113127 3300028380 Bacteria 2220
755 Ga0268265_10119495 3300028380 Bacteria 2168
756 Ga0268264_10013544 3300028381 Bacteria 6715
757 Ga0268264_10014259 3300028381 Bacteria 6533
758 Ga0268264_10023725 3300028381 Bacteria 5003
759 Ga0268264_10029612 3300028381 Bacteria 4486
760 Ga0268264_10109945 3300028381 Bacteria 2413
761 Ga0307515_10221879 3300028794 Bacteria 1706
762 Ga0316177_1102257 3300030731 Bacteria 4475
763 Ga0316176_1041333 3300030732 Bacteria 1760
764 Ga0314311_1238457 3300030733 Bacteria 12605
765 Ga0316178_1166803 3300030735 Bacteria 7580
766 Ga0316183_1039650 3300030742 Bacteria 3808
767 Ga0316181_1020412 3300030744 Bacteria 2986
768 Ga0316182_1044478 3300030745 Bacteria 3224
769 Ga0316182_1145400 3300030745 Bacteria 3288
770 Ga0307513_10000019 3300031456 Bacteria 231194
771 Ga0307513_10211695 3300031456 Bacteria 1769
772 Ga0307513_10334900 3300031456 Bacteria 1266
773 Ga0307509_10068107 3300031507 Bacteria 3725
774 Ga0307408_100004292 3300031548 Bacteria 9673
775 Ga0307408_100004313 3300031548 Bacteria 9652
776 Ga0307408_100014889 3300031548 Bacteria 5173
777 Ga0307408_100194304 3300031548 Bacteria 1637
778 Ga0307408_100224096 3300031548 Bacteria 1536
779 Ga0307514_10021463 3300031649 Bacteria 5263
780 Ga0316578_10012589 3300031728 Bacteria 4464
781 Ga0307516_10006735 3300031730 Bacteria 13430
782 Ga0307405_10000798 3300031731 Bacteria 12359
783 Ga0307405_10001876 3300031731 Bacteria 9025
784 Ga0307405_10020850 3300031731 Bacteria 3671
785 Ga0307405_10030842 3300031731 Bacteria 3148
786 Ga0307405_10032492 3300031731 Bacteria 3085
787 Ga0307405_10107382 3300031731 Bacteria 1884
788 Ga0307413_10015713 3300031824 Bacteria 3887
789 Ga0307413_10116111 3300031824 Bacteria 1803
790 Ga0307410_10004000 3300031852 Bacteria 7523
791 Ga0307410_10008979 3300031852 Bacteria 5577
792 Ga0307406_10001910 3300031901 Bacteria 11355
793 Ga0307406_10002619 3300031901 Bacteria 9801
794 Ga0307406_10022292 3300031901 Bacteria 3755
795 Ga0307406_10042139 3300031901 Bacteria 2849
796 Ga0307406_10211595 3300031901 Bacteria 1435
797 Ga0307406_10252560 3300031901 Bacteria 1329
798 Ga0307407_10022005 3300031903 Bacteria 3299
799 Ga0307407_10026461 3300031903 Bacteria 3072
800 Ga0307412_10005668 3300031911 Bacteria 7017
801 Ga0307412_10158755 3300031911 Bacteria 1677
802 Ga0307412_10311269 3300031911 Bacteria 1249
803 Ga0307409_100020265 3300031995 Bacteria 4528
804 Ga0307409_100269320 3300031995 Bacteria 1568
805 Ga0307409_100340591 3300031995 Bacteria 1411
806 Ga0307409_100383269 3300031995 Bacteria 1337
807 Ga0307416_100001269 3300032002 Bacteria 13581
808 Ga0307416_100005156 3300032002 Bacteria 7985
809 Ga0307416_100051067 3300032002 Bacteria 3300
810 Ga0307416_100152318 3300032002 Bacteria 2123
811 Ga0307414_10005736 3300032004 Bacteria 6858
812 Ga0307414_10019419 3300032004 Bacteria 4212
813 Ga0307411_10000231 3300032005 Bacteria 18220
814 Ga0307411_10009176 3300032005 Bacteria 5180
815 Ga0307411_10217297 3300032005 Bacteria 1480
816 Ga0307411_10257509 3300032005 Bacteria 1376
817 Ga0307415_100000546 3300032126 Bacteria 16469
818 Ga0307415_100239065 3300032126 Bacteria 1468
819 Ga0307507_10121180 3300033179 Bacteria 2091
820 Ga0373938_0020315 3300034957 Bacteria 1337
821 Ga0373945_0093074 3300035116 Bacteria 1170
822 Ga0373943_0153517 3300035170 Bacteria 1249
823 Ga0316574_0031556 3300035398 Bacteria 3214
824 Ga0373931_0000443 3300035691 Bacteria 16827
825 Ga0373931_0013999 3300035691 Bacteria 3915
826 Ga0373935_0001145 3300035692 Bacteria 14506
827 Ga0373947_0022154 3300035725 Bacteria 3682
828 Ga0373947_0028635 3300035725 Bacteria 3267
829 Ga0373937_0104975 3300036401 Bacteria 2625
830 Ga0373937_0472565 3300036401 Bacteria 1191
831 Ga0316584_0011804 3300036712 Bacteria 6151
832 Ga0316584_0138164 3300036712 Bacteria 1818
833 Ga0316584_0177681 3300036712 Bacteria 1577
834 Ga0316584_0207316 3300036712 Bacteria 1444
835 Ga0373925_0000836 3300037068 Bacteria 28317
836 Ga0373925_0067619 3300037068 Bacteria 2695
837 Ga0395899_0002529 3300037312 Bacteria 14811
838 Ga0395899_0138264 3300037312 Bacteria 1735
839 Ga0395900_0075074 3300037418 Bacteria 3475
840 Ga0395898_0194049 3300037466 Bacteria 1940
841 Ga0395905_0021347 3300037471 Bacteria 6124
842 Ga0395905_0045293 3300037471 Bacteria 4126
843 Ga0395905_0067514 3300037471 Bacteria 3349
844 Ga0395901_0085327 3300038443 Bacteria 3301
845 Ga0400483_168565 3300039062 Bacteria 2069
846 Ga0400483_193646 3300039062 Bacteria 2471
847 Ga0400483_210702 3300039062 Bacteria 1537
848 Ga0439436_0013957 3300041404 Bacteria 2427
849 Ga0439439_0002414 3300041406 Bacteria 3963
850 Ga0439447_008745 3300041407 Bacteria 3120
851 Ga0439447_024482 3300041407 Bacteria 1563
852 Ga0439466_0008563 3300041411 Bacteria 3855
853 Ga0439465_0008096 3300041413 Bacteria 3321
854 Ga0439465_0034194 3300041413 Bacteria 1627
855 Ga0451793_1480505 3300041452 Bacteria 1830
856 Ga0451853_2708462 3300041512 Bacteria 4837
857 Ga0439431_0004409 3300041997 Bacteria 3094
858 Ga0439433_0002940 3300041999 Bacteria 3649
859 Ga0439437_005985 3300042000 Bacteria 1344
860 Ga0439442_010918 3300042002 Bacteria 1845
861 Ga0439445_0005099 3300042004 Bacteria 2987
862 Ga0439449_0005349 3300042007 Bacteria 4918
863 Ga0439449_0007053 3300042007 Bacteria 4281
864 Ga0439457_014543 3300042014 Bacteria 1760
865 Ga0439462_0005125 3300042015 Bacteria 3215
866 Ga0439462_0005627 3300042015 Bacteria 3094
867 Ga0450911_000678 3300042115 Bacteria 10145
868 Ga0450890_002348 3300042127 Bacteria 2611
869 Ga0450896_007298 3300042133 Bacteria 1524
870 Ga0450898_017877 3300042134 Bacteria 1223
871 Ga0450898_023004 3300042134 Bacteria 1106
872 Ga0450906_004460 3300042145 Bacteria 2937
873 Ga0450906_005292 3300042145 Bacteria 2662
874 Ga0439446_0002184 3300042156 Bacteria 4660
875 Ga0439446_0019201 3300042156 Bacteria 1920
876 Ga0450908_000851 3300042184 Bacteria 5891
877 Ga0439434_0005245 3300042435 Bacteria 3790
878 Ga0439434_0006656 3300042435 Bacteria 3376
879 Ga0439434_0019991 3300042435 Bacteria 2010
880 Ga0439435_0004111 3300042436 Bacteria 3106
881 Ga0450918_002199 3300042531 Bacteria 3713
882 Ga0450893_0012858 3300042532 Bacteria 1392
883 Ga0451577_0002016 3300042876 Bacteria 25208
884 Ga0451577_0079441 3300042876 Bacteria 2924
885 Ga0451577_0119122 3300042876 Bacteria 2364
886 Ga0451577_0288188 3300042876 Bacteria 1488
887 Ga0451577_0375563 3300042876 Bacteria 1290
888 Ga0466965_0006030 3300044683 Bacteria 5476
889 Ga0453684_0200401 3300044712 Bacteria 2327
890 Ga0451576_0431395 3300045051 Bacteria 1383
891 Ga0451576_0516318 3300045051 Bacteria 1255
892 Ga0495592_0273398 3300046454 Bacteria 1108
893 Ga0495590_0024371 3300046457 Bacteria 2132
894 Ga0495639_0071974 3300046475 Bacteria 1598
895 Ga0495628_0164311 3300046516 Bacteria 1686
896 Ga0495630_0151613 3300046517 Bacteria 1764
897 Ga0495632_0004875 3300046519 Bacteria 9000
898 Ga0495643_0096377 3300046522 Bacteria 1521
899 Ga0495598_0011667 3300046537 Bacteria 2137
900 Ga0495621_0009980 3300046539 Bacteria 2898
901 Ga0495621_0011602 3300046539 Bacteria 2731
902 Ga0495621_0021883 3300046539 Bacteria 2113
903 Ga0495621_0048016 3300046539 Bacteria 1519
904 Ga0495621_0075422 3300046539 Bacteria 1249
905 Ga0495645_0135212 3300046543 Bacteria 1725
906 Ga0495668_0148016 3300046616 Bacteria 1286
907 Ga0495625_0000436 3300046660 Bacteria 62756
908 Ga0495625_0000657 3300046660 Bacteria 49342
909 Ga0495625_0057149 3300046660 Bacteria 2775
910 Ga0495658_0046866 3300046683 Bacteria 2432
911 Ga0495658_0095969 3300046683 Bacteria 1763
912 Ga0495658_0108456 3300046683 Bacteria 1666
913 Ga0495613_0110017 3300046689 Bacteria 1986
914 Ga0495649_0004571 3300046694 Bacteria 9020
915 Ga0495687_004201 3300047443 Bacteria 9884
916 Ga0495687_013819 3300047443 Bacteria 4187
917 Ga0495685_006660 3300047447 Bacteria 3793
918 Ga0495684_0136804 3300047471 Bacteria 1838
919 Ga0495686_0000872 3300047472 Bacteria 38466
920 Ga0495615_0005426 3300048090 Bacteria 2292
921 Ga0495626_0045483 3300048091 Bacteria 2049
922 Ga0496100_0135829 3300048903 Bacteria 1737
923 Ga0496101_0006307 3300048904 Bacteria 7633
924 Ga0496101_0009890 3300048904 Bacteria 6284
925 Ga0496101_0203037 3300048904 Bacteria 1533
926 Ga0496102_0001475 3300048905 Bacteria 20760
927 Ga0496102_0040656 3300048905 Bacteria 4207
928 Ga0496102_0117821 3300048905 Bacteria 2478
929 Ga0496103_0032431 3300048906 Bacteria 3188
930 Ga0496104_0032233 3300048907 Bacteria 4876
931 Ga0496104_0244730 3300048907 Bacteria 1706
932 Ga0496105_0021713 3300048908 Bacteria 5195
933 Ga0496105_0101130 3300048908 Bacteria 2381
934 Ga0496106_0010786 3300048909 Bacteria 6754
935 Ga0496106_0019068 3300048909 Bacteria 5084
936 Ga0496106_0101253 3300048909 Bacteria 2234
937 Ga0496106_0354961 3300048909 Bacteria 1178
938 Ga0496107_0009538 3300048910 Bacteria 6735
939 Ga0496107_0028246 3300048910 Bacteria 3986
940 Ga0496107_0064875 3300048910 Bacteria 2647
941 Ga0496107_0075397 3300048910 Bacteria 2455
942 Ga0496108_0020796 3300048911 Bacteria 5395
943 Ga0496108_0021517 3300048911 Bacteria 5300
944 Ga0496109_0019144 3300048912 Bacteria 6030
945 Ga0496109_0023911 3300048912 Bacteria 5426
946 Ga0496109_0133117 3300048912 Bacteria 2322
947 Ga0496110_0017980 3300048913 Bacteria 5922
948 Ga0496111_0038799 3300048914 Bacteria 3413
949 Ga0496111_0105217 3300048914 Bacteria 2076
950 Ga0496112_0431009 3300048915 Bacteria 1257
951 Ga0496114_0011902 3300048917 Bacteria 6962
952 Ga0496114_0040324 3300048917 Bacteria 3865
953 Ga0496114_0254709 3300048917 Bacteria 1545
954 Ga0496115_0005084 3300048918 Bacteria 9561
955 Ga0496116_0005983 3300048919 Bacteria 11157
956 Ga0496118_0115529 3300048921 Bacteria 1766
957 Ga0496121_0003212 3300048924 Bacteria 23519
958 Ga0496121_0013389 3300048924 Bacteria 8821
959 Ga0496121_0064747 3300048924 Bacteria 2979
960 Ga0496122_0000693 3300048925 Bacteria 67068
961 Ga0496122_0003061 3300048925 Bacteria 22565
962 Ga0496123_0000433 3300048926 Bacteria 75427
963 Ga0496123_0000600 3300048926 Bacteria 61187
964 Ga0496124_0037994 3300048927 Bacteria 4182
965 Ga0496124_0039236 3300048927 Bacteria 4106
966 Ga0496125_0001798 3300048928 Bacteria 29631
967 Ga0496125_0014212 3300048928 Bacteria 7762
968 Ga0496125_0018475 3300048928 Bacteria 6621
969 Ga0496125_0044295 3300048928 Bacteria 3765
970 Ga0496126_0208509 3300048929 Bacteria 1646
971 Ga0495682_0017939 3300049460 Bacteria 2666
972 Ga0501292_006715 3300049515 Bacteria 1644
973 Ga0501032_0007171 3300049569 Bacteria 8157
974 Ga0501033_0004540 3300049570 Bacteria 11112
975 Ga0501033_0243036 3300049570 Bacteria 1277
976 Ga0501034_0000533 3300049571 Bacteria 60463
977 Ga0501034_0435809 3300049571 Bacteria 1230
978 Ga0501036_0076639 3300049572 Bacteria 2829
979 Ga0501036_0210526 3300049572 Bacteria 1634
980 Ga0501037_0001180 3300049573 Bacteria 19290
981 Ga0501037_0454300 3300049573 Bacteria 873
982 Ga0501038_0042157 3300049574 Bacteria 3976
983 Ga0501038_0107350 3300049574 Bacteria 2316
984 Ga0501039_0003182 3300049575 Bacteria 12277
985 Ga0501039_0037529 3300049575 Bacteria 3740
986 Ga0501040_0009697 3300049576 Bacteria 6288
987 Ga0501041_0016961 3300049577 Bacteria 4333
988 Ga0501042_0004635 3300049578 Bacteria 8773
989 Ga0501042_0140638 3300049578 Bacteria 1740
990 Ga0501042_0151182 3300049578 Bacteria 1674
991 Ga0501043_0000018 3300049579 Bacteria 161101
992 Ga0501043_0000084 3300049579 Bacteria 84010
993 Ga0501046_0000042 3300049580 Bacteria 151850
994 Ga0501046_0020865 3300049580 Bacteria 5410
995 Ga0501046_0101693 3300049580 Bacteria 2204
996 Ga0501046_0276256 3300049580 Bacteria 1231
997 Ga0501047_0000052 3300049581 Bacteria 153448
998 Ga0501047_0045141 3300049581 Bacteria 4260
999 Ga0501048_0000459 3300049582 Bacteria 28550
1000 Ga0501048_0095246 3300049582 Bacteria 2099
1001 Ga0501048_0154559 3300049582 Bacteria 1623
1002 Ga0501067_0099881 3300049583 Bacteria 1612
1003 Ga0501068_0001747 3300049584 Bacteria 11554
1004 Ga0501068_0090097 3300049584 Bacteria 1892
1005 Ga0501069_0000026 3300049585 Bacteria 109293
1006 Ga0501070_0000043 3300049586 Bacteria 109293
1007 Ga0501070_0042744 3300049586 Bacteria 3774
1008 Ga0501070_0081583 3300049586 Bacteria 2676
1009 Ga0501071_0008142 3300049587 Bacteria 6913
1010 Ga0501071_0046072 3300049587 Bacteria 3132
1011 Ga0501071_0064553 3300049587 Bacteria 2656
1012 Ga0501071_0072159 3300049587 Bacteria 2518
1013 Ga0501072_0000934 3300049588 Bacteria 21525
1014 Ga0501072_0001325 3300049588 Bacteria 18572
1015 Ga0501072_0001824 3300049588 Bacteria 15849
1016 Ga0501072_0010544 3300049588 Bacteria 7035
1017 Ga0501072_0038420 3300049588 Bacteria 3757
1018 Ga0501072_0167568 3300049588 Bacteria 1753
1019 Ga0501072_0330462 3300049588 Bacteria 1211
1020 Ga0501073_0006904 3300049589 Bacteria 8449
1021 Ga0501073_0200176 3300049589 Bacteria 1381
1022 Ga0501074_0000132 3300049590 Bacteria 38468
1023 Ga0501074_0035319 3300049590 Bacteria 3622
1024 Ga0501075_0001811 3300049591 Bacteria 14079
1025 Ga0501075_0028281 3300049591 Bacteria 4138
1026 Ga0501075_0028345 3300049591 Bacteria 4133
1027 Ga0501075_0230253 3300049591 Bacteria 1413
1028 Ga0501076_0001410 3300049592 Bacteria 16095
1029 Ga0501076_0012416 3300049592 Bacteria 6366
1030 Ga0501076_0022601 3300049592 Bacteria 4835
1031 Ga0501076_0039282 3300049592 Bacteria 3716
1032 Ga0501076_0132711 3300049592 Bacteria 2020
1033 Ga0501077_0023008 3300049593 Bacteria 3951
1034 Ga0501249_002170 3300049679 Bacteria 3997
1035 Ga0501225_0012666 3300049705 Bacteria 2367
1036 Ga0501079_0022089 3300049741 Bacteria 4875
1037 Ga0501079_0028588 3300049741 Bacteria 4279
1038 Ga0501080_0000798 3300049742 Bacteria 25770
1039 Ga0501080_0012497 3300049742 Bacteria 7786
1040 Ga0501080_0083714 3300049742 Bacteria 2964
1041 Ga0501081_0018177 3300049743 Bacteria 4666
1042 Ga0501081_0021790 3300049743 Bacteria 4280
1043 Ga0501081_0034661 3300049743 Bacteria 3434
1044 Ga0501081_0194192 3300049743 Bacteria 1471
1045 Ga0501083_0000583 3300049744 Bacteria 23442
1046 Ga0501083_0017623 3300049744 Bacteria 4978
1047 Ga0501083_0103814 3300049744 Bacteria 1873
1048 Ga0501262_000777 3300049759 Bacteria 3694
1049 Ga0501035_0000092 3300049822 Bacteria 111685
1050 Ga0501035_0014747 3300049822 Bacteria 7215
1051 Ga0501035_0048810 3300049822 Bacteria 3795
1052 Ga0501044_0000254 3300049823 Bacteria 67556
1053 Ga0501044_0315737 3300049823 Bacteria 1488
1054 Ga0501044_0493428 3300049823 Bacteria 1126
1055 Ga0501045_0004179 3300049824 Bacteria 9972
1056 Ga0501045_0012716 3300049824 Bacteria 5928
1057 Ga0501045_0017821 3300049824 Bacteria 5044
1058 Ga0501045_0054430 3300049824 Bacteria 2925
1059 nmdc:mga03683_12443_c1 3300050489 Bacteria 3108
1060 nmdc:mga03683_37606_c1 3300050489 Bacteria 1973
1061 nmdc:mga03683_74014_c1 3300050489 Bacteria 1461
1062 nmdc:mga03n38_9263_c1 3300050490 Bacteria 3572
1063 nmdc:mga00v17_118941_c1 3300050491 Bacteria 1681
1064 nmdc:mga00v17_14000_c1 3300050491 Bacteria 4467
1065 nmdc:mga00v17_58612_c1 3300050491 Bacteria 2360
1066 nmdc:mga0yw44_163219_c1 3300050492 Bacteria 1459
1067 nmdc:mga0k408_117603_c1 3300050493 Bacteria 1573
1068 nmdc:mga0k408_2504_c1 3300050493 Bacteria 9772
1069 nmdc:mga0k408_26524_c1 3300050493 Bacteria 3285
1070 nmdc:mga0k408_33851_c1 3300050493 Bacteria 2924
1071 nmdc:mga0k408_37748_c1 3300050493 Bacteria 2774
1072 nmdc:mga0k408_39715_c1 3300050493 Bacteria 2706
1073 nmdc:mga0k408_70510_c1 3300050493 Bacteria 2039
1074 nmdc:mga0k408_80504_c1 3300050493 Bacteria 1907
1075 nmdc:mga0k408_8501_c1 3300050493 Bacteria 5513
1076 nmdc:mga06z11_64011_c1 3300050494 Bacteria 1926
1077 nmdc:mga07m45_10958_c1 3300050496 Bacteria 4751
1078 nmdc:mga07m45_163589_c1 3300050496 Bacteria 1292
1079 nmdc:mga07m45_24609_c2 3300050496 Bacteria 2106
1080 nmdc:mga07m45_251322_c1 3300050496 Bacteria 1029
1081 nmdc:mga07m45_29761_c1 3300050496 Bacteria 3023
1082 nmdc:mga07m45_3595_c1 3300050496 Bacteria 7491
1083 nmdc:mga07m45_4217_c1 3300050496 Bacteria 7030
1084 nmdc:mga07m45_4465_c1 3300050496 Bacteria 6844
1085 nmdc:mga07m45_55817_c1 3300050496 Bacteria 2233
1086 nmdc:mga05p37_258143_c1 3300050507 Bacteria 2087
1087 nmdc:mga09592_88506_c1 3300050508 Bacteria 2645
1088 nmdc:mga0qj67_137532_c1 3300050509 Bacteria 1979
1089 nmdc:mga08y16_252510_c1 3300050511 Bacteria 1822
1090 nmdc:mga08y16_68497_c1 3300050511 Bacteria 3700
1091 nmdc:mga0n895_374113_c1 3300050512 Bacteria 1442
1092 Ga0495601_0072698 3300053077 Bacteria 2197
1093 Ga0495619_0030891 3300053085 Bacteria 3469
1094 Ga0500644_0004275 3300053088 Bacteria 3569
1095 Ga0500644_0015537 3300053088 Bacteria 2174
1096 Ga0500583_0096232 3300053092 Bacteria 1446
1097 Ga0500593_000937 3300053117 Bacteria 10762
1098 Ga0500618_003736 3300053125 Bacteria 5104
1099 Ga0500559_0003779 3300053136 Bacteria 7350
1100 Ga0500559_0108354 3300053136 Bacteria 1285
1101 Ga0500573_0148840 3300053140 Bacteria 1284
1102 Ga0500645_000100 3300053730 Bacteria 68299
1103 Ga0500645_001458 3300053730 Bacteria 11931
1104 Ga0501084_0007050 3300054114 Bacteria 9267
1105 Ga0501084_0016085 3300054114 Bacteria 6211
1106 Ga0501084_0263216 3300054114 Bacteria 1456
1107 Ga0590074_007002 3300059423 Bacteria 1874
1108 Ga0590075_006012 3300059424 Bacteria 2872
1109 Ga0590077_004037 3300059426 Bacteria 3022
1110 Ga0501082_0014180 3300060353 Bacteria 6860
1111 Ga0501082_0031537 3300060353 Bacteria 4571
1112 Ga0501082_0063791 3300060353 Bacteria 3172
1113 Ga0501082_0083473 3300060353 Bacteria 2756
1114 Ga0501082_0117012 3300060353 Unclassified 2309
1115 Ga0530510_0016205 3300061734 Bacteria 5270
1116 Ga0530510_0154995 3300061734 Bacteria 1693
1117 Ga0530510_0214214 3300061734 Bacteria 1431
1118 Ga0530510_0300536 3300061734 Bacteria 1201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050489 nmdc:mga03683_12443_c1 nmdc:mga03683_12443_c1_2138_3094 262
2 3300049573 Ga0501037_0454300 Ga0501037_0454300_48_863 267
3 3300048924 Ga0496121_0064747 Ga0496121_0064747_1147_2025 274
4 3300048925 Ga0496122_0000693 Ga0496122_0000693_7629_8507 274
5 3300048926 Ga0496123_0000433 Ga0496123_0000433_15873_16751 274
6 3300006048 Ga0075363_100018976 Ga0075363_1000189763 289
7 3300006177 Ga0075362_10035913 Ga0075362_100359132 289
8 3300031731 Ga0307405_10030842 Ga0307405_100308423 289
9 3300035116 Ga0373945_0093074 Ga0373945_0093074_110_1129 292
10 3300039062 Ga0400483_210702 Ga0400483_210702_561_1523 296
11 3300042876 Ga0451577_0079441 Ga0451577_0079441_315_1292 296
12 3300045051 Ga0451576_0516318 Ga0451576_0516318_158_1135 296
13 3300002704 JGI25155J39150_1000329 JGI25155J39150_10003295 297
14 3300002705 JGI25156J39149_1000675 JGI25156J39149_100067512 297
15 3300002738 JGI25154J39366_1000615 JGI25154J39366_10006156 297
16 3300002741 JGI25157J39369_1000628 JGI25157J39369_10006286 297
17 3300003758 Ga0055532_1000157 Ga0055532_100015739 297
18 3300005563 Ga0068855_100011080 Ga0068855_1000110809 297
19 3300005614 Ga0068856_100118186 Ga0068856_1001181863 297
20 3300009011 Ga0105251_10081813 Ga0105251_100818131 297
21 3300009093 Ga0105240_10002015 Ga0105240_1000201514 297
22 3300009545 Ga0105237_10211301 Ga0105237_102113011 297
23 3300009551 Ga0105238_10055872 Ga0105238_100558721 297
24 3300014497 Ga0182008_10017118 Ga0182008_100171183 297
25 3300014497 Ga0182008_10038992 Ga0182008_100389923 297
26 3300015261 Ga0182006_1046531 Ga0182006_10465312 297
27 3300025206 Ga0209435_100085 Ga0209435_10008515 297
28 3300025229 Ga0209147_100217 Ga0209147_10021740 297
29 3300025233 Ga0209437_100549 Ga0209437_10054922 297
30 3300025242 Ga0209258_100390 Ga0209258_10039015 297
31 3300025246 Ga0209646_1000227 Ga0209646_100022715 297
32 3300025250 Ga0209026_1000340 Ga0209026_100034026 297
33 3300025256 Ga0209759_1000561 Ga0209759_100056115 297
34 3300025272 Ga0209455_1003261 Ga0209455_10032614 297
35 3300025913 Ga0207695_10001995 Ga0207695_1000199515 297
36 3300025914 Ga0207671_10179164 Ga0207671_101791641 297
37 3300025949 Ga0207667_10003921 Ga0207667_100039219 297
38 3300026078 Ga0207702_10089135 Ga0207702_100891351 297
39 3300035692 Ga0373935_0001145 Ga0373935_0001145_12285_13244 297
40 3300037068 Ga0373925_0067619 Ga0373925_0067619_1414_2373 297
41 3300046660 Ga0495625_0000657 Ga0495625_0000657_5642_6616 297
42 3300048919 Ga0496116_0005983 Ga0496116_0005983_1443_2393 297
43 3300048921 Ga0496118_0115529 Ga0496118_0115529_85_1035 297
44 3300048924 Ga0496121_0013389 Ga0496121_0013389_3710_4753 297
45 3300048928 Ga0496125_0018475 Ga0496125_0018475_5258_6208 297
46 3300049576 Ga0501040_0009697 Ga0501040_0009697_5131_6108 297
47 3300049588 Ga0501072_0010544 Ga0501072_0010544_3014_3991 297
48 3300049591 Ga0501075_0001811 Ga0501075_0001811_7582_8559 297
49 3300049592 Ga0501076_0012416 Ga0501076_0012416_3295_4272 297
50 3300049824 Ga0501045_0054430 Ga0501045_0054430_416_1393 297
51 3300005457 Ga0070662_100045744 Ga0070662_1000457444 298
52 3300031456 Ga0307513_10000019 Ga0307513_10000019144 298
53 3300042436 Ga0439435_0004111 Ga0439435_0004111_1287_2264 298
54 3300005564 Ga0070664_100276429 Ga0070664_1002764292 299
55 3300003792 Ga0055540_1002490 Ga0055540_10024905 300
56 3300006186 Ga0075369_10018149 Ga0075369_100181493 300
57 3300006948 Ga0099826_10146050 Ga0099826_101460502 300
58 3300025303 Ga0209051_1000268 Ga0209051_100026849 300
59 3300031649 Ga0307514_10021463 Ga0307514_100214635 300
60 3300031995 Ga0307409_100269320 Ga0307409_1002693201 300
61 3300026078 Ga0207702_10279721 Ga0207702_102797211 301
62 3300030731 Ga0316177_1102257 Ga0316177_11022574 301
63 3300030732 Ga0316176_1041333 Ga0316176_10413331 301
64 3300030733 Ga0314311_1238457 Ga0314311_12384579 301
65 3300030735 Ga0316178_1166803 Ga0316178_11668037 301
66 3300030742 Ga0316183_1039650 Ga0316183_10396504 301
67 3300030744 Ga0316181_1020412 Ga0316181_10204122 301
68 3300030745 Ga0316182_1145400 Ga0316182_11454002 301
69 3300031901 Ga0307406_10042139 Ga0307406_100421392 301
70 3300032005 Ga0307411_10217297 Ga0307411_102172972 301
71 3300042127 Ga0450890_002348 Ga0450890_002348_1439_2446 301
72 3300046475 Ga0495639_0071974 Ga0495639_0071974_205_1185 301
73 3300046516 Ga0495628_0164311 Ga0495628_0164311_290_1270 301
74 3300046517 Ga0495630_0151613 Ga0495630_0151613_222_1202 301
75 3300046543 Ga0495645_0135212 Ga0495645_0135212_355_1335 301
76 3300046683 Ga0495658_0095969 Ga0495658_0095969_705_1685 301
77 3300047471 Ga0495684_0136804 Ga0495684_0136804_554_1534 301
78 3300049679 Ga0501249_002170 Ga0501249_002170_1702_2724 301
79 3300049705 Ga0501225_0012666 Ga0501225_0012666_231_1253 301
80 3300053077 Ga0495601_0072698 Ga0495601_0072698_1195_2175 301
81 3300053085 Ga0495619_0030891 Ga0495619_0030891_532_1512 301
82 3300001989 JGI24739J22299_10032375 JGI24739J22299_100323752 302
83 3300003578 Ga0006562J51391_1111043 Ga0006562J51391_11110433 302
84 3300003578 Ga0006562J51391_1111046 Ga0006562J51391_11110463 302
85 3300005842 Ga0068858_100001243 Ga0068858_10000124311 302
86 3300006353 Ga0075370_10004947 Ga0075370_100049475 302
87 3300013100 Ga0157373_10003497 Ga0157373_1000349710 302
88 3300014497 Ga0182008_10006784 Ga0182008_100067844 302
89 3300015261 Ga0182006_1006282 Ga0182006_10062823 302
90 3300026035 Ga0207703_10069773 Ga0207703_100697732 302
91 3300049588 Ga0501072_0038420 Ga0501072_0038420_1172_2161 302
92 3300050491 nmdc:mga00v17_118941_c1 nmdc:mga00v17_118941_c1_33_1088 302
93 3300050496 nmdc:mga07m45_24609_c2 nmdc:mga07m45_24609_c2_674_1777 302
94 3300050496 nmdc:mga07m45_3595_c1 nmdc:mga07m45_3595_c1_4809_5864 302
95 3300060353 Ga0501082_0063791 Ga0501082_0063791_724_1713 302
96 iso_pu_bacteria 2883577096 2883580304 302
97 3300005328 Ga0070676_10016798 Ga0070676_100167983 303
98 3300005335 Ga0070666_10181372 Ga0070666_101813721 303
99 3300005337 Ga0070682_100069593 Ga0070682_1000695932 303
100 3300005338 Ga0068868_100011920 Ga0068868_1000119201 303
101 3300005353 Ga0070669_100006690 Ga0070669_1000066907 303
102 3300005356 Ga0070674_100102600 Ga0070674_1001026002 303
103 3300005457 Ga0070662_100001865 Ga0070662_1000018657 303
104 3300005547 Ga0070693_100026183 Ga0070693_1000261833 303
105 3300005937 Ga0081455_10041760 Ga0081455_100417603 303
106 3300009098 Ga0105245_10044681 Ga0105245_100446814 303
107 3300009177 Ga0105248_10078918 Ga0105248_100789182 303
108 3300010375 Ga0105239_10041873 Ga0105239_100418733 303
109 3300013102 Ga0157371_10073766 Ga0157371_100737662 303
110 3300013296 Ga0157374_10007785 Ga0157374_100077858 303
111 3300013306 Ga0163162_10011482 Ga0163162_100114823 303
112 3300025315 Ga0207697_10035380 Ga0207697_100353803 303
113 3300025907 Ga0207645_10008940 Ga0207645_100089403 303
114 3300025923 Ga0207681_10011923 Ga0207681_100119233 303
115 3300025926 Ga0207659_10023327 Ga0207659_100233271 303
116 3300025933 Ga0207706_10003064 Ga0207706_100030647 303
117 3300025972 Ga0207668_10071114 Ga0207668_100711143 303
118 3300026023 Ga0207677_10285673 Ga0207677_102856732 303
119 3300034957 Ga0373938_0020315 Ga0373938_0020315_317_1318 303
120 3300035691 Ga0373931_0000443 Ga0373931_0000443_11402_12403 303
121 3300041512 Ga0451853_2708462 Ga0451853_2708462_284_1300 303
122 3300048903 Ga0496100_0135829 Ga0496100_0135829_691_1692 303
123 3300048908 Ga0496105_0101130 Ga0496105_0101130_61_1062 303
124 3300048910 Ga0496107_0009538 Ga0496107_0009538_4374_5375 303
125 3300048914 Ga0496111_0105217 Ga0496111_0105217_75_1076 303
126 3300048917 Ga0496114_0254709 Ga0496114_0254709_469_1470 303
127 3300053088 Ga0500644_0004275 Ga0500644_0004275_1919_2911 303
128 3300053117 Ga0500593_000937 Ga0500593_000937_2522_3514 303
129 3300053730 Ga0500645_000100 Ga0500645_000100_22860_23852 303
130 3300027682 Ga0209971_1011407 Ga0209971_10114072 305
131 3300053730 Ga0500645_001458 Ga0500645_001458_2428_3420 305
132 3300049574 Ga0501038_0042157 Ga0501038_0042157_1984_2961 306
133 3300049575 Ga0501039_0003182 Ga0501039_0003182_11049_12026 306
134 3300049578 Ga0501042_0004635 Ga0501042_0004635_3096_4073 306
135 3300049580 Ga0501046_0020865 Ga0501046_0020865_1171_2148 306
136 3300049586 Ga0501070_0042744 Ga0501070_0042744_1817_2794 306
137 3300049587 Ga0501071_0064553 Ga0501071_0064553_1325_2302 306
138 3300049588 Ga0501072_0000934 Ga0501072_0000934_13330_14307 306
139 3300049591 Ga0501075_0028345 Ga0501075_0028345_1910_2887 306
140 3300049592 Ga0501076_0001410 Ga0501076_0001410_8580_9557 306
141 3300049593 Ga0501077_0023008 Ga0501077_0023008_1471_2448 306
142 3300049741 Ga0501079_0028588 Ga0501079_0028588_1284_2261 306
143 3300049743 Ga0501081_0021790 Ga0501081_0021790_2028_3005 306
144 3300049822 Ga0501035_0048810 Ga0501035_0048810_1038_2015 306
145 3300049824 Ga0501045_0004179 Ga0501045_0004179_966_1943 306
146 3300054114 Ga0501084_0007050 Ga0501084_0007050_266_1243 306
147 3300060353 Ga0501082_0083473 Ga0501082_0083473_1675_2652 306
148 3300061734 Ga0530510_0016205 Ga0530510_0016205_2070_3047 306
149 3300005458 Ga0070681_10040512 Ga0070681_100405122 307
150 3300005518 Ga0070699_100231453 Ga0070699_1002314532 307
151 3300005530 Ga0070679_100024460 Ga0070679_1000244602 307
152 3300005546 Ga0070696_100077803 Ga0070696_1000778033 307
153 3300005563 Ga0068855_100010124 Ga0068855_1000101248 307
154 3300025949 Ga0207667_10000334 Ga0207667_100003345 307
155 3300037471 Ga0395905_0045293 Ga0395905_0045293_1602_2585 307
156 3300042134 Ga0450898_023004 Ga0450898_023004_40_969 307
157 3300046660 Ga0495625_0000436 Ga0495625_0000436_37275_38204 307
158 3300049579 Ga0501043_0000018 Ga0501043_0000018_38376_39347 307
159 3300049580 Ga0501046_0000042 Ga0501046_0000042_38376_39347 307
160 3300049581 Ga0501047_0000052 Ga0501047_0000052_114102_115073 307
161 3300049582 Ga0501048_0000459 Ga0501048_0000459_22790_23761 307
162 3300049759 Ga0501262_000777 Ga0501262_000777_2347_3276 307
163 3300049824 Ga0501045_0017821 Ga0501045_0017821_2799_3770 307
164 3300003773 Ga0055537_1000988 Ga0055537_10009889 308
165 3300003784 Ga0055534_1000238 Ga0055534_10002389 308
166 3300003790 Ga0055528_1000455 Ga0055528_100045533 308
167 3300005329 Ga0070683_100295914 Ga0070683_1002959141 308
168 3300005344 Ga0070661_100003514 Ga0070661_1000035146 308
169 3300005456 Ga0070678_100187000 Ga0070678_1001870002 308
170 3300005535 Ga0070684_100077603 Ga0070684_1000776032 308
171 3300005564 Ga0070664_100096818 Ga0070664_1000968182 308
172 3300005616 Ga0068852_100001729 Ga0068852_1000017297 308
173 3300005834 Ga0068851_10001475 Ga0068851_100014759 308
174 3300006948 Ga0099826_10005293 Ga0099826_100052933 308
175 3300013307 Ga0157372_10160432 Ga0157372_101604323 308
176 3300025263 Ga0209565_1000085 Ga0209565_10000859 308
177 3300025273 Ga0209673_1000739 Ga0209673_10007399 308
178 3300025291 Ga0209675_1000083 Ga0209675_10000839 308
179 3300025294 Ga0209025_1022946 Ga0209025_10229462 308
180 3300025321 Ga0207656_10021886 Ga0207656_100218861 308
181 3300025920 Ga0207649_10003702 Ga0207649_100037022 308
182 3300025944 Ga0207661_10326552 Ga0207661_103265522 308
183 3300025945 Ga0207679_10049412 Ga0207679_100494121 308
184 3300026116 Ga0207674_10084299 Ga0207674_100842991 308
185 3300026121 Ga0207683_10195609 Ga0207683_101956092 308
186 3300037312 Ga0395899_0002529 Ga0395899_0002529_6512_7477 308
187 3300037312 Ga0395899_0138264 Ga0395899_0138264_223_1188 308
188 3300037466 Ga0395898_0194049 Ga0395898_0194049_955_1920 308
189 3300038443 Ga0395901_0085327 Ga0395901_0085327_1354_2319 308
190 3300049588 Ga0501072_0330462 Ga0501072_0330462_36_1025 308
191 3300005981 Ga0081538_10023874 Ga0081538_100238743 309
192 3300006048 Ga0075363_100005387 Ga0075363_1000053875 309
193 3300006051 Ga0075364_10172596 Ga0075364_101725962 309
194 3300006177 Ga0075362_10007830 Ga0075362_100078302 309
195 3300006195 Ga0075366_10037733 Ga0075366_100377333 309
196 3300014968 Ga0157379_10042801 Ga0157379_100428013 309
197 3300049588 Ga0501072_0001824 Ga0501072_0001824_10486_11481 309
198 3300049590 Ga0501074_0035319 Ga0501074_0035319_1977_2915 309
199 3300050490 nmdc:mga03n38_9263_c1 nmdc:mga03n38_9263_c1_2323_3303 309
200 3300050491 nmdc:mga00v17_58612_c1 nmdc:mga00v17_58612_c1_1161_2141 309
201 3300050493 nmdc:mga0k408_33851_c1 nmdc:mga0k408_33851_c1_217_1197 309
202 3300050496 nmdc:mga07m45_251322_c1 nmdc:mga07m45_251322_c1_11_946 309
203 3300053088 Ga0500644_0015537 Ga0500644_0015537_633_1610 309
204 3300013308 Ga0157375_10128234 Ga0157375_101282343 310
205 iso_pu_bacteria 2891048133 2891049488 310
206 iso_pu_bacteria 2928130867 2928133802 310
207 3300031456 Ga0307513_10211695 Ga0307513_102116951 311
208 3300036712 Ga0316584_0177681 Ga0316584_0177681_300_1349 311
209 3300048928 Ga0496125_0014212 Ga0496125_0014212_2576_3535 311
210 3300049572 Ga0501036_0076639 Ga0501036_0076639_1577_2554 311
211 3300049574 Ga0501038_0107350 Ga0501038_0107350_618_1595 311
212 3300049822 Ga0501035_0014747 Ga0501035_0014747_4618_5595 311
213 3300060353 Ga0501082_0031537 Ga0501082_0031537_1317_2294 311
214 iso_pu_bacteria 2773857925 2774868937 311
215 iso_pu_bacteria 2828305725 2828308014 311
216 3300005937 Ga0081455_10031721 Ga0081455_100317214 312
217 3300006847 Ga0075431_100227061 Ga0075431_1002270613 312
218 3300009147 Ga0114129_10197819 Ga0114129_101978192 312
219 3300035398 Ga0316574_0031556 Ga0316574_0031556_794_1768 312
220 3300036712 Ga0316584_0207316 Ga0316584_0207316_255_1229 312
221 3300039062 Ga0400483_193646 Ga0400483_193646_673_1674 312
222 3300048925 Ga0496122_0003061 Ga0496122_0003061_19881_20852 312
223 3300048926 Ga0496123_0000600 Ga0496123_0000600_58480_59451 312
224 3300049515 Ga0501292_006715 Ga0501292_006715_503_1462 312
225 3300049569 Ga0501032_0007171 Ga0501032_0007171_4367_5320 312
226 3300049570 Ga0501033_0004540 Ga0501033_0004540_9679_10632 312
227 3300049571 Ga0501034_0435809 Ga0501034_0435809_131_1084 312
228 3300049573 Ga0501037_0001180 Ga0501037_0001180_3695_4648 312
229 3300049579 Ga0501043_0000084 Ga0501043_0000084_68800_69753 312
230 3300049585 Ga0501069_0000026 Ga0501069_0000026_14258_15211 312
231 3300049586 Ga0501070_0000043 Ga0501070_0000043_14258_15211 312
232 3300049587 Ga0501071_0008142 Ga0501071_0008142_4864_5817 312
233 3300049590 Ga0501074_0000132 Ga0501074_0000132_28894_29847 312
234 3300049742 Ga0501080_0000798 Ga0501080_0000798_9990_10943 312
235 3300049744 Ga0501083_0000583 Ga0501083_0000583_14258_15211 312
236 3300049822 Ga0501035_0000092 Ga0501035_0000092_14258_15211 312
237 3300049823 Ga0501044_0000254 Ga0501044_0000254_14258_15211 312
238 3300050507 nmdc:mga05p37_258143_c1 nmdc:mga05p37_258143_c1_507_1457 312
239 3300050508 nmdc:mga09592_88506_c1 nmdc:mga09592_88506_c1_542_1492 312
240 3300005328 Ga0070676_10001469 Ga0070676_1000146911 313
241 3300005331 Ga0070670_100013736 Ga0070670_1000137365 313
242 3300005331 Ga0070670_100026539 Ga0070670_1000265394 313
243 3300005331 Ga0070670_100130154 Ga0070670_1001301542 313
244 3300005331 Ga0070670_100242235 Ga0070670_1002422352 313
245 3300005334 Ga0068869_100043093 Ga0068869_1000430933 313
246 3300005334 Ga0068869_100108550 Ga0068869_1001085501 313
247 3300005335 Ga0070666_10000519 Ga0070666_1000051915 313
248 3300005338 Ga0068868_100002158 Ga0068868_1000021588 313
249 3300005347 Ga0070668_100007990 Ga0070668_1000079903 313
250 3300005347 Ga0070668_100023897 Ga0070668_1000238973 313
251 3300005353 Ga0070669_100001262 Ga0070669_10000126214 313
252 3300005353 Ga0070669_100046877 Ga0070669_1000468772 313
253 3300005354 Ga0070675_100007384 Ga0070675_1000073848 313
254 3300005354 Ga0070675_100058110 Ga0070675_1000581102 313
255 3300005355 Ga0070671_100123270 Ga0070671_1001232702 313
256 3300005356 Ga0070674_100117326 Ga0070674_1001173262 313
257 3300005364 Ga0070673_100006079 Ga0070673_1000060794 313
258 3300005364 Ga0070673_100102535 Ga0070673_1001025353 313
259 3300005445 Ga0070708_100011872 Ga0070708_1000118729 313
260 3300005456 Ga0070678_100000370 Ga0070678_10000037014 313
261 3300005456 Ga0070678_100047664 Ga0070678_1000476642 313
262 3300005459 Ga0068867_100001303 Ga0068867_10000130317 313
263 3300005543 Ga0070672_100000521 Ga0070672_10000052118 313
264 3300005543 Ga0070672_100010245 Ga0070672_1000102453 313
265 3300005548 Ga0070665_100100839 Ga0070665_1001008393 313
266 3300005563 Ga0068855_100097584 Ga0068855_1000975843 313
267 3300005564 Ga0070664_100032971 Ga0070664_1000329715 313
268 3300005578 Ga0068854_100007738 Ga0068854_1000077385 313
269 3300005578 Ga0068854_100155817 Ga0068854_1001558172 313
270 3300005616 Ga0068852_100132919 Ga0068852_1001329192 313
271 3300005617 Ga0068859_100006747 Ga0068859_1000067478 313
272 3300005618 Ga0068864_100003750 Ga0068864_10000375014 313
273 3300005618 Ga0068864_100091336 Ga0068864_1000913363 313
274 3300005719 Ga0068861_100268065 Ga0068861_1002680652 313
275 3300005834 Ga0068851_10052393 Ga0068851_100523932 313
276 3300005840 Ga0068870_10044132 Ga0068870_100441322 313
277 3300005841 Ga0068863_100088048 Ga0068863_1000880482 313
278 3300005842 Ga0068858_100002523 Ga0068858_10000252313 313
279 3300005843 Ga0068860_100001951 Ga0068860_10000195120 313
280 3300005843 Ga0068860_100069571 Ga0068860_1000695713 313
281 3300006038 Ga0075365_10261103 Ga0075365_102611031 313
282 3300006058 Ga0075432_10087465 Ga0075432_100874651 313
283 3300006177 Ga0075362_10031856 Ga0075362_100318562 313
284 3300006177 Ga0075362_10060680 Ga0075362_100606803 313
285 3300006178 Ga0075367_10010266 Ga0075367_100102666 313
286 3300006178 Ga0075367_10129930 Ga0075367_101299302 313
287 3300006186 Ga0075369_10010388 Ga0075369_100103884 313
288 3300006195 Ga0075366_10014442 Ga0075366_100144424 313
289 3300006195 Ga0075366_10039484 Ga0075366_100394843 313
290 3300006195 Ga0075366_10065523 Ga0075366_100655231 313
291 3300006237 Ga0097621_100001254 Ga0097621_10000125414 313
292 3300006353 Ga0075370_10001723 Ga0075370_1000172310 313
293 3300006353 Ga0075370_10003842 Ga0075370_100038423 313
294 3300006353 Ga0075370_10026591 Ga0075370_100265913 313
295 3300006353 Ga0075370_10147823 Ga0075370_101478232 313
296 3300006881 Ga0068865_100182377 Ga0068865_1001823772 313
297 3300006931 Ga0097620_100006747 Ga0097620_1000067478 313
298 3300007265 Ga0099794_10150737 Ga0099794_101507371 313
299 3300009093 Ga0105240_10035036 Ga0105240_100350364 313
300 3300009098 Ga0105245_10079495 Ga0105245_100794952 313
301 3300009148 Ga0105243_10034087 Ga0105243_100340872 313
302 3300009174 Ga0105241_10467482 Ga0105241_104674821 313
303 3300009177 Ga0105248_10005363 Ga0105248_1000536312 313
304 3300009545 Ga0105237_10006741 Ga0105237_100067414 313
305 3300009545 Ga0105237_10191488 Ga0105237_101914883 313
306 3300009551 Ga0105238_10000712 Ga0105238_1000071238 313
307 3300010375 Ga0105239_10023554 Ga0105239_100235543 313
308 3300010375 Ga0105239_10038511 Ga0105239_100385113 313
309 3300011119 Ga0105246_10116927 Ga0105246_101169273 313
310 3300013296 Ga0157374_10004611 Ga0157374_100046118 313
311 3300013306 Ga0163162_10003382 Ga0163162_100033822 313
312 3300013308 Ga0157375_10049211 Ga0157375_100492115 313
313 3300014326 Ga0157380_10011972 Ga0157380_100119725 313
314 3300014968 Ga0157379_10005600 Ga0157379_100056003 313
315 3300015261 Ga0182006_1004396 Ga0182006_10043967 313
316 3300017792 Ga0163161_10185113 Ga0163161_101851131 313
317 3300025315 Ga0207697_10015147 Ga0207697_100151473 313
318 3300025321 Ga0207656_10106950 Ga0207656_101069502 313
319 3300025903 Ga0207680_10039910 Ga0207680_100399103 313
320 3300025907 Ga0207645_10003699 Ga0207645_100036995 313
321 3300025907 Ga0207645_10004517 Ga0207645_100045176 313
322 3300025912 Ga0207707_10315884 Ga0207707_103158841 313
323 3300025913 Ga0207695_10001105 Ga0207695_1000110527 313
324 3300025913 Ga0207695_10081341 Ga0207695_100813413 313
325 3300025914 Ga0207671_10017479 Ga0207671_100174794 313
326 3300025914 Ga0207671_10018940 Ga0207671_100189404 313
327 3300025923 Ga0207681_10000997 Ga0207681_1000099710 313
328 3300025923 Ga0207681_10081732 Ga0207681_100817322 313
329 3300025924 Ga0207694_10000171 Ga0207694_1000017160 313
330 3300025925 Ga0207650_10075298 Ga0207650_100752983 313
331 3300025925 Ga0207650_10209361 Ga0207650_102093612 313
332 3300025926 Ga0207659_10009586 Ga0207659_100095862 313
333 3300025926 Ga0207659_10160937 Ga0207659_101609372 313
334 3300025931 Ga0207644_10008734 Ga0207644_100087345 313
335 3300025931 Ga0207644_10274154 Ga0207644_102741542 313
336 3300025935 Ga0207709_10063050 Ga0207709_100630501 313
337 3300025937 Ga0207669_10013291 Ga0207669_100132913 313
338 3300025937 Ga0207669_10143687 Ga0207669_101436873 313
339 3300025938 Ga0207704_10014736 Ga0207704_100147363 313
340 3300025940 Ga0207691_10000041 Ga0207691_1000004146 313
341 3300025940 Ga0207691_10067505 Ga0207691_100675052 313
342 3300025941 Ga0207711_10005215 Ga0207711_100052157 313
343 3300025942 Ga0207689_10046150 Ga0207689_100461503 313
344 3300025942 Ga0207689_10071266 Ga0207689_100712662 313
345 3300025942 Ga0207689_10075796 Ga0207689_100757962 313
346 3300025945 Ga0207679_10093612 Ga0207679_100936122 313
347 3300025949 Ga0207667_10098334 Ga0207667_100983342 313
348 3300025961 Ga0207712_10124462 Ga0207712_101244622 313
349 3300025972 Ga0207668_10026972 Ga0207668_100269722 313
350 3300025972 Ga0207668_10320754 Ga0207668_103207542 313
351 3300025981 Ga0207640_10044487 Ga0207640_100444873 313
352 3300025986 Ga0207658_10001850 Ga0207658_1000185012 313
353 3300026035 Ga0207703_10006085 Ga0207703_100060859 313
354 3300026035 Ga0207703_10287478 Ga0207703_102874782 313
355 3300026088 Ga0207641_10002988 Ga0207641_1000298810 313
356 3300026088 Ga0207641_10174786 Ga0207641_101747863 313
357 3300026089 Ga0207648_10002857 Ga0207648_100028579 313
358 3300026089 Ga0207648_10026051 Ga0207648_100260515 313
359 3300026095 Ga0207676_10047080 Ga0207676_100470802 313
360 3300026118 Ga0207675_100071030 Ga0207675_1000710303 313
361 3300026118 Ga0207675_100118134 Ga0207675_1001181343 313
362 3300026121 Ga0207683_10000011 Ga0207683_1000001171 313
363 3300026121 Ga0207683_10042093 Ga0207683_100420932 313
364 3300028379 Ga0268266_10020786 Ga0268266_100207866 313
365 3300028379 Ga0268266_10426849 Ga0268266_104268491 313
366 3300028381 Ga0268264_10014259 Ga0268264_100142592 313
367 3300031507 Ga0307509_10068107 Ga0307509_100681073 313
368 3300031548 Ga0307408_100224096 Ga0307408_1002240962 313
369 3300031824 Ga0307413_10116111 Ga0307413_101161112 313
370 3300033179 Ga0307507_10121180 Ga0307507_101211802 313
371 3300036401 Ga0373937_0472565 Ga0373937_0472565_194_1156 313
372 3300042876 Ga0451577_0288188 Ga0451577_0288188_147_1115 313
373 3300046457 Ga0495590_0024371 Ga0495590_0024371_1002_1973 313
374 3300046519 Ga0495632_0004875 Ga0495632_0004875_7909_8880 313
375 3300046522 Ga0495643_0096377 Ga0495643_0096377_169_1140 313
376 3300046537 Ga0495598_0011667 Ga0495598_0011667_531_1502 313
377 3300046539 Ga0495621_0009980 Ga0495621_0009980_421_1392 313
378 3300046539 Ga0495621_0048016 Ga0495621_0048016_328_1305 313
379 3300046616 Ga0495668_0148016 Ga0495668_0148016_302_1273 313
380 3300046660 Ga0495625_0057149 Ga0495625_0057149_309_1280 313
381 3300046694 Ga0495649_0004571 Ga0495649_0004571_5096_6067 313
382 3300047443 Ga0495687_004201 Ga0495687_004201_3565_4536 313
383 3300047443 Ga0495687_013819 Ga0495687_013819_334_1305 313
384 3300048090 Ga0495615_0005426 Ga0495615_0005426_1297_2268 313
385 3300048091 Ga0495626_0045483 Ga0495626_0045483_334_1305 313
386 3300048905 Ga0496102_0117821 Ga0496102_0117821_13_984 313
387 3300048909 Ga0496106_0354961 Ga0496106_0354961_161_1132 313
388 3300048910 Ga0496107_0028246 Ga0496107_0028246_1459_2430 313
389 3300048914 Ga0496111_0038799 Ga0496111_0038799_1275_2246 313
390 3300048917 Ga0496114_0011902 Ga0496114_0011902_5550_6521 313
391 3300049460 Ga0495682_0017939 Ga0495682_0017939_141_1112 313
392 3300050489 nmdc:mga03683_74014_c1 nmdc:mga03683_74014_c1_15_986 313
393 3300050493 nmdc:mga0k408_117603_c1 nmdc:mga0k408_117603_c1_12_968 313
394 3300050493 nmdc:mga0k408_2504_c1 nmdc:mga0k408_2504_c1_2449_3420 313
395 3300050493 nmdc:mga0k408_37748_c1 nmdc:mga0k408_37748_c1_66_1037 313
396 3300050493 nmdc:mga0k408_39715_c1 nmdc:mga0k408_39715_c1_76_1197 313
397 3300050493 nmdc:mga0k408_70510_c1 nmdc:mga0k408_70510_c1_766_1734 313
398 3300050493 nmdc:mga0k408_8501_c1 nmdc:mga0k408_8501_c1_2000_2971 313
399 3300050494 nmdc:mga06z11_64011_c1 nmdc:mga06z11_64011_c1_90_1061 313
400 3300050496 nmdc:mga07m45_10958_c1 nmdc:mga07m45_10958_c1_3656_4627 313
401 3300050496 nmdc:mga07m45_29761_c1 nmdc:mga07m45_29761_c1_1738_2709 313
402 3300050496 nmdc:mga07m45_4217_c1 nmdc:mga07m45_4217_c1_5709_6680 313
403 3300050496 nmdc:mga07m45_4465_c1 nmdc:mga07m45_4465_c1_3574_4545 313
404 3300050496 nmdc:mga07m45_55817_c1 nmdc:mga07m45_55817_c1_657_1628 313
405 3300053092 Ga0500583_0096232 Ga0500583_0096232_393_1364 313
406 3300053125 Ga0500618_003736 Ga0500618_003736_1177_2160 313
407 3300053140 Ga0500573_0148840 Ga0500573_0148840_191_1162 313
408 iso_pu_bacteria 2511231026 2511383679 313
409 iso_pu_bacteria 2521172590 2521559290 313
410 iso_pu_bacteria 2548876994 2550696168 313
411 iso_pu_bacteria 2739367655 2739612352 313
412 iso_pu_bacteria 2765235838 2765568540 313
413 iso_pu_bacteria 2808606386 2808981273 313
414 iso_pu_bacteria 2808606415 2809128856 313
415 iso_pu_bacteria 2808606419 2809148477 313
416 iso_pu_bacteria 2818991445 2819595488 313
417 iso_pu_bacteria 2818991449 2819615805 313
418 iso_pu_bacteria 2839094727 2839096581 313
419 iso_pu_bacteria 2844533157 2844536088 313
420 iso_pu_bacteria 2852618963 2852621010 313
421 iso_pu_bacteria 2884811622 2884817063 313
422 iso_pu_bacteria 2884836552 2884836746 313
423 iso_pu_bacteria 2884852848 2884853037 313
424 iso_pu_bacteria 2887375801 2887378437 313
425 iso_pu_bacteria 2896154374 2896155845 313
426 iso_pu_bacteria 2904439833 2904443699 313
427 iso_pu_bacteria 2904530477 2904532597 313
428 iso_pu_bacteria 2904584206 2904585095 313
429 iso_pu_bacteria 2904589729 2904593444 313
430 iso_pu_bacteria 2904601388 2904605624 313
431 iso_pu_bacteria 2919046199 2919048098 313
432 iso_pu_bacteria 2919079590 2919081419 313
433 3300005844 Ga0068862_100020263 Ga0068862_1000202634 314
434 3300005844 Ga0068862_100218301 Ga0068862_1002183011 314
435 3300006195 Ga0075366_10004464 Ga0075366_100044642 314
436 3300006195 Ga0075366_10011543 Ga0075366_100115434 314
437 3300025925 Ga0207650_10020151 Ga0207650_100201513 314
438 3300025961 Ga0207712_10100355 Ga0207712_101003551 314
439 3300025986 Ga0207658_10066949 Ga0207658_100669493 314
440 3300026089 Ga0207648_10015074 Ga0207648_100150747 314
441 3300026095 Ga0207676_10075591 Ga0207676_100755913 314
442 3300028380 Ga0268265_10119495 Ga0268265_101194953 314
443 3300041997 Ga0439431_0004409 Ga0439431_0004409_1604_2578 314
444 3300042876 Ga0451577_0002016 Ga0451577_0002016_23314_24285 314
445 3300044712 Ga0453684_0200401 Ga0453684_0200401_620_1618 314
446 3300045051 Ga0451576_0431395 Ga0451576_0431395_207_1178 314
447 3300046539 Ga0495621_0011602 Ga0495621_0011602_406_1386 314
448 3300049571 Ga0501034_0000533 Ga0501034_0000533_3299_4273 314
449 3300049588 Ga0501072_0001325 Ga0501072_0001325_9295_10269 314
450 3300050493 nmdc:mga0k408_80504_c1 nmdc:mga0k408_80504_c1_762_1727 314
451 3300050509 nmdc:mga0qj67_137532_c1 nmdc:mga0qj67_137532_c1_13_978 314
452 3300003790 Ga0055528_1034568 Ga0055528_10345682 315
453 3300005329 Ga0070683_100189547 Ga0070683_1001895473 315
454 3300005334 Ga0068869_100001166 Ga0068869_1000011663 315
455 3300005335 Ga0070666_10180616 Ga0070666_101806161 315
456 3300005339 Ga0070660_100019317 Ga0070660_1000193175 315
457 3300005366 Ga0070659_100011894 Ga0070659_1000118946 315
458 3300005367 Ga0070667_100007175 Ga0070667_1000071754 315
459 3300005367 Ga0070667_100181955 Ga0070667_1001819553 315
460 3300005455 Ga0070663_100005811 Ga0070663_1000058113 315
461 3300005535 Ga0070684_100037632 Ga0070684_1000376324 315
462 3300005539 Ga0068853_100003859 Ga0068853_1000038595 315
463 3300005539 Ga0068853_100226518 Ga0068853_1002265181 315
464 3300005543 Ga0070672_100002814 Ga0070672_1000028143 315
465 3300005545 Ga0070695_100037763 Ga0070695_1000377631 315
466 3300005545 Ga0070695_100081924 Ga0070695_1000819243 315
467 3300005548 Ga0070665_100010072 Ga0070665_1000100728 315
468 3300005549 Ga0070704_100044993 Ga0070704_1000449932 315
469 3300005577 Ga0068857_100136285 Ga0068857_1001362853 315
470 3300005616 Ga0068852_100013463 Ga0068852_1000134633 315
471 3300005616 Ga0068852_100033932 Ga0068852_1000339323 315
472 3300005617 Ga0068859_100067612 Ga0068859_1000676122 315
473 3300005617 Ga0068859_100157504 Ga0068859_1001575043 315
474 3300005618 Ga0068864_100209738 Ga0068864_1002097383 315
475 3300005719 Ga0068861_100001603 Ga0068861_1000016033 315
476 3300005842 Ga0068858_100002158 Ga0068858_1000021587 315
477 3300005843 Ga0068860_100008919 Ga0068860_1000089193 315
478 3300006038 Ga0075365_10010813 Ga0075365_100108133 315
479 3300006038 Ga0075365_10010993 Ga0075365_100109935 315
480 3300006051 Ga0075364_10101939 Ga0075364_101019393 315
481 3300006237 Ga0097621_100006981 Ga0097621_1000069816 315
482 3300006353 Ga0075370_10076194 Ga0075370_100761942 315
483 3300006358 Ga0068871_100511317 Ga0068871_1005113171 315
484 3300006881 Ga0068865_100036388 Ga0068865_1000363883 315
485 3300006931 Ga0097620_100067615 Ga0097620_1000676152 315
486 3300006931 Ga0097620_100157509 Ga0097620_1001575093 315
487 3300009147 Ga0114129_10073089 Ga0114129_100730892 315
488 3300013307 Ga0157372_10009644 Ga0157372_100096448 315
489 3300014326 Ga0157380_10030668 Ga0157380_100306683 315
490 3300014968 Ga0157379_10006927 Ga0157379_100069273 315
491 3300014969 Ga0157376_10012394 Ga0157376_100123943 315
492 3300017792 Ga0163161_10006381 Ga0163161_100063818 315
493 3300025273 Ga0209673_1001648 Ga0209673_100164820 315
494 3300025903 Ga0207680_10282689 Ga0207680_102826891 315
495 3300025914 Ga0207671_10127263 Ga0207671_101272633 315
496 3300025919 Ga0207657_10024965 Ga0207657_100249652 315
497 3300025920 Ga0207649_10130628 Ga0207649_101306282 315
498 3300025932 Ga0207690_10308621 Ga0207690_103086211 315
499 3300025938 Ga0207704_10121633 Ga0207704_101216332 315
500 3300025940 Ga0207691_10038989 Ga0207691_100389893 315
501 3300025941 Ga0207711_10018271 Ga0207711_100182716 315
502 3300025942 Ga0207689_10000851 Ga0207689_100008513 315
503 3300025944 Ga0207661_10142709 Ga0207661_101427092 315
504 3300025986 Ga0207658_10011533 Ga0207658_100115333 315
505 3300025986 Ga0207658_10149878 Ga0207658_101498783 315
506 3300026035 Ga0207703_10001420 Ga0207703_100014206 315
507 3300026041 Ga0207639_10033670 Ga0207639_100336703 315
508 3300026067 Ga0207678_10010020 Ga0207678_100100208 315
509 3300026089 Ga0207648_10180497 Ga0207648_101804973 315
510 3300026116 Ga0207674_10023423 Ga0207674_100234233 315
511 3300026118 Ga0207675_100000246 Ga0207675_10000024612 315
512 3300026142 Ga0207698_10012637 Ga0207698_100126371 315
513 3300026142 Ga0207698_10063555 Ga0207698_100635553 315
514 3300028379 Ga0268266_10013255 Ga0268266_100132556 315
515 3300028381 Ga0268264_10023725 Ga0268264_100237254 315
516 3300030745 Ga0316182_1044478 Ga0316182_10444783 315
517 3300031456 Ga0307513_10334900 Ga0307513_103349001 315
518 3300031548 Ga0307408_100014889 Ga0307408_1000148895 315
519 3300031548 Ga0307408_100194304 Ga0307408_1001943041 315
520 3300031730 Ga0307516_10006735 Ga0307516_100067359 315
521 3300031731 Ga0307405_10020850 Ga0307405_100208503 315
522 3300031901 Ga0307406_10001910 Ga0307406_100019105 315
523 3300031901 Ga0307406_10252560 Ga0307406_102525601 315
524 3300036712 Ga0316584_0011804 Ga0316584_0011804_3414_4376 315
525 3300036712 Ga0316584_0138164 Ga0316584_0138164_674_1636 315
526 3300037418 Ga0395900_0075074 Ga0395900_0075074_323_1306 315
527 3300037471 Ga0395905_0021347 Ga0395905_0021347_1195_2178 315
528 3300037471 Ga0395905_0067514 Ga0395905_0067514_1429_2412 315
529 3300041413 Ga0439465_0008096 Ga0439465_0008096_289_1359 315
530 3300041452 Ga0451793_1480505 Ga0451793_1480505_255_1247 315
531 3300042145 Ga0450906_004460 Ga0450906_004460_89_1159 315
532 3300042184 Ga0450908_000851 Ga0450908_000851_4595_5665 315
533 3300042435 Ga0439434_0005245 Ga0439434_0005245_2578_3648 315
534 3300042531 Ga0450918_002199 Ga0450918_002199_996_2066 315
535 3300048904 Ga0496101_0006307 Ga0496101_0006307_4648_5649 315
536 3300048905 Ga0496102_0040656 Ga0496102_0040656_1394_2395 315
537 3300048907 Ga0496104_0244730 Ga0496104_0244730_666_1667 315
538 3300048909 Ga0496106_0101253 Ga0496106_0101253_46_1047 315
539 3300048911 Ga0496108_0021517 Ga0496108_0021517_396_1370 315
540 3300048912 Ga0496109_0023911 Ga0496109_0023911_431_1432 315
541 3300048913 Ga0496110_0017980 Ga0496110_0017980_4882_5883 315
542 3300048918 Ga0496115_0005084 Ga0496115_0005084_4911_5912 315
543 3300049581 Ga0501047_0045141 Ga0501047_0045141_2843_3826 315
544 3300049582 Ga0501048_0154559 Ga0501048_0154559_377_1345 315
545 3300049583 Ga0501067_0099881 Ga0501067_0099881_592_1557 315
546 3300049584 Ga0501068_0001747 Ga0501068_0001747_6215_7180 315
547 3300049586 Ga0501070_0081583 Ga0501070_0081583_1603_2568 315
548 3300049587 Ga0501071_0072159 Ga0501071_0072159_1493_2461 315
549 3300049589 Ga0501073_0006904 Ga0501073_0006904_6148_7113 315
550 3300049589 Ga0501073_0200176 Ga0501073_0200176_332_1291 315
551 3300049591 Ga0501075_0230253 Ga0501075_0230253_153_1121 315
552 3300049592 Ga0501076_0132711 Ga0501076_0132711_161_1129 315
553 3300049742 Ga0501080_0012497 Ga0501080_0012497_6110_7075 315
554 3300049742 Ga0501080_0083714 Ga0501080_0083714_1994_2953 315
555 3300049744 Ga0501083_0017623 Ga0501083_0017623_381_1346 315
556 3300049823 Ga0501044_0315737 Ga0501044_0315737_391_1374 315
557 3300049823 Ga0501044_0493428 Ga0501044_0493428_93_1076 315
558 3300050492 nmdc:mga0yw44_163219_c1 nmdc:mga0yw44_163219_c1_422_1405 315
559 3300050493 nmdc:mga0k408_26524_c1 nmdc:mga0k408_26524_c1_70_1125 315
560 3300050512 nmdc:mga0n895_374113_c1 nmdc:mga0n895_374113_c1_18_989 315
561 3300060353 Ga0501082_0117012 Ga0501082_0117012_644_1612 315
562 3300061734 Ga0530510_0154995 Ga0530510_0154995_399_1367 315
563 iso_pu_bacteria 2643221628 2644159419 315
564 iso_pu_bacteria 2842677519 2842679062 315
565 iso_pu_bacteria 2842733646 2842735465 315
566 iso_pu_bacteria 2842747753 2842751440 315
567 iso_pu_bacteria 2885192300 2885192805 315
568 iso_pu_bacteria 2904449895 2904456262 315
569 iso_pu_bacteria 2904456579 2904457618 315
570 iso_pu_bacteria 2919462493 2919466976 315
571 iso_pu_bacteria 2929520902 2929527337 315
572 iso_pu_bacteria 2945945610 2945947349 315
573 iso_pu_bacteria 2945972063 2945977634 315
574 iso_pu_bacteria 2954767861 2954772613 315
575 3300003784 Ga0055534_1001423 Ga0055534_10014237 316
576 3300005331 Ga0070670_100020534 Ga0070670_1000205343 316
577 3300005334 Ga0068869_100080969 Ga0068869_1000809692 316
578 3300005347 Ga0070668_100110555 Ga0070668_1001105552 316
579 3300005353 Ga0070669_100058270 Ga0070669_1000582703 316
580 3300005354 Ga0070675_100030103 Ga0070675_1000301033 316
581 3300005364 Ga0070673_100096066 Ga0070673_1000960663 316
582 3300005367 Ga0070667_100066358 Ga0070667_1000663582 316
583 3300005441 Ga0070700_100059678 Ga0070700_1000596782 316
584 3300005456 Ga0070678_100135141 Ga0070678_1001351412 316
585 3300005459 Ga0068867_100000873 Ga0068867_1000008735 316
586 3300005536 Ga0070697_100036554 Ga0070697_1000365542 316
587 3300005543 Ga0070672_100062338 Ga0070672_1000623383 316
588 3300005616 Ga0068852_100223705 Ga0068852_1002237052 316
589 3300005617 Ga0068859_100309004 Ga0068859_1003090042 316
590 3300005618 Ga0068864_100136322 Ga0068864_1001363221 316
591 3300005719 Ga0068861_100002030 Ga0068861_1000020306 316
592 3300005841 Ga0068863_100145646 Ga0068863_1001456462 316
593 3300005841 Ga0068863_100207969 Ga0068863_1002079692 316
594 3300005843 Ga0068860_100001806 Ga0068860_10000180619 316
595 3300005843 Ga0068860_100233824 Ga0068860_1002338242 316
596 3300005844 Ga0068862_100008420 Ga0068862_1000084207 316
597 3300006358 Ga0068871_100036282 Ga0068871_1000362823 316
598 3300006931 Ga0097620_100308999 Ga0097620_1003089992 316
599 3300009177 Ga0105248_10167569 Ga0105248_101675693 316
600 3300013100 Ga0157373_10169208 Ga0157373_101692082 316
601 3300013306 Ga0163162_10005117 Ga0163162_1000511710 316
602 3300013308 Ga0157375_10027008 Ga0157375_100270083 316
603 3300014968 Ga0157379_10075638 Ga0157379_100756383 316
604 3300025284 Ga0209130_1003167 Ga0209130_10031677 316
605 3300025291 Ga0209675_1005992 Ga0209675_10059925 316
606 3300025292 Ga0209676_1003233 Ga0209676_10032337 316
607 3300025303 Ga0209051_1008309 Ga0209051_10083095 316
608 3300025304 Ga0209257_1015029 Ga0209257_10150294 316
609 3300025923 Ga0207681_10038086 Ga0207681_100380862 316
610 3300025940 Ga0207691_10104956 Ga0207691_101049563 316
611 3300025941 Ga0207711_10101843 Ga0207711_101018432 316
612 3300025942 Ga0207689_10108204 Ga0207689_101082043 316
613 3300026075 Ga0207708_10087016 Ga0207708_100870162 316
614 3300026088 Ga0207641_10054954 Ga0207641_100549544 316
615 3300026089 Ga0207648_10002805 Ga0207648_1000280512 316
616 3300026095 Ga0207676_10026388 Ga0207676_100263883 316
617 3300026118 Ga0207675_100002991 Ga0207675_10000299114 316
618 3300026121 Ga0207683_10138823 Ga0207683_101388232 316
619 3300026121 Ga0207683_10192185 Ga0207683_101921852 316
620 3300028380 Ga0268265_10113127 Ga0268265_101131272 316
621 3300028381 Ga0268264_10013544 Ga0268264_100135442 316
622 3300042000 Ga0439437_005985 Ga0439437_005985_209_1168 316
623 3300047447 Ga0495685_006660 Ga0495685_006660_2470_3456 316
624 3300050496 nmdc:mga07m45_163589_c1 nmdc:mga07m45_163589_c1_14_1009 316
625 iso_pu_bacteria 2842333319 2842337144 316
626 iso_pu_bacteria 8045864390 8045867889 316
627 3300005328 Ga0070676_10003857 Ga0070676_100038573 317
628 3300005331 Ga0070670_100023320 Ga0070670_1000233203 317
629 3300005331 Ga0070670_100068892 Ga0070670_1000688923 317
630 3300005331 Ga0070670_100115483 Ga0070670_1001154832 317
631 3300005333 Ga0070677_10011153 Ga0070677_100111534 317
632 3300005333 Ga0070677_10037771 Ga0070677_100377711 317
633 3300005335 Ga0070666_10007582 Ga0070666_100075823 317
634 3300005338 Ga0068868_100018728 Ga0068868_1000187283 317
635 3300005339 Ga0070660_100007902 Ga0070660_1000079027 317
636 3300005339 Ga0070660_100032256 Ga0070660_1000322562 317
637 3300005340 Ga0070689_100080341 Ga0070689_1000803412 317
638 3300005343 Ga0070687_100015439 Ga0070687_1000154394 317
639 3300005344 Ga0070661_100146395 Ga0070661_1001463953 317
640 3300005347 Ga0070668_100031308 Ga0070668_1000313084 317
641 3300005347 Ga0070668_100069350 Ga0070668_1000693503 317
642 3300005353 Ga0070669_100019592 Ga0070669_1000195924 317
643 3300005354 Ga0070675_100087079 Ga0070675_1000870793 317
644 3300005354 Ga0070675_100220284 Ga0070675_1002202842 317
645 3300005355 Ga0070671_100000154 Ga0070671_1000001543 317
646 3300005356 Ga0070674_100153958 Ga0070674_1001539581 317
647 3300005366 Ga0070659_100252295 Ga0070659_1002522952 317
648 3300005367 Ga0070667_100007586 Ga0070667_1000075866 317
649 3300005441 Ga0070700_100048995 Ga0070700_1000489953 317
650 3300005456 Ga0070678_100093135 Ga0070678_1000931353 317
651 3300005456 Ga0070678_100157255 Ga0070678_1001572551 317
652 3300005456 Ga0070678_100358664 Ga0070678_1003586641 317
653 3300005457 Ga0070662_100061168 Ga0070662_1000611684 317
654 3300005457 Ga0070662_100237134 Ga0070662_1002371342 317
655 3300005459 Ga0068867_100061816 Ga0068867_1000618162 317
656 3300005530 Ga0070679_100019303 Ga0070679_1000193034 317
657 3300005536 Ga0070697_100282602 Ga0070697_1002826021 317
658 3300005544 Ga0070686_100060748 Ga0070686_1000607483 317
659 3300005564 Ga0070664_100230374 Ga0070664_1002303743 317
660 3300005617 Ga0068859_100253657 Ga0068859_1002536573 317
661 3300005618 Ga0068864_100163541 Ga0068864_1001635411 317
662 3300005719 Ga0068861_100002402 Ga0068861_1000024024 317
663 3300005834 Ga0068851_10019905 Ga0068851_100199054 317
664 3300005841 Ga0068863_100039133 Ga0068863_1000391333 317
665 3300005841 Ga0068863_100229961 Ga0068863_1002299611 317
666 3300005842 Ga0068858_100015242 Ga0068858_1000152423 317
667 3300005843 Ga0068860_100017241 Ga0068860_1000172416 317
668 3300006881 Ga0068865_100031574 Ga0068865_1000315743 317
669 3300006931 Ga0097620_100253655 Ga0097620_1002536553 317
670 3300009148 Ga0105243_10055467 Ga0105243_100554674 317
671 3300009553 Ga0105249_10065042 Ga0105249_100650424 317
672 3300013104 Ga0157370_10015402 Ga0157370_100154027 317
673 3300013105 Ga0157369_10358477 Ga0157369_103584772 317
674 3300013307 Ga0157372_10045912 Ga0157372_100459124 317
675 3300013307 Ga0157372_10073342 Ga0157372_100733422 317
676 3300013308 Ga0157375_10087332 Ga0157375_100873323 317
677 3300013308 Ga0157375_10122509 Ga0157375_101225092 317
678 3300014325 Ga0163163_10214618 Ga0163163_102146182 317
679 3300014326 Ga0157380_10005916 Ga0157380_100059163 317
680 3300017792 Ga0163161_10099500 Ga0163161_100995002 317
681 3300020082 Ga0206353_11663169 Ga0206353_116631692 317
682 3300025315 Ga0207697_10032504 Ga0207697_100325042 317
683 3300025893 Ga0207682_10003225 Ga0207682_100032257 317
684 3300025903 Ga0207680_10092937 Ga0207680_100929372 317
685 3300025903 Ga0207680_10125775 Ga0207680_101257751 317
686 3300025909 Ga0207705_10036814 Ga0207705_100368142 317
687 3300025918 Ga0207662_10003935 Ga0207662_100039353 317
688 3300025919 Ga0207657_10008450 Ga0207657_100084507 317
689 3300025921 Ga0207652_10021796 Ga0207652_100217963 317
690 3300025923 Ga0207681_10002620 Ga0207681_100026207 317
691 3300025925 Ga0207650_10004296 Ga0207650_100042967 317
692 3300025925 Ga0207650_10096643 Ga0207650_100966433 317
693 3300025925 Ga0207650_10129828 Ga0207650_101298282 317
694 3300025926 Ga0207659_10088419 Ga0207659_100884192 317
695 3300025931 Ga0207644_10146289 Ga0207644_101462892 317
696 3300025931 Ga0207644_10229190 Ga0207644_102291902 317
697 3300025932 Ga0207690_10228278 Ga0207690_102282781 317
698 3300025935 Ga0207709_10080776 Ga0207709_100807762 317
699 3300025936 Ga0207670_10062894 Ga0207670_100628942 317
700 3300025938 Ga0207704_10014461 Ga0207704_100144613 317
701 3300025940 Ga0207691_10059638 Ga0207691_100596383 317
702 3300025941 Ga0207711_10082353 Ga0207711_100823532 317
703 3300025942 Ga0207689_10019823 Ga0207689_100198234 317
704 3300025945 Ga0207679_10103430 Ga0207679_101034302 317
705 3300025960 Ga0207651_10072898 Ga0207651_100728982 317
706 3300025972 Ga0207668_10032867 Ga0207668_100328674 317
707 3300025986 Ga0207658_10003204 Ga0207658_1000320412 317
708 3300026035 Ga0207703_10004937 Ga0207703_100049372 317
709 3300026075 Ga0207708_10009750 Ga0207708_100097503 317
710 3300026088 Ga0207641_10009057 Ga0207641_100090576 317
711 3300026088 Ga0207641_10069803 Ga0207641_100698031 317
712 3300026088 Ga0207641_10073258 Ga0207641_100732582 317
713 3300026095 Ga0207676_10264931 Ga0207676_102649311 317
714 3300026121 Ga0207683_10048942 Ga0207683_100489423 317
715 3300026121 Ga0207683_10102442 Ga0207683_101024423 317
716 3300026121 Ga0207683_10113183 Ga0207683_101131833 317
717 3300026121 Ga0207683_10164935 Ga0207683_101649353 317
718 3300026121 Ga0207683_10275719 Ga0207683_102757192 317
719 3300026142 Ga0207698_10022567 Ga0207698_100225674 317
720 3300028380 Ga0268265_10048618 Ga0268265_100486183 317
721 3300028381 Ga0268264_10029612 Ga0268264_100296123 317
722 3300031728 Ga0316578_10012589 Ga0316578_100125894 317
723 3300031731 Ga0307405_10001876 Ga0307405_100018763 317
724 3300032002 Ga0307416_100001269 Ga0307416_1000012698 317
725 3300032005 Ga0307411_10257509 Ga0307411_102575092 317
726 3300032126 Ga0307415_100000546 Ga0307415_1000005468 317
727 3300035725 Ga0373947_0028635 Ga0373947_0028635_1665_2648 317
728 3300036401 Ga0373937_0104975 Ga0373937_0104975_1211_2194 317
729 3300037068 Ga0373925_0000836 Ga0373925_0000836_21431_22417 317
730 3300046454 Ga0495592_0273398 Ga0495592_0273398_48_1031 317
731 3300046539 Ga0495621_0075422 Ga0495621_0075422_133_1116 317
732 3300046683 Ga0495658_0046866 Ga0495658_0046866_1315_2298 317
733 3300046683 Ga0495658_0108456 Ga0495658_0108456_284_1270 317
734 3300046689 Ga0495613_0110017 Ga0495613_0110017_410_1393 317
735 3300049578 Ga0501042_0151182 Ga0501042_0151182_254_1234 317
736 3300049580 Ga0501046_0276256 Ga0501046_0276256_171_1151 317
737 3300049591 Ga0501075_0028281 Ga0501075_0028281_1422_2402 317
738 3300049592 Ga0501076_0022601 Ga0501076_0022601_2053_3033 317
739 3300049743 Ga0501081_0018177 Ga0501081_0018177_3222_4202 317
740 3300050491 nmdc:mga00v17_14000_c1 nmdc:mga00v17_14000_c1_3259_4236 317
741 3300050511 nmdc:mga08y16_252510_c1 nmdc:mga08y16_252510_c1_140_1123 317
742 3300059423 Ga0590074_007002 Ga0590074_007002_304_1272 317
743 3300059424 Ga0590075_006012 Ga0590075_006012_372_1340 317
744 3300059426 Ga0590077_004037 Ga0590077_004037_1831_2799 317
745 iso_pu_bacteria 2837678835 2837683754 317
746 3300001976 JGI24752J21851_1002519 JGI24752J21851_10025192 318
747 3300001991 JGI24743J22301_10006240 JGI24743J22301_100062402 318
748 3300002076 JGI24749J21850_1003366 JGI24749J21850_10033662 318
749 3300002459 JGI24751J29686_10008885 JGI24751J29686_100088852 318
750 3300003659 JGI25404J52841_10001225 JGI25404J52841_100012252 318
751 3300005290 Ga0065712_10170837 Ga0065712_101708372 318
752 3300005293 Ga0065715_10226844 Ga0065715_102268441 318
753 3300005327 Ga0070658_10105595 Ga0070658_101055952 318
754 3300005328 Ga0070676_10000072 Ga0070676_1000007231 318
755 3300005328 Ga0070676_10010873 Ga0070676_100108732 318
756 3300005328 Ga0070676_10015869 Ga0070676_100158692 318
757 3300005328 Ga0070676_10134569 Ga0070676_101345691 318
758 3300005329 Ga0070683_100019115 Ga0070683_1000191153 318
759 3300005330 Ga0070690_100017328 Ga0070690_1000173283 318
760 3300005331 Ga0070670_100002700 Ga0070670_1000027006 318
761 3300005331 Ga0070670_100005878 Ga0070670_10000587810 318
762 3300005331 Ga0070670_100018322 Ga0070670_1000183226 318
763 3300005331 Ga0070670_100159406 Ga0070670_1001594063 318
764 3300005331 Ga0070670_100434692 Ga0070670_1004346921 318
765 3300005333 Ga0070677_10000616 Ga0070677_1000061611 318
766 3300005333 Ga0070677_10000865 Ga0070677_1000086510 318
767 3300005333 Ga0070677_10009003 Ga0070677_100090033 318
768 3300005334 Ga0068869_100013966 Ga0068869_1000139662 318
769 3300005335 Ga0070666_10008460 Ga0070666_100084605 318
770 3300005335 Ga0070666_10013992 Ga0070666_100139923 318
771 3300005335 Ga0070666_10088756 Ga0070666_100887562 318
772 3300005338 Ga0068868_100001393 Ga0068868_1000013939 318
773 3300005338 Ga0068868_100009557 Ga0068868_1000095573 318
774 3300005338 Ga0068868_100054771 Ga0068868_1000547713 318
775 3300005339 Ga0070660_100005630 Ga0070660_1000056304 318
776 3300005339 Ga0070660_100029916 Ga0070660_1000299162 318
777 3300005340 Ga0070689_100002746 Ga0070689_1000027467 318
778 3300005343 Ga0070687_100047387 Ga0070687_1000473872 318
779 3300005344 Ga0070661_100017793 Ga0070661_1000177933 318
780 3300005344 Ga0070661_100059804 Ga0070661_1000598043 318
781 3300005344 Ga0070661_100102158 Ga0070661_1001021582 318
782 3300005347 Ga0070668_100002017 Ga0070668_10000201710 318
783 3300005347 Ga0070668_100004555 Ga0070668_10000455510 318
784 3300005347 Ga0070668_100091961 Ga0070668_1000919612 318
785 3300005347 Ga0070668_100255202 Ga0070668_1002552021 318
786 3300005353 Ga0070669_100085877 Ga0070669_1000858772 318
787 3300005354 Ga0070675_100000476 Ga0070675_10000047626 318
788 3300005354 Ga0070675_100003131 Ga0070675_1000031313 318
789 3300005354 Ga0070675_100028275 Ga0070675_1000282754 318
790 3300005354 Ga0070675_100030147 Ga0070675_1000301473 318
791 3300005354 Ga0070675_100191571 Ga0070675_1001915712 318
792 3300005355 Ga0070671_100006308 Ga0070671_1000063089 318
793 3300005355 Ga0070671_100008085 Ga0070671_1000080853 318
794 3300005355 Ga0070671_100009602 Ga0070671_1000096025 318
795 3300005355 Ga0070671_100048136 Ga0070671_1000481364 318
796 3300005355 Ga0070671_100067489 Ga0070671_1000674893 318
797 3300005355 Ga0070671_100217506 Ga0070671_1002175062 318
798 3300005355 Ga0070671_100300035 Ga0070671_1003000351 318
799 3300005356 Ga0070674_100002257 Ga0070674_10000225713 318
800 3300005356 Ga0070674_100010524 Ga0070674_1000105245 318
801 3300005356 Ga0070674_100014457 Ga0070674_1000144576 318
802 3300005356 Ga0070674_100021330 Ga0070674_1000213302 318
803 3300005364 Ga0070673_100000208 Ga0070673_1000002086 318
804 3300005364 Ga0070673_100003413 Ga0070673_1000034136 318
805 3300005364 Ga0070673_100011947 Ga0070673_1000119473 318
806 3300005365 Ga0070688_100002922 Ga0070688_1000029227 318
807 3300005366 Ga0070659_100010715 Ga0070659_1000107153 318
808 3300005366 Ga0070659_100162178 Ga0070659_1001621782 318
809 3300005367 Ga0070667_100000550 Ga0070667_10000055032 318
810 3300005367 Ga0070667_100040646 Ga0070667_1000406463 318
811 3300005455 Ga0070663_100004102 Ga0070663_1000041023 318
812 3300005455 Ga0070663_100005729 Ga0070663_1000057296 318
813 3300005455 Ga0070663_100076951 Ga0070663_1000769511 318
814 3300005455 Ga0070663_100122614 Ga0070663_1001226142 318
815 3300005456 Ga0070678_100033269 Ga0070678_1000332693 318
816 3300005456 Ga0070678_100073750 Ga0070678_1000737503 318
817 3300005457 Ga0070662_100001776 Ga0070662_10000177612 318
818 3300005457 Ga0070662_100217151 Ga0070662_1002171512 318
819 3300005457 Ga0070662_100283851 Ga0070662_1002838512 318
820 3300005459 Ga0068867_100010420 Ga0068867_1000104203 318
821 3300005459 Ga0068867_100035490 Ga0068867_1000354903 318
822 3300005459 Ga0068867_100147320 Ga0068867_1001473203 318
823 3300005459 Ga0068867_100155115 Ga0068867_1001551152 318
824 3300005459 Ga0068867_100279973 Ga0068867_1002799731 318
825 3300005466 Ga0070685_10009131 Ga0070685_100091314 318
826 3300005466 Ga0070685_10099095 Ga0070685_100990952 318
827 3300005535 Ga0070684_100093087 Ga0070684_1000930872 318
828 3300005539 Ga0068853_100058065 Ga0068853_1000580653 318
829 3300005539 Ga0068853_100272097 Ga0068853_1002720972 318
830 3300005539 Ga0068853_100488126 Ga0068853_1004881261 318
831 3300005543 Ga0070672_100000757 Ga0070672_1000007576 318
832 3300005543 Ga0070672_100006010 Ga0070672_1000060105 318
833 3300005543 Ga0070672_100020888 Ga0070672_1000208883 318
834 3300005543 Ga0070672_100023965 Ga0070672_1000239653 318
835 3300005543 Ga0070672_100171986 Ga0070672_1001719862 318
836 3300005544 Ga0070686_100009145 Ga0070686_1000091457 318
837 3300005548 Ga0070665_100002350 Ga0070665_10000235020 318
838 3300005548 Ga0070665_100016840 Ga0070665_1000168409 318
839 3300005548 Ga0070665_100151448 Ga0070665_1001514481 318
840 3300005563 Ga0068855_100001489 Ga0068855_10000148929 318
841 3300005564 Ga0070664_100003967 Ga0070664_1000039671 318
842 3300005564 Ga0070664_100014861 Ga0070664_1000148617 318
843 3300005564 Ga0070664_100023132 Ga0070664_1000231326 318
844 3300005577 Ga0068857_100014884 Ga0068857_1000148844 318
845 3300005577 Ga0068857_100149978 Ga0068857_1001499783 318
846 3300005578 Ga0068854_100036357 Ga0068854_1000363573 318
847 3300005578 Ga0068854_100064284 Ga0068854_1000642843 318
848 3300005578 Ga0068854_100107203 Ga0068854_1001072033 318
849 3300005614 Ga0068856_100001185 Ga0068856_10000118520 318
850 3300005614 Ga0068856_100015944 Ga0068856_1000159443 318
851 3300005615 Ga0070702_100261315 Ga0070702_1002613152 318
852 3300005616 Ga0068852_100040670 Ga0068852_1000406703 318
853 3300005616 Ga0068852_100439372 Ga0068852_1004393722 318
854 3300005617 Ga0068859_100001157 Ga0068859_10000115717 318
855 3300005617 Ga0068859_100036604 Ga0068859_1000366045 318
856 3300005618 Ga0068864_100000432 Ga0068864_10000043222 318
857 3300005618 Ga0068864_100015226 Ga0068864_1000152267 318
858 3300005834 Ga0068851_10002802 Ga0068851_100028022 318
859 3300005834 Ga0068851_10007813 Ga0068851_100078133 318
860 3300005840 Ga0068870_10013314 Ga0068870_100133141 318
861 3300005840 Ga0068870_10044695 Ga0068870_100446953 318
862 3300005841 Ga0068863_100003841 Ga0068863_1000038416 318
863 3300005841 Ga0068863_100008368 Ga0068863_1000083686 318
864 3300005841 Ga0068863_100031131 Ga0068863_1000311315 318
865 3300005842 Ga0068858_100000549 Ga0068858_1000005492 318
866 3300005842 Ga0068858_100039347 Ga0068858_1000393474 318
867 3300005843 Ga0068860_100085144 Ga0068860_1000851442 318
868 3300005844 Ga0068862_100150186 Ga0068862_1001501862 318
869 3300005844 Ga0068862_100224885 Ga0068862_1002248852 318
870 3300005937 Ga0081455_10223856 Ga0081455_102238561 318
871 3300005981 Ga0081538_10040377 Ga0081538_100403773 318
872 3300005983 Ga0081540_1000140 Ga0081540_100014049 318
873 3300006038 Ga0075365_10024084 Ga0075365_100240844 318
874 3300006237 Ga0097621_100020573 Ga0097621_1000205731 318
875 3300006237 Ga0097621_100091265 Ga0097621_1000912653 318
876 3300006237 Ga0097621_100092310 Ga0097621_1000923103 318
877 3300006358 Ga0068871_100004365 Ga0068871_1000043652 318
878 3300006358 Ga0068871_100040447 Ga0068871_1000404473 318
879 3300006881 Ga0068865_100044433 Ga0068865_1000444333 318
880 3300006881 Ga0068865_100330694 Ga0068865_1003306941 318
881 3300006881 Ga0068865_100493602 Ga0068865_1004936021 318
882 3300006931 Ga0097620_100001157 Ga0097620_10000115717 318
883 3300006931 Ga0097620_100036607 Ga0097620_1000366075 318
884 3300007788 Ga0099795_10027120 Ga0099795_100271203 318
885 3300009094 Ga0111539_10019093 Ga0111539_100190937 318
886 3300009101 Ga0105247_10150864 Ga0105247_101508642 318
887 3300009147 Ga0114129_10299060 Ga0114129_102990603 318
888 3300009148 Ga0105243_10042603 Ga0105243_100426032 318
889 3300009177 Ga0105248_10019965 Ga0105248_100199658 318
890 3300009177 Ga0105248_10021059 Ga0105248_100210593 318
891 3300009177 Ga0105248_10101795 Ga0105248_101017953 318
892 3300009545 Ga0105237_10051752 Ga0105237_100517523 318
893 3300009553 Ga0105249_10027806 Ga0105249_100278063 318
894 3300009553 Ga0105249_10230085 Ga0105249_102300852 318
895 3300013100 Ga0157373_10022410 Ga0157373_100224104 318
896 3300013100 Ga0157373_10031344 Ga0157373_100313443 318
897 3300013102 Ga0157371_10001965 Ga0157371_1000196511 318
898 3300013104 Ga0157370_10315503 Ga0157370_103155032 318
899 3300013105 Ga0157369_10030173 Ga0157369_100301733 318
900 3300013105 Ga0157369_10086176 Ga0157369_100861763 318
901 3300013296 Ga0157374_10007802 Ga0157374_100078026 318
902 3300013297 Ga0157378_10008972 Ga0157378_100089727 318
903 3300013297 Ga0157378_10362704 Ga0157378_103627042 318
904 3300013307 Ga0157372_10001631 Ga0157372_1000163121 318
905 3300013308 Ga0157375_10001432 Ga0157375_1000143216 318
906 3300013308 Ga0157375_10043974 Ga0157375_100439742 318
907 3300013308 Ga0157375_10090945 Ga0157375_100909453 318
908 3300013308 Ga0157375_10169220 Ga0157375_101692203 318
909 3300013308 Ga0157375_10498317 Ga0157375_104983171 318
910 3300014325 Ga0163163_10003225 Ga0163163_100032254 318
911 3300014325 Ga0163163_10014223 Ga0163163_100142233 318
912 3300014325 Ga0163163_10047954 Ga0163163_100479543 318
913 3300014325 Ga0163163_10220438 Ga0163163_102204382 318
914 3300014326 Ga0157380_10014102 Ga0157380_100141026 318
915 3300014326 Ga0157380_10087581 Ga0157380_100875812 318
916 3300014497 Ga0182008_10087307 Ga0182008_100873072 318
917 3300014745 Ga0157377_10015987 Ga0157377_100159872 318
918 3300014968 Ga0157379_10016501 Ga0157379_100165016 318
919 3300014968 Ga0157379_10033673 Ga0157379_100336734 318
920 3300014969 Ga0157376_10044805 Ga0157376_100448052 318
921 3300014969 Ga0157376_10333533 Ga0157376_103335332 318
922 3300017792 Ga0163161_10021826 Ga0163161_100218263 318
923 3300017792 Ga0163161_10029199 Ga0163161_100291993 318
924 3300025291 Ga0209675_1001883 Ga0209675_100188312 318
925 3300025315 Ga0207697_10008010 Ga0207697_100080103 318
926 3300025315 Ga0207697_10012216 Ga0207697_100122162 318
927 3300025315 Ga0207697_10031550 Ga0207697_100315503 318
928 3300025321 Ga0207656_10028402 Ga0207656_100284022 318
929 3300025893 Ga0207682_10000233 Ga0207682_1000023322 318
930 3300025893 Ga0207682_10000416 Ga0207682_100004163 318
931 3300025893 Ga0207682_10000730 Ga0207682_100007304 318
932 3300025893 Ga0207682_10082362 Ga0207682_100823622 318
933 3300025901 Ga0207688_10007003 Ga0207688_100070036 318
934 3300025903 Ga0207680_10028844 Ga0207680_100288443 318
935 3300025903 Ga0207680_10030095 Ga0207680_100300953 318
936 3300025903 Ga0207680_10035838 Ga0207680_100358383 318
937 3300025903 Ga0207680_10162049 Ga0207680_101620492 318
938 3300025904 Ga0207647_10032700 Ga0207647_100327001 318
939 3300025906 Ga0207699_10124936 Ga0207699_101249361 318
940 3300025907 Ga0207645_10000686 Ga0207645_1000068610 318
941 3300025907 Ga0207645_10018867 Ga0207645_100188673 318
942 3300025907 Ga0207645_10032584 Ga0207645_100325844 318
943 3300025907 Ga0207645_10038430 Ga0207645_100384304 318
944 3300025907 Ga0207645_10056511 Ga0207645_100565113 318
945 3300025908 Ga0207643_10003526 Ga0207643_100035265 318
946 3300025918 Ga0207662_10026298 Ga0207662_100262983 318
947 3300025919 Ga0207657_10000371 Ga0207657_1000037116 318
948 3300025919 Ga0207657_10022790 Ga0207657_100227903 318
949 3300025920 Ga0207649_10038909 Ga0207649_100389091 318
950 3300025923 Ga0207681_10002861 Ga0207681_100028619 318
951 3300025923 Ga0207681_10093690 Ga0207681_100936903 318
952 3300025923 Ga0207681_10167435 Ga0207681_101674352 318
953 3300025923 Ga0207681_10179096 Ga0207681_101790962 318
954 3300025925 Ga0207650_10004120 Ga0207650_100041208 318
955 3300025925 Ga0207650_10007398 Ga0207650_100073986 318
956 3300025925 Ga0207650_10046084 Ga0207650_100460843 318
957 3300025925 Ga0207650_10062060 Ga0207650_100620602 318
958 3300025925 Ga0207650_10163633 Ga0207650_101636332 318
959 3300025926 Ga0207659_10012735 Ga0207659_100127352 318
960 3300025926 Ga0207659_10046936 Ga0207659_100469363 318
961 3300025926 Ga0207659_10053624 Ga0207659_100536243 318
962 3300025926 Ga0207659_10082490 Ga0207659_100824902 318
963 3300025929 Ga0207664_10140989 Ga0207664_101409892 318
964 3300025931 Ga0207644_10007246 Ga0207644_100072466 318
965 3300025931 Ga0207644_10007864 Ga0207644_100078649 318
966 3300025931 Ga0207644_10011531 Ga0207644_100115314 318
967 3300025931 Ga0207644_10025072 Ga0207644_100250723 318
968 3300025931 Ga0207644_10030488 Ga0207644_100304883 318
969 3300025931 Ga0207644_10033338 Ga0207644_100333383 318
970 3300025931 Ga0207644_10154066 Ga0207644_101540662 318
971 3300025931 Ga0207644_10192292 Ga0207644_101922922 318
972 3300025932 Ga0207690_10001079 Ga0207690_100010797 318
973 3300025933 Ga0207706_10000179 Ga0207706_1000017919 318
974 3300025933 Ga0207706_10013481 Ga0207706_100134817 318
975 3300025933 Ga0207706_10092805 Ga0207706_100928053 318
976 3300025933 Ga0207706_10105431 Ga0207706_101054313 318
977 3300025934 Ga0207686_10237880 Ga0207686_102378801 318
978 3300025935 Ga0207709_10224536 Ga0207709_102245362 318
979 3300025936 Ga0207670_10020062 Ga0207670_100200622 318
980 3300025937 Ga0207669_10000479 Ga0207669_1000047912 318
981 3300025937 Ga0207669_10001512 Ga0207669_100015125 318
982 3300025937 Ga0207669_10007275 Ga0207669_100072756 318
983 3300025937 Ga0207669_10184135 Ga0207669_101841351 318
984 3300025938 Ga0207704_10003830 Ga0207704_100038309 318
985 3300025938 Ga0207704_10204426 Ga0207704_102044262 318
986 3300025940 Ga0207691_10000367 Ga0207691_1000036711 318
987 3300025940 Ga0207691_10005253 Ga0207691_100052533 318
988 3300025940 Ga0207691_10005358 Ga0207691_1000535812 318
989 3300025940 Ga0207691_10005440 Ga0207691_100054402 318
990 3300025940 Ga0207691_10037005 Ga0207691_100370051 318
991 3300025940 Ga0207691_10048155 Ga0207691_100481553 318
992 3300025941 Ga0207711_10004403 Ga0207711_100044034 318
993 3300025941 Ga0207711_10063437 Ga0207711_100634373 318
994 3300025941 Ga0207711_10228731 Ga0207711_102287311 318
995 3300025942 Ga0207689_10005338 Ga0207689_100053388 318
996 3300025944 Ga0207661_10031272 Ga0207661_100312723 318
997 3300025945 Ga0207679_10011022 Ga0207679_100110227 318
998 3300025945 Ga0207679_10030380 Ga0207679_100303803 318
999 3300025945 Ga0207679_10080294 Ga0207679_100802942 318
1000 3300025949 Ga0207667_10009084 Ga0207667_100090845 318
1001 3300025960 Ga0207651_10001412 Ga0207651_100014122 318
1002 3300025960 Ga0207651_10001584 Ga0207651_100015841 318
1003 3300025960 Ga0207651_10008282 Ga0207651_100082823 318
1004 3300025960 Ga0207651_10055636 Ga0207651_100556363 318
1005 3300025972 Ga0207668_10000795 Ga0207668_100007959 318
1006 3300025972 Ga0207668_10125349 Ga0207668_101253493 318
1007 3300025981 Ga0207640_10053914 Ga0207640_100539143 318
1008 3300025981 Ga0207640_10321683 Ga0207640_103216832 318
1009 3300025986 Ga0207658_10019704 Ga0207658_100197043 318
1010 3300025986 Ga0207658_10023944 Ga0207658_100239443 318
1011 3300025986 Ga0207658_10100428 Ga0207658_101004283 318
1012 3300026023 Ga0207677_10003006 Ga0207677_100030064 318
1013 3300026023 Ga0207677_10027131 Ga0207677_100271313 318
1014 3300026023 Ga0207677_10046801 Ga0207677_100468011 318
1015 3300026023 Ga0207677_10117436 Ga0207677_101174363 318
1016 3300026035 Ga0207703_10032102 Ga0207703_100321024 318
1017 3300026035 Ga0207703_10078747 Ga0207703_100787472 318
1018 3300026035 Ga0207703_10126999 Ga0207703_101269992 318
1019 3300026041 Ga0207639_10004490 Ga0207639_100044905 318
1020 3300026067 Ga0207678_10007687 Ga0207678_100076875 318
1021 3300026067 Ga0207678_10013948 Ga0207678_100139483 318
1022 3300026067 Ga0207678_10032954 Ga0207678_100329545 318
1023 3300026067 Ga0207678_10225597 Ga0207678_102255972 318
1024 3300026075 Ga0207708_10013661 Ga0207708_100136616 318
1025 3300026078 Ga0207702_10000997 Ga0207702_1000099711 318
1026 3300026088 Ga0207641_10006864 Ga0207641_100068649 318
1027 3300026088 Ga0207641_10015622 Ga0207641_100156228 318
1028 3300026088 Ga0207641_10114735 Ga0207641_101147352 318
1029 3300026088 Ga0207641_10166582 Ga0207641_101665823 318
1030 3300026089 Ga0207648_10002589 Ga0207648_1000258910 318
1031 3300026089 Ga0207648_10003625 Ga0207648_100036256 318
1032 3300026089 Ga0207648_10004483 Ga0207648_100044836 318
1033 3300026089 Ga0207648_10004957 Ga0207648_100049573 318
1034 3300026089 Ga0207648_10061795 Ga0207648_100617952 318
1035 3300026095 Ga0207676_10000825 Ga0207676_1000082514 318
1036 3300026095 Ga0207676_10005307 Ga0207676_100053077 318
1037 3300026095 Ga0207676_10031603 Ga0207676_100316033 318
1038 3300026116 Ga0207674_10011739 Ga0207674_100117393 318
1039 3300026116 Ga0207674_10111391 Ga0207674_101113912 318
1040 3300026118 Ga0207675_100006052 Ga0207675_1000060528 318
1041 3300026121 Ga0207683_10000246 Ga0207683_1000024633 318
1042 3300026121 Ga0207683_10003698 Ga0207683_100036987 318
1043 3300026121 Ga0207683_10008758 Ga0207683_100087587 318
1044 3300026121 Ga0207683_10029899 Ga0207683_100298993 318
1045 3300026121 Ga0207683_10064281 Ga0207683_100642813 318
1046 3300026142 Ga0207698_10015622 Ga0207698_100156223 318
1047 3300026142 Ga0207698_10066304 Ga0207698_100663043 318
1048 3300027364 Ga0209967_1015869 Ga0209967_10158691 318
1049 3300027471 Ga0209995_1003012 Ga0209995_10030122 318
1050 3300027665 Ga0209983_1010008 Ga0209983_10100083 318
1051 3300027682 Ga0209971_1000713 Ga0209971_10007137 318
1052 3300027717 Ga0209998_10004220 Ga0209998_100042202 318
1053 3300027876 Ga0209974_10002500 Ga0209974_100025006 318
1054 3300027876 Ga0209974_10003146 Ga0209974_100031465 318
1055 3300028379 Ga0268266_10005957 Ga0268266_100059576 318
1056 3300028379 Ga0268266_10074066 Ga0268266_100740663 318
1057 3300028381 Ga0268264_10109945 Ga0268264_101099452 318
1058 3300028794 Ga0307515_10221879 Ga0307515_102218792 318
1059 3300031548 Ga0307408_100004292 Ga0307408_1000042927 318
1060 3300031548 Ga0307408_100004313 Ga0307408_1000043137 318
1061 3300031731 Ga0307405_10000798 Ga0307405_100007986 318
1062 3300031731 Ga0307405_10032492 Ga0307405_100324922 318
1063 3300031731 Ga0307405_10107382 Ga0307405_101073823 318
1064 3300031824 Ga0307413_10015713 Ga0307413_100157132 318
1065 3300031852 Ga0307410_10004000 Ga0307410_100040006 318
1066 3300031852 Ga0307410_10008979 Ga0307410_100089793 318
1067 3300031901 Ga0307406_10002619 Ga0307406_100026197 318
1068 3300031901 Ga0307406_10022292 Ga0307406_100222921 318
1069 3300031901 Ga0307406_10211595 Ga0307406_102115951 318
1070 3300031903 Ga0307407_10022005 Ga0307407_100220053 318
1071 3300031903 Ga0307407_10026461 Ga0307407_100264613 318
1072 3300031911 Ga0307412_10005668 Ga0307412_100056683 318
1073 3300031911 Ga0307412_10158755 Ga0307412_101587552 318
1074 3300031911 Ga0307412_10311269 Ga0307412_103112691 318
1075 3300031995 Ga0307409_100020265 Ga0307409_1000202652 318
1076 3300031995 Ga0307409_100340591 Ga0307409_1003405911 318
1077 3300031995 Ga0307409_100383269 Ga0307409_1003832691 318
1078 3300032002 Ga0307416_100005156 Ga0307416_1000051567 318
1079 3300032002 Ga0307416_100051067 Ga0307416_1000510672 318
1080 3300032002 Ga0307416_100152318 Ga0307416_1001523181 318
1081 3300032004 Ga0307414_10005736 Ga0307414_100057363 318
1082 3300032004 Ga0307414_10019419 Ga0307414_100194193 318
1083 3300032005 Ga0307411_10000231 Ga0307411_100002313 318
1084 3300032005 Ga0307411_10009176 Ga0307411_100091763 318
1085 3300032126 Ga0307415_100239065 Ga0307415_1002390652 318
1086 3300035170 Ga0373943_0153517 Ga0373943_0153517_248_1210 318
1087 3300035691 Ga0373931_0013999 Ga0373931_0013999_1631_2593 318
1088 3300035725 Ga0373947_0022154 Ga0373947_0022154_1115_2077 318
1089 3300039062 Ga0400483_168565 Ga0400483_168565_476_1456 318
1090 3300041404 Ga0439436_0013957 Ga0439436_0013957_1401_2372 318
1091 3300041406 Ga0439439_0002414 Ga0439439_0002414_1640_2611 318
1092 3300041407 Ga0439447_008745 Ga0439447_008745_302_1273 318
1093 3300041407 Ga0439447_024482 Ga0439447_024482_185_1156 318
1094 3300041411 Ga0439466_0008563 Ga0439466_0008563_1887_2858 318
1095 3300041413 Ga0439465_0034194 Ga0439465_0034194_112_1083 318
1096 3300041999 Ga0439433_0002940 Ga0439433_0002940_2498_3505 318
1097 3300042002 Ga0439442_010918 Ga0439442_010918_115_1086 318
1098 3300042004 Ga0439445_0005099 Ga0439445_0005099_929_1900 318
1099 3300042007 Ga0439449_0005349 Ga0439449_0005349_3493_4494 318
1100 3300042007 Ga0439449_0007053 Ga0439449_0007053_112_1119 318
1101 3300042014 Ga0439457_014543 Ga0439457_014543_590_1561 318
1102 3300042015 Ga0439462_0005125 Ga0439462_0005125_515_1486 318
1103 3300042015 Ga0439462_0005627 Ga0439462_0005627_1630_2601 318
1104 3300042115 Ga0450911_000678 Ga0450911_000678_6990_7961 318
1105 3300042133 Ga0450896_007298 Ga0450896_007298_369_1340 318
1106 3300042134 Ga0450898_017877 Ga0450898_017877_136_1107 318
1107 3300042145 Ga0450906_005292 Ga0450906_005292_334_1305 318
1108 3300042156 Ga0439446_0002184 Ga0439446_0002184_131_1138 318
1109 3300042156 Ga0439446_0019201 Ga0439446_0019201_33_1004 318
1110 3300042435 Ga0439434_0006656 Ga0439434_0006656_338_1309 318
1111 3300042435 Ga0439434_0019991 Ga0439434_0019991_110_1081 318
1112 3300042532 Ga0450893_0012858 Ga0450893_0012858_46_1017 318
1113 3300042876 Ga0451577_0119122 Ga0451577_0119122_479_1447 318
1114 3300042876 Ga0451577_0375563 Ga0451577_0375563_288_1256 318
1115 3300044683 Ga0466965_0006030 Ga0466965_0006030_3494_4465 318
1116 3300046539 Ga0495621_0021883 Ga0495621_0021883_706_1668 318
1117 3300047472 Ga0495686_0000872 Ga0495686_0000872_18749_19717 318
1118 3300048904 Ga0496101_0009890 Ga0496101_0009890_1323_2285 318
1119 3300048904 Ga0496101_0203037 Ga0496101_0203037_531_1493 318
1120 3300048905 Ga0496102_0001475 Ga0496102_0001475_1642_2604 318
1121 3300048906 Ga0496103_0032431 Ga0496103_0032431_773_1735 318
1122 3300048907 Ga0496104_0032233 Ga0496104_0032233_3686_4648 318
1123 3300048908 Ga0496105_0021713 Ga0496105_0021713_4083_5045 318
1124 3300048909 Ga0496106_0010786 Ga0496106_0010786_3916_4878 318
1125 3300048909 Ga0496106_0019068 Ga0496106_0019068_1912_2874 318
1126 3300048910 Ga0496107_0064875 Ga0496107_0064875_1519_2481 318
1127 3300048910 Ga0496107_0075397 Ga0496107_0075397_300_1262 318
1128 3300048911 Ga0496108_0020796 Ga0496108_0020796_4071_5033 318
1129 3300048912 Ga0496109_0019144 Ga0496109_0019144_1105_2067 318
1130 3300048912 Ga0496109_0133117 Ga0496109_0133117_779_1741 318
1131 3300048915 Ga0496112_0431009 Ga0496112_0431009_161_1123 318
1132 3300048917 Ga0496114_0040324 Ga0496114_0040324_1387_2349 318
1133 3300048924 Ga0496121_0003212 Ga0496121_0003212_18688_19668 318
1134 3300048927 Ga0496124_0037994 Ga0496124_0037994_1010_1981 318
1135 3300048927 Ga0496124_0039236 Ga0496124_0039236_2415_3386 318
1136 3300048928 Ga0496125_0001798 Ga0496125_0001798_6498_7469 318
1137 3300048928 Ga0496125_0044295 Ga0496125_0044295_1156_2127 318
1138 3300048929 Ga0496126_0208509 Ga0496126_0208509_661_1632 318
1139 3300049570 Ga0501033_0243036 Ga0501033_0243036_196_1164 318
1140 3300049572 Ga0501036_0210526 Ga0501036_0210526_585_1562 318
1141 3300049575 Ga0501039_0037529 Ga0501039_0037529_520_1488 318
1142 3300049577 Ga0501041_0016961 Ga0501041_0016961_1068_2036 318
1143 3300049578 Ga0501042_0140638 Ga0501042_0140638_30_998 318
1144 3300049580 Ga0501046_0101693 Ga0501046_0101693_384_1379 318
1145 3300049582 Ga0501048_0095246 Ga0501048_0095246_274_1242 318
1146 3300049584 Ga0501068_0090097 Ga0501068_0090097_140_1108 318
1147 3300049587 Ga0501071_0046072 Ga0501071_0046072_295_1263 318
1148 3300049588 Ga0501072_0167568 Ga0501072_0167568_562_1539 318
1149 3300049592 Ga0501076_0039282 Ga0501076_0039282_2283_3251 318
1150 3300049741 Ga0501079_0022089 Ga0501079_0022089_2869_3837 318
1151 3300049743 Ga0501081_0034661 Ga0501081_0034661_98_1066 318
1152 3300049743 Ga0501081_0194192 Ga0501081_0194192_202_1179 318
1153 3300049744 Ga0501083_0103814 Ga0501083_0103814_820_1788 318
1154 3300049824 Ga0501045_0012716 Ga0501045_0012716_4229_5197 318
1155 3300050489 nmdc:mga03683_37606_c1 nmdc:mga03683_37606_c1_489_1460 318
1156 3300050511 nmdc:mga08y16_68497_c1 nmdc:mga08y16_68497_c1_2293_3255 318
1157 3300053136 Ga0500559_0003779 Ga0500559_0003779_1714_2685 318
1158 3300053136 Ga0500559_0108354 Ga0500559_0108354_254_1225 318
1159 3300054114 Ga0501084_0016085 Ga0501084_0016085_1009_1977 318
1160 3300054114 Ga0501084_0263216 Ga0501084_0263216_119_1096 318
1161 3300060353 Ga0501082_0014180 Ga0501082_0014180_5554_6522 318
1162 3300061734 Ga0530510_0214214 Ga0530510_0214214_172_1149 318
1163 3300061734 Ga0530510_0300536 Ga0530510_0300536_198_1166 318
1164 iso_pu_bacteria 2643221651 2644291400 318
1165 iso_pu_bacteria 2643221654 2644301302 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

97

371

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9384 24 315
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9356 28 316
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9245 24 316
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9158 23 312
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9143 24 315
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9319 118 235 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9083 118 237 3.40.190.10
4x9tA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9031 24 312 3.40.190.150
2f5xC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8999 24 316 3.40.190.150
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8875 23 312 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A1Y1S0I1-F1-model_v4 ABC transporter substrate-binding protein 0.9572 23 313
AF-A0A1B2R0B6-F1-model_v4 ABC transporter substrate-binding protein 0.9547 19 316
AF-A0A844TKW8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.954 19 318
AF-A0A1I5TAT0-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.9499 19 315
AF-A0A536ZN56-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9497 19 316

Feature Viewer

pLDDT pTM Quality
92.38 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map