metagRoot

F491041

General Info

Members	Datasets	Scaffolds	Average Seq Length
1163	510	1110	252

Family's Representative Sequence

Representative Sequence	3300042138\|Ga0450903_001471\|Ga0450903_001471_590_1456
Length	288
Sequence	LVKARDDPRRCAGAAGAGAVHRCPGRFLYDHGMNPFVQPGARCALSVNVNKVALLRNTRHLGIPSVLRAAEQCLAAGAQGITVHPRPDARHIREGDVRDLHALLKQWPQAEFNIEGNPFHNLMDFVRELRPHQCTFVPDSEGQFTSDHGWDLAKDGERVKLLIAEAKSLGVRVSLFMDAEPAAMPLAKAVGADRVELYTEPYAAAWGTPRRQQELQRFADAARAAQAAGLGVNAGHDLSRDNLADFLRAVPGVLEVSIGHALIADALELGYAATVRQYLDAIAGSARP

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
3	2522125168	Dyadobacter beijingensis DSM 21582	Isolate	Rhizosphere
4	2547132374	Acidovorax radicis N35	Isolate	Unclassified
5	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
6	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
7	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
8	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
9	2643221570	Acidovorax sp. Root568	Isolate	Unclassified
10	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
11	2643221652	Acidovorax sp. Root402	Isolate	Unclassified
12	2643221658	Variovorax sp. Root411	Isolate	Unclassified
13	2643221672	Variovorax sp. Root434	Isolate	Unclassified
14	2643221683	Variovorax sp. Root473	Isolate	Unclassified
15	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
16	2721755523	Delftia sp. HK171	Isolate	Unclassified
17	2738541277	Variovorax sp. GV051	Isolate	Unclassified
18	2738541307	Variovorax sp. GV008	Isolate	Unclassified
19	2738543013	Variovorax sp. BT01	Isolate	Unclassified
20	2738543019	Variovorax sp. GV040	Isolate	Unclassified
21	2818991446	Variovorax sp. 1180	Isolate	Unclassified
22	2839138175	Delftia acidovorans B15	Isolate	Rhizosphere
23	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
24	2842718218	Acidovorax sp. R-73343	Isolate	Unclassified
25	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
26	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
27	2881101125	Ramlibacter rhizophilus CCTCC AB2015357	Isolate	Rhizosphere
28	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
29	2885211737	Variovorax sp. 553	Isolate	Unclassified
30	2894023352	Diaphorobacter ruginosibacter DSM 27467	Isolate	Nodule
31	2899924645	Variovorax sp. 369	Isolate	Unclassified
32	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
33	2904456579	Variovorax sp. 2002	Isolate	Unclassified
34	2904479285	Comamonas sediminis 4487	Isolate	Rhizosphere
35	2911138879	Spirosoma sp. KUDC1026	Isolate	Rhizosphere
36	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
37	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
38	2928037797	Variovorax sp. 1126	Isolate	Unclassified
39	2928044640	Variovorax sp. 1128	Isolate	Unclassified
40	2928051484	Variovorax sp. 1133	Isolate	Unclassified
41	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
42	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
43	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
44	2928115317	Pseudacidovorax sp. 1753	Isolate	Rhizosphere
45	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
46	2932422444	Comamonas sp. 4034	Isolate	Rhizosphere
47	2939631187	Ottowia thiooxydans 2709	Isolate	Rhizosphere
48	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
49	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
50	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
51	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
52	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
53	2974320154	Acidovorax wautersii SORGH_AS 335	Isolate	Unclassified
54	2990710928	Acidovorax delafieldii SLBN-75	Isolate	Rhizosphere
55	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
56	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
57	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
58	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
59	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
60	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
61	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
62	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
63	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
64	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
65	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
66	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
67	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
68	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
69	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
70	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
71	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
72	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
73	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
74	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
75	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
76	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
77	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
78	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
79	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
80	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
81	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
82	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
83	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
84	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
85	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
86	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
87	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
88	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
89	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
90	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
91	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
92	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
93	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
94	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
95	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
96	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
97	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
98	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
99	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
100	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
101	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
102	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
103	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
104	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
105	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
106	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
107	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
108	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
109	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
110	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
111	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
112	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
113	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
114	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
115	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
116	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
117	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
118	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
119	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
120	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
121	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
122	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
123	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
124	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
125	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
126	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
127	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
128	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
129	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
130	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
131	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
132	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
133	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
134	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
135	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
136	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
137	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
138	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
139	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
140	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
141	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
142	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
143	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
144	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
145	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
146	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
147	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
148	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
149	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
150	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
151	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
152	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
153	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
154	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
155	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
156	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
157	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
158	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
159	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
160	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
161	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
162	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
163	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
164	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
165	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
166	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
167	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
168	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
169	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
170	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
171	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
172	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
173	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
174	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
175	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
176	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
177	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
178	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
179	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
180	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
181	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
182	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
183	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
184	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
185	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
186	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
187	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
188	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
189	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
190	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
191	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
192	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
193	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
194	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
195	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
196	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
197	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
198	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
199	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
200	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
201	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
202	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
203	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
204	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
205	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
206	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
207	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
208	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
209	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
210	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
211	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
212	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
213	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
271	3300027252	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
275	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
276	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
280	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
281	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
282	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
283	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
284	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
285	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
286	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
287	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
288	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
289	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
290	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
291	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
292	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
293	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
294	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
295	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
296	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
297	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
298	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
299	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
300	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
301	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
302	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
303	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
304	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
305	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
306	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
307	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
308	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
309	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
310	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
311	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
312	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
313	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
314	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
315	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
316	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
317	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
318	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
319	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
320	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
321	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
322	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
323	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
324	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
325	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
326	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
327	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
328	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
329	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
330	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
331	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
332	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
333	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
334	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
335	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
336	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
337	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
338	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
339	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
340	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
341	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
342	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
343	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
344	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
345	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
346	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
347	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
348	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
349	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
350	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
351	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
352	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
353	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
354	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
355	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
356	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
357	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
358	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
359	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
360	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
361	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
362	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
363	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
364	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
365	3300042128	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123	Metagenome	Rhizosphere
366	3300042129	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95	Metagenome	Rhizosphere
367	3300042130	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97	Metagenome	Rhizosphere
368	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
369	3300042132	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133	Metagenome	Rhizosphere
370	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
371	3300042135	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127	Metagenome	Rhizosphere
372	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
373	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
374	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
375	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
376	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
377	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
378	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
379	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
380	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
381	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
382	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
383	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
384	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
385	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
386	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
387	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
388	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
389	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
390	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
391	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
392	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
393	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
394	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
395	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
396	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
397	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
398	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
399	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
400	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
401	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
402	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
403	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
404	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
405	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
406	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
407	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
408	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
409	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
410	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
411	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
412	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
413	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
414	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
415	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
416	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
417	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
418	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
419	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
420	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
421	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
422	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
423	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
424	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
425	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
426	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
427	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
428	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
429	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
430	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
431	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
432	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
433	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
434	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
435	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
436	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
437	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
438	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
439	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
440	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
441	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
442	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
443	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
444	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
445	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
446	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
447	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
448	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
449	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
450	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
451	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
452	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
453	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
454	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
455	3300049654	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control	Metagenome	Rhizosphere
456	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
457	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
458	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
459	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
460	3300049688	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought	Metagenome	Rhizosphere
461	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
462	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
463	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
464	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
465	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
466	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
467	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
468	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
469	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
470	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
471	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
472	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
473	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
474	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
475	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
476	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
477	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
478	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
479	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
480	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
481	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
482	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
483	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
484	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
485	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
486	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
487	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
488	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
489	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
490	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
491	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
492	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
493	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
494	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
495	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
496	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
497	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
498	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
499	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
500	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
501	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
502	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
503	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
504	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
505	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
506	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
507	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
508	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
509	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
510	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	95.27
Metatranscriptomes	0.17
Isolates	4.56

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	17.54
Nodule	0.52
Rhizoplane	2.06
Rhizosphere	70.59
Stem	0
Stem Tuber	0
Unclassified	9.29

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_1036878	2162886007	Bacteria	954
2	JGI24740J21852_10031024	3300001979	Bacteria	1730
3	JGI24735J21928_10044636	3300002067	Bacteria	1288
4	JGI25158J39367_1009797	3300002739	Bacteria	1306
5	JGI25152J39213_1002179	3300002773	Bacteria	7668
6	JGI25150J39212_1003727	3300002774	Bacteria	3516
7	JGI25159J45721_1002209	3300002987	Bacteria	7541
8	JGI25151J46595_10003194	3300003187	Bacteria	9182
9	JGI25151J46595_10019329	3300003187	Bacteria	2896
10	JGI25151J46595_10074619	3300003187	Bacteria	1010
11	rootH1_10000267	3300003316	Bacteria	12785
12	rootH1_10073277	3300003316	Bacteria	1571
13	rootH2_10025884	3300003320	Bacteria	23481
14	rootH2_10088503	3300003320	Bacteria	1310
15	rootL2_10007616	3300003322	Bacteria	4111
16	rootH1_10093616	3300003323	Bacteria	7426
17	rootH1_10209635	3300003323	Bacteria	1832
18	JGI25160J50197_1012763	3300003354	Bacteria	2896
19	JGI25160J50197_1013248	3300003354	Bacteria	2820
20	JGI25161J50226_1004084	3300003374	Bacteria	3142
21	Ga0006562J51391_1088777	3300003578	Bacteria	3949
22	Ga0006562J51391_1088780	3300003578	Bacteria	2400
23	Ga0055525_1000004	3300003759	Bacteria	888039
24	Ga0055535_1000318	3300003761	Bacteria	48605
25	Ga0055542_1000022	3300003762	Bacteria	302315
26	Ga0055526_1015326	3300003771	Bacteria	3084
27	Ga0055537_1000881	3300003773	Bacteria	14293
28	Ga0055537_1006182	3300003773	Bacteria	3084
29	Ga0055537_1009896	3300003773	Bacteria	2059
30	Ga0055524_1013445	3300003775	Bacteria	3085
31	Ga0055524_1013457	3300003775	Bacteria	3084
32	Ga0055536_1005218	3300003781	Bacteria	6411
33	Ga0055536_1014919	3300003781	Bacteria	2692
34	Ga0055534_1000614	3300003784	Bacteria	18415
35	Ga0055534_1000826	3300003784	Bacteria	14293
36	Ga0055534_1002108	3300003784	Bacteria	7140
37	Ga0055528_1003272	3300003790	Bacteria	8244
38	Ga0055528_1013529	3300003790	Bacteria	3084
39	Ga0055540_1002475	3300003792	Bacteria	9708
40	Ga0055540_1015657	3300003792	Bacteria	2194
41	Ga0055531_10000730	3300003794	Bacteria	27806
42	Ga0055531_10010242	3300003794	Bacteria	4686
43	Ga0055543_1001710	3300004625	Bacteria	8275
44	Ga0055543_1001757	3300004625	Bacteria	8100
45	Ga0065165_1000083	3300005262	Bacteria	156204
46	Ga0065165_1004672	3300005262	Bacteria	8275
47	Ga0065165_1030189	3300005262	Bacteria	1728
48	Ga0065165_1051348	3300005262	Bacteria	1169
49	Ga0065714_10005438	3300005288	Bacteria	4585
50	Ga0065704_10082448	3300005289	Bacteria	3596
51	Ga0065704_10094233	3300005289	Bacteria	2554
52	Ga0070658_10002038	3300005327	Bacteria	16943
53	Ga0070658_10143973	3300005327	Bacteria	1992
54	Ga0070658_10177081	3300005327	Bacteria	1794
55	Ga0070676_10071093	3300005328	Bacteria	2089
56	Ga0070683_100000397	3300005329	Bacteria	30109
57	Ga0070683_100013208	3300005329	Bacteria	7194
58	Ga0070690_100010179	3300005330	Bacteria	5463
59	Ga0070690_100147117	3300005330	Bacteria	1604
60	Ga0070670_100008161	3300005331	Bacteria	8917
61	Ga0070670_100011039	3300005331	Bacteria	7718
62	Ga0070670_100508468	3300005331	Bacteria	1072
63	Ga0070677_10014642	3300005333	Bacteria	2765
64	Ga0070677_10069684	3300005333	Bacteria	1476
65	Ga0068869_100006018	3300005334	Bacteria	7673
66	Ga0068869_100009303	3300005334	Bacteria	6373
67	Ga0068869_100011326	3300005334	Bacteria	5844
68	Ga0068869_100057537	3300005334	Bacteria	2839
69	Ga0068869_100245042	3300005334	Bacteria	1429
70	Ga0068869_100589447	3300005334	Bacteria	938
71	Ga0070666_10005842	3300005335	Bacteria	7558
72	Ga0070666_10023270	3300005335	Bacteria	4033
73	Ga0070680_100023614	3300005336	Bacteria	4906
74	Ga0068868_100025650	3300005338	Bacteria	4486
75	Ga0068868_100036822	3300005338	Bacteria	3790
76	Ga0068868_100050975	3300005338	Bacteria	3253
77	Ga0068868_100078920	3300005338	Bacteria	2636
78	Ga0068868_100488522	3300005338	Bacteria	1077
79	Ga0070660_100048463	3300005339	Bacteria	3264
80	Ga0070660_100055247	3300005339	Bacteria	3068
81	Ga0070660_100062582	3300005339	Bacteria	2891
82	Ga0070689_100000005	3300005340	Bacteria	396551
83	Ga0070689_100054759	3300005340	Bacteria	3089
84	Ga0070691_10089834	3300005341	Bacteria	1513
85	Ga0070691_10105152	3300005341	Bacteria	1406
86	Ga0070687_100123949	3300005343	Bacteria	1482
87	Ga0070661_100040077	3300005344	Bacteria	3415
88	Ga0070661_100091319	3300005344	Bacteria	2255
89	Ga0070661_100201590	3300005344	Bacteria	1520
90	Ga0070668_100011100	3300005347	Bacteria	6705
91	Ga0070668_100039496	3300005347	Bacteria	3609
92	Ga0070668_100483787	3300005347	Bacteria	1069
93	Ga0070669_100008914	3300005353	Bacteria	7156
94	Ga0070669_100036533	3300005353	Bacteria	3560
95	Ga0070669_100129958	3300005353	Bacteria	1931
96	Ga0070675_100004779	3300005354	Bacteria	10332
97	Ga0070675_100010417	3300005354	Bacteria	7263
98	Ga0070675_100011548	3300005354	Bacteria	6918
99	Ga0070675_100017314	3300005354	Bacteria	5725
100	Ga0070675_100633764	3300005354	Bacteria	971
101	Ga0070671_100035021	3300005355	Bacteria	4158
102	Ga0070671_100159230	3300005355	Bacteria	1908
103	Ga0070674_100004964	3300005356	Bacteria	7624
104	Ga0070674_100289990	3300005356	Bacteria	1300
105	Ga0070673_100048394	3300005364	Bacteria	3314
106	Ga0070673_100050422	3300005364	Bacteria	3255
107	Ga0070673_100191216	3300005364	Bacteria	1758
108	Ga0070688_100068293	3300005365	Bacteria	2266
109	Ga0070688_100186188	3300005365	Bacteria	1443
110	Ga0070688_100209042	3300005365	Bacteria	1369
111	Ga0070659_100005335	3300005366	Bacteria	9220
112	Ga0070659_100025278	3300005366	Bacteria	4558
113	Ga0070659_100111479	3300005366	Bacteria	2208
114	Ga0070659_100174063	3300005366	Bacteria	1765
115	Ga0070659_100307267	3300005366	Bacteria	1324
116	Ga0070667_100015048	3300005367	Bacteria	6392
117	Ga0070667_100016760	3300005367	Bacteria	6063
118	Ga0070667_100039535	3300005367	Bacteria	3954
119	Ga0070667_100326564	3300005367	Bacteria	1385
120	Ga0070667_100377520	3300005367	Bacteria	1287
121	Ga0070667_100500367	3300005367	Bacteria	1114
122	Ga0070714_100036152	3300005435	Bacteria	4142
123	Ga0070713_100221378	3300005436	Bacteria	1717
124	Ga0070708_100135375	3300005445	Bacteria	2282
125	Ga0070663_100023633	3300005455	Bacteria	4122
126	Ga0070663_100064518	3300005455	Bacteria	2647
127	Ga0070678_100060993	3300005456	Bacteria	2779
128	Ga0070678_100134075	3300005456	Bacteria	1972
129	Ga0070662_100012119	3300005457	Bacteria	5708
130	Ga0070662_100028703	3300005457	Bacteria	3874
131	Ga0070681_10008306	3300005458	Bacteria	10166
132	Ga0070681_10085425	3300005458	Bacteria	3108
133	Ga0068867_100000143	3300005459	Bacteria	45972
134	Ga0068867_100020479	3300005459	Bacteria	4714
135	Ga0068867_100031764	3300005459	Bacteria	3815
136	Ga0068867_100141831	3300005459	Bacteria	1879
137	Ga0068867_100431013	3300005459	Bacteria	1119
138	Ga0070685_10278376	3300005466	Bacteria	1119
139	Ga0070685_10450847	3300005466	Bacteria	901
140	Ga0070706_100648467	3300005467	Bacteria	980
141	Ga0070699_100182579	3300005518	Bacteria	1862
142	Ga0070679_100016306	3300005530	Bacteria	7160
143	Ga0070679_100042059	3300005530	Bacteria	4550
144	Ga0070684_100124826	3300005535	Bacteria	2318
145	Ga0070684_100187966	3300005535	Bacteria	1879
146	Ga0068853_100015746	3300005539	Bacteria	6211
147	Ga0068853_100018186	3300005539	Bacteria	5813
148	Ga0068853_100056523	3300005539	Bacteria	3384
149	Ga0068853_100921568	3300005539	Bacteria	840
150	Ga0070672_100007063	3300005543	Bacteria	7594
151	Ga0070672_100010437	3300005543	Bacteria	6445
152	Ga0070672_100128528	3300005543	Bacteria	2080
153	Ga0070686_100147071	3300005544	Bacteria	1646
154	Ga0070695_100296187	3300005545	Bacteria	1194
155	Ga0070693_100060705	3300005547	Bacteria	2195
156	Ga0070693_100234629	3300005547	Bacteria	1209
157	Ga0070665_100137822	3300005548	Bacteria	2443
158	Ga0068855_100000030	3300005563	Bacteria	171124
159	Ga0068855_100048944	3300005563	Bacteria	4987
160	Ga0068855_100121807	3300005563	Bacteria	2985
161	Ga0068855_100155862	3300005563	Bacteria	2595
162	Ga0070664_100016787	3300005564	Bacteria	6008
163	Ga0070664_100019897	3300005564	Bacteria	5525
164	Ga0068857_100117751	3300005577	Bacteria	2390
165	Ga0068857_100332951	3300005577	Bacteria	1403
166	Ga0068854_100034035	3300005578	Bacteria	3556
167	Ga0068854_100043140	3300005578	Bacteria	3195
168	Ga0068856_100009753	3300005614	Bacteria	9329
169	Ga0068856_100053806	3300005614	Bacteria	3969
170	Ga0068856_100221898	3300005614	Bacteria	1905
171	Ga0068856_100374911	3300005614	Bacteria	1442
172	Ga0068856_100648483	3300005614	Bacteria	1076
173	Ga0070702_100013522	3300005615	Bacteria	4121
174	Ga0068852_100013743	3300005616	Bacteria	6205
175	Ga0068852_100017004	3300005616	Bacteria	5694
176	Ga0068852_100069757	3300005616	Bacteria	3082
177	Ga0068852_100075824	3300005616	Bacteria	2968
178	Ga0068852_100108424	3300005616	Bacteria	2520
179	Ga0068852_100390209	3300005616	Bacteria	1367
180	Ga0068852_101015779	3300005616	Bacteria	848
181	Ga0068864_100009971	3300005618	Bacteria	7838
182	Ga0068864_100020710	3300005618	Bacteria	5504
183	Ga0068864_100032590	3300005618	Bacteria	4428
184	Ga0068864_100037444	3300005618	Bacteria	4140
185	Ga0068864_100045557	3300005618	Bacteria	3762
186	Ga0068866_10002843	3300005718	Bacteria	7136
187	Ga0068861_100001754	3300005719	Bacteria	13938
188	Ga0068861_100016460	3300005719	Bacteria	5234
189	Ga0068861_100089193	3300005719	Bacteria	2430
190	Ga0068861_100135613	3300005719	Bacteria	2002
191	Ga0068851_10061367	3300005834	Bacteria	1927
192	Ga0068851_10078933	3300005834	Bacteria	1716
193	Ga0068851_10352277	3300005834	Bacteria	857
194	Ga0068863_100008147	3300005841	Bacteria	10232
195	Ga0068863_100020787	3300005841	Bacteria	6269
196	Ga0068863_100104364	3300005841	Bacteria	2696
197	Ga0068863_100203348	3300005841	Bacteria	1906
198	Ga0068863_100329233	3300005841	Bacteria	1485
199	Ga0068863_100549139	3300005841	Bacteria	1141
200	Ga0068858_100009976	3300005842	Bacteria	9020
201	Ga0068858_100024249	3300005842	Bacteria	5653
202	Ga0068858_100029185	3300005842	Bacteria	5121
203	Ga0068858_100032464	3300005842	Bacteria	4847
204	Ga0068860_100010210	3300005843	Bacteria	9293
205	Ga0068860_100012046	3300005843	Bacteria	8517
206	Ga0068860_100173567	3300005843	Bacteria	2083
207	Ga0068862_100020780	3300005844	Bacteria	5484
208	Ga0081539_10024526	3300005985	Bacteria	3909
209	Ga0075365_10007752	3300006038	Bacteria	6044
210	Ga0075365_10026590	3300006038	Bacteria	3675
211	Ga0075365_10050774	3300006038	Bacteria	2737
212	Ga0075365_10117294	3300006038	Bacteria	1833
213	Ga0075368_10005874	3300006042	Bacteria	4249
214	Ga0075368_10139736	3300006042	Bacteria	1009
215	Ga0075363_100009000	3300006048	Bacteria	4679
216	Ga0075363_100031433	3300006048	Bacteria	2753
217	Ga0075363_100046125	3300006048	Bacteria	2311
218	Ga0075364_10028222	3300006051	Bacteria	3591
219	Ga0075364_10151893	3300006051	Bacteria	1561
220	Ga0075432_10034197	3300006058	Bacteria	1764
221	Ga0075362_10022360	3300006177	Bacteria	2664
222	Ga0075362_10032078	3300006177	Bacteria	2277
223	Ga0075362_10032934	3300006177	Bacteria	2252
224	Ga0075362_10033663	3300006177	Bacteria	2230
225	Ga0075362_10082115	3300006177	Bacteria	1487
226	Ga0075367_10010036	3300006178	Bacteria	4963
227	Ga0075367_10013850	3300006178	Bacteria	4351
228	Ga0075367_10189134	3300006178	Bacteria	1285
229	Ga0075366_10009816	3300006195	Bacteria	5354
230	Ga0075366_10017214	3300006195	Bacteria	4157
231	Ga0075366_10021908	3300006195	Bacteria	3715
232	Ga0075366_10023961	3300006195	Bacteria	3558
233	Ga0075366_10032058	3300006195	Bacteria	3093
234	Ga0075366_10041971	3300006195	Bacteria	2709
235	Ga0075366_10080306	3300006195	Bacteria	1947
236	Ga0075366_10201369	3300006195	Bacteria	1211
237	Ga0075366_10222175	3300006195	Bacteria	1151
238	Ga0075366_10223808	3300006195	Bacteria	1146
239	Ga0075366_10275820	3300006195	Bacteria	1027
240	Ga0097621_100041515	3300006237	Bacteria	3703
241	Ga0097621_100116302	3300006237	Bacteria	2264
242	Ga0075370_10015981	3300006353	Bacteria	4031
243	Ga0075370_10042919	3300006353	Bacteria	2555
244	Ga0075370_10052433	3300006353	Bacteria	2314
245	Ga0075370_10067217	3300006353	Bacteria	2046
246	Ga0068871_100005973	3300006358	Bacteria	8569
247	Ga0068871_100006732	3300006358	Bacteria	8160
248	Ga0068871_100149906	3300006358	Unclassified	1988
249	Ga0068871_100153563	3300006358	Bacteria	1964
250	Ga0075430_100141939	3300006846	Bacteria	2000
251	Ga0075430_100520423	3300006846	Bacteria	981
252	Ga0075431_100043478	3300006847	Bacteria	4635
253	Ga0075429_100015687	3300006880	Bacteria	6564
254	Ga0075429_100020001	3300006880	Bacteria	5805
255	Ga0075429_100058629	3300006880	Bacteria	3353
256	Ga0068865_100051731	3300006881	Bacteria	2845
257	Ga0068865_100314215	3300006881	Bacteria	1258
258	Ga0079104_1000002	3300006946	Bacteria	514469
259	Ga0079104_1034992	3300006946	Bacteria	1216
260	Ga0099826_10003829	3300006948	Bacteria	10360
261	Ga0075435_100245154	3300007076	Bacteria	1524
262	Ga0105250_10001857	3300009092	Bacteria	10999
263	Ga0105240_10043762	3300009093	Bacteria	5694
264	Ga0105240_10060597	3300009093	Bacteria	4718
265	Ga0105240_10149162	3300009093	Bacteria	2787
266	Ga0111539_10009683	3300009094	Bacteria	12160
267	Ga0105245_10000712	3300009098	Bacteria	29939
268	Ga0105245_10405021	3300009098	Bacteria	1364
269	Ga0114129_10167700	3300009147	Bacteria	2995
270	Ga0114129_10282441	3300009147	Bacteria	2218
271	Ga0105243_10002687	3300009148	Bacteria	14776
272	Ga0105243_10003440	3300009148	Bacteria	12807
273	Ga0105243_10005315	3300009148	Bacteria	10064
274	Ga0105243_10009176	3300009148	Bacteria	7550
275	Ga0105243_10091493	3300009148	Bacteria	2505
276	Ga0105243_10154456	3300009148	Bacteria	1972
277	Ga0105241_10066975	3300009174	Unclassified	2779
278	Ga0105242_10001350	3300009176	Bacteria	19375
279	Ga0105242_10162660	3300009176	Bacteria	1955
280	Ga0105248_10010877	3300009177	Bacteria	10046
281	Ga0105248_10155837	3300009177	Bacteria	2577
282	Ga0105237_10026693	3300009545	Bacteria	5902
283	Ga0105238_10038345	3300009551	Bacteria	4866
284	Ga0105238_10268737	3300009551	Unclassified	1686
285	Ga0105238_10270281	3300009551	Bacteria	1681
286	Ga0105249_10059930	3300009553	Bacteria	3491
287	Ga0105249_10548980	3300009553	Bacteria	1206
288	Ga0105239_10326443	3300010375	Bacteria	1731
289	Ga0157373_10015854	3300013100	Bacteria	5501
290	Ga0157373_10049992	3300013100	Bacteria	2978
291	Ga0157371_10048775	3300013102	Bacteria	3010
292	Ga0157371_10092941	3300013102	Bacteria	2137
293	Ga0157371_10329636	3300013102	Bacteria	1109
294	Ga0157370_10007241	3300013104	Bacteria	12103
295	Ga0157370_10067902	3300013104	Bacteria	3370
296	Ga0157370_10089028	3300013104	Bacteria	2899
297	Ga0157370_10179104	3300013104	Bacteria	1970
298	Ga0157370_10358210	3300013104	Bacteria	1344
299	Ga0157369_10021114	3300013105	Bacteria	7279
300	Ga0157369_10202627	3300013105	Bacteria	2082
301	Ga0157374_10012674	3300013296	Bacteria	7342
302	Ga0157374_10086676	3300013296	Bacteria	2979
303	Ga0157374_10104497	3300013296	Bacteria	2719
304	Ga0157374_10184069	3300013296	Bacteria	2042
305	Ga0157374_10259805	3300013296	Bacteria	1710
306	Ga0157374_10869807	3300013296	Bacteria	918
307	Ga0157378_10042299	3300013297	Bacteria	4044
308	Ga0157378_10154346	3300013297	Bacteria	2141
309	Ga0157378_10351640	3300013297	Bacteria	1440
310	Ga0163162_10009814	3300013306	Bacteria	9317
311	Ga0163162_10015375	3300013306	Bacteria	7477
312	Ga0163162_10015380	3300013306	Bacteria	7475
313	Ga0163162_10181209	3300013306	Bacteria	2232
314	Ga0157372_10057881	3300013307	Bacteria	4333
315	Ga0157372_10075427	3300013307	Bacteria	3805
316	Ga0157372_10358459	3300013307	Bacteria	1699
317	Ga0157375_10062939	3300013308	Bacteria	3689
318	Ga0157375_10093843	3300013308	Bacteria	3068
319	Ga0157375_10102612	3300013308	Bacteria	2946
320	Ga0157375_10121655	3300013308	Bacteria	2720
321	Ga0157375_10141593	3300013308	Bacteria	2532
322	Ga0157375_10417599	3300013308	Bacteria	1508
323	Ga0157375_11239821	3300013308	Bacteria	876
324	Ga0163163_10037474	3300014325	Bacteria	4717
325	Ga0157380_10012326	3300014326	Bacteria	6201
326	Ga0157380_10073215	3300014326	Bacteria	2777
327	Ga0157380_10249300	3300014326	Bacteria	1606
328	Ga0182008_10005290	3300014497	Bacteria	7377
329	Ga0157377_10000047	3300014745	Bacteria	94451
330	Ga0157377_10002823	3300014745	Bacteria	7749
331	Ga0157377_10201891	3300014745	Bacteria	1263
332	Ga0157379_10022800	3300014968	Bacteria	5548
333	Ga0157379_10030462	3300014968	Bacteria	4803
334	Ga0157379_10356949	3300014968	Bacteria	1339
335	Ga0157379_10758873	3300014968	Bacteria	914
336	Ga0157376_10010115	3300014969	Bacteria	6889
337	Ga0157376_10015391	3300014969	Bacteria	5777
338	Ga0157376_10117781	3300014969	Bacteria	2349
339	Ga0157376_10164684	3300014969	Bacteria	2013
340	Ga0157376_10833368	3300014969	Unclassified	937
341	Ga0182006_1003497	3300015261	Bacteria	8011
342	Ga0182006_1086593	3300015261	Bacteria	1133
343	Ga0182006_1095082	3300015261	Bacteria	1066
344	Ga0182007_10001359	3300015262	Bacteria	13193
345	Ga0163161_10001107	3300017792	Bacteria	20364
346	Ga0163161_10007282	3300017792	Bacteria	7636
347	Ga0163161_10014906	3300017792	Bacteria	5415
348	Ga0163161_10025520	3300017792	Bacteria	4182
349	Ga0163161_10034930	3300017792	Bacteria	3597
350	Ga0163161_10044555	3300017792	Bacteria	3196
351	Ga0213876_10039532	3300021384	Bacteria	2493
352	Ga0213876_10058103	3300021384	Bacteria	2042
353	Ga0209436_108568	3300025208	Bacteria	2023
354	Ga0209147_103059	3300025229	Bacteria	3528
355	Ga0209563_100013	3300025230	Bacteria	941463
356	Ga0209258_100009	3300025242	Bacteria	996276
357	Ga0207425_1000798	3300025245	Bacteria	16022
358	Ga0207425_1002594	3300025245	Bacteria	6268
359	Ga0209148_1000007	3300025254	Bacteria	1592273
360	Ga0209129_1000024	3300025258	Bacteria	417268
361	Ga0209129_1000085	3300025258	Bacteria	181765
362	Ga0209129_1000783	3300025258	Bacteria	20092
363	Ga0209565_1000046	3300025263	Bacteria	226073
364	Ga0209565_1000518	3300025263	Bacteria	27559
365	Ga0209565_1002940	3300025263	Bacteria	5800
366	Ga0209673_1000053	3300025273	Bacteria	279449
367	Ga0209673_1000288	3300025273	Bacteria	94017
368	Ga0209673_1003947	3300025273	Bacteria	8289
369	Ga0209673_1016555	3300025273	Bacteria	2750
370	Ga0209130_1000283	3300025284	Bacteria	62554
371	Ga0209130_1000963	3300025284	Bacteria	22711
372	Ga0209130_1013707	3300025284	Bacteria	2066
373	Ga0209675_1000010	3300025291	Bacteria	541927
374	Ga0209675_1003009	3300025291	Bacteria	8289
375	Ga0209675_1003161	3300025291	Bacteria	8001
376	Ga0209675_1003275	3300025291	Bacteria	7796
377	Ga0209676_1000108	3300025292	Bacteria	221168
378	Ga0209676_1000626	3300025292	Bacteria	51133
379	Ga0209676_1001037	3300025292	Bacteria	32207
380	Ga0209676_1001793	3300025292	Bacteria	18020
381	Ga0209025_1001124	3300025294	Bacteria	38313
382	Ga0209025_1001282	3300025294	Bacteria	34517
383	Ga0209025_1005001	3300025294	Bacteria	11079
384	Ga0209025_1039148	3300025294	Bacteria	2073
385	Ga0209025_1062095	3300025294	Bacteria	1389
386	Ga0209564_1000472	3300025295	Bacteria	67352
387	Ga0209564_1000481	3300025295	Bacteria	66411
388	Ga0209758_1000049	3300025297	Bacteria	345104
389	Ga0209758_1029480	3300025297	Bacteria	2293
390	Ga0209758_1053408	3300025297	Bacteria	1388
391	Ga0209758_1056022	3300025297	Bacteria	1334
392	Ga0209050_1000002	3300025298	Bacteria	1792849
393	Ga0209050_1001046	3300025298	Bacteria	34171
394	Ga0209256_1000098	3300025299	Bacteria	204152
395	Ga0209256_1000464	3300025299	Bacteria	61298
396	Ga0207426_1000038	3300025302	Bacteria	441522
397	Ga0207426_1000053	3300025302	Bacteria	384818
398	Ga0207426_1040385	3300025302	Bacteria	1454
399	Ga0209051_1000002	3300025303	Bacteria	1631846
400	Ga0209051_1000244	3300025303	Bacteria	91505
401	Ga0209051_1000590	3300025303	Bacteria	42835
402	Ga0209051_1000939	3300025303	Bacteria	28775
403	Ga0209051_1000976	3300025303	Bacteria	27866
404	Ga0209051_1006689	3300025303	Bacteria	6448
405	Ga0209051_1010982	3300025303	Bacteria	4516
406	Ga0209257_1000002	3300025304	Bacteria	1767052
407	Ga0209257_1000144	3300025304	Bacteria	197078
408	Ga0209257_1001281	3300025304	Bacteria	30768
409	Ga0209257_1005717	3300025304	Bacteria	8532
410	Ga0209257_1005969	3300025304	Bacteria	8167
411	Ga0207697_10060746	3300025315	Bacteria	1572
412	Ga0207656_10015851	3300025321	Bacteria	2923
413	Ga0207656_10032599	3300025321	Bacteria	2165
414	Ga0207656_10245216	3300025321	Bacteria	876
415	Ga0207696_1035103	3300025711	Bacteria	1494
416	Ga0207655_1001943	3300025728	Bacteria	17680
417	Ga0207682_10060510	3300025893	Bacteria	1584
418	Ga0207682_10078940	3300025893	Bacteria	1407
419	Ga0207682_10100890	3300025893	Bacteria	1262
420	Ga0207688_10298579	3300025901	Bacteria	984
421	Ga0207680_10115920	3300025903	Bacteria	1745
422	Ga0207680_10172738	3300025903	Bacteria	1457
423	Ga0207645_10011283	3300025907	Bacteria	6107
424	Ga0207645_10023842	3300025907	Bacteria	3972
425	Ga0207645_10055716	3300025907	Bacteria	2524
426	Ga0207705_10006770	3300025909	Bacteria	8472
427	Ga0207705_10038851	3300025909	Bacteria	3410
428	Ga0207705_10082235	3300025909	Bacteria	2349
429	Ga0207705_10173356	3300025909	Bacteria	1625
430	Ga0207654_10072257	3300025911	Bacteria	2053
431	Ga0207654_10085067	3300025911	Bacteria	1913
432	Ga0207707_10011169	3300025912	Bacteria	7813
433	Ga0207707_10122228	3300025912	Bacteria	2276
434	Ga0207695_10330049	3300025913	Bacteria	1414
435	Ga0207695_10374801	3300025913	Bacteria	1309
436	Ga0207671_10140612	3300025914	Bacteria	1860
437	Ga0207671_10144821	3300025914	Bacteria	1832
438	Ga0207671_10283045	3300025914	Bacteria	1308
439	Ga0207663_10172433	3300025916	Bacteria	1538
440	Ga0207660_10048694	3300025917	Bacteria	3000
441	Ga0207662_10002309	3300025918	Bacteria	9551
442	Ga0207662_10053759	3300025918	Bacteria	2399
443	Ga0207662_10191669	3300025918	Bacteria	1319
444	Ga0207657_10015900	3300025919	Bacteria	7269
445	Ga0207657_10017805	3300025919	Bacteria	6802
446	Ga0207657_10053780	3300025919	Bacteria	3486
447	Ga0207657_10126325	3300025919	Bacteria	2100
448	Ga0207649_10004705	3300025920	Bacteria	7384
449	Ga0207649_10065775	3300025920	Bacteria	2296
450	Ga0207652_10014724	3300025921	Bacteria	6339
451	Ga0207681_10004142	3300025923	Bacteria	8988
452	Ga0207681_10031186	3300025923	Bacteria	3479
453	Ga0207681_10195247	3300025923	Bacteria	1551
454	Ga0207694_10128368	3300025924	Bacteria	2030
455	Ga0207694_10266013	3300025924	Bacteria	1406
456	Ga0207650_10003249	3300025925	Bacteria	11199
457	Ga0207650_10007645	3300025925	Bacteria	7363
458	Ga0207659_10005359	3300025926	Bacteria	7772
459	Ga0207659_10009237	3300025926	Bacteria	6156
460	Ga0207659_10099297	3300025926	Bacteria	2191
461	Ga0207659_10123971	3300025926	Bacteria	1984
462	Ga0207659_10148349	3300025926	Bacteria	1829
463	Ga0207687_10048575	3300025927	Bacteria	2947
464	Ga0207687_10067279	3300025927	Bacteria	2548
465	Ga0207700_10041338	3300025928	Bacteria	3372
466	Ga0207664_10065137	3300025929	Bacteria	2917
467	Ga0207644_10015626	3300025931	Bacteria	5099
468	Ga0207690_10018071	3300025932	Bacteria	4319
469	Ga0207690_10031674	3300025932	Bacteria	3386
470	Ga0207690_10051373	3300025932	Bacteria	2757
471	Ga0207690_10206944	3300025932	Bacteria	1494
472	Ga0207706_10004316	3300025933	Bacteria	13357
473	Ga0207706_10010163	3300025933	Bacteria	8614
474	Ga0207706_10106205	3300025933	Bacteria	2471
475	Ga0207706_10391455	3300025933	Bacteria	1205
476	Ga0207686_10149227	3300025934	Bacteria	1626
477	Ga0207709_10000015	3300025935	Bacteria	493221
478	Ga0207709_10001107	3300025935	Bacteria	19740
479	Ga0207709_10005518	3300025935	Bacteria	7178
480	Ga0207709_10015578	3300025935	Bacteria	4216
481	Ga0207709_10032365	3300025935	Bacteria	3061
482	Ga0207670_10000004	3300025936	Bacteria	707262
483	Ga0207669_10022825	3300025937	Bacteria	3330
484	Ga0207704_10026882	3300025938	Bacteria	3163
485	Ga0207704_10262090	3300025938	Bacteria	1304
486	Ga0207691_10006932	3300025940	Bacteria	10926
487	Ga0207691_10036148	3300025940	Bacteria	4577
488	Ga0207691_10056404	3300025940	Bacteria	3578
489	Ga0207691_10138817	3300025940	Bacteria	2143
490	Ga0207711_10016383	3300025941	Bacteria	6161
491	Ga0207711_10078888	3300025941	Bacteria	2873
492	Ga0207689_10007087	3300025942	Bacteria	9854
493	Ga0207689_10009559	3300025942	Bacteria	8364
494	Ga0207689_10013353	3300025942	Bacteria	7009
495	Ga0207689_10026903	3300025942	Bacteria	4815
496	Ga0207661_10002800	3300025944	Bacteria	12035
497	Ga0207661_10081303	3300025944	Bacteria	2676
498	Ga0207661_10139585	3300025944	Bacteria	2084
499	Ga0207661_10264680	3300025944	Bacteria	1532
500	Ga0207679_10018021	3300025945	Bacteria	4721
501	Ga0207679_10040394	3300025945	Bacteria	3339
502	Ga0207679_10143688	3300025945	Bacteria	1932
503	Ga0207679_10146320	3300025945	Bacteria	1917
504	Ga0207667_10000104	3300025949	Bacteria	134147
505	Ga0207667_10170872	3300025949	Bacteria	2234
506	Ga0207651_10018990	3300025960	Bacteria	4108
507	Ga0207651_10026845	3300025960	Bacteria	3606
508	Ga0207651_10040675	3300025960	Bacteria	3078
509	Ga0207651_10094594	3300025960	Bacteria	2197
510	Ga0207651_10245023	3300025960	Bacteria	1463
511	Ga0207712_10004623	3300025961	Bacteria	8693
512	Ga0207712_10115360	3300025961	Bacteria	2022
513	Ga0207668_10029872	3300025972	Bacteria	3577
514	Ga0207668_10084445	3300025972	Bacteria	2314
515	Ga0207668_10103567	3300025972	Bacteria	2120
516	Ga0207668_10201882	3300025972	Bacteria	1584
517	Ga0207640_10015669	3300025981	Bacteria	4392
518	Ga0207640_10080506	3300025981	Bacteria	2224
519	Ga0207658_10007981	3300025986	Bacteria	7206
520	Ga0207658_10027918	3300025986	Bacteria	3970
521	Ga0207658_10033970	3300025986	Bacteria	3641
522	Ga0207658_10065926	3300025986	Bacteria	2722
523	Ga0207658_10176268	3300025986	Bacteria	1766
524	Ga0207677_10006219	3300026023	Bacteria	6528
525	Ga0207677_10055234	3300026023	Bacteria	2714
526	Ga0207677_10065025	3300026023	Bacteria	2543
527	Ga0207677_10076814	3300026023	Bacteria	2379
528	Ga0207677_10149456	3300026023	Bacteria	1800
529	Ga0207703_10014712	3300026035	Bacteria	6106
530	Ga0207703_10021862	3300026035	Bacteria	5009
531	Ga0207703_10022609	3300026035	Bacteria	4935
532	Ga0207639_10006782	3300026041	Bacteria	7794
533	Ga0207639_10056806	3300026041	Bacteria	3001
534	Ga0207639_10165295	3300026041	Bacteria	1869
535	Ga0207678_10006013	3300026067	Bacteria	10798
536	Ga0207678_10087341	3300026067	Bacteria	2665
537	Ga0207678_10157724	3300026067	Bacteria	1938
538	Ga0207702_10119023	3300026078	Bacteria	2361
539	Ga0207702_10212209	3300026078	Bacteria	1800
540	Ga0207641_10004568	3300026088	Bacteria	11965
541	Ga0207641_10501955	3300026088	Bacteria	1178
542	Ga0207648_10000019	3300026089	Bacteria	144209
543	Ga0207648_10012908	3300026089	Bacteria	7801
544	Ga0207648_10033583	3300026089	Bacteria	4525
545	Ga0207676_10008687	3300026095	Bacteria	7223
546	Ga0207676_10015345	3300026095	Bacteria	5522
547	Ga0207676_10041317	3300026095	Bacteria	3539
548	Ga0207676_10043099	3300026095	Bacteria	3472
549	Ga0207676_10143746	3300026095	Bacteria	2045
550	Ga0207674_10020637	3300026116	Bacteria	7114
551	Ga0207674_10048325	3300026116	Bacteria	4355
552	Ga0207674_10088052	3300026116	Bacteria	3098
553	Ga0207675_100004056	3300026118	Bacteria	14185
554	Ga0207675_100010863	3300026118	Bacteria	8527
555	Ga0207675_100031877	3300026118	Bacteria	4910
556	Ga0207675_100238892	3300026118	Bacteria	1755
557	Ga0207683_10049353	3300026121	Bacteria	3684
558	Ga0207683_10058397	3300026121	Bacteria	3387
559	Ga0207683_10085867	3300026121	Bacteria	2798
560	Ga0207683_10106762	3300026121	Bacteria	2504
561	Ga0207698_10015757	3300026142	Bacteria	5076
562	Ga0207698_10104707	3300026142	Bacteria	2355
563	Ga0207698_10114659	3300026142	Unclassified	2267
564	Ga0207698_10200933	3300026142	Bacteria	1785
565	Ga0209281_1000007	3300027111	Bacteria	938265
566	Ga0209973_1001667	3300027252	Bacteria	1974
567	Ga0209970_1000149	3300027614	Bacteria	10736
568	Ga0209983_1003887	3300027665	Bacteria	3159
569	Ga0209282_1052535	3300027666	Bacteria	2325
570	Ga0209813_10099854	3300027866	Bacteria	986
571	Ga0268266_10135790	3300028379	Bacteria	2203
572	Ga0268265_10018402	3300028380	Bacteria	4841
573	Ga0268264_10003212	3300028381	Bacteria	14160
574	Ga0268264_10059514	3300028381	Bacteria	3201
575	Ga0268264_10091577	3300028381	Bacteria	2623
576	Ga0268264_10145206	3300028381	Bacteria	2121
577	Ga0265337_1021702	3300028556	Bacteria	1998
578	Ga0265337_1034402	3300028556	Bacteria	1490
579	Ga0265319_1003232	3300028563	Bacteria	8572
580	Ga0265334_10068411	3300028573	Bacteria	1326
581	Ga0265323_10000193	3300028653	Bacteria	36767
582	Ga0265336_10010282	3300028666	Bacteria	3207
583	Ga0307517_10115450	3300028786	Bacteria	2015
584	Ga0307517_10129728	3300028786	Bacteria	1821
585	Ga0307515_10000080	3300028794	Bacteria	224941
586	Ga0307515_10000084	3300028794	Bacteria	221434
587	Ga0307515_10000180	3300028794	Bacteria	156173
588	Ga0307515_10000265	3300028794	Bacteria	129554
589	Ga0307515_10106662	3300028794	Bacteria	3320
590	Ga0307515_10118735	3300028794	Bacteria	3015
591	Ga0307515_10231470	3300028794	Bacteria	1639
592	Ga0307515_10231523	3300028794	Bacteria	1639
593	Ga0265338_10001453	3300028800	Bacteria	38436
594	Ga0265338_10061206	3300028800	Bacteria	3301
595	Ga0265338_10080234	3300028800	Bacteria	2742
596	Ga0265324_10000411	3300029957	Bacteria	30799
597	Ga0307512_10128276	3300030522	Bacteria	1602
598	Ga0316177_1123614	3300030731	Bacteria	2238
599	Ga0316177_1151208	3300030731	Bacteria	1510
600	Ga0316181_1025232	3300030744	Bacteria	1995
601	Ga0316182_1001733	3300030745	Bacteria	1022
602	Ga0265330_10000022	3300031235	Bacteria	154198
603	Ga0265330_10005959	3300031235	Bacteria	6033
604	Ga0265330_10009787	3300031235	Bacteria	4542
605	Ga0265330_10029130	3300031235	Bacteria	2485
606	Ga0265330_10068545	3300031235	Bacteria	1536
607	Ga0265332_10000001	3300031238	Bacteria	863783
608	Ga0265332_10000009	3300031238	Bacteria	295760
609	Ga0265332_10039403	3300031238	Bacteria	2047
610	Ga0265332_10065851	3300031238	Bacteria	1547
611	Ga0265320_10008527	3300031240	Bacteria	6267
612	Ga0265320_10017575	3300031240	Bacteria	3964
613	Ga0265325_10001234	3300031241	Bacteria	18239
614	Ga0265325_10012296	3300031241	Bacteria	4898
615	Ga0265325_10020357	3300031241	Unclassified	3657
616	Ga0265325_10163664	3300031241	Bacteria	1045
617	Ga0265329_10036614	3300031242	Bacteria	1582
618	Ga0265329_10072908	3300031242	Bacteria	1086
619	Ga0265340_10001345	3300031247	Bacteria	14102
620	Ga0265339_10000018	3300031249	Bacteria	181364
621	Ga0265339_10007866	3300031249	Bacteria	6839
622	Ga0265339_10036707	3300031249	Bacteria	2741
623	Ga0265327_10017870	3300031251	Bacteria	4424
624	Ga0265316_10001635	3300031344	Bacteria	23873
625	Ga0265316_10002572	3300031344	Bacteria	18733
626	Ga0265316_10067917	3300031344	Bacteria	2756
627	Ga0307513_10002929	3300031456	Bacteria	23340
628	Ga0307513_10016692	3300031456	Bacteria	8839
629	Ga0307513_10196785	3300031456	Bacteria	1861
630	Ga0307408_100000663	3300031548	Bacteria	28685
631	Ga0307408_100093037	3300031548	Bacteria	2280
632	Ga0307408_100123756	3300031548	Bacteria	2007
633	Ga0307408_100195866	3300031548	Bacteria	1631
634	Ga0307408_100323225	3300031548	Bacteria	1300
635	Ga0307408_100443775	3300031548	Bacteria	1124
636	Ga0265313_10001373	3300031595	Bacteria	22850
637	Ga0265313_10078499	3300031595	Bacteria	1505
638	Ga0307508_10228574	3300031616	Bacteria	1459
639	Ga0307514_10000319	3300031649	Bacteria	115327
640	Ga0307514_10007214	3300031649	Bacteria	9589
641	Ga0265314_10000013	3300031711	Bacteria	403405
642	Ga0265314_10000015	3300031711	Bacteria	397180
643	Ga0265314_10026568	3300031711	Bacteria	4348
644	Ga0265314_10078746	3300031711	Bacteria	2181
645	Ga0265314_10088190	3300031711	Bacteria	2026
646	Ga0265342_10000117	3300031712	Bacteria	87799
647	Ga0265342_10006804	3300031712	Bacteria	8459
648	Ga0265342_10020107	3300031712	Bacteria	4290
649	Ga0265342_10065890	3300031712	Bacteria	2122
650	Ga0265342_10100287	3300031712	Bacteria	1650
651	Ga0265342_10176288	3300031712	Bacteria	1173
652	Ga0316576_10009653	3300031727	Bacteria	6242
653	Ga0316576_10013052	3300031727	Bacteria	5508
654	Ga0316576_10085103	3300031727	Bacteria	2350
655	Ga0316576_10238390	3300031727	Unclassified	1367
656	Ga0316576_10291571	3300031727	Unclassified	1221
657	Ga0316576_10325145	3300031727	Bacteria	1147
658	Ga0316578_10000597	3300031728	Bacteria	12621
659	Ga0307516_10000483	3300031730	Bacteria	52925
660	Ga0307516_10147070	3300031730	Bacteria	2121
661	Ga0307516_10427581	3300031730	Bacteria	982
662	Ga0307405_10048023	3300031731	Bacteria	2630
663	Ga0307405_10068623	3300031731	Bacteria	2269
664	Ga0307405_10217520	3300031731	Bacteria	1399
665	Ga0307405_10640839	3300031731	Bacteria	872
666	Ga0316577_10074132	3300031733	Bacteria	1900
667	Ga0307410_10103028	3300031852	Bacteria	2049
668	Ga0307410_10127163	3300031852	Bacteria	1867
669	Ga0307410_10193554	3300031852	Bacteria	1548
670	Ga0307406_10000930	3300031901	Bacteria	16340
671	Ga0307406_10003504	3300031901	Bacteria	8547
672	Ga0307412_10019540	3300031911	Bacteria	4105
673	Ga0307412_10039320	3300031911	Bacteria	3053
674	Ga0307412_10047004	3300031911	Bacteria	2832
675	Ga0307412_10058617	3300031911	Bacteria	2576
676	Ga0307412_10109697	3300031911	Bacteria	1968
677	Ga0307412_10180693	3300031911	Bacteria	1587
678	Ga0307412_10182041	3300031911	Bacteria	1581
679	Ga0307412_10212296	3300031911	Bacteria	1478
680	Ga0307412_10326232	3300031911	Bacteria	1223
681	Ga0307409_100009019	3300031995	Bacteria	6101
682	Ga0307409_100186161	3300031995	Bacteria	1843
683	Ga0307416_100001658	3300032002	Bacteria	12289
684	Ga0307416_100027523	3300032002	Bacteria	4212
685	Ga0307416_100195427	3300032002	Bacteria	1913
686	Ga0307416_100336962	3300032002	Bacteria	1519
687	Ga0307414_10059141	3300032004	Bacteria	2704
688	Ga0307414_10078433	3300032004	Bacteria	2407
689	Ga0307414_10175576	3300032004	Bacteria	1718
690	Ga0307414_10631888	3300032004	Bacteria	963
691	Ga0307411_10117713	3300032005	Bacteria	1915
692	Ga0307411_10233360	3300032005	Bacteria	1436
693	Ga0307411_10262066	3300032005	Bacteria	1365
694	Ga0307411_10586241	3300032005	Bacteria	957
695	Ga0307415_100006170	3300032126	Bacteria	6435
696	Ga0307415_100235814	3300032126	Bacteria	1477
697	Ga0316585_10035743	3300032137	Bacteria	1574
698	Ga0316580_10024236	3300032139	Unclassified	1875
699	Ga0373949_0003177	3300035090	Bacteria	3995
700	Ga0373936_0086232	3300035113	Bacteria	1312
701	Ga0373962_0062166	3300035242	Bacteria	1099
702	Ga0316574_0043088	3300035398	Bacteria	2788
703	Ga0316574_0188679	3300035398	Bacteria	1326
704	Ga0316574_0356707	3300035398	Unclassified	925
705	Ga0373924_0044377	3300035410	Bacteria	1827
706	Ga0373931_0008347	3300035691	Bacteria	4907
707	Ga0373931_0012403	3300035691	Bacteria	4128
708	Ga0373931_0072969	3300035691	Bacteria	1878
709	Ga0373927_0233778	3300035695	Bacteria	1208
710	Ga0373933_0264591	3300035724	Bacteria	1109
711	Ga0373937_0825622	3300036401	Bacteria	875
712	Ga0316582_0016799	3300036647	Unclassified	4219
713	Ga0316582_0085216	3300036647	Bacteria	2070
714	Ga0316582_0447954	3300036647	Bacteria	890
715	Ga0316584_0003757	3300036712	Bacteria	9942
716	Ga0316584_0008350	3300036712	Bacteria	7131
717	Ga0316584_0153941	3300036712	Bacteria	1710
718	Ga0316584_0266798	3300036712	Bacteria	1247
719	Ga0316584_0334423	3300036712	Bacteria	1090
720	Ga0373925_0017081	3300037068	Bacteria	5253
721	Ga0395899_0019534	3300037312	Bacteria	5146
722	Ga0395899_0034273	3300037312	Bacteria	3812
723	Ga0395900_0020449	3300037418	Bacteria	6757
724	Ga0395898_0031352	3300037466	Bacteria	5312
725	Ga0395898_0130946	3300037466	Bacteria	2403
726	Ga0395898_0836682	3300037466	Unclassified	860
727	Ga0395898_0855204	3300037466	Bacteria	849
728	Ga0395905_0005085	3300037471	Bacteria	13535
729	Ga0395905_0007311	3300037471	Bacteria	11003
730	Ga0395905_0017351	3300037471	Bacteria	6836
731	Ga0395905_0040888	3300037471	Bacteria	4349
732	Ga0395905_0044289	3300037471	Bacteria	4176
733	Ga0395905_0090493	3300037471	Bacteria	2869
734	Ga0395905_0230108	3300037471	Bacteria	1733
735	Ga0395905_0261658	3300037471	Bacteria	1615
736	Ga0395905_0394955	3300037471	Bacteria	1277
737	Ga0395901_0172965	3300038443	Bacteria	2266
738	Ga0395901_0187310	3300038443	Bacteria	2170
739	Ga0395901_0415487	3300038443	Bacteria	1380
740	Ga0400483_074169	3300039062	Bacteria	2249
741	Ga0400483_125235	3300039062	Bacteria	8881
742	Ga0400483_145606	3300039062	Bacteria	48337
743	Ga0400483_153483	3300039062	Bacteria	2479
744	Ga0400483_287756	3300039062	Bacteria	35166
745	Ga0400489_13079	3300039093	Unclassified	1518
746	Ga0436365_0130005	3300039437	Bacteria	874
747	Ga0436365_0978309	3300039437	Bacteria	4949
748	Ga0436365_1180975	3300039437	Bacteria	5918
749	Ga0436361_0279495	3300039447	Bacteria	15969
750	Ga0436361_0614584	3300039447	Bacteria	7589
751	Ga0439436_0000941	3300041404	Bacteria	8019
752	Ga0439436_0004681	3300041404	Bacteria	4197
753	Ga0439436_0004752	3300041404	Bacteria	4165
754	Ga0439436_0048133	3300041404	Bacteria	1210
755	Ga0439439_0005691	3300041406	Bacteria	2857
756	Ga0439439_0055201	3300041406	Bacteria	1047
757	Ga0439447_031174	3300041407	Bacteria	1339
758	Ga0439461_0045868	3300041410	Bacteria	957
759	Ga0439466_0009179	3300041411	Bacteria	3705
760	Ga0439466_0010962	3300041411	Bacteria	3360
761	Ga0439465_0023629	3300041413	Bacteria	1935
762	Ga0451807_2561322	3300041486	Bacteria	1496
763	Ga0451855_1620512	3300041511	Bacteria	781
764	Ga0439431_0000136	3300041997	Bacteria	13215
765	Ga0439431_0026642	3300041997	Bacteria	1417
766	Ga0439433_0000676	3300041999	Bacteria	6577
767	Ga0439433_0006006	3300041999	Bacteria	2610
768	Ga0439442_002772	3300042002	Bacteria	3440
769	Ga0439442_005065	3300042002	Bacteria	2634
770	Ga0439445_0010992	3300042004	Bacteria	2150
771	Ga0439445_0062076	3300042004	Bacteria	1023
772	Ga0439432_001610	3300042006	Bacteria	8457
773	Ga0439432_003327	3300042006	Bacteria	5973
774	Ga0439449_0000231	3300042007	Bacteria	20096
775	Ga0439449_0001881	3300042007	Bacteria	8268
776	Ga0439449_0003040	3300042007	Bacteria	6538
777	Ga0439449_0003921	3300042007	Bacteria	5769
778	Ga0439452_001605	3300042010	Bacteria	8930
779	Ga0439452_062431	3300042010	Bacteria	832
780	Ga0439455_0036959	3300042012	Bacteria	1237
781	Ga0439457_001194	3300042014	Bacteria	7822
782	Ga0439462_0015872	3300042015	Bacteria	1944
783	Ga0450911_000302	3300042115	Bacteria	17801
784	Ga0450920_014788	3300042122	Bacteria	1480
785	Ga0450890_000183	3300042127	Bacteria	9525
786	Ga0450897_002059	3300042128	Bacteria	1463
787	Ga0450891_000265	3300042129	Bacteria	5300
788	Ga0450892_001981	3300042130	Bacteria	1817
789	Ga0450894_002638	3300042131	Bacteria	2388
790	Ga0450895_004198	3300042132	Bacteria	1132
791	Ga0450898_008214	3300042134	Bacteria	1641
792	Ga0450899_002843	3300042135	Bacteria	1872
793	Ga0450903_001471	3300042138	Bacteria	4394
794	Ga0450905_024948	3300042142	Bacteria	898
795	Ga0450889_000106	3300042144	Bacteria	8145
796	Ga0450906_003810	3300042145	Bacteria	3207
797	Ga0450906_014575	3300042145	Bacteria	1438
798	Ga0450910_019663	3300042147	Bacteria	1015
799	Ga0439446_0007098	3300042156	Bacteria	2937
800	Ga0439446_0008739	3300042156	Bacteria	2698
801	Ga0439446_0013908	3300042156	Bacteria	2214
802	Ga0450908_000659	3300042184	Bacteria	6623
803	Ga0450908_003584	3300042184	Bacteria	3023
804	Ga0450909_003671	3300042185	Bacteria	2180
805	Ga0439434_0002408	3300042435	Bacteria	5436
806	Ga0439434_0009538	3300042435	Bacteria	2855
807	Ga0450916_004645	3300042530	Bacteria	1558
808	Ga0451577_0000641	3300042876	Bacteria	55722
809	Ga0451577_0010491	3300042876	Bacteria	8848
810	Ga0451577_0011268	3300042876	Bacteria	8469
811	Ga0451577_0033651	3300042876	Bacteria	4621
812	Ga0451577_0048478	3300042876	Bacteria	3795
813	Ga0451577_0064634	3300042876	Bacteria	3263
814	Ga0451577_0067284	3300042876	Bacteria	3195
815	Ga0451577_0077115	3300042876	Bacteria	2972
816	Ga0451577_0127331	3300042876	Bacteria	2282
817	Ga0451577_0133839	3300042876	Bacteria	2225
818	Ga0451577_0144899	3300042876	Bacteria	2135
819	Ga0451577_0152811	3300042876	Bacteria	2077
820	Ga0451577_0170778	3300042876	Bacteria	1959
821	Ga0451577_0292677	3300042876	Bacteria	1476
822	Ga0466969_0004881	3300044656	Bacteria	7143
823	Ga0466972_0075738	3300044658	Bacteria	1603
824	Ga0466972_0080508	3300044658	Bacteria	1551
825	Ga0453683_0000066	3300044673	Bacteria	164788
826	Ga0453683_0001628	3300044673	Bacteria	18851
827	Ga0453683_0002265	3300044673	Bacteria	15199
828	Ga0453683_0056224	3300044673	Unclassified	2462
829	Ga0453683_0097870	3300044673	Bacteria	1842
830	Ga0453683_0121105	3300044673	Bacteria	1647
831	Ga0453683_0145487	3300044673	Bacteria	1496
832	Ga0453683_0315935	3300044673	Bacteria	1000
833	Ga0466965_0093754	3300044683	Bacteria	1529
834	Ga0466965_0109697	3300044683	Bacteria	1417
835	Ga0466966_0003352	3300044684	Bacteria	10560
836	Ga0466961_0030775	3300044693	Bacteria	3448
837	Ga0466963_0161926	3300044694	Bacteria	1557
838	Ga0466964_0119695	3300044706	Bacteria	1185
839	Ga0453684_0000257	3300044712	Bacteria	228854
840	Ga0453684_0000440	3300044712	Bacteria	169397
841	Ga0453684_0001121	3300044712	Bacteria	83919
842	Ga0453684_0001818	3300044712	Bacteria	56168
843	Ga0453684_0003919	3300044712	Bacteria	32695
844	Ga0453684_0004685	3300044712	Bacteria	28338
845	Ga0453684_0007360	3300044712	Bacteria	20308
846	Ga0453684_0010392	3300044712	Bacteria	15928
847	Ga0453684_0012675	3300044712	Bacteria	13848
848	Ga0453684_0015449	3300044712	Bacteria	12072
849	Ga0453684_0015456	3300044712	Bacteria	12069
850	Ga0453684_0016232	3300044712	Bacteria	11667
851	Ga0453684_0031247	3300044712	Bacteria	7490
852	Ga0453684_0043657	3300044712	Bacteria	6021
853	Ga0453684_0047669	3300044712	Bacteria	5679
854	Ga0453684_0056215	3300044712	Bacteria	5106
855	Ga0453684_0070423	3300044712	Bacteria	4429
856	Ga0453684_0095653	3300044712	Bacteria	3650
857	Ga0453684_0129293	3300044712	Bacteria	3033
858	Ga0453684_0213742	3300044712	Bacteria	2239
859	Ga0453684_0256338	3300044712	Bacteria	2006
860	Ga0453684_0273725	3300044712	Bacteria	1928
861	Ga0453684_0435714	3300044712	Bacteria	1461
862	Ga0453684_0557985	3300044712	Unclassified	1261
863	Ga0453684_0572675	3300044712	Unclassified	1241
864	Ga0453684_0815845	3300044712	Bacteria	1005
865	Ga0453684_0827708	3300044712	Bacteria	996
866	Ga0453684_0855368	3300044712	Bacteria	977
867	Ga0466971_0091768	3300044719	Bacteria	1391
868	Ga0466968_0015412	3300044735	Bacteria	3029
869	Ga0466968_0024801	3300044735	Bacteria	2453
870	Ga0466970_0009622	3300044765	Bacteria	4890
871	Ga0466957_0025194	3300044842	Bacteria	3524
872	Ga0466959_0038447	3300045049	Bacteria	3536
873	Ga0451576_0000783	3300045051	Bacteria	62485
874	Ga0451576_0000942	3300045051	Bacteria	54657
875	Ga0451576_0001153	3300045051	Bacteria	47700
876	Ga0451576_0002104	3300045051	Bacteria	31012
877	Ga0451576_0003704	3300045051	Bacteria	20672
878	Ga0451576_0016080	3300045051	Bacteria	8266
879	Ga0451576_0024717	3300045051	Bacteria	6485
880	Ga0451576_0059421	3300045051	Bacteria	3990
881	Ga0451576_0070413	3300045051	Bacteria	3641
882	Ga0451576_0088503	3300045051	Bacteria	3221
883	Ga0451576_0098159	3300045051	Bacteria	3046
884	Ga0451576_0119390	3300045051	Bacteria	2745
885	Ga0451576_0125566	3300045051	Bacteria	2674
886	Ga0451576_0157578	3300045051	Bacteria	2369
887	Ga0451576_0188831	3300045051	Bacteria	2152
888	Ga0451576_0285269	3300045051	Bacteria	1726
889	Ga0451576_0313736	3300045051	Unclassified	1641
890	Ga0451576_0317198	3300045051	Bacteria	1631
891	Ga0451576_0526045	3300045051	Bacteria	1242
892	Ga0451576_0549178	3300045051	Bacteria	1214
893	Ga0451576_0670764	3300045051	Unclassified	1089
894	Ga0451576_0691569	3300045051	Bacteria	1072
895	Ga0466967_0029517	3300045976	Bacteria	4590
896	Ga0466967_0171339	3300045976	Bacteria	2043
897	Ga0495627_007561	3300046453	Bacteria	4155
898	Ga0495651_0315645	3300046462	Bacteria	1043
899	Ga0495585_0049379	3300046492	Bacteria	2336
900	Ga0495610_0010895	3300046512	Bacteria	5611
901	Ga0495616_0007017	3300046513	Bacteria	6777
902	Ga0495620_0008213	3300046515	Bacteria	5613
903	Ga0495620_0029637	3300046515	Bacteria	2530
904	Ga0495628_0370326	3300046516	Bacteria	1051
905	Ga0495631_0000387	3300046518	Bacteria	30358
906	Ga0495637_0011280	3300046520	Bacteria	4297
907	Ga0495637_0026376	3300046520	Bacteria	2609
908	Ga0495637_0117630	3300046520	Bacteria	1025
909	Ga0495663_0013211	3300046525	Bacteria	2309
910	Ga0495642_0040756	3300046528	Bacteria	1887
911	Ga0495654_0006463	3300046530	Bacteria	6661
912	Ga0495621_0005665	3300046539	Bacteria	3605
913	Ga0495621_0005950	3300046539	Bacteria	3537
914	Ga0495621_0011510	3300046539	Bacteria	2739
915	Ga0495621_0044127	3300046539	Bacteria	1575
916	Ga0495597_0000110	3300046542	Bacteria	72678
917	Ga0495633_0014855	3300046558	Bacteria	4053
918	Ga0495656_0001522	3300046615	Bacteria	7578
919	Ga0495656_0020916	3300046615	Bacteria	2542
920	Ga0495625_0000870	3300046660	Bacteria	41078
921	Ga0495625_0129295	3300046660	Bacteria	1712
922	Ga0495661_0206559	3300046665	Bacteria	1025
923	Ga0495588_0065730	3300046674	Bacteria	1882
924	Ga0495658_0064760	3300046683	Bacteria	2107
925	Ga0495671_0002650	3300046692	Bacteria	11246
926	Ga0496101_0006461	3300048904	Bacteria	7545
927	Ga0496101_0120213	3300048904	Bacteria	1985
928	Ga0496101_0189249	3300048904	Bacteria	1588
929	Ga0496101_0459085	3300048904	Bacteria	1005
930	Ga0496104_0041483	3300048907	Bacteria	4315
931	Ga0496104_0142437	3300048907	Bacteria	2303
932	Ga0496104_0264332	3300048907	Bacteria	1633
933	Ga0496105_0049259	3300048908	Bacteria	3478
934	Ga0496107_0040094	3300048910	Bacteria	3360
935	Ga0496107_0115862	3300048910	Bacteria	1972
936	Ga0496108_0200181	3300048911	Bacteria	1733
937	Ga0496108_0305174	3300048911	Bacteria	1387
938	Ga0496108_0466783	3300048911	Bacteria	1103
939	Ga0496109_0535763	3300048912	Bacteria	1105
940	Ga0496110_0058367	3300048913	Bacteria	3399
941	Ga0496110_0115353	3300048913	Bacteria	2418
942	Ga0496113_0159428	3300048916	Bacteria	1783
943	Ga0496114_0007762	3300048917	Bacteria	8488
944	Ga0496115_0024922	3300048918	Bacteria	4653
945	Ga0496115_0214779	3300048918	Bacteria	1588
946	Ga0496116_0013288	3300048919	Bacteria	6653
947	Ga0496116_0065668	3300048919	Bacteria	2326
948	Ga0496117_0011404	3300048920	Bacteria	7961
949	Ga0496117_0015770	3300048920	Bacteria	6415
950	Ga0496117_0059062	3300048920	Bacteria	2652
951	Ga0496118_0011891	3300048921	Bacteria	8428
952	Ga0496118_0019444	3300048921	Bacteria	6070
953	Ga0496121_0003789	3300048924	Bacteria	21095
954	Ga0496121_0012542	3300048924	Bacteria	9224
955	Ga0496121_0034190	3300048924	Bacteria	4579
956	Ga0496121_0053687	3300048924	Bacteria	3374
957	Ga0496122_0000998	3300048925	Bacteria	50283
958	Ga0496122_0022445	3300048925	Bacteria	5610
959	Ga0496122_0028070	3300048925	Bacteria	4790
960	Ga0496122_0094605	3300048925	Bacteria	2022
961	Ga0496122_0099329	3300048925	Bacteria	1952
962	Ga0496122_0140175	3300048925	Bacteria	1514
963	Ga0496123_0000045	3300048926	Bacteria	249294
964	Ga0496123_0020616	3300048926	Bacteria	5152
965	Ga0496123_0052597	3300048926	Bacteria	2701
966	Ga0496123_0079554	3300048926	Bacteria	2002
967	Ga0496123_0136615	3300048926	Bacteria	1348
968	Ga0496123_0184095	3300048926	Bacteria	1087
969	Ga0496124_0000596	3300048927	Bacteria	60853
970	Ga0496124_0039974	3300048927	Bacteria	4060
971	Ga0496124_0081642	3300048927	Bacteria	2656
972	Ga0496124_0160882	3300048927	Bacteria	1750
973	Ga0496124_0210660	3300048927	Bacteria	1471
974	Ga0496125_0011376	3300048928	Bacteria	8907
975	Ga0496125_0012583	3300048928	Bacteria	8383
976	Ga0496125_0014698	3300048928	Bacteria	7607
977	Ga0496125_0017503	3300048928	Bacteria	6828
978	Ga0496125_0022653	3300048928	Bacteria	5826
979	Ga0496125_0026750	3300048928	Bacteria	5243
980	Ga0496125_0031594	3300048928	Bacteria	4716
981	Ga0496125_0077729	3300048928	Bacteria	2556
982	Ga0496126_0014757	3300048929	Bacteria	7883
983	Ga0496126_0131458	3300048929	Bacteria	2162
984	Ga0501031_0005333	3300049568	Bacteria	8373
985	Ga0501034_0002214	3300049571	Bacteria	24035
986	Ga0501034_0003819	3300049571	Bacteria	16979
987	Ga0501037_0028228	3300049573	Bacteria	4145
988	Ga0501043_0000020	3300049579	Bacteria	155270
989	Ga0501043_0204789	3300049579	Bacteria	1530
990	Ga0501046_0000039	3300049580	Bacteria	155237
991	Ga0501047_0000028	3300049581	Bacteria	220279
992	Ga0501048_0000484	3300049582	Bacteria	27870
993	Ga0501068_0061621	3300049584	Bacteria	2280
994	Ga0501069_0003526	3300049585	Bacteria	8053
995	Ga0501070_0078268	3300049586	Unclassified	2736
996	Ga0501071_0123363	3300049587	Unclassified	1921
997	Ga0501072_0237732	3300049588	Unclassified	1451
998	Ga0501073_0052716	3300049589	Bacteria	2848
999	Ga0501073_0203951	3300049589	Bacteria	1367
1000	Ga0501074_0332709	3300049590	Bacteria	1078
1001	Ga0501198_000001	3300049649	Bacteria	234552
1002	Ga0501202_110232	3300049652	Unclassified	680
1003	Ga0501207_000453	3300049654	Bacteria	4585
1004	Ga0501222_000013	3300049662	Bacteria	87490
1005	Ga0501235_042525	3300049669	Bacteria	1041
1006	Ga0501249_007885	3300049679	Bacteria	2209
1007	Ga0501249_027919	3300049679	Bacteria	1250
1008	Ga0501257_000925	3300049686	Bacteria	5959
1009	Ga0501257_008922	3300049686	Bacteria	2259
1010	Ga0501257_058797	3300049686	Bacteria	969
1011	Ga0501259_009186	3300049688	Unclassified	1601
1012	Ga0501225_0006505	3300049705	Bacteria	3412
1013	Ga0501225_0011438	3300049705	Bacteria	2495
1014	Ga0501080_0224496	3300049742	Bacteria	1718
1015	Ga0501080_0398670	3300049742	Bacteria	1238
1016	Ga0501083_0003972	3300049744	Bacteria	10385
1017	Ga0501262_000321	3300049759	Bacteria	5821
1018	Ga0501035_0046871	3300049822	Bacteria	3885
1019	Ga0501035_0141154	3300049822	Bacteria	2094
1020	Ga0501044_0006083	3300049823	Bacteria	13320
1021	Ga0501044_0037610	3300049823	Bacteria	5058
1022	Ga0501044_0161468	3300049823	Bacteria	2217
1023	Ga0501044_0702254	3300049823	Bacteria	897
1024	Ga0501045_0015944	3300049824	Bacteria	5331
1025	Ga0501045_0094630	3300049824	Bacteria	2210
1026	nmdc:mga03683_102652_c1	3300050489	Bacteria	1258
1027	nmdc:mga03683_11937_c1	3300050489	Bacteria	3159
1028	nmdc:mga03683_13364_c1	3300050489	Bacteria	2117
1029	nmdc:mga03683_41929_c1	3300050489	Bacteria	1881
1030	nmdc:mga03683_4753_c1	3300050489	Bacteria	4531
1031	nmdc:mga03683_50779_c1	3300050489	Bacteria	1729
1032	nmdc:mga03683_8148_c1	3300050489	Bacteria	3671
1033	nmdc:mga03n38_3462_c1	3300050490	Bacteria	5073
1034	nmdc:mga03n38_36613_c1	3300050490	Bacteria	2111
1035	nmdc:mga03n38_6656_c1	3300050490	Bacteria	4034
1036	nmdc:mga00v17_11986_c2	3300050491	Bacteria	4085
1037	nmdc:mga00v17_154708_c1	3300050491	Bacteria	1474
1038	nmdc:mga00v17_266647_c1	3300050491	Bacteria	1111
1039	nmdc:mga00v17_32558_c2	3300050491	Bacteria	2140
1040	nmdc:mga00v17_64632_c1	3300050491	Bacteria	2255
1041	nmdc:mga0yw44_205157_c1	3300050492	Bacteria	1303
1042	nmdc:mga0yw44_275680_c1	3300050492	Bacteria	1123
1043	nmdc:mga0yw44_4790_c1	3300050492	Bacteria	6272
1044	nmdc:mga0yw44_68331_c1	3300050492	Bacteria	2198
1045	nmdc:mga0k408_106905_c1	3300050493	Bacteria	1653
1046	nmdc:mga0k408_136693_c1	3300050493	Bacteria	1456
1047	nmdc:mga0k408_16726_c1	3300050493	Bacteria	4076
1048	nmdc:mga0k408_200386_c1	3300050493	Bacteria	1192
1049	nmdc:mga0k408_23101_c1	3300050493	Bacteria	3505
1050	nmdc:mga0k408_251584_c1	3300050493	Bacteria	1055
1051	nmdc:mga0k408_330873_c1	3300050493	Bacteria	909
1052	nmdc:mga0k408_37821_c1	3300050493	Bacteria	2771
1053	nmdc:mga0k408_5104_c2	3300050493	Bacteria	5534
1054	nmdc:mga0k408_6458_c1	3300050493	Bacteria	6249
1055	nmdc:mga0k408_81769_c1	3300050493	Bacteria	1892
1056	nmdc:mga06z11_167522_c1	3300050494	Bacteria	1259
1057	nmdc:mga06z11_223153_c1	3300050494	Bacteria	1102
1058	nmdc:mga06z11_94953_c1	3300050494	Bacteria	1626
1059	nmdc:mga04h51_41362_c1	3300050495	Bacteria	1506
1060	nmdc:mga07m45_21433_c1	3300050496	Bacteria	2226
1061	nmdc:mga07m45_30562_c1	3300050496	Bacteria	2984
1062	nmdc:mga07m45_7630_c1	3300050496	Bacteria	5535
1063	nmdc:mga07m45_92661_c1	3300050496	Bacteria	1732
1064	nmdc:mga07m45_9617_c1	3300050496	Bacteria	5024
1065	nmdc:mga05p37_272618_c1	3300050507	Bacteria	2021
1066	nmdc:mga09592_12816_c1	3300050508	Bacteria	6837
1067	nmdc:mga09592_61093_c1	3300050508	Bacteria	3186
1068	nmdc:mga0qj67_17938_c1	3300050509	Bacteria	5388
1069	nmdc:mga06r32_512338_c1	3300050510	Bacteria	1176
1070	nmdc:mga06r32_92200_c1	3300050510	Bacteria	2961
1071	nmdc:mga0sz30_8443_c1	3300050516	Bacteria	3890
1072	Ga0500610_0002946	3300053079	Bacteria	6407
1073	Ga0500610_0023763	3300053079	Bacteria	3038
1074	Ga0500555_069644	3300053103	Bacteria	930
1075	Ga0500560_083404	3300053107	Bacteria	1063
1076	Ga0500571_000059	3300053110	Bacteria	33280
1077	Ga0500593_000173	3300053117	Bacteria	26150
1078	Ga0500594_0005452	3300053118	Bacteria	2824
1079	Ga0500594_0012360	3300053118	Bacteria	2010
1080	Ga0500607_001787	3300053121	Bacteria	18576
1081	Ga0500608_144782	3300053122	Bacteria	1049
1082	Ga0500608_146039	3300053122	Bacteria	1042
1083	Ga0500618_004835	3300053125	Bacteria	4209
1084	Ga0500626_004754	3300053128	Bacteria	5209
1085	Ga0500655_000313	3300053133	Bacteria	10985
1086	Ga0500655_007030	3300053133	Bacteria	2024
1087	Ga0500559_0004716	3300053136	Bacteria	6416
1088	Ga0500559_0011229	3300053136	Bacteria	3828
1089	Ga0500568_0004329	3300053139	Bacteria	7614
1090	Ga0500573_0173453	3300053140	Bacteria	1164
1091	Ga0500574_015562	3300053141	Bacteria	1820
1092	Ga0500577_0252742	3300053142	Bacteria	766
1093	Ga0500586_045582	3300053145	Bacteria	1501
1094	Ga0500590_004451	3300053148	Bacteria	6617
1095	Ga0500604_0081422	3300053151	Bacteria	1046
1096	Ga0500616_0026839	3300053153	Bacteria	3183
1097	Ga0500622_0000049	3300053156	Bacteria	145793
1098	Ga0500622_0000056	3300053156	Bacteria	142254
1099	Ga0500627_0007369	3300053158	Bacteria	3823
1100	Ga0500627_0054057	3300053158	Bacteria	1756
1101	Ga0500633_0085413	3300053160	Bacteria	1147
1102	Ga0500634_0033732	3300053161	Bacteria	2789
1103	Ga0500636_0000049	3300053177	Bacteria	57130
1104	Ga0500636_0079891	3300053177	Bacteria	1885
1105	Ga0500637_0132138	3300053178	Bacteria	1447
1106	Ga0501084_0061542	3300054114	Bacteria	3143
1107	Ga0590071_002858	3300059421	Bacteria	4318
1108	Ga0501082_0107267	3300060353	Unclassified	2416
1109	Ga0466962_0002485	3300061719	Bacteria	8732
1110	Ga0466962_0043456	3300061719	Bacteria	2150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300044712	Ga0453684_0213742	Ga0453684_0213742_22_669	208
2	3300035398	Ga0316574_0356707	Ga0316574_0356707_271_906	210
3	3300044712	Ga0453684_0827708	Ga0453684_0827708_342_983	212
4	3300044712	Ga0453684_0095653	Ga0453684_0095653_2726_3475	214
5	3300049652	Ga0501202_110232	Ga0501202_110232_18_665	214
6	3300005563	Ga0068855_100000030	Ga0068855_10000003044	218
7	3300025949	Ga0207667_10000104	Ga0207667_1000010469	218
8	3300003323	rootH1_10093616	rootH1_100936164	219
9	3300039062	Ga0400483_153483	Ga0400483_153483_11_676	219
10	3300054114	Ga0501084_0061542	Ga0501084_0061542_761_1513	219
11	3300014326	Ga0157380_10249300	Ga0157380_102493003	220
12	3300025893	Ga0207682_10078940	Ga0207682_100789402	220
13	3300031238	Ga0265332_10065851	Ga0265332_100658512	220
14	3300025926	Ga0207659_10148349	Ga0207659_101483492	221
15	3300025960	Ga0207651_10026845	Ga0207651_100268453	221
16	3300028556	Ga0265337_1021702	Ga0265337_10217022	221
17	3300028800	Ga0265338_10061206	Ga0265338_100612063	221
18	3300031235	Ga0265330_10068545	Ga0265330_100685451	221
19	3300031241	Ga0265325_10001234	Ga0265325_100012342	221
20	3300031242	Ga0265329_10072908	Ga0265329_100729082	221
21	3300031247	Ga0265340_10001345	Ga0265340_100013456	221
22	3300031344	Ga0265316_10067917	Ga0265316_100679173	221
23	3300031711	Ga0265314_10000015	Ga0265314_10000015107	221
24	3300031712	Ga0265342_10000117	Ga0265342_1000011753	221
25	3300042156	Ga0439446_0007098	Ga0439446_0007098_11_679	221
26	3300044719	Ga0466971_0091768	Ga0466971_0091768_632_1378	221
27	3300005985	Ga0081539_10024526	Ga0081539_100245265	222
28	3300025940	Ga0207691_10036148	Ga0207691_100361483	223
29	3300025972	Ga0207668_10084445	Ga0207668_100844453	223
30	3300037466	Ga0395898_0836682	Ga0395898_0836682_105_836	224
31	3300005333	Ga0070677_10069684	Ga0070677_100696842	225
32	3300025986	Ga0207658_10176268	Ga0207658_101762682	225
33	3300046539	Ga0495621_0011510	Ga0495621_0011510_1736_2533	226
34	3300013306	Ga0163162_10181209	Ga0163162_101812092	227
35	3300009098	Ga0105245_10000712	Ga0105245_1000071229	228
36	3300025911	Ga0207654_10085067	Ga0207654_100850673	228
37	3300025927	Ga0207687_10048575	Ga0207687_100485753	228
38	3300005347	Ga0070668_100039496	Ga0070668_1000394964	229
39	3300005367	Ga0070667_100377520	Ga0070667_1003775202	229
40	3300006195	Ga0075366_10023961	Ga0075366_100239614	229
41	3300025972	Ga0207668_10029872	Ga0207668_100298722	229
42	3300050493	nmdc:mga0k408_5104_c2	nmdc:mga0k408_5104_c2_505_1263	229
43	3300006846	Ga0075430_100141939	Ga0075430_1001419393	230
44	3300006880	Ga0075429_100015687	Ga0075429_1000156876	230
45	3300042876	Ga0451577_0170778	Ga0451577_0170778_451_1194	230
46	3300044712	Ga0453684_0000257	Ga0453684_0000257_39448_40191	230
47	3300050508	nmdc:mga09592_12816_c1	nmdc:mga09592_12816_c1_2820_3620	230
48	3300050509	nmdc:mga0qj67_17938_c1	nmdc:mga0qj67_17938_c1_1268_2068	230
49	3300031911	Ga0307412_10180693	Ga0307412_101806932	231
50	3300037471	Ga0395905_0230108	Ga0395905_0230108_134_865	231
51	3300042876	Ga0451577_0064634	Ga0451577_0064634_2128_2886	231
52	3300045051	Ga0451576_0000942	Ga0451576_0000942_41177_41911	232
53	3300045051	Ga0451576_0125566	Ga0451576_0125566_419_1171	232
54	3300048904	Ga0496101_0189249	Ga0496101_0189249_428_1180	232
55	3300048907	Ga0496104_0041483	Ga0496104_0041483_2066_2818	232
56	3300048908	Ga0496105_0049259	Ga0496105_0049259_576_1328	232
57	3300048917	Ga0496114_0007762	Ga0496114_0007762_5950_6702	232
58	3300050510	nmdc:mga06r32_512338_c1	nmdc:mga06r32_512338_c1_122_868	232
59	iso_pu_bacteria	2911138879	2911139347	232
60	3300005841	Ga0068863_100329233	Ga0068863_1003292331	233
61	3300031995	Ga0307409_100186161	Ga0307409_1001861612	233
62	iso_pu_bacteria	2522125168	2522549795	233
63	3300025913	Ga0207695_10330049	Ga0207695_103300492	234
64	3300025914	Ga0207671_10144821	Ga0207671_101448212	234
65	3300031595	Ga0265313_10078499	Ga0265313_100784991	234
66	3300028800	Ga0265338_10001453	Ga0265338_100014538	235
67	3300031240	Ga0265320_10017575	Ga0265320_100175754	235
68	3300031242	Ga0265329_10036614	Ga0265329_100366142	235
69	3300031249	Ga0265339_10007866	Ga0265339_100078663	235
70	3300031712	Ga0265342_10006804	Ga0265342_100068047	235
71	3300005614	Ga0068856_100053806	Ga0068856_1000538065	236
72	3300009553	Ga0105249_10548980	Ga0105249_105489802	236
73	3300013296	Ga0157374_10086676	Ga0157374_100866763	236
74	3300013306	Ga0163162_10015380	Ga0163162_100153807	236
75	3300014969	Ga0157376_10164684	Ga0157376_101646842	236
76	3300028653	Ga0265323_10000193	Ga0265323_1000019323	236
77	3300028794	Ga0307515_10000180	Ga0307515_1000018060	236
78	3300031251	Ga0265327_10017870	Ga0265327_100178703	236
79	3300031344	Ga0265316_10001635	Ga0265316_1000163519	236
80	3300031616	Ga0307508_10228574	Ga0307508_102285742	236
81	3300031712	Ga0265342_10065890	Ga0265342_100658902	236
82	3300031733	Ga0316577_10074132	Ga0316577_100741322	236
83	3300036712	Ga0316584_0003757	Ga0316584_0003757_672_1385	236
84	3300042876	Ga0451577_0010491	Ga0451577_0010491_6752_7465	236
85	3300042876	Ga0451577_0067284	Ga0451577_0067284_831_1544	236
86	3300042876	Ga0451577_0133839	Ga0451577_0133839_1206_1919	236
87	3300042876	Ga0451577_0152811	Ga0451577_0152811_531_1244	236
88	3300044673	Ga0453683_0000066	Ga0453683_0000066_113686_114399	236
89	3300044673	Ga0453683_0056224	Ga0453683_0056224_51_764	236
90	3300044673	Ga0453683_0097870	Ga0453683_0097870_1019_1732	236
91	3300044712	Ga0453684_0000440	Ga0453684_0000440_150222_150935	236
92	3300044712	Ga0453684_0007360	Ga0453684_0007360_16009_16722	236
93	3300044712	Ga0453684_0012675	Ga0453684_0012675_8585_9298	236
94	3300044712	Ga0453684_0015456	Ga0453684_0015456_9621_10334	236
95	3300044712	Ga0453684_0016232	Ga0453684_0016232_8205_8918	236
96	3300044712	Ga0453684_0031247	Ga0453684_0031247_5731_6444	236
97	3300044712	Ga0453684_0047669	Ga0453684_0047669_1857_2570	236
98	3300044712	Ga0453684_0056215	Ga0453684_0056215_3016_3729	236
99	3300044712	Ga0453684_0070423	Ga0453684_0070423_352_1068	236
100	3300044712	Ga0453684_0129293	Ga0453684_0129293_645_1361	236
101	3300044712	Ga0453684_0273725	Ga0453684_0273725_487_1200	236
102	3300044712	Ga0453684_0435714	Ga0453684_0435714_101_814	236
103	3300044712	Ga0453684_0557985	Ga0453684_0557985_193_906	236
104	3300044712	Ga0453684_0572675	Ga0453684_0572675_35_748	236
105	3300044712	Ga0453684_0855368	Ga0453684_0855368_67_780	236
106	3300045051	Ga0451576_0000783	Ga0451576_0000783_50390_51103	236
107	3300045051	Ga0451576_0016080	Ga0451576_0016080_5340_6053	236
108	3300045051	Ga0451576_0157578	Ga0451576_0157578_827_1540	236
109	3300045051	Ga0451576_0285269	Ga0451576_0285269_444_1157	236
110	3300045051	Ga0451576_0670764	Ga0451576_0670764_13_726	236
111	3300046539	Ga0495621_0044127	Ga0495621_0044127_619_1404	236
112	3300003316	rootH1_10000267	rootH1_1000026710	237
113	3300003322	rootL2_10007616	rootL2_100076163	237
114	3300003781	Ga0055536_1005218	Ga0055536_10052185	237
115	3300005262	Ga0065165_1000083	Ga0065165_100008398	237
116	3300005347	Ga0070668_100483787	Ga0070668_1004837871	237
117	3300005616	Ga0068852_100390209	Ga0068852_1003902092	237
118	3300013104	Ga0157370_10067902	Ga0157370_100679022	237
119	3300025292	Ga0209676_1000626	Ga0209676_100062612	237
120	3300031727	Ga0316576_10238390	Ga0316576_102383902	237
121	3300031731	Ga0307405_10640839	Ga0307405_106408391	237
122	3300031911	Ga0307412_10212296	Ga0307412_102122961	237
123	3300032004	Ga0307414_10059141	Ga0307414_100591414	237
124	3300036712	Ga0316584_0266798	Ga0316584_0266798_245_961	237
125	3300039062	Ga0400483_074169	Ga0400483_074169_691_1407	237
126	3300042876	Ga0451577_0077115	Ga0451577_0077115_71_793	237
127	3300042876	Ga0451577_0127331	Ga0451577_0127331_1324_2040	237
128	3300042876	Ga0451577_0144899	Ga0451577_0144899_984_1730	237
129	3300044673	Ga0453683_0121105	Ga0453683_0121105_222_938	237
130	3300044712	Ga0453684_0003919	Ga0453684_0003919_23735_24451	237
131	3300044712	Ga0453684_0004685	Ga0453684_0004685_24596_25318	237
132	3300044712	Ga0453684_0010392	Ga0453684_0010392_452_1168	237
133	3300045051	Ga0451576_0070413	Ga0451576_0070413_990_1706	237
134	3300045051	Ga0451576_0119390	Ga0451576_0119390_56_814	237
135	3300045051	Ga0451576_0549178	Ga0451576_0549178_435_1151	237
136	3300049669	Ga0501235_042525	Ga0501235_042525_264_983	237
137	3300049679	Ga0501249_027919	Ga0501249_027919_272_991	237
138	3300053133	Ga0500655_007030	Ga0500655_007030_680_1396	237
139	3300053151	Ga0500604_0081422	Ga0500604_0081422_121_837	237
140	3300053156	Ga0500622_0000049	Ga0500622_0000049_144054_144770	237
141	3300053156	Ga0500622_0000056	Ga0500622_0000056_1151_1867	237
142	3300053158	Ga0500627_0054057	Ga0500627_0054057_395_1111	237
143	3300003320	rootH2_10088503	rootH2_100885031	238
144	3300005328	Ga0070676_10071093	Ga0070676_100710933	238
145	3300005330	Ga0070690_100010179	Ga0070690_1000101794	238
146	3300005334	Ga0068869_100057537	Ga0068869_1000575371	238
147	3300005335	Ga0070666_10023270	Ga0070666_100232704	238
148	3300005338	Ga0068868_100050975	Ga0068868_1000509753	238
149	3300005340	Ga0070689_100054759	Ga0070689_1000547593	238
150	3300005344	Ga0070661_100201590	Ga0070661_1002015902	238
151	3300005354	Ga0070675_100010417	Ga0070675_1000104175	238
152	3300005355	Ga0070671_100035021	Ga0070671_1000350214	238
153	3300005364	Ga0070673_100048394	Ga0070673_1000483943	238
154	3300005365	Ga0070688_100068293	Ga0070688_1000682932	238
155	3300005366	Ga0070659_100307267	Ga0070659_1003072672	238
156	3300005535	Ga0070684_100124826	Ga0070684_1001248263	238
157	3300005618	Ga0068864_100009971	Ga0068864_1000099717	238
158	3300005841	Ga0068863_100020787	Ga0068863_1000207873	238
159	3300005842	Ga0068858_100032464	Ga0068858_1000324643	238
160	3300006358	Ga0068871_100153563	Ga0068871_1001535631	238
161	3300009094	Ga0111539_10009683	Ga0111539_100096833	238
162	3300014325	Ga0163163_10037474	Ga0163163_100374746	238
163	3300014745	Ga0157377_10201891	Ga0157377_102018912	238
164	3300025321	Ga0207656_10032599	Ga0207656_100325992	238
165	3300025903	Ga0207680_10115920	Ga0207680_101159202	238
166	3300025907	Ga0207645_10055716	Ga0207645_100557163	238
167	3300025923	Ga0207681_10195247	Ga0207681_101952472	238
168	3300025926	Ga0207659_10009237	Ga0207659_100092374	238
169	3300025931	Ga0207644_10015626	Ga0207644_100156263	238
170	3300025933	Ga0207706_10391455	Ga0207706_103914552	238
171	3300025942	Ga0207689_10013353	Ga0207689_100133534	238
172	3300025944	Ga0207661_10081303	Ga0207661_100813032	238
173	3300025945	Ga0207679_10040394	Ga0207679_100403942	238
174	3300025960	Ga0207651_10040675	Ga0207651_100406753	238
175	3300025986	Ga0207658_10033970	Ga0207658_100339702	238
176	3300026023	Ga0207677_10055234	Ga0207677_100552343	238
177	3300026095	Ga0207676_10008687	Ga0207676_100086877	238
178	3300026121	Ga0207683_10049353	Ga0207683_100493534	238
179	3300028381	Ga0268264_10145206	Ga0268264_101452061	238
180	3300031235	Ga0265330_10005959	Ga0265330_100059594	238
181	3300031235	Ga0265330_10009787	Ga0265330_100097873	238
182	3300031344	Ga0265316_10002572	Ga0265316_1000257215	238
183	3300031712	Ga0265342_10176288	Ga0265342_101762882	238
184	3300031727	Ga0316576_10009653	Ga0316576_100096536	238
185	3300031727	Ga0316576_10291571	Ga0316576_102915712	238
186	3300031727	Ga0316576_10325145	Ga0316576_103251452	238
187	3300031728	Ga0316578_10000597	Ga0316578_1000059711	238
188	3300032137	Ga0316585_10035743	Ga0316585_100357432	238
189	3300032139	Ga0316580_10024236	Ga0316580_100242362	238
190	3300035398	Ga0316574_0188679	Ga0316574_0188679_131_850	238
191	3300036647	Ga0316582_0016799	Ga0316582_0016799_1472_2191	238
192	3300036647	Ga0316582_0085216	Ga0316582_0085216_977_1696	238
193	3300036647	Ga0316582_0447954	Ga0316582_0447954_154_873	238
194	3300036712	Ga0316584_0008350	Ga0316584_0008350_342_1061	238
195	3300036712	Ga0316584_0153941	Ga0316584_0153941_516_1235	238
196	3300041511	Ga0451855_1620512	Ga0451855_1620512_51_770	238
197	3300042876	Ga0451577_0292677	Ga0451577_0292677_668_1450	238
198	3300044712	Ga0453684_0001121	Ga0453684_0001121_7446_8165	238
199	3300045051	Ga0451576_0088503	Ga0451576_0088503_168_887	238
200	3300045051	Ga0451576_0313736	Ga0451576_0313736_615_1334	238
201	3300048904	Ga0496101_0459085	Ga0496101_0459085_113_898	238
202	3300048913	Ga0496110_0115353	Ga0496110_0115353_406_1191	238
203	3300053142	Ga0500577_0252742	Ga0500577_0252742_40_756	238
204	3300028794	Ga0307515_10106662	Ga0307515_101066623	239
205	3300044712	Ga0453684_0015449	Ga0453684_0015449_7315_8037	239
206	3300044712	Ga0453684_0043657	Ga0453684_0043657_3692_4414	239
207	3300005367	Ga0070667_100326564	Ga0070667_1003265642	240
208	3300025986	Ga0207658_10065926	Ga0207658_100659263	240
209	3300028573	Ga0265334_10068411	Ga0265334_100684112	240
210	3300028666	Ga0265336_10010282	Ga0265336_100102823	240
211	3300031238	Ga0265332_10039403	Ga0265332_100394032	240
212	3300044673	Ga0453683_0145487	Ga0453683_0145487_169_912	240
213	3300044712	Ga0453684_0256338	Ga0453684_0256338_689_1432	240
214	3300045051	Ga0451576_0001153	Ga0451576_0001153_742_1485	240
215	3300005336	Ga0070680_100023614	Ga0070680_1000236143	241
216	3300005340	Ga0070689_100000005	Ga0070689_10000000541	241
217	3300005458	Ga0070681_10008306	Ga0070681_100083064	241
218	3300005530	Ga0070679_100016306	Ga0070679_1000163066	241
219	3300005535	Ga0070684_100187966	Ga0070684_1001879663	241
220	3300005544	Ga0070686_100147071	Ga0070686_1001470712	241
221	3300009174	Ga0105241_10066975	Ga0105241_100669752	241
222	3300009551	Ga0105238_10268737	Ga0105238_102687371	241
223	3300013308	Ga0157375_11239821	Ga0157375_112398211	241
224	3300025912	Ga0207707_10011169	Ga0207707_100111696	241
225	3300025917	Ga0207660_10048694	Ga0207660_100486942	241
226	3300025921	Ga0207652_10014724	Ga0207652_100147244	241
227	3300025936	Ga0207670_10000004	Ga0207670_10000004419	241
228	3300045051	Ga0451576_0317198	Ga0451576_0317198_537_1304	241
229	3300049822	Ga0501035_0046871	Ga0501035_0046871_1173_1958	241
230	3300005367	Ga0070667_100500367	Ga0070667_1005003672	242
231	3300005435	Ga0070714_100036152	Ga0070714_1000361523	242
232	3300006946	Ga0079104_1000002	Ga0079104_1000002321	242
233	3300009093	Ga0105240_10149162	Ga0105240_101491623	242
234	3300013102	Ga0157371_10329636	Ga0157371_103296361	242
235	3300025913	Ga0207695_10374801	Ga0207695_103748012	242
236	3300025916	Ga0207663_10172433	Ga0207663_101724332	242
237	3300025929	Ga0207664_10065137	Ga0207664_100651372	242
238	3300026078	Ga0207702_10119023	Ga0207702_101190232	242
239	3300027111	Ga0209281_1000007	Ga0209281_1000007539	242
240	3300028794	Ga0307515_10000080	Ga0307515_10000080171	242
241	3300045051	Ga0451576_0098159	Ga0451576_0098159_556_1314	242
242	3300049823	Ga0501044_0161468	Ga0501044_0161468_294_1052	242
243	iso_pu_bacteria	2885192300	2885197899	242
244	3300003320	rootH2_10025884	rootH2_100258846	243
245	3300005548	Ga0070665_100137822	Ga0070665_1001378223	243
246	3300005563	Ga0068855_100121807	Ga0068855_1001218072	243
247	3300006358	Ga0068871_100149906	Ga0068871_1001499062	243
248	3300009148	Ga0105243_10005315	Ga0105243_100053154	243
249	3300014969	Ga0157376_10833368	Ga0157376_108333682	243
250	3300025302	Ga0207426_1040385	Ga0207426_10403852	243
251	3300025935	Ga0207709_10000015	Ga0207709_10000015314	243
252	3300028379	Ga0268266_10135790	Ga0268266_101357902	243
253	3300031238	Ga0265332_10000009	Ga0265332_1000000951	243
254	3300031241	Ga0265325_10020357	Ga0265325_100203572	243
255	3300031595	Ga0265313_10001373	Ga0265313_1000137323	243
256	3300037471	Ga0395905_0261658	Ga0395905_0261658_803_1534	243
257	3300044712	Ga0453684_0815845	Ga0453684_0815845_38_787	243
258	3300049589	Ga0501073_0052716	Ga0501073_0052716_179_934	243
259	3300049654	Ga0501207_000453	Ga0501207_000453_950_1684	243
260	3300049686	Ga0501257_000925	Ga0501257_000925_4756_5490	243
261	3300049688	Ga0501259_009186	Ga0501259_009186_642_1376	243
262	3300049705	Ga0501225_0006505	Ga0501225_0006505_296_1030	243
263	3300049742	Ga0501080_0224496	Ga0501080_0224496_343_1086	243
264	3300053122	Ga0500608_146039	Ga0500608_146039_207_974	243
265	3300003323	rootH1_10209635	rootH1_102096351	244
266	3300005547	Ga0070693_100060705	Ga0070693_1000607052	244
267	3300005578	Ga0068854_100043140	Ga0068854_1000431402	244
268	3300014968	Ga0157379_10758873	Ga0157379_107588731	244
269	3300025909	Ga0207705_10082235	Ga0207705_100822352	244
270	3300028563	Ga0265319_1003232	Ga0265319_100323210	244
271	3300028794	Ga0307515_10000084	Ga0307515_10000084106	244
272	3300028794	Ga0307515_10231470	Ga0307515_102314702	244
273	3300030522	Ga0307512_10128276	Ga0307512_101282762	244
274	3300031235	Ga0265330_10029130	Ga0265330_100291303	244
275	3300031240	Ga0265320_10008527	Ga0265320_100085274	244
276	3300031249	Ga0265339_10036707	Ga0265339_100367071	244
277	3300031456	Ga0307513_10002929	Ga0307513_1000292911	244
278	3300031456	Ga0307513_10016692	Ga0307513_100166925	244
279	3300031649	Ga0307514_10000319	Ga0307514_1000031956	244
280	3300031711	Ga0265314_10026568	Ga0265314_100265683	244
281	3300031711	Ga0265314_10088190	Ga0265314_100881902	244
282	3300049573	Ga0501037_0028228	Ga0501037_0028228_3147_3908	244
283	3300002067	JGI24735J21928_10044636	JGI24735J21928_100446362	245
284	3300003187	JGI25151J46595_10074619	JGI25151J46595_100746192	245
285	3300005327	Ga0070658_10002038	Ga0070658_1000203810	245
286	3300005334	Ga0068869_100245042	Ga0068869_1002450422	245
287	3300005343	Ga0070687_100123949	Ga0070687_1001239492	245
288	3300005354	Ga0070675_100633764	Ga0070675_1006337642	245
289	3300005355	Ga0070671_100159230	Ga0070671_1001592302	245
290	3300005364	Ga0070673_100191216	Ga0070673_1001912161	245
291	3300005365	Ga0070688_100186188	Ga0070688_1001861882	245
292	3300005466	Ga0070685_10450847	Ga0070685_104508471	245
293	3300006048	Ga0075363_100046125	Ga0075363_1000461253	245
294	3300006177	Ga0075362_10032078	Ga0075362_100320783	245
295	3300006195	Ga0075366_10080306	Ga0075366_100803063	245
296	3300006195	Ga0075366_10275820	Ga0075366_102758201	245
297	3300006353	Ga0075370_10015981	Ga0075370_100159813	245
298	3300015261	Ga0182006_1095082	Ga0182006_10950822	245
299	3300025294	Ga0209025_1062095	Ga0209025_10620953	245
300	3300025901	Ga0207688_10298579	Ga0207688_102985792	245
301	3300025909	Ga0207705_10006770	Ga0207705_100067709	245
302	3300025914	Ga0207671_10140612	Ga0207671_101406123	245
303	3300025918	Ga0207662_10191669	Ga0207662_101916692	245
304	3300031456	Ga0307513_10196785	Ga0307513_101967852	245
305	3300031548	Ga0307408_100195866	Ga0307408_1001958662	245
306	3300031727	Ga0316576_10085103	Ga0316576_100851032	245
307	3300031852	Ga0307410_10127163	Ga0307410_101271632	245
308	3300031852	Ga0307410_10193554	Ga0307410_101935542	245
309	3300031911	Ga0307412_10058617	Ga0307412_100586172	245
310	3300032004	Ga0307414_10175576	Ga0307414_101755762	245
311	3300032126	Ga0307415_100235814	Ga0307415_1002358142	245
312	3300035398	Ga0316574_0043088	Ga0316574_0043088_901_1668	245
313	3300041404	Ga0439436_0000941	Ga0439436_0000941_3831_4574	245
314	3300041404	Ga0439436_0004752	Ga0439436_0004752_2061_2804	245
315	3300041406	Ga0439439_0005691	Ga0439439_0005691_1782_2525	245
316	3300041406	Ga0439439_0055201	Ga0439439_0055201_266_1009	245
317	3300041407	Ga0439447_031174	Ga0439447_031174_276_1019	245
318	3300041411	Ga0439466_0010962	Ga0439466_0010962_706_1449	245
319	3300041997	Ga0439431_0000136	Ga0439431_0000136_1419_2162	245
320	3300041999	Ga0439433_0000676	Ga0439433_0000676_2614_3357	245
321	3300041999	Ga0439433_0006006	Ga0439433_0006006_421_1164	245
322	3300042002	Ga0439442_002772	Ga0439442_002772_2040_2783	245
323	3300042002	Ga0439442_005065	Ga0439442_005065_1465_2208	245
324	3300042004	Ga0439445_0010992	Ga0439445_0010992_1088_1831	245
325	3300042006	Ga0439432_001610	Ga0439432_001610_6915_7658	245
326	3300042006	Ga0439432_003327	Ga0439432_003327_5218_5961	245
327	3300042007	Ga0439449_0000231	Ga0439449_0000231_1359_2102	245
328	3300042007	Ga0439449_0003040	Ga0439449_0003040_5589_6332	245
329	3300042010	Ga0439452_001605	Ga0439452_001605_4231_4974	245
330	3300042014	Ga0439457_001194	Ga0439457_001194_3738_4481	245
331	3300042128	Ga0450897_002059	Ga0450897_002059_153_905	245
332	3300042131	Ga0450894_002638	Ga0450894_002638_935_1678	245
333	3300042132	Ga0450895_004198	Ga0450895_004198_164_907	245
334	3300042145	Ga0450906_014575	Ga0450906_014575_516_1259	245
335	3300042184	Ga0450908_003584	Ga0450908_003584_1980_2723	245
336	3300042185	Ga0450909_003671	Ga0450909_003671_744_1487	245
337	3300042435	Ga0439434_0002408	Ga0439434_0002408_1728_2471	245
338	3300042435	Ga0439434_0009538	Ga0439434_0009538_2046_2789	245
339	3300048919	Ga0496116_0013288	Ga0496116_0013288_655_1398	245
340	3300048920	Ga0496117_0011404	Ga0496117_0011404_3717_4460	245
341	3300048924	Ga0496121_0053687	Ga0496121_0053687_1767_2510	245
342	3300048926	Ga0496123_0184095	Ga0496123_0184095_145_888	245
343	3300048927	Ga0496124_0210660	Ga0496124_0210660_55_843	245
344	3300049584	Ga0501068_0061621	Ga0501068_0061621_209_958	245
345	3300050489	nmdc:mga03683_8148_c1	nmdc:mga03683_8148_c1_2826_3569	245
346	3300050490	nmdc:mga03n38_6656_c1	nmdc:mga03n38_6656_c1_2384_3127	245
347	3300050493	nmdc:mga0k408_106905_c1	nmdc:mga0k408_106905_c1_116_859	245
348	3300050493	nmdc:mga0k408_251584_c1	nmdc:mga0k408_251584_c1_241_984	245
349	3300050496	nmdc:mga07m45_9617_c1	nmdc:mga07m45_9617_c1_342_1085	245
350	3300053145	Ga0500586_045582	Ga0500586_045582_644_1435	245
351	iso_pu_bacteria	2643221658	2644324567	245
352	iso_pu_bacteria	2738543013	2739248172	245
353	iso_pu_bacteria	2939631187	2939632625	245
354	3300005331	Ga0070670_100011039	Ga0070670_1000110397	246
355	3300005518	Ga0070699_100182579	Ga0070699_1001825792	246
356	3300005618	Ga0068864_100037444	Ga0068864_1000374443	246
357	3300005834	Ga0068851_10078933	Ga0068851_100789333	246
358	3300006038	Ga0075365_10050774	Ga0075365_100507743	246
359	3300006042	Ga0075368_10005874	Ga0075368_100058744	246
360	3300006048	Ga0075363_100009000	Ga0075363_1000090006	246
361	3300006177	Ga0075362_10082115	Ga0075362_100821152	246
362	3300006178	Ga0075367_10010036	Ga0075367_100100364	246
363	3300006195	Ga0075366_10021908	Ga0075366_100219083	246
364	3300006353	Ga0075370_10067217	Ga0075370_100672172	246
365	3300006846	Ga0075430_100520423	Ga0075430_1005204231	246
366	3300006847	Ga0075431_100043478	Ga0075431_1000434784	246
367	3300006880	Ga0075429_100020001	Ga0075429_1000200014	246
368	3300006880	Ga0075429_100058629	Ga0075429_1000586292	246
369	3300007076	Ga0075435_100245154	Ga0075435_1002451542	246
370	3300025918	Ga0207662_10053759	Ga0207662_100537592	246
371	3300025925	Ga0207650_10007645	Ga0207650_100076457	246
372	3300026095	Ga0207676_10041317	Ga0207676_100413172	246
373	3300027866	Ga0209813_10099854	Ga0209813_100998542	246
374	3300028556	Ga0265337_1034402	Ga0265337_10344022	246
375	3300028794	Ga0307515_10231523	Ga0307515_102315232	246
376	3300028800	Ga0265338_10080234	Ga0265338_100802343	246
377	3300029957	Ga0265324_10000411	Ga0265324_1000041110	246
378	3300031241	Ga0265325_10163664	Ga0265325_101636642	246
379	3300031249	Ga0265339_10000018	Ga0265339_1000001811	246
380	3300031712	Ga0265342_10020107	Ga0265342_100201072	246
381	3300035090	Ga0373949_0003177	Ga0373949_0003177_1841_2599	246
382	3300035691	Ga0373931_0072969	Ga0373931_0072969_442_1200	246
383	3300036401	Ga0373937_0825622	Ga0373937_0825622_44_796	246
384	3300039062	Ga0400483_125235	Ga0400483_125235_4395_5147	246
385	3300039062	Ga0400483_287756	Ga0400483_287756_12199_12951	246
386	3300049571	Ga0501034_0003819	Ga0501034_0003819_2311_3054	246
387	3300049585	Ga0501069_0003526	Ga0501069_0003526_1004_1762	246
388	3300049586	Ga0501070_0078268	Ga0501070_0078268_766_1524	246
389	3300049587	Ga0501071_0123363	Ga0501071_0123363_948_1706	246
390	3300049588	Ga0501072_0237732	Ga0501072_0237732_307_1065	246
391	3300049744	Ga0501083_0003972	Ga0501083_0003972_842_1585	246
392	3300049823	Ga0501044_0037610	Ga0501044_0037610_1027_1770	246
393	3300050489	nmdc:mga03683_41929_c1	nmdc:mga03683_41929_c1_303_1046	246
394	3300050492	nmdc:mga0yw44_205157_c1	nmdc:mga0yw44_205157_c1_490_1233	246
395	3300050493	nmdc:mga0k408_37821_c1	nmdc:mga0k408_37821_c1_333_1076	246
396	3300050494	nmdc:mga06z11_223153_c1	nmdc:mga06z11_223153_c1_15_773	246
397	3300050495	nmdc:mga04h51_41362_c1	nmdc:mga04h51_41362_c1_489_1232	246
398	3300050508	nmdc:mga09592_61093_c1	nmdc:mga09592_61093_c1_1801_2559	246
399	3300050510	nmdc:mga06r32_92200_c1	nmdc:mga06r32_92200_c1_600_1358	246
400	3300060353	Ga0501082_0107267	Ga0501082_0107267_106_864	246
401	iso_pu_bacteria	2881101125	2881105460	246
402	3300005329	Ga0070683_100000397	Ga0070683_1000003977	247
403	3300005331	Ga0070670_100508468	Ga0070670_1005084681	247
404	3300005365	Ga0070688_100209042	Ga0070688_1002090422	247
405	3300005616	Ga0068852_100069757	Ga0068852_1000697572	247
406	3300006038	Ga0075365_10117294	Ga0075365_101172943	247
407	3300014968	Ga0157379_10356949	Ga0157379_103569491	247
408	3300025292	Ga0209676_1001793	Ga0209676_100179313	247
409	3300025298	Ga0209050_1001046	Ga0209050_100104613	247
410	3300025303	Ga0209051_1000976	Ga0209051_100097626	247
411	3300025304	Ga0209257_1001281	Ga0209257_100128128	247
412	3300025944	Ga0207661_10002800	Ga0207661_100028006	247
413	3300026142	Ga0207698_10114659	Ga0207698_101146593	247
414	3300039093	Ga0400489_13079	Ga0400489_13079_458_1222	247
415	3300041404	Ga0439436_0048133	Ga0439436_0048133_282_1028	247
416	3300042010	Ga0439452_062431	Ga0439452_062431_44_790	247
417	3300042135	Ga0450899_002843	Ga0450899_002843_354_1100	247
418	3300042156	Ga0439446_0008739	Ga0439446_0008739_1374_2120	247
419	3300044673	Ga0453683_0001628	Ga0453683_0001628_12848_13594	247
420	3300045051	Ga0451576_0003704	Ga0451576_0003704_1681_2427	247
421	3300048904	Ga0496101_0120213	Ga0496101_0120213_526_1281	247
422	3300048910	Ga0496107_0115862	Ga0496107_0115862_897_1652	247
423	3300048918	Ga0496115_0024922	Ga0496115_0024922_1744_2499	247
424	3300048924	Ga0496121_0003789	Ga0496121_0003789_4524_5276	247
425	3300050489	nmdc:mga03683_102652_c1	nmdc:mga03683_102652_c1_333_1082	247
426	3300050491	nmdc:mga00v17_266647_c1	nmdc:mga00v17_266647_c1_102_851	247
427	3300050492	nmdc:mga0yw44_275680_c1	nmdc:mga0yw44_275680_c1_365_1111	247
428	iso_pu_bacteria	2928084124	2928086689	247
429	3300005436	Ga0070713_100221378	Ga0070713_1002213782	248
430	3300005466	Ga0070685_10278376	Ga0070685_102783762	248
431	3300017792	Ga0163161_10034930	Ga0163161_100349304	248
432	3300025926	Ga0207659_10123971	Ga0207659_101239713	248
433	3300025928	Ga0207700_10041338	Ga0207700_100413382	248
434	3300025972	Ga0207668_10103567	Ga0207668_101035671	248
435	3300026121	Ga0207683_10106762	Ga0207683_101067623	248
436	3300028794	Ga0307515_10000265	Ga0307515_1000026585	248
437	3300031548	Ga0307408_100323225	Ga0307408_1003232252	248
438	3300035113	Ga0373936_0086232	Ga0373936_0086232_143_889	248
439	3300035695	Ga0373927_0233778	Ga0373927_0233778_10_756	248
440	3300036712	Ga0316584_0334423	Ga0316584_0334423_38_805	248
441	3300037466	Ga0395898_0130946	Ga0395898_0130946_684_1436	248
442	3300039447	Ga0436361_0614584	Ga0436361_0614584_981_1778	248
443	3300041413	Ga0439465_0023629	Ga0439465_0023629_748_1503	248
444	3300042004	Ga0439445_0062076	Ga0439445_0062076_108_863	248
445	3300042007	Ga0439449_0001881	Ga0439449_0001881_3727_4482	248
446	3300042115	Ga0450911_000302	Ga0450911_000302_13963_14718	248
447	3300042876	Ga0451577_0033651	Ga0451577_0033651_3716_4498	248
448	3300046539	Ga0495621_0005665	Ga0495621_0005665_1406_2161	248
449	3300046615	Ga0495656_0001522	Ga0495656_0001522_5391_6146	248
450	3300046615	Ga0495656_0020916	Ga0495656_0020916_1377_2129	248
451	3300048928	Ga0496125_0017503	Ga0496125_0017503_1995_2768	248
452	3300048928	Ga0496125_0022653	Ga0496125_0022653_1217_1972	248
453	3300048928	Ga0496125_0031594	Ga0496125_0031594_1528_2283	248
454	3300048929	Ga0496126_0131458	Ga0496126_0131458_653_1408	248
455	3300049571	Ga0501034_0002214	Ga0501034_0002214_15708_16481	248
456	3300053125	Ga0500618_004835	Ga0500618_004835_3317_4075	248
457	iso_pu_bacteria	2738541277	2738719065	248
458	iso_pu_bacteria	2738543019	2739281827	248
459	iso_pu_bacteria	2842677519	2842682310	248
460	iso_pu_bacteria	2904449895	2904450514	248
461	iso_pu_bacteria	2904456579	2904456662	248
462	iso_pu_bacteria	2929520902	2929521229	248
463	iso_pu_bacteria	2945945610	2945949249	248
464	iso_pu_bacteria	2945972063	2945973293	248
465	iso_pu_bacteria	2954767861	2954768614	248
466	3300003773	Ga0055537_1000881	Ga0055537_100088112	249
467	3300003784	Ga0055534_1000826	Ga0055534_10008267	249
468	3300003790	Ga0055528_1003272	Ga0055528_10032726	249
469	3300003794	Ga0055531_10000730	Ga0055531_1000073017	249
470	3300005356	Ga0070674_100289990	Ga0070674_1002899902	249
471	3300005719	Ga0068861_100135613	Ga0068861_1001356132	249
472	3300006948	Ga0099826_10003829	Ga0099826_100038297	249
473	3300009093	Ga0105240_10043762	Ga0105240_100437623	249
474	3300021384	Ga0213876_10058103	Ga0213876_100581032	249
475	3300025263	Ga0209565_1000046	Ga0209565_100004635	249
476	3300025273	Ga0209673_1000053	Ga0209673_100005343	249
477	3300025291	Ga0209675_1000010	Ga0209675_1000010324	249
478	3300025297	Ga0209758_1053408	Ga0209758_10534082	249
479	3300025303	Ga0209051_1000244	Ga0209051_100024427	249
480	3300025304	Ga0209257_1000144	Ga0209257_1000144152	249
481	3300025960	Ga0207651_10245023	Ga0207651_102450232	249
482	3300026023	Ga0207677_10065025	Ga0207677_100650253	249
483	3300026118	Ga0207675_100238892	Ga0207675_1002388922	249
484	3300027666	Ga0209282_1052535	Ga0209282_10525353	249
485	3300031727	Ga0316576_10013052	Ga0316576_100130521	249
486	3300031730	Ga0307516_10147070	Ga0307516_101470702	249
487	3300037471	Ga0395905_0005085	Ga0395905_0005085_5083_5838	249
488	3300039437	Ga0436365_1180975	Ga0436365_1180975_941_1699	249
489	3300041486	Ga0451807_2561322	Ga0451807_2561322_219_980	249
490	3300046525	Ga0495663_0013211	Ga0495663_0013211_1184_1936	249
491	3300046528	Ga0495642_0040756	Ga0495642_0040756_691_1443	249
492	3300046674	Ga0495588_0065730	Ga0495588_0065730_903_1655	249
493	3300049823	Ga0501044_0702254	Ga0501044_0702254_13_768	249
494	iso_pu_bacteria	2643221628	2644162401	249
495	iso_pu_bacteria	2842733646	2842734313	249
496	iso_pu_bacteria	2904479285	2904483481	249
497	iso_pu_bacteria	2928115317	2928115652	249
498	iso_pu_bacteria	2932422444	2932424792	249
499	3300003784	Ga0055534_1000614	Ga0055534_100061418	250
500	3300005262	Ga0065165_1030189	Ga0065165_10301893	250
501	3300005334	Ga0068869_100589447	Ga0068869_1005894471	250
502	3300005341	Ga0070691_10089834	Ga0070691_100898343	250
503	3300005614	Ga0068856_100648483	Ga0068856_1006484831	250
504	3300005834	Ga0068851_10352277	Ga0068851_103522771	250
505	3300009093	Ga0105240_10060597	Ga0105240_100605974	250
506	3300009551	Ga0105238_10038345	Ga0105238_100383453	250
507	3300025284	Ga0209130_1013707	Ga0209130_10137073	250
508	3300025291	Ga0209675_1003161	Ga0209675_10031617	250
509	3300025303	Ga0209051_1010982	Ga0209051_10109824	250
510	3300025304	Ga0209257_1005717	Ga0209257_10057176	250
511	3300025912	Ga0207707_10122228	Ga0207707_101222282	250
512	3300025919	Ga0207657_10017805	Ga0207657_100178056	250
513	3300025924	Ga0207694_10128368	Ga0207694_101283682	250
514	3300025949	Ga0207667_10170872	Ga0207667_101708722	250
515	3300025972	Ga0207668_10201882	Ga0207668_102018821	250
516	3300027614	Ga0209970_1000149	Ga0209970_10001497	250
517	3300027665	Ga0209983_1003887	Ga0209983_10038872	250
518	3300044673	Ga0453683_0315935	Ga0453683_0315935_17_796	250
519	iso_pu_bacteria	2643221683	2644464548	250
520	iso_pu_bacteria	2738541307	2738880088	250
521	iso_pu_bacteria	2842747753	2842749436	250
522	3300005327	Ga0070658_10143973	Ga0070658_101439733	251
523	3300005563	Ga0068855_100155862	Ga0068855_1001558623	251
524	3300006178	Ga0075367_10189134	Ga0075367_101891342	251
525	3300009092	Ga0105250_10001857	Ga0105250_100018575	251
526	3300009545	Ga0105237_10026693	Ga0105237_100266933	251
527	3300013104	Ga0157370_10179104	Ga0157370_101791043	251
528	3300017792	Ga0163161_10007282	Ga0163161_100072826	251
529	3300025711	Ga0207696_1035103	Ga0207696_10351033	251
530	3300025909	Ga0207705_10173356	Ga0207705_101733562	251
531	3300031711	Ga0265314_10078746	Ga0265314_100787463	251
532	3300031712	Ga0265342_10100287	Ga0265342_101002872	251
533	3300037312	Ga0395899_0019534	Ga0395899_0019534_3124_3882	251
534	3300037312	Ga0395899_0034273	Ga0395899_0034273_1308_2069	251
535	3300037418	Ga0395900_0020449	Ga0395900_0020449_3703_4461	251
536	3300037466	Ga0395898_0031352	Ga0395898_0031352_3046_3804	251
537	3300038443	Ga0395901_0172965	Ga0395901_0172965_1286_2047	251
538	3300038443	Ga0395901_0187310	Ga0395901_0187310_269_1027	251
539	3300038443	Ga0395901_0415487	Ga0395901_0415487_393_1154	251
540	3300039062	Ga0400483_145606	Ga0400483_145606_40242_41012	251
541	3300042007	Ga0439449_0003921	Ga0439449_0003921_3996_4754	251
542	3300042015	Ga0439462_0015872	Ga0439462_0015872_326_1084	251
543	3300042127	Ga0450890_000183	Ga0450890_000183_5279_6142	251
544	3300042129	Ga0450891_000265	Ga0450891_000265_1599_2462	251
545	3300042130	Ga0450892_001981	Ga0450892_001981_321_1184	251
546	3300042142	Ga0450905_024948	Ga0450905_024948_17_880	251
547	3300042144	Ga0450889_000106	Ga0450889_000106_6746_7609	251
548	3300042530	Ga0450916_004645	Ga0450916_004645_214_1077	251
549	3300042876	Ga0451577_0011268	Ga0451577_0011268_4841_5620	251
550	3300044658	Ga0466972_0075738	Ga0466972_0075738_505_1266	251
551	3300044673	Ga0453683_0002265	Ga0453683_0002265_8152_8931	251
552	3300044683	Ga0466965_0093754	Ga0466965_0093754_710_1471	251
553	3300044735	Ga0466968_0024801	Ga0466968_0024801_343_1104	251
554	3300045051	Ga0451576_0024717	Ga0451576_0024717_2720_3499	251
555	3300045051	Ga0451576_0691569	Ga0451576_0691569_110_889	251
556	3300046513	Ga0495616_0007017	Ga0495616_0007017_1783_2541	251
557	3300046515	Ga0495620_0029637	Ga0495620_0029637_884_1642	251
558	3300046518	Ga0495631_0000387	Ga0495631_0000387_5809_6567	251
559	3300046520	Ga0495637_0011280	Ga0495637_0011280_1772_2530	251
560	3300046530	Ga0495654_0006463	Ga0495654_0006463_4898_5656	251
561	3300046539	Ga0495621_0005950	Ga0495621_0005950_1430_2188	251
562	3300046683	Ga0495658_0064760	Ga0495658_0064760_10_768	251
563	3300048911	Ga0496108_0305174	Ga0496108_0305174_31_789	251
564	3300048924	Ga0496121_0034190	Ga0496121_0034190_2141_2899	251
565	3300048925	Ga0496122_0022445	Ga0496122_0022445_3920_4678	251
566	3300048925	Ga0496122_0094605	Ga0496122_0094605_497_1258	251
567	3300048926	Ga0496123_0052597	Ga0496123_0052597_1637_2395	251
568	3300048927	Ga0496124_0039974	Ga0496124_0039974_2464_3225	251
569	3300048928	Ga0496125_0077729	Ga0496125_0077729_1637_2395	251
570	3300049579	Ga0501043_0204789	Ga0501043_0204789_10_771	251
571	3300049589	Ga0501073_0203951	Ga0501073_0203951_135_896	251
572	3300049742	Ga0501080_0398670	Ga0501080_0398670_79_840	251
573	3300049822	Ga0501035_0141154	Ga0501035_0141154_590_1351	251
574	3300049823	Ga0501044_0006083	Ga0501044_0006083_12244_13005	251
575	3300050494	nmdc:mga06z11_167522_c1	nmdc:mga06z11_167522_c1_219_986	251
576	3300053107	Ga0500560_083404	Ga0500560_083404_227_985	251
577	3300053110	Ga0500571_000059	Ga0500571_000059_24340_25098	251
578	3300053118	Ga0500594_0005452	Ga0500594_0005452_1812_2570	251
579	3300053133	Ga0500655_000313	Ga0500655_000313_5722_6480	251
580	3300053139	Ga0500568_0004329	Ga0500568_0004329_5965_6723	251
581	3300053153	Ga0500616_0026839	Ga0500616_0026839_1099_1857	251
582	3300053161	Ga0500634_0033732	Ga0500634_0033732_519_1277	251
583	3300053177	Ga0500636_0000049	Ga0500636_0000049_13048_13812	251
584	3300053177	Ga0500636_0079891	Ga0500636_0079891_15_773	251
585	3300053178	Ga0500637_0132138	Ga0500637_0132138_347_1111	251
586	iso_pu_bacteria	2513020051	2513227805	251
587	iso_pu_bacteria	2643221672	2644396419	251
588	iso_pu_bacteria	2842718218	2842721354	251
589	iso_pu_bacteria	2894023352	2894026929	251
590	iso_pu_bacteria	2919462493	2919462947	251
591	iso_pu_bacteria	2974320154	2974322563	251
592	3300003578	Ga0006562J51391_1088777	Ga0006562J51391_10887773	252
593	3300003578	Ga0006562J51391_1088780	Ga0006562J51391_10887803	252
594	3300003759	Ga0055525_1000004	Ga0055525_1000004465	252
595	3300003792	Ga0055540_1002475	Ga0055540_10024757	252
596	3300005288	Ga0065714_10005438	Ga0065714_100054383	252
597	3300005289	Ga0065704_10094233	Ga0065704_100942333	252
598	3300005338	Ga0068868_100488522	Ga0068868_1004885222	252
599	3300005539	Ga0068853_100921568	Ga0068853_1009215681	252
600	3300005614	Ga0068856_100221898	Ga0068856_1002218982	252
601	3300005616	Ga0068852_101015779	Ga0068852_1010157791	252
602	3300005842	Ga0068858_100009976	Ga0068858_1000099766	252
603	3300006038	Ga0075365_10007752	Ga0075365_100077526	252
604	3300006038	Ga0075365_10026590	Ga0075365_100265904	252
605	3300006048	Ga0075363_100031433	Ga0075363_1000314333	252
606	3300006051	Ga0075364_10028222	Ga0075364_100282222	252
607	3300006051	Ga0075364_10151893	Ga0075364_101518932	252
608	3300006058	Ga0075432_10034197	Ga0075432_100341972	252
609	3300006177	Ga0075362_10022360	Ga0075362_100223603	252
610	3300006177	Ga0075362_10032934	Ga0075362_100329342	252
611	3300006195	Ga0075366_10017214	Ga0075366_100172143	252
612	3300006195	Ga0075366_10041971	Ga0075366_100419713	252
613	3300006195	Ga0075366_10222175	Ga0075366_102221752	252
614	3300013100	Ga0157373_10015854	Ga0157373_100158542	252
615	3300014969	Ga0157376_10015391	Ga0157376_100153914	252
616	3300015261	Ga0182006_1086593	Ga0182006_10865932	252
617	3300017792	Ga0163161_10014906	Ga0163161_100149063	252
618	3300025230	Ga0209563_100013	Ga0209563_100013466	252
619	3300025273	Ga0209673_1016555	Ga0209673_10165553	252
620	3300025303	Ga0209051_1000939	Ga0209051_10009396	252
621	3300025961	Ga0207712_10115360	Ga0207712_101153602	252
622	3300026035	Ga0207703_10021862	Ga0207703_100218626	252
623	3300026041	Ga0207639_10165295	Ga0207639_101652953	252
624	3300026078	Ga0207702_10212209	Ga0207702_102122093	252
625	3300026116	Ga0207674_10088052	Ga0207674_100880524	252
626	3300028786	Ga0307517_10115450	Ga0307517_101154502	252
627	3300030731	Ga0316177_1123614	Ga0316177_11236143	252
628	3300030731	Ga0316177_1151208	Ga0316177_11512082	252
629	3300030744	Ga0316181_1025232	Ga0316181_10252323	252
630	3300030745	Ga0316182_1001733	Ga0316182_10017332	252
631	3300031548	Ga0307408_100123756	Ga0307408_1001237562	252
632	3300031649	Ga0307514_10007214	Ga0307514_100072147	252
633	3300031731	Ga0307405_10068623	Ga0307405_100686233	252
634	3300031731	Ga0307405_10217520	Ga0307405_102175202	252
635	3300031901	Ga0307406_10003504	Ga0307406_100035048	252
636	3300031911	Ga0307412_10019540	Ga0307412_100195405	252
637	3300031911	Ga0307412_10182041	Ga0307412_101820412	252
638	3300032004	Ga0307414_10078433	Ga0307414_100784333	252
639	3300032004	Ga0307414_10631888	Ga0307414_106318882	252
640	3300032005	Ga0307411_10262066	Ga0307411_102620662	252
641	3300037466	Ga0395898_0855204	Ga0395898_0855204_51_815	252
642	3300037471	Ga0395905_0040888	Ga0395905_0040888_196_963	252
643	3300037471	Ga0395905_0394955	Ga0395905_0394955_278_1042	252
644	3300041404	Ga0439436_0004681	Ga0439436_0004681_2588_3355	252
645	3300041411	Ga0439466_0009179	Ga0439466_0009179_961_1728	252
646	3300042122	Ga0450920_014788	Ga0450920_014788_554_1321	252
647	3300042138	Ga0450903_001471	Ga0450903_001471_590_1456	252
648	3300042145	Ga0450906_003810	Ga0450906_003810_814_1581	252
649	3300042147	Ga0450910_019663	Ga0450910_019663_175_942	252
650	3300042184	Ga0450908_000659	Ga0450908_000659_4002_4769	252
651	3300042876	Ga0451577_0000641	Ga0451577_0000641_34695_35462	252
652	3300042876	Ga0451577_0048478	Ga0451577_0048478_2749_3519	252
653	3300044712	Ga0453684_0001818	Ga0453684_0001818_20707_21474	252
654	3300045051	Ga0451576_0002104	Ga0451576_0002104_6551_7318	252
655	3300045976	Ga0466967_0171339	Ga0466967_0171339_907_1674	252
656	3300046558	Ga0495633_0014855	Ga0495633_0014855_1214_1984	252
657	3300046660	Ga0495625_0000870	Ga0495625_0000870_24522_25289	252
658	3300048904	Ga0496101_0006461	Ga0496101_0006461_3611_4378	252
659	3300048925	Ga0496122_0099329	Ga0496122_0099329_366_1136	252
660	3300048926	Ga0496123_0136615	Ga0496123_0136615_157_927	252
661	3300049590	Ga0501074_0332709	Ga0501074_0332709_94_876	252
662	3300049679	Ga0501249_007885	Ga0501249_007885_390_1154	252
663	3300049705	Ga0501225_0011438	Ga0501225_0011438_654_1418	252
664	3300049759	Ga0501262_000321	Ga0501262_000321_694_1458	252
665	3300050489	nmdc:mga03683_11937_c1	nmdc:mga03683_11937_c1_1179_1946	252
666	3300050489	nmdc:mga03683_4753_c1	nmdc:mga03683_4753_c1_654_1418	252
667	3300050489	nmdc:mga03683_50779_c1	nmdc:mga03683_50779_c1_880_1653	252
668	3300050490	nmdc:mga03n38_3462_c1	nmdc:mga03n38_3462_c1_990_1757	252
669	3300050490	nmdc:mga03n38_36613_c1	nmdc:mga03n38_36613_c1_1271_2038	252
670	3300050491	nmdc:mga00v17_154708_c1	nmdc:mga00v17_154708_c1_292_1056	252
671	3300050491	nmdc:mga00v17_32558_c2	nmdc:mga00v17_32558_c2_466_1269	252
672	3300050491	nmdc:mga00v17_64632_c1	nmdc:mga00v17_64632_c1_887_1654	252
673	3300050492	nmdc:mga0yw44_4790_c1	nmdc:mga0yw44_4790_c1_2020_2787	252
674	3300050492	nmdc:mga0yw44_68331_c1	nmdc:mga0yw44_68331_c1_584_1354	252
675	3300050493	nmdc:mga0k408_136693_c1	nmdc:mga0k408_136693_c1_172_945	252
676	3300050493	nmdc:mga0k408_23101_c1	nmdc:mga0k408_23101_c1_930_1697	252
677	3300050493	nmdc:mga0k408_330873_c1	nmdc:mga0k408_330873_c1_72_839	252
678	3300050493	nmdc:mga0k408_6458_c1	nmdc:mga0k408_6458_c1_1765_2532	252
679	3300050496	nmdc:mga07m45_21433_c1	nmdc:mga07m45_21433_c1_712_1476	252
680	3300050496	nmdc:mga07m45_92661_c1	nmdc:mga07m45_92661_c1_361_1125	252
681	3300050516	nmdc:mga0sz30_8443_c1	nmdc:mga0sz30_8443_c1_15_779	252
682	3300053122	Ga0500608_144782	Ga0500608_144782_174_941	252
683	iso_pu_bacteria	2919704043	2919707255	252
684	3300002739	JGI25158J39367_1009797	JGI25158J39367_10097972	253
685	3300002773	JGI25152J39213_1002179	JGI25152J39213_10021793	253
686	3300003187	JGI25151J46595_10019329	JGI25151J46595_100193293	253
687	3300003354	JGI25160J50197_1012763	JGI25160J50197_10127633	253
688	3300003374	JGI25161J50226_1004084	JGI25161J50226_10040843	253
689	3300003761	Ga0055535_1000318	Ga0055535_100031823	253
690	3300003762	Ga0055542_1000022	Ga0055542_100002223	253
691	3300003773	Ga0055537_1009896	Ga0055537_10098962	253
692	3300003775	Ga0055524_1013445	Ga0055524_10134453	253
693	3300003781	Ga0055536_1014919	Ga0055536_10149192	253
694	3300003784	Ga0055534_1002108	Ga0055534_10021088	253
695	3300003792	Ga0055540_1015657	Ga0055540_10156573	253
696	3300004625	Ga0055543_1001757	Ga0055543_10017578	253
697	3300005262	Ga0065165_1051348	Ga0065165_10513482	253
698	3300005327	Ga0070658_10177081	Ga0070658_101770812	253
699	3300005338	Ga0068868_100036822	Ga0068868_1000368225	253
700	3300005539	Ga0068853_100018186	Ga0068853_1000181866	253
701	3300005543	Ga0070672_100128528	Ga0070672_1001285282	253
702	3300006353	Ga0075370_10052433	Ga0075370_100524333	253
703	3300009148	Ga0105243_10002687	Ga0105243_100026879	253
704	3300013102	Ga0157371_10048775	Ga0157371_100487753	253
705	3300017792	Ga0163161_10025520	Ga0163161_100255206	253
706	3300025208	Ga0209436_108568	Ga0209436_1085682	253
707	3300025229	Ga0209147_103059	Ga0209147_1030592	253
708	3300025242	Ga0209258_100009	Ga0209258_100009686	253
709	3300025245	Ga0207425_1002594	Ga0207425_10025945	253
710	3300025254	Ga0209148_1000007	Ga0209148_1000007686	253
711	3300025263	Ga0209565_1002940	Ga0209565_10029402	253
712	3300025273	Ga0209673_1000288	Ga0209673_10002889	253
713	3300025284	Ga0209130_1000963	Ga0209130_100096313	253
714	3300025291	Ga0209675_1003275	Ga0209675_10032757	253
715	3300025292	Ga0209676_1000108	Ga0209676_100010828	253
716	3300025292	Ga0209676_1001037	Ga0209676_100103728	253
717	3300025294	Ga0209025_1005001	Ga0209025_10050011	253
718	3300025295	Ga0209564_1000472	Ga0209564_10004729	253
719	3300025297	Ga0209758_1029480	Ga0209758_10294802	253
720	3300025297	Ga0209758_1056022	Ga0209758_10560222	253
721	3300025298	Ga0209050_1000002	Ga0209050_1000002286	253
722	3300025299	Ga0209256_1000098	Ga0209256_100009823	253
723	3300025302	Ga0207426_1000038	Ga0207426_100003823	253
724	3300025303	Ga0209051_1000002	Ga0209051_100000254	253
725	3300025303	Ga0209051_1000590	Ga0209051_100059028	253
726	3300025304	Ga0209257_1000002	Ga0209257_1000002195	253
727	3300025935	Ga0207709_10001107	Ga0207709_1000110713	253
728	3300025940	Ga0207691_10138817	Ga0207691_101388172	253
729	3300026023	Ga0207677_10006219	Ga0207677_100062192	253
730	3300026041	Ga0207639_10006782	Ga0207639_100067828	253
731	3300031911	Ga0307412_10109697	Ga0307412_101096973	253
732	3300032002	Ga0307416_100336962	Ga0307416_1003369622	253
733	3300032005	Ga0307411_10117713	Ga0307411_101177132	253
734	3300037471	Ga0395905_0017351	Ga0395905_0017351_2575_3348	253
735	3300046462	Ga0495651_0315645	Ga0495651_0315645_218_985	253
736	3300046512	Ga0495610_0010895	Ga0495610_0010895_4285_5052	253
737	3300046515	Ga0495620_0008213	Ga0495620_0008213_4678_5445	253
738	3300046520	Ga0495637_0026376	Ga0495637_0026376_101_868	253
739	3300046665	Ga0495661_0206559	Ga0495661_0206559_163_930	253
740	3300046692	Ga0495671_0002650	Ga0495671_0002650_6495_7262	253
741	3300048907	Ga0496104_0264332	Ga0496104_0264332_28_804	253
742	3300048920	Ga0496117_0059062	Ga0496117_0059062_1592_2392	253
743	3300048921	Ga0496118_0011891	Ga0496118_0011891_4101_4901	253
744	3300048927	Ga0496124_0160882	Ga0496124_0160882_520_1320	253
745	3300049824	Ga0501045_0094630	Ga0501045_0094630_115_885	253
746	3300053079	Ga0500610_0002946	Ga0500610_0002946_36_803	253
747	3300053079	Ga0500610_0023763	Ga0500610_0023763_1637_2404	253
748	3300053103	Ga0500555_069644	Ga0500555_069644_136_903	253
749	3300053117	Ga0500593_000173	Ga0500593_000173_21368_22135	253
750	3300053121	Ga0500607_001787	Ga0500607_001787_11768_12535	253
751	3300053128	Ga0500626_004754	Ga0500626_004754_4027_4794	253
752	3300053136	Ga0500559_0011229	Ga0500559_0011229_1897_2664	253
753	3300053158	Ga0500627_0007369	Ga0500627_0007369_633_1400	253
754	iso_pu_bacteria	2599185214	2599625452	253
755	iso_pu_bacteria	2599185226	2599673465	253
756	iso_pu_bacteria	2599185227	2599683135	253
757	iso_pu_bacteria	2599185229	2599695377	253
758	iso_pu_bacteria	2721755523	2722882233	253
759	iso_pu_bacteria	2818991446	2819599556	253
760	iso_pu_bacteria	2839138175	2839142388	253
761	iso_pu_bacteria	2885211737	2885214527	253
762	iso_pu_bacteria	2899924645	2899927814	253
763	iso_pu_bacteria	2928037797	2928041908	253
764	iso_pu_bacteria	2928044640	2928049472	253
765	iso_pu_bacteria	2928051484	2928051852	253
766	iso_pu_bacteria	2928064002	2928065455	253
767	iso_pu_bacteria	2928070936	2928072912	253
768	3300001979	JGI24740J21852_10031024	JGI24740J21852_100310243	254
769	3300005353	Ga0070669_100129958	Ga0070669_1001299581	254
770	3300006042	Ga0075368_10139736	Ga0075368_101397362	254
771	3300013104	Ga0157370_10358210	Ga0157370_103582102	254
772	3300025933	Ga0207706_10010163	Ga0207706_100101635	254
773	3300031731	Ga0307405_10048023	Ga0307405_100480233	254
774	3300046453	Ga0495627_007561	Ga0495627_007561_2489_3262	254
775	3300048925	Ga0496122_0000998	Ga0496122_0000998_26525_27292	254
776	3300048925	Ga0496122_0140175	Ga0496122_0140175_470_1243	254
777	3300048926	Ga0496123_0000045	Ga0496123_0000045_26463_27230	254
778	3300048926	Ga0496123_0020616	Ga0496123_0020616_3506_4279	254
779	3300048927	Ga0496124_0081642	Ga0496124_0081642_452_1219	254
780	3300048928	Ga0496125_0026750	Ga0496125_0026750_943_1743	254
781	3300049568	Ga0501031_0005333	Ga0501031_0005333_4237_5010	254
782	3300053118	Ga0500594_0012360	Ga0500594_0012360_599_1366	254
783	3300053136	Ga0500559_0004716	Ga0500559_0004716_761_1528	254
784	3300053140	Ga0500573_0173453	Ga0500573_0173453_101_868	254
785	3300053141	Ga0500574_015562	Ga0500574_015562_98_868	254
786	3300053160	Ga0500633_0085413	Ga0500633_0085413_369_1136	254
787	3300059421	Ga0590071_002858	Ga0590071_002858_2071_2850	254
788	iso_pu_bacteria	2643221570	2643868185	254
789	iso_pu_bacteria	2643221652	2644293792	254
790	iso_pu_bacteria	2643221717	2644644726	254
791	iso_pu_bacteria	2945909444	2945913655	254
792	iso_pu_bacteria	2945984333	2945990948	254
793	iso_pu_bacteria	2990710928	2990713455	254
794	3300002774	JGI25150J39212_1003727	JGI25150J39212_10037273	255
795	3300002987	JGI25159J45721_1002209	JGI25159J45721_10022097	255
796	3300003316	rootH1_10073277	rootH1_100732772	255
797	3300003354	JGI25160J50197_1013248	JGI25160J50197_10132483	255
798	3300003771	Ga0055526_1015326	Ga0055526_10153263	255
799	3300003773	Ga0055537_1006182	Ga0055537_10061823	255
800	3300003775	Ga0055524_1013457	Ga0055524_10134573	255
801	3300003790	Ga0055528_1013529	Ga0055528_10135293	255
802	3300003794	Ga0055531_10010242	Ga0055531_100102424	255
803	3300004625	Ga0055543_1001710	Ga0055543_10017107	255
804	3300005262	Ga0065165_1004672	Ga0065165_10046727	255
805	3300005366	Ga0070659_100111479	Ga0070659_1001114792	255
806	3300005539	Ga0068853_100015746	Ga0068853_1000157467	255
807	3300005564	Ga0070664_100019897	Ga0070664_1000198973	255
808	3300005577	Ga0068857_100117751	Ga0068857_1001177513	255
809	3300005616	Ga0068852_100075824	Ga0068852_1000758243	255
810	3300006195	Ga0075366_10032058	Ga0075366_100320583	255
811	3300006881	Ga0068865_100314215	Ga0068865_1003142152	255
812	3300006946	Ga0079104_1034992	Ga0079104_10349922	255
813	3300009147	Ga0114129_10167700	Ga0114129_101677003	255
814	3300009148	Ga0105243_10003440	Ga0105243_100034407	255
815	3300009551	Ga0105238_10270281	Ga0105238_102702813	255
816	3300010375	Ga0105239_10326443	Ga0105239_103264432	255
817	3300014326	Ga0157380_10073215	Ga0157380_100732153	255
818	3300014497	Ga0182008_10005290	Ga0182008_100052903	255
819	3300015261	Ga0182006_1003497	Ga0182006_10034972	255
820	3300015262	Ga0182007_10001359	Ga0182007_100013598	255
821	3300025245	Ga0207425_1000798	Ga0207425_10007987	255
822	3300025258	Ga0209129_1000024	Ga0209129_1000024390	255
823	3300025258	Ga0209129_1000085	Ga0209129_1000085171	255
824	3300025263	Ga0209565_1000518	Ga0209565_10005183	255
825	3300025273	Ga0209673_1003947	Ga0209673_10039473	255
826	3300025284	Ga0209130_1000283	Ga0209130_100028335	255
827	3300025291	Ga0209675_1003009	Ga0209675_10030093	255
828	3300025294	Ga0209025_1001124	Ga0209025_100112414	255
829	3300025294	Ga0209025_1039148	Ga0209025_10391481	255
830	3300025295	Ga0209564_1000481	Ga0209564_100048154	255
831	3300025297	Ga0209758_1000049	Ga0209758_1000049309	255
832	3300025299	Ga0209256_1000464	Ga0209256_100046434	255
833	3300025302	Ga0207426_1000053	Ga0207426_1000053345	255
834	3300025303	Ga0209051_1006689	Ga0209051_10066897	255
835	3300025304	Ga0209257_1005969	Ga0209257_10059693	255
836	3300025728	Ga0207655_1001943	Ga0207655_10019439	255
837	3300025927	Ga0207687_10067279	Ga0207687_100672793	255
838	3300025932	Ga0207690_10051373	Ga0207690_100513732	255
839	3300025938	Ga0207704_10262090	Ga0207704_102620902	255
840	3300026116	Ga0207674_10020637	Ga0207674_100206377	255
841	3300028786	Ga0307517_10129728	Ga0307517_101297282	255
842	3300031730	Ga0307516_10000483	Ga0307516_100004836	255
843	3300031911	Ga0307412_10039320	Ga0307412_100393203	255
844	3300031911	Ga0307412_10326232	Ga0307412_103262322	255
845	3300032002	Ga0307416_100195427	Ga0307416_1001954273	255
846	3300037471	Ga0395905_0007311	Ga0395905_0007311_7169_7951	255
847	3300042012	Ga0439455_0036959	Ga0439455_0036959_401_1183	255
848	3300042134	Ga0450898_008214	Ga0450898_008214_671_1453	255
849	3300044683	Ga0466965_0109697	Ga0466965_0109697_32_814	255
850	3300044706	Ga0466964_0119695	Ga0466964_0119695_198_980	255
851	3300048919	Ga0496116_0065668	Ga0496116_0065668_1474_2250	255
852	3300048920	Ga0496117_0015770	Ga0496117_0015770_1154_1930	255
853	3300048921	Ga0496118_0019444	Ga0496118_0019444_1059_1835	255
854	3300048928	Ga0496125_0012583	Ga0496125_0012583_6027_6803	255
855	3300049686	Ga0501257_008922	Ga0501257_008922_596_1378	255
856	3300050491	nmdc:mga00v17_11986_c2	nmdc:mga00v17_11986_c2_1316_2086	255
857	3300050493	nmdc:mga0k408_16726_c1	nmdc:mga0k408_16726_c1_2683_3459	255
858	3300050493	nmdc:mga0k408_200386_c1	nmdc:mga0k408_200386_c1_393_1178	255
859	3300050496	nmdc:mga07m45_30562_c1	nmdc:mga07m45_30562_c1_1706_2482	255
860	3300050507	nmdc:mga05p37_272618_c1	nmdc:mga05p37_272618_c1_508_1293	255
861	iso_pu_bacteria	2547132374	2548499956	255
862	3300003187	JGI25151J46595_10003194	JGI25151J46595_100031947	256
863	3300005329	Ga0070683_100013208	Ga0070683_1000132084	256
864	3300005330	Ga0070690_100147117	Ga0070690_1001471172	256
865	3300005331	Ga0070670_100008161	Ga0070670_1000081617	256
866	3300005333	Ga0070677_10014642	Ga0070677_100146423	256
867	3300005334	Ga0068869_100006018	Ga0068869_1000060186	256
868	3300005334	Ga0068869_100009303	Ga0068869_1000093033	256
869	3300005335	Ga0070666_10005842	Ga0070666_100058425	256
870	3300005338	Ga0068868_100025650	Ga0068868_1000256504	256
871	3300005338	Ga0068868_100078920	Ga0068868_1000789203	256
872	3300005339	Ga0070660_100048463	Ga0070660_1000484633	256
873	3300005339	Ga0070660_100055247	Ga0070660_1000552473	256
874	3300005341	Ga0070691_10105152	Ga0070691_101051522	256
875	3300005344	Ga0070661_100040077	Ga0070661_1000400773	256
876	3300005344	Ga0070661_100091319	Ga0070661_1000913192	256
877	3300005347	Ga0070668_100011100	Ga0070668_1000111004	256
878	3300005353	Ga0070669_100008914	Ga0070669_1000089144	256
879	3300005353	Ga0070669_100036533	Ga0070669_1000365332	256
880	3300005354	Ga0070675_100004779	Ga0070675_1000047797	256
881	3300005354	Ga0070675_100011548	Ga0070675_1000115485	256
882	3300005354	Ga0070675_100017314	Ga0070675_1000173143	256
883	3300005356	Ga0070674_100004964	Ga0070674_1000049647	256
884	3300005364	Ga0070673_100050422	Ga0070673_1000504224	256
885	3300005366	Ga0070659_100005335	Ga0070659_1000053354	256
886	3300005366	Ga0070659_100025278	Ga0070659_1000252783	256
887	3300005367	Ga0070667_100015048	Ga0070667_1000150486	256
888	3300005367	Ga0070667_100016760	Ga0070667_1000167607	256
889	3300005367	Ga0070667_100039535	Ga0070667_1000395352	256
890	3300005455	Ga0070663_100023633	Ga0070663_1000236331	256
891	3300005455	Ga0070663_100064518	Ga0070663_1000645181	256
892	3300005456	Ga0070678_100060993	Ga0070678_1000609933	256
893	3300005456	Ga0070678_100134075	Ga0070678_1001340752	256
894	3300005457	Ga0070662_100012119	Ga0070662_1000121192	256
895	3300005457	Ga0070662_100028703	Ga0070662_1000287035	256
896	3300005458	Ga0070681_10085425	Ga0070681_100854254	256
897	3300005459	Ga0068867_100020479	Ga0068867_1000204793	256
898	3300005459	Ga0068867_100141831	Ga0068867_1001418312	256
899	3300005530	Ga0070679_100042059	Ga0070679_1000420594	256
900	3300005539	Ga0068853_100056523	Ga0068853_1000565233	256
901	3300005543	Ga0070672_100007063	Ga0070672_1000070634	256
902	3300005543	Ga0070672_100010437	Ga0070672_1000104374	256
903	3300005545	Ga0070695_100296187	Ga0070695_1002961872	256
904	3300005547	Ga0070693_100234629	Ga0070693_1002346292	256
905	3300005563	Ga0068855_100048944	Ga0068855_1000489446	256
906	3300005564	Ga0070664_100016787	Ga0070664_1000167874	256
907	3300005577	Ga0068857_100332951	Ga0068857_1003329512	256
908	3300005578	Ga0068854_100034035	Ga0068854_1000340353	256
909	3300005614	Ga0068856_100009753	Ga0068856_1000097534	256
910	3300005614	Ga0068856_100374911	Ga0068856_1003749112	256
911	3300005615	Ga0070702_100013522	Ga0070702_1000135224	256
912	3300005616	Ga0068852_100013743	Ga0068852_1000137437	256
913	3300005616	Ga0068852_100017004	Ga0068852_1000170046	256
914	3300005616	Ga0068852_100108424	Ga0068852_1001084243	256
915	3300005618	Ga0068864_100020710	Ga0068864_1000207104	256
916	3300005618	Ga0068864_100032590	Ga0068864_1000325902	256
917	3300005618	Ga0068864_100045557	Ga0068864_1000455574	256
918	3300005718	Ga0068866_10002843	Ga0068866_100028434	256
919	3300005719	Ga0068861_100001754	Ga0068861_1000017547	256
920	3300005719	Ga0068861_100089193	Ga0068861_1000891933	256
921	3300005834	Ga0068851_10061367	Ga0068851_100613671	256
922	3300005841	Ga0068863_100008147	Ga0068863_1000081477	256
923	3300005841	Ga0068863_100104364	Ga0068863_1001043643	256
924	3300005841	Ga0068863_100203348	Ga0068863_1002033482	256
925	3300005842	Ga0068858_100024249	Ga0068858_1000242497	256
926	3300005842	Ga0068858_100029185	Ga0068858_1000291854	256
927	3300005843	Ga0068860_100010210	Ga0068860_1000102107	256
928	3300005843	Ga0068860_100012046	Ga0068860_1000120464	256
929	3300005844	Ga0068862_100020780	Ga0068862_1000207801	256
930	3300006195	Ga0075366_10009816	Ga0075366_100098167	256
931	3300006237	Ga0097621_100041515	Ga0097621_1000415152	256
932	3300006237	Ga0097621_100116302	Ga0097621_1001163021	256
933	3300006353	Ga0075370_10042919	Ga0075370_100429193	256
934	3300006358	Ga0068871_100005973	Ga0068871_1000059734	256
935	3300006358	Ga0068871_100006732	Ga0068871_1000067324	256
936	3300006881	Ga0068865_100051731	Ga0068865_1000517313	256
937	3300009098	Ga0105245_10405021	Ga0105245_104050212	256
938	3300009148	Ga0105243_10091493	Ga0105243_100914933	256
939	3300009148	Ga0105243_10154456	Ga0105243_101544562	256
940	3300009177	Ga0105248_10010877	Ga0105248_100108777	256
941	3300009177	Ga0105248_10155837	Ga0105248_101558373	256
942	3300009553	Ga0105249_10059930	Ga0105249_100599303	256
943	3300013100	Ga0157373_10049992	Ga0157373_100499923	256
944	3300013102	Ga0157371_10092941	Ga0157371_100929411	256
945	3300013104	Ga0157370_10089028	Ga0157370_100890282	256
946	3300013105	Ga0157369_10021114	Ga0157369_100211147	256
947	3300013105	Ga0157369_10202627	Ga0157369_102026271	256
948	3300013296	Ga0157374_10012674	Ga0157374_100126744	256
949	3300013296	Ga0157374_10184069	Ga0157374_101840692	256
950	3300013296	Ga0157374_10869807	Ga0157374_108698071	256
951	3300013297	Ga0157378_10351640	Ga0157378_103516402	256
952	3300013306	Ga0163162_10009814	Ga0163162_100098144	256
953	3300013306	Ga0163162_10015375	Ga0163162_100153754	256
954	3300013307	Ga0157372_10057881	Ga0157372_100578814	256
955	3300013307	Ga0157372_10075427	Ga0157372_100754273	256
956	3300013307	Ga0157372_10358459	Ga0157372_103584592	256
957	3300013308	Ga0157375_10062939	Ga0157375_100629393	256
958	3300013308	Ga0157375_10093843	Ga0157375_100938432	256
959	3300013308	Ga0157375_10102612	Ga0157375_101026124	256
960	3300013308	Ga0157375_10121655	Ga0157375_101216553	256
961	3300013308	Ga0157375_10141593	Ga0157375_101415933	256
962	3300014326	Ga0157380_10012326	Ga0157380_100123263	256
963	3300014745	Ga0157377_10002823	Ga0157377_100028234	256
964	3300014968	Ga0157379_10022800	Ga0157379_100228004	256
965	3300014968	Ga0157379_10030462	Ga0157379_100304624	256
966	3300014969	Ga0157376_10010115	Ga0157376_100101154	256
967	3300014969	Ga0157376_10117781	Ga0157376_101177812	256
968	3300017792	Ga0163161_10044555	Ga0163161_100445554	256
969	3300021384	Ga0213876_10039532	Ga0213876_100395322	256
970	3300025258	Ga0209129_1000783	Ga0209129_100078315	256
971	3300025294	Ga0209025_1001282	Ga0209025_100128228	256
972	3300025315	Ga0207697_10060746	Ga0207697_100607462	256
973	3300025321	Ga0207656_10015851	Ga0207656_100158513	256
974	3300025321	Ga0207656_10245216	Ga0207656_102452161	256
975	3300025893	Ga0207682_10060510	Ga0207682_100605102	256
976	3300025893	Ga0207682_10100890	Ga0207682_101008901	256
977	3300025903	Ga0207680_10172738	Ga0207680_101727382	256
978	3300025907	Ga0207645_10011283	Ga0207645_100112834	256
979	3300025907	Ga0207645_10023842	Ga0207645_100238422	256
980	3300025911	Ga0207654_10072257	Ga0207654_100722572	256
981	3300025914	Ga0207671_10283045	Ga0207671_102830452	256
982	3300025918	Ga0207662_10002309	Ga0207662_100023096	256
983	3300025919	Ga0207657_10053780	Ga0207657_100537803	256
984	3300025919	Ga0207657_10126325	Ga0207657_101263252	256
985	3300025920	Ga0207649_10004705	Ga0207649_100047053	256
986	3300025920	Ga0207649_10065775	Ga0207649_100657753	256
987	3300025923	Ga0207681_10004142	Ga0207681_100041424	256
988	3300025923	Ga0207681_10031186	Ga0207681_100311863	256
989	3300025924	Ga0207694_10266013	Ga0207694_102660132	256
990	3300025925	Ga0207650_10003249	Ga0207650_100032493	256
991	3300025926	Ga0207659_10005359	Ga0207659_100053597	256
992	3300025926	Ga0207659_10099297	Ga0207659_100992973	256
993	3300025932	Ga0207690_10018071	Ga0207690_100180714	256
994	3300025932	Ga0207690_10031674	Ga0207690_100316743	256
995	3300025932	Ga0207690_10206944	Ga0207690_102069442	256
996	3300025933	Ga0207706_10004316	Ga0207706_100043167	256
997	3300025933	Ga0207706_10106205	Ga0207706_101062052	256
998	3300025934	Ga0207686_10149227	Ga0207686_101492272	256
999	3300025935	Ga0207709_10015578	Ga0207709_100155785	256
1000	3300025935	Ga0207709_10032365	Ga0207709_100323653	256
1001	3300025937	Ga0207669_10022825	Ga0207669_100228253	256
1002	3300025938	Ga0207704_10026882	Ga0207704_100268823	256
1003	3300025940	Ga0207691_10006932	Ga0207691_100069324	256
1004	3300025940	Ga0207691_10056404	Ga0207691_100564043	256
1005	3300025941	Ga0207711_10016383	Ga0207711_100163837	256
1006	3300025941	Ga0207711_10078888	Ga0207711_100788884	256
1007	3300025942	Ga0207689_10007087	Ga0207689_100070877	256
1008	3300025942	Ga0207689_10009559	Ga0207689_100095594	256
1009	3300025944	Ga0207661_10139585	Ga0207661_101395853	256
1010	3300025944	Ga0207661_10264680	Ga0207661_102646802	256
1011	3300025945	Ga0207679_10018021	Ga0207679_100180216	256
1012	3300025945	Ga0207679_10143688	Ga0207679_101436882	256
1013	3300025960	Ga0207651_10094594	Ga0207651_100945942	256
1014	3300025961	Ga0207712_10004623	Ga0207712_100046238	256
1015	3300025981	Ga0207640_10015669	Ga0207640_100156693	256
1016	3300025981	Ga0207640_10080506	Ga0207640_100805063	256
1017	3300025986	Ga0207658_10007981	Ga0207658_100079818	256
1018	3300025986	Ga0207658_10027918	Ga0207658_100279182	256
1019	3300026023	Ga0207677_10076814	Ga0207677_100768142	256
1020	3300026035	Ga0207703_10014712	Ga0207703_100147127	256
1021	3300026035	Ga0207703_10022609	Ga0207703_100226096	256
1022	3300026041	Ga0207639_10056806	Ga0207639_100568063	256
1023	3300026067	Ga0207678_10006013	Ga0207678_100060133	256
1024	3300026067	Ga0207678_10087341	Ga0207678_100873413	256
1025	3300026088	Ga0207641_10004568	Ga0207641_100045685	256
1026	3300026089	Ga0207648_10012908	Ga0207648_100129086	256
1027	3300026095	Ga0207676_10015345	Ga0207676_100153453	256
1028	3300026095	Ga0207676_10043099	Ga0207676_100430993	256
1029	3300026095	Ga0207676_10143746	Ga0207676_101437463	256
1030	3300026116	Ga0207674_10048325	Ga0207674_100483256	256
1031	3300026118	Ga0207675_100004056	Ga0207675_1000040567	256
1032	3300026118	Ga0207675_100031877	Ga0207675_1000318773	256
1033	3300026121	Ga0207683_10058397	Ga0207683_100583973	256
1034	3300026121	Ga0207683_10085867	Ga0207683_100858673	256
1035	3300026142	Ga0207698_10104707	Ga0207698_101047073	256
1036	3300028380	Ga0268265_10018402	Ga0268265_100184022	256
1037	3300028381	Ga0268264_10003212	Ga0268264_1000321210	256
1038	3300028381	Ga0268264_10059514	Ga0268264_100595143	256
1039	3300028794	Ga0307515_10118735	Ga0307515_101187354	256
1040	3300032005	Ga0307411_10233360	Ga0307411_102333601	256
1041	3300035242	Ga0373962_0062166	Ga0373962_0062166_234_1019	256
1042	3300035410	Ga0373924_0044377	Ga0373924_0044377_636_1421	256
1043	3300035691	Ga0373931_0012403	Ga0373931_0012403_1533_2318	256
1044	3300035724	Ga0373933_0264591	Ga0373933_0264591_43_828	256
1045	3300037068	Ga0373925_0017081	Ga0373925_0017081_2334_3119	256
1046	3300039437	Ga0436365_0978309	Ga0436365_0978309_827_1612	256
1047	3300039447	Ga0436361_0279495	Ga0436361_0279495_3800_4585	256
1048	3300045051	Ga0451576_0188831	Ga0451576_0188831_1198_1983	256
1049	3300046516	Ga0495628_0370326	Ga0495628_0370326_159_944	256
1050	3300046520	Ga0495637_0117630	Ga0495637_0117630_100_882	256
1051	3300046660	Ga0495625_0129295	Ga0495625_0129295_180_953	256
1052	3300048907	Ga0496104_0142437	Ga0496104_0142437_1136_1921	256
1053	3300048910	Ga0496107_0040094	Ga0496107_0040094_291_1076	256
1054	3300048913	Ga0496110_0058367	Ga0496110_0058367_2569_3354	256
1055	3300048916	Ga0496113_0159428	Ga0496113_0159428_925_1710	256
1056	3300048918	Ga0496115_0214779	Ga0496115_0214779_706_1491	256
1057	3300049579	Ga0501043_0000020	Ga0501043_0000020_18866_19651	256
1058	3300049580	Ga0501046_0000039	Ga0501046_0000039_18904_19689	256
1059	3300049581	Ga0501047_0000028	Ga0501047_0000028_18878_19663	256
1060	3300049582	Ga0501048_0000484	Ga0501048_0000484_8425_9210	256
1061	3300049824	Ga0501045_0015944	Ga0501045_0015944_458_1243	256
1062	3300050493	nmdc:mga0k408_81769_c1	nmdc:mga0k408_81769_c1_362_1144	256
1063	3300050494	nmdc:mga06z11_94953_c1	nmdc:mga06z11_94953_c1_584_1366	256
1064	3300050496	nmdc:mga07m45_7630_c1	nmdc:mga07m45_7630_c1_622_1404	256
1065	3300053148	Ga0500590_004451	Ga0500590_004451_2091_2876	256
1066	3300005841	Ga0068863_100549139	Ga0068863_1005491392	257
1067	3300009147	Ga0114129_10282441	Ga0114129_102824411	257
1068	3300013104	Ga0157370_10007241	Ga0157370_100072418	257
1069	3300013296	Ga0157374_10104497	Ga0157374_101044973	257
1070	3300013296	Ga0157374_10259805	Ga0157374_102598052	257
1071	3300013297	Ga0157378_10042299	Ga0157378_100422993	257
1072	3300017792	Ga0163161_10001107	Ga0163161_1000110710	257
1073	3300025945	Ga0207679_10146320	Ga0207679_101463203	257
1074	3300026023	Ga0207677_10149456	Ga0207677_101494562	257
1075	3300026067	Ga0207678_10157724	Ga0207678_101577243	257
1076	3300026088	Ga0207641_10501955	Ga0207641_105019552	257
1077	3300026142	Ga0207698_10200933	Ga0207698_102009332	257
1078	3300031235	Ga0265330_10000022	Ga0265330_1000002283	257
1079	3300031238	Ga0265332_10000001	Ga0265332_10000001592	257
1080	3300031241	Ga0265325_10012296	Ga0265325_100122962	257
1081	3300031711	Ga0265314_10000013	Ga0265314_10000013225	257
1082	3300032002	Ga0307416_100027523	Ga0307416_1000275236	257
1083	3300045051	Ga0451576_0059421	Ga0451576_0059421_659_1513	257
1084	3300045051	Ga0451576_0526045	Ga0451576_0526045_282_1091	257
1085	3300048911	Ga0496108_0200181	Ga0496108_0200181_735_1523	257
1086	3300048912	Ga0496109_0535763	Ga0496109_0535763_221_1009	257
1087	3300049686	Ga0501257_058797	Ga0501257_058797_20_814	257
1088	3300005334	Ga0068869_100011326	Ga0068869_1000113264	258
1089	3300005339	Ga0070660_100062582	Ga0070660_1000625822	258
1090	3300005366	Ga0070659_100174063	Ga0070659_1001740632	258
1091	3300005445	Ga0070708_100135375	Ga0070708_1001353753	258
1092	3300005459	Ga0068867_100000143	Ga0068867_10000014318	258
1093	3300005459	Ga0068867_100031764	Ga0068867_1000317642	258
1094	3300005459	Ga0068867_100431013	Ga0068867_1004310132	258
1095	3300005719	Ga0068861_100016460	Ga0068861_1000164603	258
1096	3300005843	Ga0068860_100173567	Ga0068860_1001735672	258
1097	3300006177	Ga0075362_10033663	Ga0075362_100336633	258
1098	3300006178	Ga0075367_10013850	Ga0075367_100138503	258
1099	3300006195	Ga0075366_10201369	Ga0075366_102013692	258
1100	3300006195	Ga0075366_10223808	Ga0075366_102238082	258
1101	3300009148	Ga0105243_10009176	Ga0105243_100091766	258
1102	3300009176	Ga0105242_10162660	Ga0105242_101626602	258
1103	3300013297	Ga0157378_10154346	Ga0157378_101543463	258
1104	3300013308	Ga0157375_10417599	Ga0157375_104175993	258
1105	3300014745	Ga0157377_10000047	Ga0157377_1000004783	258
1106	3300025909	Ga0207705_10038851	Ga0207705_100388512	258
1107	3300025919	Ga0207657_10015900	Ga0207657_100159004	258
1108	3300025935	Ga0207709_10005518	Ga0207709_100055184	258
1109	3300025942	Ga0207689_10026903	Ga0207689_100269033	258
1110	3300025960	Ga0207651_10018990	Ga0207651_100189905	258
1111	3300026089	Ga0207648_10000019	Ga0207648_1000001977	258
1112	3300026089	Ga0207648_10033583	Ga0207648_100335836	258
1113	3300026118	Ga0207675_100010863	Ga0207675_1000108636	258
1114	3300026142	Ga0207698_10015757	Ga0207698_100157573	258
1115	3300027252	Ga0209973_1001667	Ga0209973_10016672	258
1116	3300028381	Ga0268264_10091577	Ga0268264_100915773	258
1117	3300031548	Ga0307408_100000663	Ga0307408_1000006635	258
1118	3300031548	Ga0307408_100093037	Ga0307408_1000930373	258
1119	3300031548	Ga0307408_100443775	Ga0307408_1004437751	258
1120	3300031730	Ga0307516_10427581	Ga0307516_104275811	258
1121	3300031852	Ga0307410_10103028	Ga0307410_101030282	258
1122	3300031901	Ga0307406_10000930	Ga0307406_100009305	258
1123	3300031911	Ga0307412_10047004	Ga0307412_100470043	258
1124	3300031995	Ga0307409_100009019	Ga0307409_1000090193	258
1125	3300032002	Ga0307416_100001658	Ga0307416_1000016587	258
1126	3300032005	Ga0307411_10586241	Ga0307411_105862411	258
1127	3300032126	Ga0307415_100006170	Ga0307415_1000061707	258
1128	3300035691	Ga0373931_0008347	Ga0373931_0008347_1964_2764	258
1129	3300037471	Ga0395905_0044289	Ga0395905_0044289_486_1277	258
1130	3300037471	Ga0395905_0090493	Ga0395905_0090493_388_1185	258
1131	3300039437	Ga0436365_0130005	Ga0436365_0130005_39_833	258
1132	3300041410	Ga0439461_0045868	Ga0439461_0045868_89_880	258
1133	3300041997	Ga0439431_0026642	Ga0439431_0026642_142_933	258
1134	3300042156	Ga0439446_0013908	Ga0439446_0013908_1366_2157	258
1135	3300044656	Ga0466969_0004881	Ga0466969_0004881_1711_2511	258
1136	3300044658	Ga0466972_0080508	Ga0466972_0080508_103_894	258
1137	3300044684	Ga0466966_0003352	Ga0466966_0003352_5885_6685	258
1138	3300044693	Ga0466961_0030775	Ga0466961_0030775_477_1277	258
1139	3300044694	Ga0466963_0161926	Ga0466963_0161926_226_1026	258
1140	3300044735	Ga0466968_0015412	Ga0466968_0015412_451_1248	258
1141	3300044765	Ga0466970_0009622	Ga0466970_0009622_2574_3374	258
1142	3300044842	Ga0466957_0025194	Ga0466957_0025194_1242_2042	258
1143	3300045049	Ga0466959_0038447	Ga0466959_0038447_444_1244	258
1144	3300045976	Ga0466967_0029517	Ga0466967_0029517_567_1367	258
1145	3300046492	Ga0495585_0049379	Ga0495585_0049379_441_1241	258
1146	3300046542	Ga0495597_0000110	Ga0495597_0000110_52958_53737	258
1147	3300048911	Ga0496108_0466783	Ga0496108_0466783_198_995	258
1148	3300048924	Ga0496121_0012542	Ga0496121_0012542_2704_3501	258
1149	3300048927	Ga0496124_0000596	Ga0496124_0000596_39040_39837	258
1150	3300048928	Ga0496125_0014698	Ga0496125_0014698_2461_3258	258
1151	3300049649	Ga0501198_000001	Ga0501198_000001_150746_151546	258
1152	3300049662	Ga0501222_000013	Ga0501222_000013_3710_4510	258
1153	3300050489	nmdc:mga03683_13364_c1	nmdc:mga03683_13364_c1_117_911	258
1154	3300061719	Ga0466962_0002485	Ga0466962_0002485_5349_6149	258
1155	3300061719	Ga0466962_0043456	Ga0466962_0043456_1161_1955	258
1156	3300005467	Ga0070706_100648467	Ga0070706_1006484671	259
1157	3300009176	Ga0105242_10001350	Ga0105242_100013504	259
1158	2162886007	SwRhRL2b_contig_1036878	SwRhRL2b_0735.00003890	260
1159	3300005289	Ga0065704_10082448	Ga0065704_100824481	260
1160	3300048925	Ga0496122_0028070	Ga0496122_0028070_1845_2627	260
1161	3300048926	Ga0496123_0079554	Ga0496123_0079554_977_1759	260
1162	3300048928	Ga0496125_0011376	Ga0496125_0011376_5059_5841	260
1163	3300048929	Ga0496126_0014757	Ga0496126_0014757_2961_3743	260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03740

PdxJ

Pyridoxal phosphate biosynthesis protein PdxJ

44

282

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6w6a-assembly1.cif.gz_A	crystal structure of a pyridoxine 5'-phosphate synthease from stenotrophomonas maltophilia k279a	0.9732	13	251
1ixo-assembly3.cif.gz_A-2	enzyme-analogue substrate complex of pyridoxine 5'-phosphate synthase	0.957	12	256
3f4n-assembly5.cif.gz_B	crystal structure of pyridoxal phosphate biosynthetic protein pdxj from yersinia pestis	0.9516	13	255
1ixo-assembly3.cif.gz_A-2	enzyme-analogue substrate complex of pyridoxine 5'-phosphate synthase	0.9452	12	256
6w6a-assembly1.cif.gz_B	crystal structure of a pyridoxine 5'-phosphate synthease from stenotrophomonas maltophilia k279a	0.9439	13	251

ID	Description	Score	Start	End	Superfamily
3gk0A00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9333	11	258	3.20.20.70
3gk0A00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9011	11	258	3.20.20.70
3o6cA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.8819	12	252	3.20.20.70
3o6cA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.8291	12	252	3.20.20.70
3t40A00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.7611	12	245	3.20.20.70

ID	Description	Score	Start	End	GO Terms
AF-A0A3D0GJF4-F1-model_v4	deleted	0.999	182	251
AF-A0A520BDX9-F1-model_v4	Pyridoxine 5'-phosphate synthase	0.9969	189	256	GO:0005829 GO:0008615 GO:0033856
AF-A1TLF3-F1-model_v4	Pyridoxine 5'-phosphate synthase (PNP synthase) (EC 2.6.99.2)	0.9958	7	259	GO:0005829 GO:0008615 GO:0033856
AF-A0A2W4U9Z8-F1-model_v4	Pyridoxine 5'-phosphate synthase (EC 2.6.99.2)	0.9951	16	255	GO:0005829 GO:0008615 GO:0033856
AF-D0J1I4-F1-model_v4	deleted	0.9948	7	259

Feature Viewer

pLDDT	pTM	Quality
94.49	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F491041

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03740

PdxJ

Pyridoxal phosphate biosynthesis protein PdxJ

44

282

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map