F491012
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1161 | 559 | 1067 | 280 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0084748|Ga0373937_0084748_397_1428 |
| Length | 335 |
| Sequence | MTTRLPIPVSFEFFPPNTPVGSEKLKTVVSELATVEPEFFSVTYGAGGSTRDKTLATVSDIAALGQEAAPHLSCVGSTKDGISEILATYRAQKIRRLVALRGDLPSGTATAGEFRYASELISFIRETQGKDWFIEVAAYPEYHPQERYAKRDLQHFAAKVKAGADSAITQFFFNPDAYFHFVDEVRALGVEVPIVPGIMPFHNYAKIAQFAARDGIDIPRWVALKMEGFMDDAGSIRAFGLDVVTRLARRLIEGGAPGLHFYTLNQSPLTLELFKRLAGGFGGGLPPASGRCHITPSSVRSASSRNGRKPWVKLTPTVTGRGVSARSVRSKKPPP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 5 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 6 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 7 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 8 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 9 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 10 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 11 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 12 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 13 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 14 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 15 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 16 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 17 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 18 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 19 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 20 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 21 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 22 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 23 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 24 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 25 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 26 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 27 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 28 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 29 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 30 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 31 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 32 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 33 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 34 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 35 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 36 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 37 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 38 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 39 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 40 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 41 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 42 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 43 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 44 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 45 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 46 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 47 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 48 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 49 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 50 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 51 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 52 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 53 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 54 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 55 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 56 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 57 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 58 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 59 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 60 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 61 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 62 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 63 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 64 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 65 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 66 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 67 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 68 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 69 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 70 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 71 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 72 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 73 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 74 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 75 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 76 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 77 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 78 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 79 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 80 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 81 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 82 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 83 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 84 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 85 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 86 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 87 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 88 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 89 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 90 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 91 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 92 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 93 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 94 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 95 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 96 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 97 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 98 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 99 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 100 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 101 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 102 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 103 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 104 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 105 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 106 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 107 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 108 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 109 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 110 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 111 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 112 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 113 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 114 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 115 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 116 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 117 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 118 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 119 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 122 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 125 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 127 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 128 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 129 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 131 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 132 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 140 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 143 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 144 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 149 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 150 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 151 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 152 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 154 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 157 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 159 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 160 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 161 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 163 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 164 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 165 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 166 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 167 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 168 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 169 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 170 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 171 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 172 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 173 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 174 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 175 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 176 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 177 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 178 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 179 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 181 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 182 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 183 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 184 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 185 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 186 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 188 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 189 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 202 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 214 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 218 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 219 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 220 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 221 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 223 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 224 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 226 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 227 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 238 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 239 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 242 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 243 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 244 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 245 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 248 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 249 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 252 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 255 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 317 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 318 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 321 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 322 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 324 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 328 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 329 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 330 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 331 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 332 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 333 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 334 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 335 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 336 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 337 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 338 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 339 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 340 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 341 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 342 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 343 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 344 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 345 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 346 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 347 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 348 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 349 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 350 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 351 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 352 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 353 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 354 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 355 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 356 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 357 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 358 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 359 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 360 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 361 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 362 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 363 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 364 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 365 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 366 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 367 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 368 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 369 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 370 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 371 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 372 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 373 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 374 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 375 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 376 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 377 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 378 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 379 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 380 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 381 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 382 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 383 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 384 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 385 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 386 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 387 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 388 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 389 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 390 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 391 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 392 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 393 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 394 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 395 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 396 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 397 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 398 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 399 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 400 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 401 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 402 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 403 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 404 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 405 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 406 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 407 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 408 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 409 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 410 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 411 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 412 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 413 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 470 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 471 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 472 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 473 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 474 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 475 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 476 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 477 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 478 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 479 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 480 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 481 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 482 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 483 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 484 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 485 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 486 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 487 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 488 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 489 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 490 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 491 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 492 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 493 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 494 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 496 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 497 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 498 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 505 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 506 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 507 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 508 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 509 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 510 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 511 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 512 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 513 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 514 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 515 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 516 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 517 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 518 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 520 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 522 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 523 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 524 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 525 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 526 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 527 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 528 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 529 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 530 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 534 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 535 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 536 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 537 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 538 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 539 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 540 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 541 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 542 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 543 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 544 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 545 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 546 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 547 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 548 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 549 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 553 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 554 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 555 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 556 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 557 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 558 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 559 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.04 |
| Metatranscriptomes | 0.78 |
| Isolates | 8.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.28 |
| Nodule | 1.72 |
| Rhizoplane | 2.5 |
| Rhizosphere | 68.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000659 | 3300001915 | Bacteria | 10436 |
| 2 | JGI24740J21852_10003369 | 3300001979 | Bacteria | 7046 |
| 3 | JGI25155J39150_1000249 | 3300002704 | Bacteria | 20726 |
| 4 | JGI25155J39150_1000328 | 3300002704 | Bacteria | 15729 |
| 5 | JGI25155J39150_1000403 | 3300002704 | Bacteria | 12058 |
| 6 | JGI25156J39149_1000117 | 3300002705 | Bacteria | 57700 |
| 7 | JGI25156J39149_1001439 | 3300002705 | Bacteria | 10102 |
| 8 | JGI25162J39368_1000148 | 3300002737 | Bacteria | 76611 |
| 9 | JGI25162J39368_1004924 | 3300002737 | Bacteria | 2850 |
| 10 | JGI25154J39366_1000107 | 3300002738 | Bacteria | 73482 |
| 11 | JGI25154J39366_1000440 | 3300002738 | Bacteria | 22091 |
| 12 | JGI25154J39366_1000661 | 3300002738 | Bacteria | 16103 |
| 13 | JGI25157J39369_1000884 | 3300002741 | Bacteria | 14427 |
| 14 | JGI25151J46595_10001412 | 3300003187 | Bacteria | 16428 |
| 15 | JGI25151J46595_10012502 | 3300003187 | Bacteria | 3858 |
| 16 | JGI25165J46597_1000030 | 3300003214 | Bacteria | 305254 |
| 17 | rootH1_10009708 | 3300003316 | Bacteria | 16787 |
| 18 | rootH1_10046862 | 3300003316 | Bacteria | 1922 |
| 19 | rootH1_10046862 | 3300003323 | Bacteria | 4327 |
| 20 | rootH1_10091210 | 3300003316 | Bacteria | 2975 |
| 21 | rootH2_10003807 | 3300003320 | Bacteria | 2237 |
| 22 | rootL2_10001066 | 3300003322 | Bacteria | 89444 |
| 23 | rootL2_10044783 | 3300003322 | Bacteria | 5369 |
| 24 | rootL2_10093618 | 3300003322 | Bacteria | 6140 |
| 25 | rootL2_10123098 | 3300003322 | Bacteria | 1657 |
| 26 | JGI26128J50194_1001242 | 3300003347 | Bacteria | 1595 |
| 27 | JGI25160J50197_1000367 | 3300003354 | Bacteria | 29519 |
| 28 | Ga0006556J51387_1023961 | 3300003479 | Bacteria | 3016 |
| 29 | Ga0006560J51390_1017447 | 3300003565 | Bacteria | 3203 |
| 30 | Ga0055538_1000017 | 3300003751 | Bacteria | 305254 |
| 31 | Ga0055538_1000085 | 3300003751 | Bacteria | 81616 |
| 32 | Ga0055538_1003429 | 3300003751 | Bacteria | 2020 |
| 33 | Ga0055539_1000022 | 3300003752 | Bacteria | 305254 |
| 34 | Ga0055539_1000126 | 3300003752 | Bacteria | 81616 |
| 35 | Ga0055539_1000214 | 3300003752 | Bacteria | 42035 |
| 36 | Ga0055533_1000030 | 3300003756 | Bacteria | 305254 |
| 37 | Ga0055533_1000133 | 3300003756 | Bacteria | 81616 |
| 38 | Ga0055533_1000605 | 3300003756 | Bacteria | 12145 |
| 39 | Ga0055533_1001088 | 3300003756 | Bacteria | 7785 |
| 40 | Ga0055532_1000040 | 3300003758 | Bacteria | 198031 |
| 41 | Ga0055532_1000044 | 3300003758 | Bacteria | 191110 |
| 42 | Ga0055525_1000034 | 3300003759 | Bacteria | 305254 |
| 43 | Ga0055525_1000054 | 3300003759 | Bacteria | 216523 |
| 44 | Ga0055525_1000174 | 3300003759 | Bacteria | 81616 |
| 45 | Ga0055525_1000420 | 3300003759 | Bacteria | 25543 |
| 46 | Ga0055535_1000029 | 3300003761 | Bacteria | 198031 |
| 47 | Ga0055542_1006798 | 3300003762 | Bacteria | 2399 |
| 48 | Ga0055529_1000055 | 3300003763 | Bacteria | 197545 |
| 49 | Ga0055529_1000945 | 3300003763 | Bacteria | 15337 |
| 50 | Ga0055526_1002077 | 3300003771 | Bacteria | 13757 |
| 51 | Ga0055526_1003730 | 3300003771 | Bacteria | 9514 |
| 52 | Ga0055526_1007791 | 3300003771 | Bacteria | 5487 |
| 53 | Ga0055537_1000114 | 3300003773 | Bacteria | 60836 |
| 54 | Ga0055524_1000550 | 3300003775 | Bacteria | 28332 |
| 55 | Ga0055524_1001670 | 3300003775 | Bacteria | 12366 |
| 56 | Ga0055524_1013761 | 3300003775 | Bacteria | 3035 |
| 57 | Ga0055524_1015430 | 3300003775 | Bacteria | 2785 |
| 58 | Ga0055536_1000031 | 3300003781 | Bacteria | 151112 |
| 59 | Ga0055534_1000259 | 3300003784 | Bacteria | 36742 |
| 60 | Ga0055534_1001330 | 3300003784 | Bacteria | 9921 |
| 61 | Ga0055534_1002212 | 3300003784 | Bacteria | 6901 |
| 62 | Ga0055534_1004644 | 3300003784 | Bacteria | 3905 |
| 63 | Ga0055528_1000059 | 3300003790 | Bacteria | 87695 |
| 64 | Ga0055531_10000042 | 3300003794 | Bacteria | 134368 |
| 65 | Ga0055541_1000015 | 3300003841 | Bacteria | 305254 |
| 66 | Ga0055541_1000085 | 3300003841 | Bacteria | 81616 |
| 67 | Ga0055541_1000760 | 3300003841 | Bacteria | 8177 |
| 68 | Ga0065165_1000474 | 3300005262 | Bacteria | 62687 |
| 69 | Ga0065165_1000621 | 3300005262 | Bacteria | 51523 |
| 70 | Ga0065165_1001219 | 3300005262 | Bacteria | 29587 |
| 71 | Ga0065165_1001544 | 3300005262 | Bacteria | 24046 |
| 72 | Ga0070658_10027022 | 3300005327 | Bacteria | 4608 |
| 73 | Ga0070658_10561836 | 3300005327 | Bacteria | 988 |
| 74 | Ga0070676_10000434 | 3300005328 | Bacteria | 19840 |
| 75 | Ga0070690_100001931 | 3300005330 | Bacteria | 11018 |
| 76 | Ga0070670_100011920 | 3300005331 | Bacteria | 7434 |
| 77 | Ga0070670_100023566 | 3300005331 | Bacteria | 5298 |
| 78 | Ga0070670_100024473 | 3300005331 | Bacteria | 5192 |
| 79 | Ga0070670_100030033 | 3300005331 | Bacteria | 4680 |
| 80 | Ga0070670_100057768 | 3300005331 | Bacteria | 3330 |
| 81 | Ga0070670_100139592 | 3300005331 | Bacteria | 2095 |
| 82 | Ga0070670_100309540 | 3300005331 | Bacteria | 1382 |
| 83 | Ga0070670_100420808 | 3300005331 | Bacteria | 1181 |
| 84 | Ga0070677_10002998 | 3300005333 | Bacteria | 5427 |
| 85 | Ga0070677_10088019 | 3300005333 | Bacteria | 1344 |
| 86 | Ga0070677_10134184 | 3300005333 | Bacteria | 1134 |
| 87 | Ga0068869_100035950 | 3300005334 | Bacteria | 3515 |
| 88 | Ga0068869_100052968 | 3300005334 | Bacteria | 2948 |
| 89 | Ga0068869_100073084 | 3300005334 | Bacteria | 2542 |
| 90 | Ga0068869_100150690 | 3300005334 | Bacteria | 1803 |
| 91 | Ga0070666_10002319 | 3300005335 | Bacteria | 11506 |
| 92 | Ga0070666_10143697 | 3300005335 | Bacteria | 1662 |
| 93 | Ga0070666_10255356 | 3300005335 | Bacteria | 1242 |
| 94 | Ga0070680_100001090 | 3300005336 | Bacteria | 19474 |
| 95 | Ga0070682_100064094 | 3300005337 | Bacteria | 2332 |
| 96 | Ga0068868_100002885 | 3300005338 | Bacteria | 11932 |
| 97 | Ga0068868_100022383 | 3300005338 | Bacteria | 4769 |
| 98 | Ga0068868_100045059 | 3300005338 | Bacteria | 3450 |
| 99 | Ga0068868_100211881 | 3300005338 | Bacteria | 1619 |
| 100 | Ga0068868_100235499 | 3300005338 | Bacteria | 1537 |
| 101 | Ga0070660_100062262 | 3300005339 | Bacteria | 2898 |
| 102 | Ga0070660_100181019 | 3300005339 | Bacteria | 1705 |
| 103 | Ga0070689_100140805 | 3300005340 | Bacteria | 1940 |
| 104 | Ga0070689_100189617 | 3300005340 | Bacteria | 1674 |
| 105 | Ga0070689_100262479 | 3300005340 | Bacteria | 1428 |
| 106 | Ga0070687_100001074 | 3300005343 | Bacteria | 9366 |
| 107 | Ga0070661_100000037 | 3300005344 | Bacteria | 107325 |
| 108 | Ga0070668_100000210 | 3300005347 | Bacteria | 38311 |
| 109 | Ga0070668_100047815 | 3300005347 | Bacteria | 3290 |
| 110 | Ga0070668_100169199 | 3300005347 | Bacteria | 1778 |
| 111 | Ga0070669_100000370 | 3300005353 | Bacteria | 34811 |
| 112 | Ga0070669_100030221 | 3300005353 | Bacteria | 3908 |
| 113 | Ga0070669_100152920 | 3300005353 | Bacteria | 1787 |
| 114 | Ga0070669_100277617 | 3300005353 | Bacteria | 1342 |
| 115 | Ga0070675_100000692 | 3300005354 | Bacteria | 23415 |
| 116 | Ga0070675_100014685 | 3300005354 | Bacteria | 6177 |
| 117 | Ga0070675_100024652 | 3300005354 | Bacteria | 4817 |
| 118 | Ga0070675_100171157 | 3300005354 | Bacteria | 1873 |
| 119 | Ga0070675_100441032 | 3300005354 | Bacteria | 1166 |
| 120 | Ga0070671_100001030 | 3300005355 | Bacteria | 20495 |
| 121 | Ga0070671_100025332 | 3300005355 | Bacteria | 4866 |
| 122 | Ga0070671_100048387 | 3300005355 | Bacteria | 3535 |
| 123 | Ga0070671_100052291 | 3300005355 | Bacteria | 3397 |
| 124 | Ga0070671_100103137 | 3300005355 | Bacteria | 2393 |
| 125 | Ga0070671_100148744 | 3300005355 | Bacteria | 1977 |
| 126 | Ga0070671_100189936 | 3300005355 | Bacteria | 1741 |
| 127 | Ga0070674_100001560 | 3300005356 | Bacteria | 12278 |
| 128 | Ga0070674_100017826 | 3300005356 | Bacteria | 4474 |
| 129 | Ga0070674_100031238 | 3300005356 | Bacteria | 3527 |
| 130 | Ga0070674_100353523 | 3300005356 | Bacteria | 1187 |
| 131 | Ga0070673_100005042 | 3300005364 | Bacteria | 8423 |
| 132 | Ga0070673_100017993 | 3300005364 | Bacteria | 5038 |
| 133 | Ga0070673_100044461 | 3300005364 | Bacteria | 3439 |
| 134 | Ga0070688_100072165 | 3300005365 | Bacteria | 2211 |
| 135 | Ga0070659_100000268 | 3300005366 | Bacteria | 40889 |
| 136 | Ga0070667_100000294 | 3300005367 | Bacteria | 56218 |
| 137 | Ga0070667_100003264 | 3300005367 | Bacteria | 13863 |
| 138 | Ga0070667_100022091 | 3300005367 | Bacteria | 5277 |
| 139 | Ga0070667_100137649 | 3300005367 | Bacteria | 2135 |
| 140 | Ga0070667_100144573 | 3300005367 | Bacteria | 2085 |
| 141 | Ga0070667_100369742 | 3300005367 | Bacteria | 1301 |
| 142 | Ga0070667_100398929 | 3300005367 | Bacteria | 1252 |
| 143 | Ga0070713_100095071 | 3300005436 | Bacteria | 2570 |
| 144 | Ga0070701_10065313 | 3300005438 | Bacteria | 1931 |
| 145 | Ga0070708_100639403 | 3300005445 | Bacteria | 1003 |
| 146 | Ga0070663_100000001 | 3300005455 | Bacteria | 318372 |
| 147 | Ga0070678_100002211 | 3300005456 | Bacteria | 10580 |
| 148 | Ga0070678_100004854 | 3300005456 | Bacteria | 7679 |
| 149 | Ga0070678_100064650 | 3300005456 | Bacteria | 2712 |
| 150 | Ga0070678_100091383 | 3300005456 | Bacteria | 2336 |
| 151 | Ga0070678_100208545 | 3300005456 | Bacteria | 1617 |
| 152 | Ga0070662_100014012 | 3300005457 | Bacteria | 5344 |
| 153 | Ga0070662_100046171 | 3300005457 | Bacteria | 3129 |
| 154 | Ga0070662_100076345 | 3300005457 | Bacteria | 2483 |
| 155 | Ga0070662_100195539 | 3300005457 | Bacteria | 1602 |
| 156 | Ga0068867_100001702 | 3300005459 | Bacteria | 15330 |
| 157 | Ga0068867_100002661 | 3300005459 | Bacteria | 12602 |
| 158 | Ga0068867_100008359 | 3300005459 | Bacteria | 7304 |
| 159 | Ga0068867_100025546 | 3300005459 | Bacteria | 4239 |
| 160 | Ga0068867_100034937 | 3300005459 | Bacteria | 3645 |
| 161 | Ga0068867_100127994 | 3300005459 | Bacteria | 1970 |
| 162 | Ga0068867_100184109 | 3300005459 | Bacteria | 1662 |
| 163 | Ga0068867_100203951 | 3300005459 | Bacteria | 1584 |
| 164 | Ga0068867_100240701 | 3300005459 | Bacteria | 1467 |
| 165 | Ga0070706_100003301 | 3300005467 | Bacteria | 15955 |
| 166 | Ga0070707_100035771 | 3300005468 | Bacteria | 4739 |
| 167 | Ga0068853_100009360 | 3300005539 | Bacteria | 7898 |
| 168 | Ga0068853_100478194 | 3300005539 | Bacteria | 1174 |
| 169 | Ga0070672_100000286 | 3300005543 | Bacteria | 28584 |
| 170 | Ga0070672_100000712 | 3300005543 | Bacteria | 19713 |
| 171 | Ga0070672_100006372 | 3300005543 | Bacteria | 7925 |
| 172 | Ga0070672_100018646 | 3300005543 | Bacteria | 5022 |
| 173 | Ga0070672_100027706 | 3300005543 | Bacteria | 4229 |
| 174 | Ga0070672_100109913 | 3300005543 | Bacteria | 2246 |
| 175 | Ga0070686_100247415 | 3300005544 | Bacteria | 1301 |
| 176 | Ga0070693_100032105 | 3300005547 | Bacteria | 2884 |
| 177 | Ga0070665_100330310 | 3300005548 | Bacteria | 1529 |
| 178 | Ga0070665_100639660 | 3300005548 | Bacteria | 1077 |
| 179 | Ga0068855_100005276 | 3300005563 | Bacteria | 15776 |
| 180 | Ga0068855_100147077 | 3300005563 | Bacteria | 2681 |
| 181 | Ga0068855_100170676 | 3300005563 | Bacteria | 2464 |
| 182 | Ga0068855_100175969 | 3300005563 | Bacteria | 2421 |
| 183 | Ga0068855_100354541 | 3300005563 | Bacteria | 1616 |
| 184 | Ga0070664_100000006 | 3300005564 | Bacteria | 189856 |
| 185 | Ga0070664_100262573 | 3300005564 | Bacteria | 1554 |
| 186 | Ga0068857_100048044 | 3300005577 | Bacteria | 3789 |
| 187 | Ga0068857_100097295 | 3300005577 | Bacteria | 2638 |
| 188 | Ga0068857_100122293 | 3300005577 | Bacteria | 2344 |
| 189 | Ga0068857_100299431 | 3300005577 | Bacteria | 1482 |
| 190 | Ga0068854_100002991 | 3300005578 | Bacteria | 10487 |
| 191 | Ga0068854_100061897 | 3300005578 | Bacteria | 2711 |
| 192 | Ga0068854_100173028 | 3300005578 | Bacteria | 1681 |
| 193 | Ga0068856_100000032 | 3300005614 | Bacteria | 124895 |
| 194 | Ga0070702_100172958 | 3300005615 | Bacteria | 1407 |
| 195 | Ga0070702_100254733 | 3300005615 | Bacteria | 1192 |
| 196 | Ga0068852_100006988 | 3300005616 | Bacteria | 8214 |
| 197 | Ga0068852_100024872 | 3300005616 | Bacteria | 4845 |
| 198 | Ga0068852_100054367 | 3300005616 | Bacteria | 3451 |
| 199 | Ga0068852_100071258 | 3300005616 | Bacteria | 3051 |
| 200 | Ga0068852_100170213 | 3300005616 | Bacteria | 2041 |
| 201 | Ga0068852_100477932 | 3300005616 | Bacteria | 1238 |
| 202 | Ga0068859_100120053 | 3300005617 | Bacteria | 2695 |
| 203 | Ga0068859_100176440 | 3300005617 | Bacteria | 2219 |
| 204 | Ga0068859_100378623 | 3300005617 | Bacteria | 1511 |
| 205 | Ga0068864_100000417 | 3300005618 | Bacteria | 36778 |
| 206 | Ga0068864_100018136 | 3300005618 | Bacteria | 5873 |
| 207 | Ga0068864_100071218 | 3300005618 | Bacteria | 3027 |
| 208 | Ga0068864_100110450 | 3300005618 | Bacteria | 2448 |
| 209 | Ga0068864_100569551 | 3300005618 | Bacteria | 1097 |
| 210 | Ga0068866_10005226 | 3300005718 | Bacteria | 5348 |
| 211 | Ga0068861_100000398 | 3300005719 | Bacteria | 25148 |
| 212 | Ga0068861_100010875 | 3300005719 | Bacteria | 6323 |
| 213 | Ga0068861_100027316 | 3300005719 | Bacteria | 4155 |
| 214 | Ga0068861_100173269 | 3300005719 | Bacteria | 1790 |
| 215 | Ga0068851_10008763 | 3300005834 | Bacteria | 4685 |
| 216 | Ga0068870_10055112 | 3300005840 | Bacteria | 2117 |
| 217 | Ga0068870_10221762 | 3300005840 | Bacteria | 1158 |
| 218 | Ga0068863_100000638 | 3300005841 | Bacteria | 35489 |
| 219 | Ga0068863_100021605 | 3300005841 | Bacteria | 6138 |
| 220 | Ga0068863_100095002 | 3300005841 | Bacteria | 2830 |
| 221 | Ga0068863_100116242 | 3300005841 | Bacteria | 2549 |
| 222 | Ga0068863_100116455 | 3300005841 | Bacteria | 2546 |
| 223 | Ga0068858_100000623 | 3300005842 | Bacteria | 36873 |
| 224 | Ga0068858_100004551 | 3300005842 | Bacteria | 13580 |
| 225 | Ga0068858_100042716 | 3300005842 | Bacteria | 4203 |
| 226 | Ga0068858_100353339 | 3300005842 | Bacteria | 1408 |
| 227 | Ga0068860_100001020 | 3300005843 | Bacteria | 30989 |
| 228 | Ga0068860_100002539 | 3300005843 | Bacteria | 19101 |
| 229 | Ga0068860_100047148 | 3300005843 | Bacteria | 4107 |
| 230 | Ga0068862_100003087 | 3300005844 | Bacteria | 14521 |
| 231 | Ga0068862_100039734 | 3300005844 | Bacteria | 3997 |
| 232 | Ga0068862_100053450 | 3300005844 | Bacteria | 3458 |
| 233 | Ga0068862_100098908 | 3300005844 | Bacteria | 2549 |
| 234 | Ga0075368_10010902 | 3300006042 | Bacteria | 3296 |
| 235 | Ga0075368_10015811 | 3300006042 | Bacteria | 2804 |
| 236 | Ga0075363_100086454 | 3300006048 | Bacteria | 1721 |
| 237 | Ga0075364_10067075 | 3300006051 | Bacteria | 2358 |
| 238 | Ga0075362_10018818 | 3300006177 | Bacteria | 2863 |
| 239 | Ga0075367_10027649 | 3300006178 | Bacteria | 3229 |
| 240 | Ga0075367_10048135 | 3300006178 | Bacteria | 2510 |
| 241 | Ga0075366_10003944 | 3300006195 | Bacteria | 7916 |
| 242 | Ga0075366_10004375 | 3300006195 | Bacteria | 7579 |
| 243 | Ga0075366_10004423 | 3300006195 | Bacteria | 7543 |
| 244 | Ga0075366_10016373 | 3300006195 | Bacteria | 4261 |
| 245 | Ga0075366_10027032 | 3300006195 | Bacteria | 3365 |
| 246 | Ga0075366_10065018 | 3300006195 | Bacteria | 2169 |
| 247 | Ga0075366_10085433 | 3300006195 | Bacteria | 1887 |
| 248 | Ga0075366_10209799 | 3300006195 | Bacteria | 1186 |
| 249 | Ga0097621_100010671 | 3300006237 | Bacteria | 6732 |
| 250 | Ga0097621_100031314 | 3300006237 | Bacteria | 4220 |
| 251 | Ga0097621_100138552 | 3300006237 | Bacteria | 2078 |
| 252 | Ga0097621_100253122 | 3300006237 | Bacteria | 1543 |
| 253 | Ga0097621_100260001 | 3300006237 | Bacteria | 1522 |
| 254 | Ga0075370_10000291 | 3300006353 | Bacteria | 17999 |
| 255 | Ga0075370_10000595 | 3300006353 | Bacteria | 13965 |
| 256 | Ga0075370_10006650 | 3300006353 | Bacteria | 5831 |
| 257 | Ga0075370_10027042 | 3300006353 | Bacteria | 3181 |
| 258 | Ga0075370_10041151 | 3300006353 | Bacteria | 2608 |
| 259 | Ga0068871_100094720 | 3300006358 | Bacteria | 2492 |
| 260 | Ga0068871_100257770 | 3300006358 | Bacteria | 1520 |
| 261 | Ga0075430_100211114 | 3300006846 | Bacteria | 1611 |
| 262 | Ga0075434_100685126 | 3300006871 | Bacteria | 1043 |
| 263 | Ga0075429_100000224 | 3300006880 | Bacteria | 38311 |
| 264 | Ga0068865_100000504 | 3300006881 | Bacteria | 21850 |
| 265 | Ga0068865_100006531 | 3300006881 | Bacteria | 7125 |
| 266 | Ga0068865_100051687 | 3300006881 | Bacteria | 2846 |
| 267 | Ga0068865_100104594 | 3300006881 | Bacteria | 2078 |
| 268 | Ga0097620_100120048 | 3300006931 | Bacteria | 2695 |
| 269 | Ga0097620_100176445 | 3300006931 | Bacteria | 2219 |
| 270 | Ga0097620_100378658 | 3300006931 | Bacteria | 1511 |
| 271 | Ga0099823_1000559 | 3300006944 | Bacteria | 25703 |
| 272 | Ga0079104_1010957 | 3300006946 | Bacteria | 2948 |
| 273 | Ga0105251_10072277 | 3300009011 | Bacteria | 1604 |
| 274 | Ga0105251_10149572 | 3300009011 | Bacteria | 1055 |
| 275 | Ga0105240_10015068 | 3300009093 | Bacteria | 10523 |
| 276 | Ga0105240_10022053 | 3300009093 | Bacteria | 8454 |
| 277 | Ga0105240_10077623 | 3300009093 | Bacteria | 4091 |
| 278 | Ga0105240_10174543 | 3300009093 | Bacteria | 2542 |
| 279 | Ga0105240_10196467 | 3300009093 | Bacteria | 2368 |
| 280 | Ga0105240_10295608 | 3300009093 | Bacteria | 1855 |
| 281 | Ga0105240_10413203 | 3300009093 | Bacteria | 1517 |
| 282 | Ga0105240_10413204 | 3300009093 | Bacteria | 1517 |
| 283 | Ga0105245_10012144 | 3300009098 | Bacteria | 7490 |
| 284 | Ga0105245_10046369 | 3300009098 | Bacteria | 3884 |
| 285 | Ga0105245_10197412 | 3300009098 | Bacteria | 1931 |
| 286 | Ga0114129_10975478 | 3300009147 | Bacteria | 1069 |
| 287 | Ga0105243_10006497 | 3300009148 | Bacteria | 9041 |
| 288 | Ga0105243_10039272 | 3300009148 | Bacteria | 3688 |
| 289 | Ga0105243_10107642 | 3300009148 | Bacteria | 2325 |
| 290 | Ga0105243_10119821 | 3300009148 | Bacteria | 2216 |
| 291 | Ga0105241_10348034 | 3300009174 | Bacteria | 1286 |
| 292 | Ga0105242_10018196 | 3300009176 | Bacteria | 5490 |
| 293 | Ga0105248_10027320 | 3300009177 | Bacteria | 6351 |
| 294 | Ga0105248_10116277 | 3300009177 | Bacteria | 3016 |
| 295 | Ga0105248_10150457 | 3300009177 | Bacteria | 2626 |
| 296 | Ga0105237_10033144 | 3300009545 | Bacteria | 5233 |
| 297 | Ga0105237_10080569 | 3300009545 | Bacteria | 3246 |
| 298 | Ga0105237_10097519 | 3300009545 | Bacteria | 2930 |
| 299 | Ga0105238_10000038 | 3300009551 | Bacteria | 162920 |
| 300 | Ga0105238_10007405 | 3300009551 | Bacteria | 10994 |
| 301 | Ga0105249_10002938 | 3300009553 | Bacteria | 14709 |
| 302 | Ga0105249_10052983 | 3300009553 | Bacteria | 3707 |
| 303 | Ga0105249_10166150 | 3300009553 | Bacteria | 2136 |
| 304 | Ga0105239_10004364 | 3300010375 | Bacteria | 16946 |
| 305 | Ga0105239_10138089 | 3300010375 | Bacteria | 2714 |
| 306 | Ga0157319_1000005 | 3300012497 | Bacteria | 372810 |
| 307 | Ga0157373_10079106 | 3300013100 | Bacteria | 2319 |
| 308 | Ga0157373_10080356 | 3300013100 | Bacteria | 2299 |
| 309 | Ga0157373_10364764 | 3300013100 | Bacteria | 1031 |
| 310 | Ga0157371_10000106 | 3300013102 | Bacteria | 126567 |
| 311 | Ga0157370_10000062 | 3300013104 | Bacteria | 115487 |
| 312 | Ga0157369_10019944 | 3300013105 | Bacteria | 7498 |
| 313 | Ga0157374_10024366 | 3300013296 | Bacteria | 5425 |
| 314 | Ga0157374_10130406 | 3300013296 | Bacteria | 2433 |
| 315 | Ga0157374_10253714 | 3300013296 | Bacteria | 1731 |
| 316 | Ga0157378_10053754 | 3300013297 | Bacteria | 3585 |
| 317 | Ga0157378_10382849 | 3300013297 | Bacteria | 1382 |
| 318 | Ga0157378_10736485 | 3300013297 | Bacteria | 1008 |
| 319 | Ga0163162_10000701 | 3300013306 | Bacteria | 30951 |
| 320 | Ga0163162_10051946 | 3300013306 | Bacteria | 4115 |
| 321 | Ga0163162_10274052 | 3300013306 | Bacteria | 1819 |
| 322 | Ga0163162_10525009 | 3300013306 | Bacteria | 1313 |
| 323 | Ga0163162_10563620 | 3300013306 | Bacteria | 1267 |
| 324 | Ga0157372_10000108 | 3300013307 | Bacteria | 86863 |
| 325 | Ga0157372_10107117 | 3300013307 | Bacteria | 3198 |
| 326 | Ga0157375_10006514 | 3300013308 | Bacteria | 10163 |
| 327 | Ga0157375_10009924 | 3300013308 | Bacteria | 8376 |
| 328 | Ga0157375_10153266 | 3300013308 | Bacteria | 2442 |
| 329 | Ga0163163_10195108 | 3300014325 | Bacteria | 2073 |
| 330 | Ga0163163_10205725 | 3300014325 | Bacteria | 2016 |
| 331 | Ga0163163_10231195 | 3300014325 | Bacteria | 1898 |
| 332 | Ga0157380_10000472 | 3300014326 | Bacteria | 24494 |
| 333 | Ga0157380_10033017 | 3300014326 | Bacteria | 3983 |
| 334 | Ga0157380_10145419 | 3300014326 | Bacteria | 2042 |
| 335 | Ga0182008_10042885 | 3300014497 | Bacteria | 2253 |
| 336 | Ga0182008_10112057 | 3300014497 | Bacteria | 1352 |
| 337 | Ga0157377_10000034 | 3300014745 | Bacteria | 117744 |
| 338 | Ga0157377_10039116 | 3300014745 | Bacteria | 2622 |
| 339 | Ga0157379_10001128 | 3300014968 | Bacteria | 21831 |
| 340 | Ga0157379_10002106 | 3300014968 | Bacteria | 16495 |
| 341 | Ga0157379_10005918 | 3300014968 | Bacteria | 10530 |
| 342 | Ga0157379_10050097 | 3300014968 | Bacteria | 3727 |
| 343 | Ga0157379_10072142 | 3300014968 | Bacteria | 3089 |
| 344 | Ga0157379_10422105 | 3300014968 | Bacteria | 1228 |
| 345 | Ga0157376_10021689 | 3300014969 | Bacteria | 4992 |
| 346 | Ga0157376_10039629 | 3300014969 | Bacteria | 3844 |
| 347 | Ga0157376_10185936 | 3300014969 | Bacteria | 1902 |
| 348 | Ga0157376_10236372 | 3300014969 | Bacteria | 1700 |
| 349 | Ga0157376_10360986 | 3300014969 | Bacteria | 1393 |
| 350 | Ga0157376_10552731 | 3300014969 | Bacteria | 1139 |
| 351 | Ga0182006_1001438 | 3300015261 | Bacteria | 14409 |
| 352 | Ga0182006_1012816 | 3300015261 | Bacteria | 3658 |
| 353 | Ga0182006_1020296 | 3300015261 | Bacteria | 2785 |
| 354 | Ga0182006_1028442 | 3300015261 | Bacteria | 2273 |
| 355 | Ga0182006_1076641 | 3300015261 | Bacteria | 1228 |
| 356 | Ga0182007_10013248 | 3300015262 | Bacteria | 3150 |
| 357 | Ga0182007_10020262 | 3300015262 | Bacteria | 2380 |
| 358 | Ga0182005_1000142 | 3300015265 | Bacteria | 50650 |
| 359 | Ga0183361_10001 | 3300016635 | Bacteria | 908583 |
| 360 | Ga0163161_10001102 | 3300017792 | Bacteria | 20382 |
| 361 | Ga0163161_10012016 | 3300017792 | Bacteria | 6007 |
| 362 | Ga0163161_10076474 | 3300017792 | Bacteria | 2457 |
| 363 | Ga0206355_1625393 | 3300020076 | Bacteria | 2024 |
| 364 | Ga0206351_10698205 | 3300020077 | Bacteria | 5141 |
| 365 | Ga0154015_1545624 | 3300020610 | Bacteria | 8382 |
| 366 | Ga0213872_10000861 | 3300021361 | Bacteria | 21979 |
| 367 | Ga0213872_10000883 | 3300021361 | Bacteria | 21687 |
| 368 | Ga0213872_10000982 | 3300021361 | Bacteria | 19943 |
| 369 | Ga0213872_10004235 | 3300021361 | Bacteria | 7693 |
| 370 | Ga0213872_10006327 | 3300021361 | Bacteria | 5958 |
| 371 | Ga0213872_10007165 | 3300021361 | Bacteria | 5512 |
| 372 | Ga0209435_100004 | 3300025206 | Bacteria | 633417 |
| 373 | Ga0209435_100891 | 3300025206 | Bacteria | 4560 |
| 374 | Ga0209760_101145 | 3300025207 | Bacteria | 3003 |
| 375 | Ga0209784_100006 | 3300025224 | Bacteria | 930704 |
| 376 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 377 | Ga0209784_100034 | 3300025224 | Bacteria | 305504 |
| 378 | Ga0209784_100559 | 3300025224 | Bacteria | 13132 |
| 379 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 380 | Ga0209566_100038 | 3300025225 | Bacteria | 305504 |
| 381 | Ga0209566_100039 | 3300025225 | Bacteria | 303368 |
| 382 | Ga0209566_100678 | 3300025225 | Bacteria | 20133 |
| 383 | Ga0209566_102039 | 3300025225 | Bacteria | 4240 |
| 384 | Ga0209566_102609 | 3300025225 | Bacteria | 3201 |
| 385 | Ga0209674_100010 | 3300025226 | Bacteria | 1038638 |
| 386 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 387 | Ga0209674_100056 | 3300025226 | Bacteria | 305504 |
| 388 | Ga0209674_100060 | 3300025226 | Bacteria | 282102 |
| 389 | Ga0209674_100076 | 3300025226 | Bacteria | 210323 |
| 390 | Ga0209674_106794 | 3300025226 | Bacteria | 1511 |
| 391 | Ga0209672_101956 | 3300025228 | Bacteria | 5797 |
| 392 | Ga0209672_108353 | 3300025228 | Bacteria | 1538 |
| 393 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 394 | Ga0209147_100018 | 3300025229 | Bacteria | 515719 |
| 395 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 396 | Ga0209563_100041 | 3300025230 | Bacteria | 407467 |
| 397 | Ga0209563_100057 | 3300025230 | Bacteria | 305604 |
| 398 | Ga0209563_100075 | 3300025230 | Bacteria | 216575 |
| 399 | Ga0209563_106287 | 3300025230 | Bacteria | 2053 |
| 400 | Ga0207427_103609 | 3300025231 | Bacteria | 3136 |
| 401 | Ga0209437_100071 | 3300025233 | Bacteria | 305604 |
| 402 | Ga0209437_100393 | 3300025233 | Bacteria | 42190 |
| 403 | Ga0209258_100028 | 3300025242 | Bacteria | 515719 |
| 404 | Ga0209258_106057 | 3300025242 | Bacteria | 1948 |
| 405 | Ga0209646_1000043 | 3300025246 | Bacteria | 343652 |
| 406 | Ga0209646_1000149 | 3300025246 | Bacteria | 100004 |
| 407 | Ga0209646_1000191 | 3300025246 | Bacteria | 75546 |
| 408 | Ga0209646_1000233 | 3300025246 | Bacteria | 57776 |
| 409 | Ga0209026_1000066 | 3300025250 | Bacteria | 207691 |
| 410 | Ga0209026_1002225 | 3300025250 | Bacteria | 7491 |
| 411 | Ga0209026_1009862 | 3300025250 | Bacteria | 1832 |
| 412 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 413 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 414 | Ga0209677_100035 | 3300025253 | Bacteria | 305504 |
| 415 | Ga0209677_102676 | 3300025253 | Bacteria | 6432 |
| 416 | Ga0209148_1000162 | 3300025254 | Bacteria | 138642 |
| 417 | Ga0209759_1000072 | 3300025256 | Bacteria | 178206 |
| 418 | Ga0209759_1000182 | 3300025256 | Bacteria | 102836 |
| 419 | Ga0209759_1001347 | 3300025256 | Bacteria | 14286 |
| 420 | Ga0209759_1003723 | 3300025256 | Bacteria | 5970 |
| 421 | Ga0209129_1004031 | 3300025258 | Bacteria | 6006 |
| 422 | Ga0209233_1000094 | 3300025261 | Bacteria | 305604 |
| 423 | Ga0209565_1000032 | 3300025263 | Bacteria | 316777 |
| 424 | Ga0209565_1000611 | 3300025263 | Bacteria | 23691 |
| 425 | Ga0207666_1013333 | 3300025271 | Bacteria | 1153 |
| 426 | Ga0209455_1000065 | 3300025272 | Bacteria | 321272 |
| 427 | Ga0209455_1001116 | 3300025272 | Bacteria | 13109 |
| 428 | Ga0209455_1010351 | 3300025272 | Bacteria | 2376 |
| 429 | Ga0209673_1000029 | 3300025273 | Bacteria | 351978 |
| 430 | Ga0209673_1004669 | 3300025273 | Bacteria | 7231 |
| 431 | Ga0209673_1009458 | 3300025273 | Bacteria | 4218 |
| 432 | Ga0209675_1000019 | 3300025291 | Bacteria | 351950 |
| 433 | Ga0209675_1000231 | 3300025291 | Bacteria | 56755 |
| 434 | Ga0209675_1001472 | 3300025291 | Bacteria | 13522 |
| 435 | Ga0209675_1009719 | 3300025291 | Bacteria | 3368 |
| 436 | Ga0209676_1000036 | 3300025292 | Bacteria | 457623 |
| 437 | Ga0209025_1000345 | 3300025294 | Bacteria | 100876 |
| 438 | Ga0209025_1000860 | 3300025294 | Bacteria | 47953 |
| 439 | Ga0209025_1000885 | 3300025294 | Bacteria | 46908 |
| 440 | Ga0209025_1002236 | 3300025294 | Bacteria | 21305 |
| 441 | Ga0209025_1003617 | 3300025294 | Bacteria | 14389 |
| 442 | Ga0209025_1020816 | 3300025294 | Bacteria | 3564 |
| 443 | Ga0209564_1000021 | 3300025295 | Bacteria | 571316 |
| 444 | Ga0209564_1000291 | 3300025295 | Bacteria | 101831 |
| 445 | Ga0209564_1001814 | 3300025295 | Bacteria | 19671 |
| 446 | Ga0209564_1002897 | 3300025295 | Bacteria | 12521 |
| 447 | Ga0209564_1003347 | 3300025295 | Bacteria | 11112 |
| 448 | Ga0209758_1014888 | 3300025297 | Bacteria | 4084 |
| 449 | Ga0209050_1001572 | 3300025298 | Bacteria | 23718 |
| 450 | Ga0209256_1000244 | 3300025299 | Bacteria | 96646 |
| 451 | Ga0209256_1000309 | 3300025299 | Bacteria | 85294 |
| 452 | Ga0209256_1001175 | 3300025299 | Bacteria | 29496 |
| 453 | Ga0209256_1003136 | 3300025299 | Bacteria | 12042 |
| 454 | Ga0209256_1012735 | 3300025299 | Bacteria | 3185 |
| 455 | Ga0207426_1000007 | 3300025302 | Bacteria | 971011 |
| 456 | Ga0209051_1002025 | 3300025303 | Bacteria | 15428 |
| 457 | Ga0209051_1003442 | 3300025303 | Bacteria | 10373 |
| 458 | Ga0209257_1000016 | 3300025304 | Bacteria | 908015 |
| 459 | Ga0209257_1000981 | 3300025304 | Bacteria | 38736 |
| 460 | Ga0209257_1003659 | 3300025304 | Bacteria | 12890 |
| 461 | Ga0209257_1021536 | 3300025304 | Bacteria | 2337 |
| 462 | Ga0207697_10005788 | 3300025315 | Bacteria | 5698 |
| 463 | Ga0207656_10007965 | 3300025321 | Bacteria | 3885 |
| 464 | Ga0207656_10049107 | 3300025321 | Bacteria | 1819 |
| 465 | Ga0207713_1077262 | 3300025735 | Bacteria | 1209 |
| 466 | Ga0207682_10001283 | 3300025893 | Bacteria | 11529 |
| 467 | Ga0207682_10066783 | 3300025893 | Bacteria | 1516 |
| 468 | Ga0207682_10067497 | 3300025893 | Bacteria | 1509 |
| 469 | Ga0207682_10128893 | 3300025893 | Bacteria | 1128 |
| 470 | Ga0207642_10005579 | 3300025899 | Bacteria | 4118 |
| 471 | Ga0207642_10014175 | 3300025899 | Bacteria | 2933 |
| 472 | Ga0207642_10041206 | 3300025899 | Bacteria | 2020 |
| 473 | Ga0207688_10055694 | 3300025901 | Bacteria | 2220 |
| 474 | Ga0207680_10002133 | 3300025903 | Bacteria | 9262 |
| 475 | Ga0207680_10048731 | 3300025903 | Bacteria | 2518 |
| 476 | Ga0207680_10283664 | 3300025903 | Bacteria | 1151 |
| 477 | Ga0207647_10053550 | 3300025904 | Bacteria | 2486 |
| 478 | Ga0207645_10001321 | 3300025907 | Bacteria | 20363 |
| 479 | Ga0207645_10002041 | 3300025907 | Bacteria | 16211 |
| 480 | Ga0207645_10004182 | 3300025907 | Bacteria | 10717 |
| 481 | Ga0207645_10034575 | 3300025907 | Bacteria | 3247 |
| 482 | Ga0207645_10163414 | 3300025907 | Bacteria | 1457 |
| 483 | Ga0207643_10159082 | 3300025908 | Bacteria | 1358 |
| 484 | Ga0207643_10263413 | 3300025908 | Bacteria | 1065 |
| 485 | Ga0207705_10053592 | 3300025909 | Bacteria | 2906 |
| 486 | Ga0207684_10012702 | 3300025910 | Bacteria | 7312 |
| 487 | Ga0207654_10065427 | 3300025911 | Bacteria | 2140 |
| 488 | Ga0207695_10000979 | 3300025913 | Bacteria | 50790 |
| 489 | Ga0207695_10001817 | 3300025913 | Bacteria | 33592 |
| 490 | Ga0207695_10002079 | 3300025913 | Bacteria | 30518 |
| 491 | Ga0207695_10082442 | 3300025913 | Bacteria | 3251 |
| 492 | Ga0207695_10108766 | 3300025913 | Bacteria | 2756 |
| 493 | Ga0207695_10550327 | 3300025913 | Bacteria | 1035 |
| 494 | Ga0207671_10001710 | 3300025914 | Bacteria | 24779 |
| 495 | Ga0207671_10182234 | 3300025914 | Bacteria | 1635 |
| 496 | Ga0207660_10006825 | 3300025917 | Bacteria | 7390 |
| 497 | Ga0207662_10163295 | 3300025918 | Bacteria | 1424 |
| 498 | Ga0207657_10127064 | 3300025919 | Bacteria | 2093 |
| 499 | Ga0207649_10000477 | 3300025920 | Bacteria | 28564 |
| 500 | Ga0207649_10095109 | 3300025920 | Bacteria | 1959 |
| 501 | Ga0207681_10001157 | 3300025923 | Bacteria | 17033 |
| 502 | Ga0207681_10012075 | 3300025923 | Bacteria | 5322 |
| 503 | Ga0207694_10000069 | 3300025924 | Bacteria | 124500 |
| 504 | Ga0207694_10011272 | 3300025924 | Bacteria | 6752 |
| 505 | Ga0207694_10025608 | 3300025924 | Bacteria | 4484 |
| 506 | Ga0207694_10145325 | 3300025924 | Bacteria | 1909 |
| 507 | Ga0207650_10000603 | 3300025925 | Bacteria | 28763 |
| 508 | Ga0207650_10001006 | 3300025925 | Bacteria | 21205 |
| 509 | Ga0207650_10032175 | 3300025925 | Bacteria | 3794 |
| 510 | Ga0207650_10048101 | 3300025925 | Bacteria | 3144 |
| 511 | Ga0207650_10320901 | 3300025925 | Bacteria | 1268 |
| 512 | Ga0207659_10000488 | 3300025926 | Bacteria | 23860 |
| 513 | Ga0207659_10003135 | 3300025926 | Bacteria | 9880 |
| 514 | Ga0207659_10033524 | 3300025926 | Bacteria | 3535 |
| 515 | Ga0207659_10038095 | 3300025926 | Bacteria | 3342 |
| 516 | Ga0207659_10162824 | 3300025926 | Bacteria | 1753 |
| 517 | Ga0207687_10019791 | 3300025927 | Bacteria | 4463 |
| 518 | Ga0207687_10022125 | 3300025927 | Bacteria | 4230 |
| 519 | Ga0207700_10059448 | 3300025928 | Bacteria | 2891 |
| 520 | Ga0207644_10019134 | 3300025931 | Bacteria | 4642 |
| 521 | Ga0207644_10021105 | 3300025931 | Bacteria | 4434 |
| 522 | Ga0207644_10043820 | 3300025931 | Bacteria | 3176 |
| 523 | Ga0207644_10183703 | 3300025931 | Bacteria | 1640 |
| 524 | Ga0207644_10386487 | 3300025931 | Bacteria | 1142 |
| 525 | Ga0207690_10001542 | 3300025932 | Bacteria | 14419 |
| 526 | Ga0207690_10061546 | 3300025932 | Bacteria | 2552 |
| 527 | Ga0207706_10005604 | 3300025933 | Bacteria | 11696 |
| 528 | Ga0207706_10023257 | 3300025933 | Bacteria | 5566 |
| 529 | Ga0207706_10067960 | 3300025933 | Bacteria | 3136 |
| 530 | Ga0207686_10161890 | 3300025934 | Bacteria | 1569 |
| 531 | Ga0207709_10022617 | 3300025935 | Bacteria | 3567 |
| 532 | Ga0207709_10077907 | 3300025935 | Bacteria | 2126 |
| 533 | Ga0207709_10166238 | 3300025935 | Bacteria | 1544 |
| 534 | Ga0207670_10137243 | 3300025936 | Bacteria | 1799 |
| 535 | Ga0207670_10137759 | 3300025936 | Bacteria | 1796 |
| 536 | Ga0207669_10002675 | 3300025937 | Bacteria | 7630 |
| 537 | Ga0207669_10010185 | 3300025937 | Bacteria | 4516 |
| 538 | Ga0207704_10002511 | 3300025938 | Bacteria | 8267 |
| 539 | Ga0207704_10003713 | 3300025938 | Bacteria | 6943 |
| 540 | Ga0207704_10164572 | 3300025938 | Bacteria | 1583 |
| 541 | Ga0207665_10275322 | 3300025939 | Bacteria | 1251 |
| 542 | Ga0207691_10001925 | 3300025940 | Bacteria | 20256 |
| 543 | Ga0207691_10002589 | 3300025940 | Bacteria | 17678 |
| 544 | Ga0207691_10026069 | 3300025940 | Bacteria | 5486 |
| 545 | Ga0207691_10029199 | 3300025940 | Bacteria | 5159 |
| 546 | Ga0207691_10044567 | 3300025940 | Bacteria | 4081 |
| 547 | Ga0207691_10066955 | 3300025940 | Bacteria | 3248 |
| 548 | Ga0207691_10076817 | 3300025940 | Bacteria | 3009 |
| 549 | Ga0207691_10105579 | 3300025940 | Bacteria | 2509 |
| 550 | Ga0207711_10009121 | 3300025941 | Bacteria | 8282 |
| 551 | Ga0207711_10057113 | 3300025941 | Bacteria | 3355 |
| 552 | Ga0207711_10469707 | 3300025941 | Bacteria | 1171 |
| 553 | Ga0207711_10604105 | 3300025941 | Bacteria | 1024 |
| 554 | Ga0207689_10000415 | 3300025942 | Bacteria | 39864 |
| 555 | Ga0207689_10032225 | 3300025942 | Bacteria | 4360 |
| 556 | Ga0207689_10205596 | 3300025942 | Bacteria | 1626 |
| 557 | Ga0207689_10217162 | 3300025942 | Bacteria | 1580 |
| 558 | Ga0207661_10146534 | 3300025944 | Bacteria | 2037 |
| 559 | Ga0207679_10000012 | 3300025945 | Bacteria | 339773 |
| 560 | Ga0207679_10021183 | 3300025945 | Bacteria | 4401 |
| 561 | Ga0207679_10072028 | 3300025945 | Bacteria | 2609 |
| 562 | Ga0207679_10368181 | 3300025945 | Bacteria | 1257 |
| 563 | Ga0207667_10000043 | 3300025949 | Bacteria | 261426 |
| 564 | Ga0207667_10025668 | 3300025949 | Bacteria | 6448 |
| 565 | Ga0207667_10066892 | 3300025949 | Bacteria | 3745 |
| 566 | Ga0207667_10268643 | 3300025949 | Bacteria | 1744 |
| 567 | Ga0207651_10031644 | 3300025960 | Bacteria | 3385 |
| 568 | Ga0207651_10062810 | 3300025960 | Bacteria | 2590 |
| 569 | Ga0207712_10002826 | 3300025961 | Bacteria | 11123 |
| 570 | Ga0207712_10046807 | 3300025961 | Bacteria | 3000 |
| 571 | Ga0207712_10188467 | 3300025961 | Bacteria | 1626 |
| 572 | Ga0207712_10328714 | 3300025961 | Bacteria | 1264 |
| 573 | Ga0207668_10257076 | 3300025972 | Bacteria | 1421 |
| 574 | Ga0207668_10272165 | 3300025972 | Bacteria | 1385 |
| 575 | Ga0207640_10000012 | 3300025981 | Bacteria | 242060 |
| 576 | Ga0207640_10007512 | 3300025981 | Bacteria | 6019 |
| 577 | Ga0207640_10567072 | 3300025981 | Bacteria | 956 |
| 578 | Ga0207658_10000212 | 3300025986 | Bacteria | 60851 |
| 579 | Ga0207658_10006064 | 3300025986 | Bacteria | 8255 |
| 580 | Ga0207658_10030972 | 3300025986 | Bacteria | 3794 |
| 581 | Ga0207658_10136734 | 3300025986 | Bacteria | 1977 |
| 582 | Ga0207658_10534647 | 3300025986 | Bacteria | 1047 |
| 583 | Ga0207677_10007613 | 3300026023 | Bacteria | 6007 |
| 584 | Ga0207677_10086434 | 3300026023 | Bacteria | 2267 |
| 585 | Ga0207677_10107251 | 3300026023 | Bacteria | 2071 |
| 586 | Ga0207677_10195898 | 3300026023 | Bacteria | 1602 |
| 587 | Ga0207677_10267004 | 3300026023 | Bacteria | 1398 |
| 588 | Ga0207703_10002429 | 3300026035 | Bacteria | 16148 |
| 589 | Ga0207703_10003032 | 3300026035 | Bacteria | 14219 |
| 590 | Ga0207703_10009710 | 3300026035 | Bacteria | 7551 |
| 591 | Ga0207703_10413025 | 3300026035 | Bacteria | 1254 |
| 592 | Ga0207639_10054234 | 3300026041 | Bacteria | 3063 |
| 593 | Ga0207639_10151752 | 3300026041 | Bacteria | 1941 |
| 594 | Ga0207639_10166052 | 3300026041 | Bacteria | 1865 |
| 595 | Ga0207678_10000009 | 3300026067 | Bacteria | 156690 |
| 596 | Ga0207678_10006113 | 3300026067 | Bacteria | 10709 |
| 597 | Ga0207678_10063109 | 3300026067 | Bacteria | 3184 |
| 598 | Ga0207678_10584938 | 3300026067 | Bacteria | 978 |
| 599 | Ga0207708_10043164 | 3300026075 | Bacteria | 3437 |
| 600 | Ga0207702_10000028 | 3300026078 | Bacteria | 183005 |
| 601 | Ga0207641_10009276 | 3300026088 | Bacteria | 8114 |
| 602 | Ga0207641_10097769 | 3300026088 | Bacteria | 2581 |
| 603 | Ga0207641_10153136 | 3300026088 | Bacteria | 2089 |
| 604 | Ga0207641_10205166 | 3300026088 | Bacteria | 1820 |
| 605 | Ga0207641_10396913 | 3300026088 | Bacteria | 1323 |
| 606 | Ga0207648_10000054 | 3300026089 | Bacteria | 106684 |
| 607 | Ga0207648_10005336 | 3300026089 | Bacteria | 12956 |
| 608 | Ga0207648_10008160 | 3300026089 | Bacteria | 10182 |
| 609 | Ga0207648_10037529 | 3300026089 | Bacteria | 4268 |
| 610 | Ga0207648_10120747 | 3300026089 | Bacteria | 2304 |
| 611 | Ga0207648_10142370 | 3300026089 | Bacteria | 2114 |
| 612 | Ga0207648_10251892 | 3300026089 | Bacteria | 1574 |
| 613 | Ga0207676_10039147 | 3300026095 | Bacteria | 3624 |
| 614 | Ga0207676_10044261 | 3300026095 | Bacteria | 3433 |
| 615 | Ga0207676_10057970 | 3300026095 | Bacteria | 3052 |
| 616 | Ga0207676_10075167 | 3300026095 | Bacteria | 2724 |
| 617 | Ga0207676_10078899 | 3300026095 | Bacteria | 2668 |
| 618 | Ga0207676_10083234 | 3300026095 | Bacteria | 2605 |
| 619 | Ga0207676_10296744 | 3300026095 | Bacteria | 1474 |
| 620 | Ga0207674_10010925 | 3300026116 | Bacteria | 10218 |
| 621 | Ga0207674_10068252 | 3300026116 | Bacteria | 3578 |
| 622 | Ga0207674_10093730 | 3300026116 | Bacteria | 2991 |
| 623 | Ga0207674_10336626 | 3300026116 | Bacteria | 1459 |
| 624 | Ga0207674_10573987 | 3300026116 | Bacteria | 1089 |
| 625 | Ga0207675_100000177 | 3300026118 | Bacteria | 57433 |
| 626 | Ga0207675_100002649 | 3300026118 | Bacteria | 17661 |
| 627 | Ga0207675_100006060 | 3300026118 | Bacteria | 11505 |
| 628 | Ga0207683_10011037 | 3300026121 | Bacteria | 7699 |
| 629 | Ga0207683_10056721 | 3300026121 | Bacteria | 3437 |
| 630 | Ga0207683_10105509 | 3300026121 | Bacteria | 2519 |
| 631 | Ga0207683_10125588 | 3300026121 | Bacteria | 2305 |
| 632 | Ga0207698_10005873 | 3300026142 | Bacteria | 7627 |
| 633 | Ga0207698_10006654 | 3300026142 | Bacteria | 7222 |
| 634 | Ga0207698_10016463 | 3300026142 | Bacteria | 4985 |
| 635 | Ga0207698_10040883 | 3300026142 | Bacteria | 3450 |
| 636 | Ga0207698_10104678 | 3300026142 | Bacteria | 2355 |
| 637 | Ga0209281_1007147 | 3300027111 | Bacteria | 2821 |
| 638 | Ga0209389_1006254 | 3300027296 | Bacteria | 10313 |
| 639 | Ga0209996_1007401 | 3300027395 | Bacteria | 1427 |
| 640 | Ga0209968_1000442 | 3300027526 | Bacteria | 6685 |
| 641 | Ga0209282_1000021 | 3300027666 | Bacteria | 177705 |
| 642 | Ga0209813_10097025 | 3300027866 | Bacteria | 998 |
| 643 | Ga0209974_10090038 | 3300027876 | Bacteria | 1063 |
| 644 | Ga0207428_10174560 | 3300027907 | Bacteria | 1626 |
| 645 | Ga0268266_10254014 | 3300028379 | Bacteria | 1627 |
| 646 | Ga0268266_10280483 | 3300028379 | Bacteria | 1549 |
| 647 | Ga0268266_10421137 | 3300028379 | Bacteria | 1265 |
| 648 | Ga0268265_10038444 | 3300028380 | Bacteria | 3520 |
| 649 | Ga0268265_10042591 | 3300028380 | Bacteria | 3370 |
| 650 | Ga0268265_10089362 | 3300028380 | Bacteria | 2457 |
| 651 | Ga0268265_10103325 | 3300028380 | Bacteria | 2307 |
| 652 | Ga0268264_10004393 | 3300028381 | Bacteria | 12027 |
| 653 | Ga0268264_10020354 | 3300028381 | Bacteria | 5422 |
| 654 | Ga0307517_10012331 | 3300028786 | Bacteria | 11744 |
| 655 | Ga0307517_10142360 | 3300028786 | Bacteria | 1678 |
| 656 | Ga0307515_10000089 | 3300028794 | Bacteria | 215736 |
| 657 | Ga0307515_10000096 | 3300028794 | Bacteria | 206366 |
| 658 | Ga0307515_10007484 | 3300028794 | Bacteria | 21573 |
| 659 | Ga0307515_10041885 | 3300028794 | Bacteria | 7185 |
| 660 | Ga0307515_10080610 | 3300028794 | Bacteria | 4242 |
| 661 | Ga0307515_10089153 | 3300028794 | Bacteria | 3888 |
| 662 | Ga0307515_10297510 | 3300028794 | Bacteria | 1302 |
| 663 | Ga0265338_10000258 | 3300028800 | Bacteria | 96517 |
| 664 | Ga0265338_10001135 | 3300028800 | Bacteria | 44081 |
| 665 | Ga0265324_10002038 | 3300029957 | Bacteria | 10739 |
| 666 | Ga0265324_10035527 | 3300029957 | Bacteria | 1735 |
| 667 | Ga0307512_10051922 | 3300030522 | Bacteria | 3275 |
| 668 | Ga0307512_10052334 | 3300030522 | Bacteria | 3257 |
| 669 | Ga0265332_10049707 | 3300031238 | Bacteria | 1803 |
| 670 | Ga0265328_10006255 | 3300031239 | Bacteria | 5058 |
| 671 | Ga0265325_10010371 | 3300031241 | Bacteria | 5400 |
| 672 | Ga0265331_10006099 | 3300031250 | Bacteria | 7172 |
| 673 | Ga0265327_10000080 | 3300031251 | Bacteria | 206086 |
| 674 | Ga0265327_10017033 | 3300031251 | Bacteria | 4581 |
| 675 | Ga0265316_10309929 | 3300031344 | Bacteria | 1148 |
| 676 | Ga0265316_10326724 | 3300031344 | Bacteria | 1113 |
| 677 | Ga0307513_10005057 | 3300031456 | Bacteria | 17459 |
| 678 | Ga0307513_10016545 | 3300031456 | Bacteria | 8890 |
| 679 | Ga0307513_10035292 | 3300031456 | Bacteria | 5596 |
| 680 | Ga0307509_10000032 | 3300031507 | Bacteria | 202919 |
| 681 | Ga0307509_10001647 | 3300031507 | Bacteria | 37422 |
| 682 | Ga0307509_10006706 | 3300031507 | Bacteria | 15360 |
| 683 | Ga0307509_10013664 | 3300031507 | Bacteria | 9594 |
| 684 | Ga0307408_100000006 | 3300031548 | Bacteria | 472824 |
| 685 | Ga0307408_100037196 | 3300031548 | Bacteria | 3427 |
| 686 | Ga0307408_100051736 | 3300031548 | Bacteria | 2960 |
| 687 | Ga0307508_10000028 | 3300031616 | Bacteria | 168639 |
| 688 | Ga0307508_10001377 | 3300031616 | Bacteria | 27383 |
| 689 | Ga0307508_10065069 | 3300031616 | Bacteria | 3213 |
| 690 | Ga0316575_10000063 | 3300031665 | Bacteria | 26008 |
| 691 | Ga0265314_10003091 | 3300031711 | Bacteria | 16392 |
| 692 | Ga0265314_10032720 | 3300031711 | Bacteria | 3821 |
| 693 | Ga0265314_10043851 | 3300031711 | Bacteria | 3175 |
| 694 | Ga0265314_10166143 | 3300031711 | Bacteria | 1337 |
| 695 | Ga0307516_10001972 | 3300031730 | Bacteria | 28094 |
| 696 | Ga0307516_10177718 | 3300031730 | Bacteria | 1864 |
| 697 | Ga0307405_10028317 | 3300031731 | Bacteria | 3261 |
| 698 | Ga0307405_10089539 | 3300031731 | Bacteria | 2033 |
| 699 | Ga0307405_10413528 | 3300031731 | Bacteria | 1059 |
| 700 | Ga0307413_10052421 | 3300031824 | Bacteria | 2464 |
| 701 | Ga0307407_10442262 | 3300031903 | Bacteria | 942 |
| 702 | Ga0307412_10034330 | 3300031911 | Bacteria | 3233 |
| 703 | Ga0307412_10117010 | 3300031911 | Bacteria | 1913 |
| 704 | Ga0307409_100019603 | 3300031995 | Bacteria | 4585 |
| 705 | Ga0307409_100084584 | 3300031995 | Bacteria | 2576 |
| 706 | Ga0307409_100336573 | 3300031995 | Bacteria | 1418 |
| 707 | Ga0307416_100017160 | 3300032002 | Bacteria | 5055 |
| 708 | Ga0307416_100032323 | 3300032002 | Bacteria | 3952 |
| 709 | Ga0307416_100243962 | 3300032002 | Bacteria | 1743 |
| 710 | Ga0307414_10042417 | 3300032004 | Bacteria | 3091 |
| 711 | Ga0307414_10333943 | 3300032004 | Bacteria | 1295 |
| 712 | Ga0307414_10608346 | 3300032004 | Bacteria | 981 |
| 713 | Ga0307411_10000288 | 3300032005 | Bacteria | 16790 |
| 714 | Ga0307411_10006128 | 3300032005 | Bacteria | 5982 |
| 715 | Ga0307411_10008111 | 3300032005 | Bacteria | 5415 |
| 716 | Ga0307411_10329331 | 3300032005 | Bacteria | 1237 |
| 717 | Ga0307415_100109353 | 3300032126 | Bacteria | 2047 |
| 718 | Ga0307510_10038927 | 3300033180 | Bacteria | 5248 |
| 719 | Ga0307510_10060241 | 3300033180 | Bacteria | 3909 |
| 720 | Ga0307510_10094301 | 3300033180 | Bacteria | 2819 |
| 721 | Ga0307510_10249400 | 3300033180 | Bacteria | 1264 |
| 722 | Ga0307510_10251756 | 3300033180 | Bacteria | 1254 |
| 723 | Ga0373934_0074756 | 3300035086 | Bacteria | 1358 |
| 724 | Ga0373940_0013736 | 3300035088 | Bacteria | 1966 |
| 725 | Ga0373932_0065646 | 3300035112 | Bacteria | 1113 |
| 726 | Ga0373939_0000019 | 3300035114 | Bacteria | 59562 |
| 727 | Ga0373954_0012937 | 3300035118 | Bacteria | 3715 |
| 728 | Ga0373960_0000625 | 3300035121 | Bacteria | 7251 |
| 729 | Ga0373943_0211349 | 3300035170 | Bacteria | 1077 |
| 730 | Ga0373946_0062880 | 3300035171 | Bacteria | 1584 |
| 731 | Ga0373931_0000679 | 3300035691 | Bacteria | 14119 |
| 732 | Ga0373931_0048610 | 3300035691 | Bacteria | 2249 |
| 733 | Ga0373947_0043758 | 3300035725 | Bacteria | 2675 |
| 734 | Ga0373937_0073412 | 3300036401 | Bacteria | 3156 |
| 735 | Ga0373937_0084748 | 3300036401 | Bacteria | 2932 |
| 736 | Ga0373937_0094160 | 3300036401 | Bacteria | 2777 |
| 737 | Ga0373925_0003513 | 3300037068 | Bacteria | 12109 |
| 738 | Ga0395899_0004383 | 3300037312 | Bacteria | 11004 |
| 739 | Ga0395899_0175410 | 3300037312 | Bacteria | 1508 |
| 740 | Ga0395900_0013773 | 3300037418 | Bacteria | 8255 |
| 741 | Ga0395900_0124976 | 3300037418 | Bacteria | 2638 |
| 742 | Ga0395900_0195119 | 3300037418 | Bacteria | 2052 |
| 743 | Ga0395900_0228891 | 3300037418 | Bacteria | 1870 |
| 744 | Ga0395900_0452826 | 3300037418 | Bacteria | 1239 |
| 745 | Ga0395898_0012659 | 3300037466 | Bacteria | 8720 |
| 746 | Ga0395898_0021873 | 3300037466 | Bacteria | 6479 |
| 747 | Ga0395898_0227363 | 3300037466 | Bacteria | 1780 |
| 748 | Ga0395905_0000176 | 3300037471 | Bacteria | 102060 |
| 749 | Ga0395905_0001424 | 3300037471 | Bacteria | 28863 |
| 750 | Ga0395905_0001639 | 3300037471 | Bacteria | 26517 |
| 751 | Ga0395905_0003250 | 3300037471 | Bacteria | 17474 |
| 752 | Ga0395905_0056444 | 3300037471 | Bacteria | 3674 |
| 753 | Ga0395905_0099973 | 3300037471 | Bacteria | 2723 |
| 754 | Ga0395905_0182943 | 3300037471 | Bacteria | 1967 |
| 755 | Ga0395905_0342059 | 3300037471 | Bacteria | 1387 |
| 756 | Ga0436364_1473161 | 3300037853 | Bacteria | 2163 |
| 757 | Ga0395901_0007843 | 3300038443 | Bacteria | 10769 |
| 758 | Ga0395901_0081520 | 3300038443 | Bacteria | 3379 |
| 759 | Ga0395901_0125401 | 3300038443 | Bacteria | 2698 |
| 760 | Ga0395901_0258231 | 3300038443 | Bacteria | 1814 |
| 761 | Ga0400491_02286 | 3300038727 | Bacteria | 1850 |
| 762 | Ga0436361_0004926 | 3300039447 | Bacteria | 16512 |
| 763 | Ga0436361_0027317 | 3300039447 | Bacteria | 79578 |
| 764 | Ga0436361_0046388 | 3300039447 | Bacteria | 28554 |
| 765 | Ga0436361_0799645 | 3300039447 | Bacteria | 27063 |
| 766 | Ga0436361_0968600 | 3300039447 | Bacteria | 8144 |
| 767 | Ga0436361_1048468 | 3300039447 | Bacteria | 939 |
| 768 | Ga0436362_0709755 | 3300039453 | Bacteria | 1463 |
| 769 | Ga0439436_0079053 | 3300041404 | Bacteria | 916 |
| 770 | Ga0439453_0018184 | 3300041408 | Bacteria | 1241 |
| 771 | Ga0439461_0007811 | 3300041410 | Bacteria | 1906 |
| 772 | Ga0439461_0019390 | 3300041410 | Bacteria | 1339 |
| 773 | Ga0451847_0330048 | 3300041503 | Bacteria | 1222 |
| 774 | Ga0451853_3142898 | 3300041512 | Bacteria | 3143 |
| 775 | Ga0451853_3427827 | 3300041512 | Bacteria | 957 |
| 776 | Ga0450917_000993 | 3300042120 | Bacteria | 2095 |
| 777 | Ga0450888_000191 | 3300042126 | Bacteria | 5385 |
| 778 | Ga0450890_009711 | 3300042127 | Bacteria | 1236 |
| 779 | Ga0450897_005099 | 3300042128 | Bacteria | 1125 |
| 780 | Ga0450891_000071 | 3300042129 | Bacteria | 8281 |
| 781 | Ga0450903_020238 | 3300042138 | Bacteria | 1029 |
| 782 | Ga0450904_008647 | 3300042139 | Bacteria | 1005 |
| 783 | Ga0450905_004917 | 3300042142 | Bacteria | 1787 |
| 784 | Ga0450889_000069 | 3300042144 | Bacteria | 9191 |
| 785 | Ga0439446_0014075 | 3300042156 | Bacteria | 2203 |
| 786 | Ga0450909_009486 | 3300042185 | Bacteria | 1421 |
| 787 | Ga0439459_0001762 | 3300042438 | Bacteria | 3239 |
| 788 | Ga0439460_0012999 | 3300042461 | Bacteria | 2171 |
| 789 | Ga0450893_0001280 | 3300042532 | Bacteria | 3804 |
| 790 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 791 | Ga0451577_0001738 | 3300042876 | Bacteria | 28073 |
| 792 | Ga0451577_0002438 | 3300042876 | Bacteria | 22187 |
| 793 | Ga0451577_0022885 | 3300042876 | Bacteria | 5703 |
| 794 | Ga0451577_0033629 | 3300042876 | Bacteria | 4622 |
| 795 | Ga0451577_0174819 | 3300042876 | Bacteria | 1935 |
| 796 | Ga0451577_0235067 | 3300042876 | Bacteria | 1657 |
| 797 | Ga0451577_0273374 | 3300042876 | Bacteria | 1530 |
| 798 | Ga0451577_0273461 | 3300042876 | Bacteria | 1530 |
| 799 | Ga0451577_0312740 | 3300042876 | Bacteria | 1424 |
| 800 | Ga0451577_0344687 | 3300042876 | Bacteria | 1351 |
| 801 | Ga0451577_0395006 | 3300042876 | Bacteria | 1255 |
| 802 | Ga0451577_0583350 | 3300042876 | Bacteria | 1015 |
| 803 | Ga0466986_0063558 | 3300044650 | Bacteria | 2556 |
| 804 | Ga0466969_0000929 | 3300044656 | Bacteria | 15821 |
| 805 | Ga0466969_0044748 | 3300044656 | Bacteria | 2200 |
| 806 | Ga0466977_0000690 | 3300044666 | Bacteria | 11950 |
| 807 | Ga0453683_0000013 | 3300044673 | Bacteria | 371932 |
| 808 | Ga0466965_0000237 | 3300044683 | Bacteria | 17680 |
| 809 | Ga0466966_0002735 | 3300044684 | Bacteria | 11583 |
| 810 | Ga0466966_0120370 | 3300044684 | Bacteria | 1613 |
| 811 | Ga0466961_0012022 | 3300044693 | Bacteria | 5531 |
| 812 | Ga0466961_0142232 | 3300044693 | Bacteria | 1501 |
| 813 | Ga0466963_0016316 | 3300044694 | Bacteria | 4617 |
| 814 | Ga0466963_0031985 | 3300044694 | Bacteria | 3403 |
| 815 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 816 | Ga0453684_0005486 | 3300044712 | Bacteria | 25079 |
| 817 | Ga0453684_0008430 | 3300044712 | Bacteria | 18462 |
| 818 | Ga0453684_0034698 | 3300044712 | Bacteria | 6993 |
| 819 | Ga0453684_0042904 | 3300044712 | Bacteria | 6088 |
| 820 | Ga0453684_0093099 | 3300044712 | Bacteria | 3713 |
| 821 | Ga0453684_0117420 | 3300044712 | Bacteria | 3220 |
| 822 | Ga0453684_0159885 | 3300044712 | Bacteria | 2666 |
| 823 | Ga0453684_0316764 | 3300044712 | Bacteria | 1768 |
| 824 | Ga0453684_0454880 | 3300044712 | Bacteria | 1424 |
| 825 | Ga0466971_0002984 | 3300044719 | Bacteria | 7188 |
| 826 | Ga0466968_0004214 | 3300044735 | Bacteria | 5360 |
| 827 | Ga0466970_0027008 | 3300044765 | Bacteria | 3010 |
| 828 | Ga0466957_0000447 | 3300044842 | Bacteria | 20382 |
| 829 | Ga0466957_0125266 | 3300044842 | Bacteria | 1641 |
| 830 | Ga0466959_0027748 | 3300045049 | Bacteria | 4198 |
| 831 | Ga0466959_0073287 | 3300045049 | Bacteria | 2477 |
| 832 | Ga0451576_0000037 | 3300045051 | Bacteria | 372173 |
| 833 | Ga0451576_0001760 | 3300045051 | Bacteria | 35546 |
| 834 | Ga0451576_0002464 | 3300045051 | Bacteria | 27543 |
| 835 | Ga0451576_0009103 | 3300045051 | Bacteria | 11553 |
| 836 | Ga0451576_0015201 | 3300045051 | Bacteria | 8539 |
| 837 | Ga0451576_0021486 | 3300045051 | Bacteria | 7014 |
| 838 | Ga0451576_0111564 | 3300045051 | Bacteria | 2846 |
| 839 | Ga0451576_0118778 | 3300045051 | Bacteria | 2752 |
| 840 | Ga0451576_0168250 | 3300045051 | Bacteria | 2287 |
| 841 | Ga0451576_0202520 | 3300045051 | Bacteria | 2073 |
| 842 | Ga0451576_0261405 | 3300045051 | Bacteria | 1809 |
| 843 | Ga0466958_0090299 | 3300045836 | Bacteria | 1895 |
| 844 | Ga0466958_0151304 | 3300045836 | Bacteria | 1464 |
| 845 | Ga0466967_0546697 | 3300045976 | Bacteria | 1140 |
| 846 | Ga0495592_0019120 | 3300046454 | Bacteria | 5212 |
| 847 | Ga0495592_0034924 | 3300046454 | Bacteria | 3789 |
| 848 | Ga0495592_0188472 | 3300046454 | Bacteria | 1399 |
| 849 | Ga0495590_0003935 | 3300046457 | Bacteria | 6041 |
| 850 | Ga0495590_0036912 | 3300046457 | Bacteria | 1704 |
| 851 | Ga0495590_0062264 | 3300046457 | Bacteria | 1306 |
| 852 | Ga0495629_0047432 | 3300046459 | Bacteria | 3013 |
| 853 | Ga0495638_0062244 | 3300046460 | Bacteria | 2304 |
| 854 | Ga0495651_0005769 | 3300046462 | Bacteria | 9446 |
| 855 | Ga0495651_0072318 | 3300046462 | Bacteria | 2619 |
| 856 | Ga0495651_0221611 | 3300046462 | Bacteria | 1308 |
| 857 | Ga0495653_0034300 | 3300046463 | Bacteria | 4015 |
| 858 | Ga0495650_0024295 | 3300046471 | Bacteria | 2864 |
| 859 | Ga0495650_0061097 | 3300046471 | Bacteria | 1511 |
| 860 | Ga0495582_0042043 | 3300046473 | Bacteria | 2518 |
| 861 | Ga0495605_0006736 | 3300046474 | Bacteria | 6569 |
| 862 | Ga0495605_0061328 | 3300046474 | Bacteria | 1800 |
| 863 | Ga0495664_0325460 | 3300046477 | Bacteria | 927 |
| 864 | Ga0495584_0010102 | 3300046491 | Bacteria | 4847 |
| 865 | Ga0495596_0000385 | 3300046500 | Bacteria | 28186 |
| 866 | Ga0495596_0134958 | 3300046500 | Bacteria | 958 |
| 867 | Ga0495607_0077829 | 3300046501 | Bacteria | 1831 |
| 868 | Ga0495583_0040632 | 3300046506 | Bacteria | 2183 |
| 869 | Ga0495606_0012870 | 3300046507 | Bacteria | 6663 |
| 870 | Ga0495608_0265627 | 3300046511 | Bacteria | 1067 |
| 871 | Ga0495610_0009756 | 3300046512 | Bacteria | 6036 |
| 872 | Ga0495616_0003889 | 3300046513 | Bacteria | 9515 |
| 873 | Ga0495620_0031763 | 3300046515 | Bacteria | 2415 |
| 874 | Ga0495628_0001234 | 3300046516 | Bacteria | 23412 |
| 875 | Ga0495628_0048653 | 3300046516 | Bacteria | 3360 |
| 876 | Ga0495628_0064766 | 3300046516 | Bacteria | 2861 |
| 877 | Ga0495630_0041291 | 3300046517 | Bacteria | 3444 |
| 878 | Ga0495632_0009387 | 3300046519 | Bacteria | 5903 |
| 879 | Ga0495642_0022222 | 3300046528 | Bacteria | 2499 |
| 880 | Ga0495642_0033764 | 3300046528 | Bacteria | 2058 |
| 881 | Ga0495652_0123393 | 3300046529 | Bacteria | 2062 |
| 882 | Ga0495652_0223499 | 3300046529 | Bacteria | 1413 |
| 883 | Ga0495609_0000136 | 3300046538 | Bacteria | 77986 |
| 884 | Ga0495609_0001940 | 3300046538 | Bacteria | 13168 |
| 885 | Ga0495609_0068091 | 3300046538 | Bacteria | 1567 |
| 886 | Ga0495621_0006088 | 3300046539 | Bacteria | 3504 |
| 887 | Ga0495597_0012048 | 3300046542 | Bacteria | 4179 |
| 888 | Ga0495645_0026599 | 3300046543 | Bacteria | 4201 |
| 889 | Ga0495633_0040028 | 3300046558 | Bacteria | 2235 |
| 890 | Ga0495667_0129864 | 3300046559 | Bacteria | 1626 |
| 891 | Ga0495668_0000029 | 3300046616 | Bacteria | 279128 |
| 892 | Ga0495668_0033309 | 3300046616 | Bacteria | 2895 |
| 893 | Ga0495668_0085564 | 3300046616 | Bacteria | 1729 |
| 894 | Ga0495625_0002966 | 3300046660 | Bacteria | 17641 |
| 895 | Ga0495625_0022770 | 3300046660 | Bacteria | 4795 |
| 896 | Ga0495625_0033839 | 3300046660 | Bacteria | 3775 |
| 897 | Ga0495635_0061843 | 3300046663 | Bacteria | 2571 |
| 898 | Ga0495646_0004580 | 3300046680 | Bacteria | 8715 |
| 899 | Ga0495646_0070868 | 3300046680 | Bacteria | 2052 |
| 900 | Ga0495647_0068643 | 3300046681 | Bacteria | 1414 |
| 901 | Ga0495669_0001803 | 3300046684 | Bacteria | 8750 |
| 902 | Ga0495670_0026463 | 3300046691 | Bacteria | 2871 |
| 903 | Ga0495671_0125627 | 3300046692 | Bacteria | 1251 |
| 904 | Ga0495649_0000541 | 3300046694 | Bacteria | 32077 |
| 905 | Ga0495649_0059878 | 3300046694 | Bacteria | 2049 |
| 906 | Ga0495589_0071998 | 3300046794 | Bacteria | 1689 |
| 907 | Ga0495600_0065179 | 3300046809 | Bacteria | 2381 |
| 908 | Ga0495600_0110953 | 3300046809 | Bacteria | 1786 |
| 909 | Ga0495660_0063546 | 3300046810 | Bacteria | 1976 |
| 910 | Ga0495660_0108014 | 3300046810 | Bacteria | 1423 |
| 911 | Ga0495604_0149320 | 3300047317 | Bacteria | 1662 |
| 912 | Ga0495636_0008030 | 3300047318 | Bacteria | 4160 |
| 913 | Ga0495636_0022950 | 3300047318 | Bacteria | 2524 |
| 914 | Ga0495674_0013839 | 3300047319 | Bacteria | 7573 |
| 915 | Ga0495683_0196721 | 3300047323 | Bacteria | 911 |
| 916 | Ga0495687_001991 | 3300047443 | Bacteria | 17372 |
| 917 | Ga0495687_006560 | 3300047443 | Bacteria | 7098 |
| 918 | Ga0495687_014896 | 3300047443 | Bacteria | 3974 |
| 919 | Ga0495687_062118 | 3300047443 | Bacteria | 1534 |
| 920 | Ga0495679_006268 | 3300047446 | Bacteria | 5148 |
| 921 | Ga0495685_008022 | 3300047447 | Bacteria | 3497 |
| 922 | Ga0495673_0146820 | 3300047469 | Bacteria | 915 |
| 923 | Ga0495681_0014798 | 3300047470 | Bacteria | 4451 |
| 924 | Ga0495684_0062323 | 3300047471 | Bacteria | 2837 |
| 925 | Ga0495686_0007111 | 3300047472 | Bacteria | 8434 |
| 926 | Ga0495593_0056385 | 3300047673 | Bacteria | 2066 |
| 927 | Ga0495602_0144374 | 3300048088 | Bacteria | 1880 |
| 928 | Ga0495602_0170371 | 3300048088 | Bacteria | 1690 |
| 929 | Ga0495626_0089455 | 3300048091 | Bacteria | 1356 |
| 930 | Ga0496100_0023701 | 3300048903 | Bacteria | 3733 |
| 931 | Ga0496100_0503784 | 3300048903 | Bacteria | 933 |
| 932 | Ga0496101_0013511 | 3300048904 | Bacteria | 5473 |
| 933 | Ga0496101_0195147 | 3300048904 | Bacteria | 1564 |
| 934 | Ga0496102_0027430 | 3300048905 | Bacteria | 5085 |
| 935 | Ga0496102_0033963 | 3300048905 | Bacteria | 4587 |
| 936 | Ga0496103_0055059 | 3300048906 | Bacteria | 2466 |
| 937 | Ga0496104_0044408 | 3300048907 | Bacteria | 4175 |
| 938 | Ga0496104_0215855 | 3300048907 | Bacteria | 1830 |
| 939 | Ga0496104_0279502 | 3300048907 | Bacteria | 1582 |
| 940 | Ga0496104_0314276 | 3300048907 | Bacteria | 1479 |
| 941 | Ga0496104_0481158 | 3300048907 | Bacteria | 1153 |
| 942 | Ga0496105_0110051 | 3300048908 | Bacteria | 2274 |
| 943 | Ga0496106_0000011 | 3300048909 | Bacteria | 222845 |
| 944 | Ga0496106_0006072 | 3300048909 | Bacteria | 8940 |
| 945 | Ga0496106_0459919 | 3300048909 | Bacteria | 1022 |
| 946 | Ga0496107_0141916 | 3300048910 | Bacteria | 1775 |
| 947 | Ga0496107_0208243 | 3300048910 | Bacteria | 1454 |
| 948 | Ga0496108_0017021 | 3300048911 | Bacteria | 5942 |
| 949 | Ga0496109_0129150 | 3300048912 | Bacteria | 2358 |
| 950 | Ga0496110_0007472 | 3300048913 | Bacteria | 8735 |
| 951 | Ga0496111_0205344 | 3300048914 | Bacteria | 1464 |
| 952 | Ga0496111_0345940 | 3300048914 | Bacteria | 1101 |
| 953 | Ga0496113_0043484 | 3300048916 | Bacteria | 3325 |
| 954 | Ga0496114_0007646 | 3300048917 | Bacteria | 8547 |
| 955 | Ga0496114_0164755 | 3300048917 | Bacteria | 1929 |
| 956 | Ga0496114_0255612 | 3300048917 | Bacteria | 1542 |
| 957 | Ga0496115_0007917 | 3300048918 | Bacteria | 7839 |
| 958 | Ga0496116_0021901 | 3300048919 | Bacteria | 4806 |
| 959 | Ga0496117_0028852 | 3300048920 | Bacteria | 4289 |
| 960 | Ga0496118_0041792 | 3300048921 | Bacteria | 3625 |
| 961 | Ga0496118_0101239 | 3300048921 | Bacteria | 1946 |
| 962 | Ga0496118_0156283 | 3300048921 | Bacteria | 1418 |
| 963 | Ga0496119_0110012 | 3300048922 | Bacteria | 1531 |
| 964 | Ga0496121_0010887 | 3300048924 | Bacteria | 10167 |
| 965 | Ga0496121_0023777 | 3300048924 | Bacteria | 5885 |
| 966 | Ga0496121_0042796 | 3300048924 | Bacteria | 3933 |
| 967 | Ga0496121_0137378 | 3300048924 | Bacteria | 1819 |
| 968 | Ga0496121_0265552 | 3300048924 | Bacteria | 1182 |
| 969 | Ga0496122_0003149 | 3300048925 | Bacteria | 22078 |
| 970 | Ga0496122_0021327 | 3300048925 | Bacteria | 5804 |
| 971 | Ga0496123_0000916 | 3300048926 | Bacteria | 46316 |
| 972 | Ga0496123_0027948 | 3300048926 | Bacteria | 4187 |
| 973 | Ga0496124_0066161 | 3300048927 | Bacteria | 3011 |
| 974 | Ga0496125_0004292 | 3300048928 | Bacteria | 16553 |
| 975 | Ga0496126_0002068 | 3300048929 | Bacteria | 28159 |
| 976 | Ga0496126_0026637 | 3300048929 | Bacteria | 5540 |
| 977 | Ga0496126_0194871 | 3300048929 | Bacteria | 1714 |
| 978 | Ga0495682_0084323 | 3300049460 | Bacteria | 1142 |
| 979 | Ga0501292_005344 | 3300049515 | Bacteria | 1789 |
| 980 | Ga0501297_000437 | 3300049520 | Bacteria | 3798 |
| 981 | Ga0501297_001705 | 3300049520 | Bacteria | 2052 |
| 982 | Ga0501300_005125 | 3300049523 | Bacteria | 1939 |
| 983 | Ga0501318_005591 | 3300049534 | Bacteria | 1253 |
| 984 | Ga0501034_0000092 | 3300049571 | Bacteria | 164224 |
| 985 | Ga0501043_0000058 | 3300049579 | Bacteria | 102030 |
| 986 | Ga0501043_0104737 | 3300049579 | Bacteria | 2223 |
| 987 | Ga0501043_0257990 | 3300049579 | Bacteria | 1341 |
| 988 | Ga0501046_0000051 | 3300049580 | Bacteria | 133545 |
| 989 | Ga0501046_0037420 | 3300049580 | Bacteria | 3899 |
| 990 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 991 | Ga0501047_0027508 | 3300049581 | Bacteria | 5479 |
| 992 | Ga0501048_0000321 | 3300049582 | Bacteria | 32907 |
| 993 | Ga0501198_000007 | 3300049649 | Bacteria | 129700 |
| 994 | Ga0501211_001859 | 3300049658 | Bacteria | 2253 |
| 995 | Ga0501222_000005 | 3300049662 | Bacteria | 129724 |
| 996 | Ga0501222_000600 | 3300049662 | Bacteria | 5290 |
| 997 | Ga0501223_008762 | 3300049663 | Bacteria | 2060 |
| 998 | Ga0501235_006815 | 3300049669 | Bacteria | 2486 |
| 999 | Ga0501221_000150 | 3300049704 | Bacteria | 9308 |
| 1000 | Ga0501225_0018533 | 3300049705 | Bacteria | 1929 |
| 1001 | Ga0501232_001083 | 3300049757 | Bacteria | 2058 |
| 1002 | Ga0501262_001378 | 3300049759 | Bacteria | 2726 |
| 1003 | Ga0501265_001507 | 3300049762 | Bacteria | 2618 |
| 1004 | Ga0501267_001311 | 3300049764 | Bacteria | 2112 |
| 1005 | Ga0501272_004940 | 3300049769 | Bacteria | 1395 |
| 1006 | Ga0501282_006018 | 3300049778 | Bacteria | 1298 |
| 1007 | Ga0501283_005329 | 3300049779 | Bacteria | 1766 |
| 1008 | Ga0501035_0007072 | 3300049822 | Bacteria | 10489 |
| 1009 | Ga0501035_0208416 | 3300049822 | Bacteria | 1673 |
| 1010 | Ga0501044_0013104 | 3300049823 | Bacteria | 8975 |
| 1011 | Ga0501044_0273189 | 3300049823 | Bacteria | 1625 |
| 1012 | Ga0501045_0075630 | 3300049824 | Bacteria | 2480 |
| 1013 | Ga0501045_0312017 | 3300049824 | Bacteria | 1170 |
| 1014 | nmdc:mga03683_113732_c1 | 3300050489 | Bacteria | 1199 |
| 1015 | nmdc:mga03683_41512_c1 | 3300050489 | Bacteria | 1890 |
| 1016 | nmdc:mga0yw44_64903_c1 | 3300050492 | Bacteria | 2248 |
| 1017 | nmdc:mga0k408_121887_c1 | 3300050493 | Bacteria | 1544 |
| 1018 | nmdc:mga0k408_19056_c1 | 3300050493 | Bacteria | 3832 |
| 1019 | nmdc:mga0k408_20391_c1 | 3300050493 | Bacteria | 2752 |
| 1020 | nmdc:mga0k408_23723_c1 | 3300050493 | Bacteria | 3464 |
| 1021 | nmdc:mga0k408_30466_c1 | 3300050493 | Bacteria | 3076 |
| 1022 | nmdc:mga0k408_370_c1 | 3300050493 | Bacteria | 24649 |
| 1023 | nmdc:mga0k408_4315_c1 | 3300050493 | Bacteria | 7552 |
| 1024 | nmdc:mga06z11_181621_c1 | 3300050494 | Bacteria | 1213 |
| 1025 | nmdc:mga06z11_34181_c1 | 3300050494 | Bacteria | 2494 |
| 1026 | nmdc:mga06z11_80032_c1 | 3300050494 | Bacteria | 1751 |
| 1027 | nmdc:mga04h51_9044_c1 | 3300050495 | Bacteria | 2685 |
| 1028 | nmdc:mga07m45_110530_c1 | 3300050496 | Bacteria | 1583 |
| 1029 | nmdc:mga07m45_14825_c1 | 3300050496 | Bacteria | 2056 |
| 1030 | nmdc:mga07m45_1517_c1 | 3300050496 | Bacteria | 10644 |
| 1031 | nmdc:mga07m45_18156_c1 | 3300050496 | Bacteria | 3791 |
| 1032 | nmdc:mga07m45_25005_c1 | 3300050496 | Bacteria | 1239 |
| 1033 | nmdc:mga07m45_32728_c1 | 3300050496 | Bacteria | 2884 |
| 1034 | nmdc:mga07m45_43356_c1 | 3300050496 | Bacteria | 2522 |
| 1035 | nmdc:mga07m45_54331_c1 | 3300050496 | Bacteria | 2264 |
| 1036 | nmdc:mga07m45_61286_c1 | 3300050496 | Bacteria | 2131 |
| 1037 | nmdc:mga07m45_7007_c1 | 3300050496 | Bacteria | 5734 |
| 1038 | nmdc:mga09592_176549_c1 | 3300050508 | Bacteria | 1847 |
| 1039 | nmdc:mga09592_819_c1 | 3300050508 | Bacteria | 24059 |
| 1040 | nmdc:mga0qj67_191552_c1 | 3300050509 | Bacteria | 1662 |
| 1041 | nmdc:mga0sz30_26990_c2 | 3300050516 | Bacteria | 1999 |
| 1042 | Ga0495601_0055940 | 3300053077 | Bacteria | 2498 |
| 1043 | Ga0495612_0039580 | 3300053078 | Bacteria | 1918 |
| 1044 | Ga0495595_0057445 | 3300053084 | Bacteria | 1815 |
| 1045 | Ga0500647_0117247 | 3300053091 | Bacteria | 1262 |
| 1046 | Ga0500583_0104323 | 3300053092 | Bacteria | 1391 |
| 1047 | Ga0500651_0080149 | 3300053093 | Bacteria | 2022 |
| 1048 | Ga0500650_0073375 | 3300053098 | Bacteria | 1600 |
| 1049 | Ga0500593_001896 | 3300053117 | Bacteria | 7524 |
| 1050 | Ga0500593_007810 | 3300053117 | Bacteria | 4373 |
| 1051 | Ga0500594_0001004 | 3300053118 | Bacteria | 6050 |
| 1052 | Ga0500595_003933 | 3300053119 | Bacteria | 6805 |
| 1053 | Ga0500618_000765 | 3300053125 | Bacteria | 18166 |
| 1054 | Ga0500618_001461 | 3300053125 | Bacteria | 10499 |
| 1055 | Ga0500658_0008109 | 3300053134 | Bacteria | 3883 |
| 1056 | Ga0500559_0000694 | 3300053136 | Bacteria | 22155 |
| 1057 | Ga0500564_019933 | 3300053138 | Bacteria | 3069 |
| 1058 | Ga0500568_0033439 | 3300053139 | Bacteria | 2109 |
| 1059 | Ga0500590_023706 | 3300053148 | Bacteria | 3185 |
| 1060 | Ga0500619_003712 | 3300053154 | Bacteria | 3171 |
| 1061 | Ga0500622_0002460 | 3300053156 | Bacteria | 13355 |
| 1062 | Ga0500622_0005187 | 3300053156 | Bacteria | 7891 |
| 1063 | Ga0500587_003270 | 3300053739 | Bacteria | 2274 |
| 1064 | Ga0587098_001158 | 3300059604 | Bacteria | 1938 |
| 1065 | Ga0587067_000132 | 3300059640 | Bacteria | 5020 |
| 1066 | Ga0587072_000426 | 3300059643 | Bacteria | 4190 |
| 1067 | Ga0530510_0350864 | 3300061734 | Bacteria | 1108 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0175410 | Ga0395899_0175410_62_904 | 252 |
| 2 | 3300037418 | Ga0395900_0195119 | Ga0395900_0195119_88_930 | 252 |
| 3 | 3300037466 | Ga0395898_0227363 | Ga0395898_0227363_453_1295 | 252 |
| 4 | 3300028794 | Ga0307515_10000096 | Ga0307515_1000009663 | 261 |
| 5 | 3300025931 | Ga0207644_10386487 | Ga0207644_103864871 | 268 |
| 6 | 3300005327 | Ga0070658_10561836 | Ga0070658_105618361 | 270 |
| 7 | 3300005331 | Ga0070670_100139592 | Ga0070670_1001395921 | 270 |
| 8 | 3300005334 | Ga0068869_100035950 | Ga0068869_1000359503 | 270 |
| 9 | 3300005335 | Ga0070666_10143697 | Ga0070666_101436972 | 270 |
| 10 | 3300005338 | Ga0068868_100002885 | Ga0068868_1000028854 | 270 |
| 11 | 3300005339 | Ga0070660_100062262 | Ga0070660_1000622623 | 270 |
| 12 | 3300005340 | Ga0070689_100262479 | Ga0070689_1002624791 | 270 |
| 13 | 3300005354 | Ga0070675_100000692 | Ga0070675_10000069222 | 270 |
| 14 | 3300005355 | Ga0070671_100103137 | Ga0070671_1001031373 | 270 |
| 15 | 3300005365 | Ga0070688_100072165 | Ga0070688_1000721653 | 270 |
| 16 | 3300005367 | Ga0070667_100003264 | Ga0070667_1000032644 | 270 |
| 17 | 3300005456 | Ga0070678_100064650 | Ga0070678_1000646501 | 270 |
| 18 | 3300005457 | Ga0070662_100076345 | Ga0070662_1000763452 | 270 |
| 19 | 3300005459 | Ga0068867_100203951 | Ga0068867_1002039512 | 270 |
| 20 | 3300005544 | Ga0070686_100247415 | Ga0070686_1002474152 | 270 |
| 21 | 3300005547 | Ga0070693_100032105 | Ga0070693_1000321053 | 270 |
| 22 | 3300005563 | Ga0068855_100147077 | Ga0068855_1001470772 | 270 |
| 23 | 3300005616 | Ga0068852_100006988 | Ga0068852_1000069883 | 270 |
| 24 | 3300005617 | Ga0068859_100120053 | Ga0068859_1001200531 | 270 |
| 25 | 3300005618 | Ga0068864_100000417 | Ga0068864_10000041733 | 270 |
| 26 | 3300005834 | Ga0068851_10008763 | Ga0068851_100087634 | 270 |
| 27 | 3300005841 | Ga0068863_100116242 | Ga0068863_1001162423 | 270 |
| 28 | 3300005842 | Ga0068858_100042716 | Ga0068858_1000427164 | 270 |
| 29 | 3300006358 | Ga0068871_100257770 | Ga0068871_1002577702 | 270 |
| 30 | 3300006931 | Ga0097620_100120048 | Ga0097620_1001200481 | 270 |
| 31 | 3300009551 | Ga0105238_10007405 | Ga0105238_1000740511 | 270 |
| 32 | 3300013100 | Ga0157373_10079106 | Ga0157373_100791062 | 270 |
| 33 | 3300013105 | Ga0157369_10019944 | Ga0157369_1001994410 | 270 |
| 34 | 3300013296 | Ga0157374_10253714 | Ga0157374_102537142 | 270 |
| 35 | 3300013306 | Ga0163162_10525009 | Ga0163162_105250092 | 270 |
| 36 | 3300014325 | Ga0163163_10205725 | Ga0163163_102057253 | 270 |
| 37 | 3300014968 | Ga0157379_10005918 | Ga0157379_100059183 | 270 |
| 38 | 3300025321 | Ga0207656_10007965 | Ga0207656_100079653 | 270 |
| 39 | 3300025893 | Ga0207682_10128893 | Ga0207682_101288931 | 270 |
| 40 | 3300025903 | Ga0207680_10048731 | Ga0207680_100487313 | 270 |
| 41 | 3300025924 | Ga0207694_10011272 | Ga0207694_100112729 | 270 |
| 42 | 3300025926 | Ga0207659_10033524 | Ga0207659_100335243 | 270 |
| 43 | 3300025931 | Ga0207644_10021105 | Ga0207644_100211055 | 270 |
| 44 | 3300025933 | Ga0207706_10067960 | Ga0207706_100679604 | 270 |
| 45 | 3300025936 | Ga0207670_10137759 | Ga0207670_101377593 | 270 |
| 46 | 3300025941 | Ga0207711_10469707 | Ga0207711_104697072 | 270 |
| 47 | 3300025945 | Ga0207679_10021183 | Ga0207679_100211832 | 270 |
| 48 | 3300025986 | Ga0207658_10006064 | Ga0207658_100060647 | 270 |
| 49 | 3300026023 | Ga0207677_10086434 | Ga0207677_100864341 | 270 |
| 50 | 3300026035 | Ga0207703_10009710 | Ga0207703_100097101 | 270 |
| 51 | 3300026088 | Ga0207641_10009276 | Ga0207641_100092765 | 270 |
| 52 | 3300026095 | Ga0207676_10075167 | Ga0207676_100751673 | 270 |
| 53 | 3300026121 | Ga0207683_10125588 | Ga0207683_101255883 | 270 |
| 54 | 3300042876 | Ga0451577_0395006 | Ga0451577_0395006_310_1158 | 270 |
| 55 | 3300048909 | Ga0496106_0459919 | Ga0496106_0459919_98_949 | 270 |
| 56 | 3300048912 | Ga0496109_0129150 | Ga0496109_0129150_118_969 | 270 |
| 57 | iso_pu_bacteria | 2643221639 | 2644219799 | 270 |
| 58 | 3300044712 | Ga0453684_0316764 | Ga0453684_0316764_752_1600 | 271 |
| 59 | 3300045051 | Ga0451576_0021486 | Ga0451576_0021486_5130_5978 | 271 |
| 60 | iso_pu_bacteria | 2562617112 | 2563055625 | 271 |
| 61 | iso_pu_bacteria | 2643221544 | 2643744130 | 271 |
| 62 | iso_pu_bacteria | 2643221585 | 2643932397 | 271 |
| 63 | iso_pu_bacteria | 2643221646 | 2644256270 | 271 |
| 64 | iso_pu_bacteria | 2643221656 | 2644313648 | 271 |
| 65 | iso_pu_bacteria | 2711768613 | 2713478727 | 271 |
| 66 | iso_pu_bacteria | 2738541337 | 2739054699 | 271 |
| 67 | iso_pu_bacteria | 2738543013 | 2739249710 | 271 |
| 68 | iso_pu_bacteria | 2842711865 | 2842717422 | 271 |
| 69 | iso_pu_bacteria | 2886848708 | 2886849101 | 271 |
| 70 | iso_pu_bacteria | 2886848708 | 2886850283 | 271 |
| 71 | iso_pu_bacteria | 2886848708 | 2886850446 | 271 |
| 72 | iso_pu_bacteria | 2886848708 | 2886853446 | 271 |
| 73 | iso_pu_bacteria | 2921643360 | 2921653674 | 271 |
| 74 | 3300003187 | JGI25151J46595_10012502 | JGI25151J46595_100125023 | 272 |
| 75 | 3300005262 | Ga0065165_1001544 | Ga0065165_10015442 | 272 |
| 76 | 3300006195 | Ga0075366_10065018 | Ga0075366_100650183 | 272 |
| 77 | 3300025258 | Ga0209129_1004031 | Ga0209129_10040315 | 272 |
| 78 | 3300025294 | Ga0209025_1002236 | Ga0209025_10022363 | 272 |
| 79 | 3300025935 | Ga0207709_10022617 | Ga0207709_100226173 | 272 |
| 80 | 3300028786 | Ga0307517_10142360 | Ga0307517_101423602 | 272 |
| 81 | 3300031239 | Ga0265328_10006255 | Ga0265328_100062553 | 272 |
| 82 | 3300031250 | Ga0265331_10006099 | Ga0265331_100060994 | 272 |
| 83 | 3300031251 | Ga0265327_10000080 | Ga0265327_10000080111 | 272 |
| 84 | 3300041404 | Ga0439436_0079053 | Ga0439436_0079053_44_868 | 272 |
| 85 | 3300041408 | Ga0439453_0018184 | Ga0439453_0018184_19_843 | 272 |
| 86 | 3300042127 | Ga0450890_009711 | Ga0450890_009711_47_871 | 272 |
| 87 | 3300042128 | Ga0450897_005099 | Ga0450897_005099_73_897 | 272 |
| 88 | 3300042138 | Ga0450903_020238 | Ga0450903_020238_70_894 | 272 |
| 89 | 3300042139 | Ga0450904_008647 | Ga0450904_008647_126_950 | 272 |
| 90 | 3300042156 | Ga0439446_0014075 | Ga0439446_0014075_288_1112 | 272 |
| 91 | 3300042185 | Ga0450909_009486 | Ga0450909_009486_529_1353 | 272 |
| 92 | 3300042461 | Ga0439460_0012999 | Ga0439460_0012999_1181_2008 | 272 |
| 93 | 3300044684 | Ga0466966_0120370 | Ga0466966_0120370_519_1346 | 272 |
| 94 | 3300046538 | Ga0495609_0068091 | Ga0495609_0068091_517_1368 | 272 |
| 95 | 3300050493 | nmdc:mga0k408_30466_c1 | nmdc:mga0k408_30466_c1_1064_1915 | 272 |
| 96 | 3300050494 | nmdc:mga06z11_181621_c1 | nmdc:mga06z11_181621_c1_176_1027 | 272 |
| 97 | 3300050496 | nmdc:mga07m45_18156_c1 | nmdc:mga07m45_18156_c1_1915_2766 | 272 |
| 98 | 3300050508 | nmdc:mga09592_176549_c1 | nmdc:mga09592_176549_c1_304_1128 | 272 |
| 99 | iso_pu_bacteria | 2501025501 | 2501073722 | 272 |
| 100 | iso_pu_bacteria | 2501025502 | 2501078483 | 272 |
| 101 | iso_pu_bacteria | 2501025504 | 2501410241 | 272 |
| 102 | iso_pu_bacteria | 2510917013 | 2511090177 | 272 |
| 103 | iso_pu_bacteria | 2510917014 | 2511095559 | 272 |
| 104 | iso_pu_bacteria | 2510917015 | 2511102196 | 272 |
| 105 | iso_pu_bacteria | 2511231003 | 2511249570 | 272 |
| 106 | iso_pu_bacteria | 2511231026 | 2511384104 | 272 |
| 107 | iso_pu_bacteria | 2513237082 | 2513554616 | 272 |
| 108 | iso_pu_bacteria | 2513237083 | 2513563567 | 272 |
| 109 | iso_pu_bacteria | 2513237150 | 2513957329 | 272 |
| 110 | iso_pu_bacteria | 2513237165 | 2514044772 | 272 |
| 111 | iso_pu_bacteria | 2513237166 | 2514050637 | 272 |
| 112 | iso_pu_bacteria | 2515154123 | 2515688179 | 272 |
| 113 | iso_pu_bacteria | 2515154189 | 2516018595 | 272 |
| 114 | iso_pu_bacteria | 2521172590 | 2521560228 | 272 |
| 115 | iso_pu_bacteria | 2548876994 | 2550695367 | 272 |
| 116 | iso_pu_bacteria | 2551306416 | 2553005030 | 272 |
| 117 | iso_pu_bacteria | 2582581311 | 2585292034 | 272 |
| 118 | iso_pu_bacteria | 2585428057 | 2587725981 | 272 |
| 119 | iso_pu_bacteria | 2585428058 | 2587735643 | 272 |
| 120 | iso_pu_bacteria | 2588253510 | 2588292810 | 272 |
| 121 | iso_pu_bacteria | 2596583598 | 2597029377 | 272 |
| 122 | iso_pu_bacteria | 2599185178 | 2599447397 | 272 |
| 123 | iso_pu_bacteria | 2600255067 | 2600813160 | 272 |
| 124 | iso_pu_bacteria | 2643221592 | 2643967918 | 272 |
| 125 | iso_pu_bacteria | 2643221603 | 2644028182 | 272 |
| 126 | iso_pu_bacteria | 2643221625 | 2644143182 | 272 |
| 127 | iso_pu_bacteria | 2643221648 | 2644271730 | 272 |
| 128 | iso_pu_bacteria | 2721755763 | 2723875888 | 272 |
| 129 | iso_pu_bacteria | 2751185846 | 2753568769 | 272 |
| 130 | iso_pu_bacteria | 2765235838 | 2765571400 | 272 |
| 131 | iso_pu_bacteria | 2791355137 | 2792836902 | 272 |
| 132 | iso_pu_bacteria | 2808606386 | 2808982437 | 272 |
| 133 | iso_pu_bacteria | 2808606415 | 2809129736 | 272 |
| 134 | iso_pu_bacteria | 2808606419 | 2809149209 | 272 |
| 135 | iso_pu_bacteria | 2816332253 | 2817259609 | 272 |
| 136 | iso_pu_bacteria | 2816332256 | 2817277276 | 272 |
| 137 | iso_pu_bacteria | 2816332286 | 2817452248 | 272 |
| 138 | iso_pu_bacteria | 2818991445 | 2819592953 | 272 |
| 139 | iso_pu_bacteria | 2818991449 | 2819616585 | 272 |
| 140 | iso_pu_bacteria | 2831864461 | 2831867658 | 272 |
| 141 | iso_pu_bacteria | 2834641062 | 2834644221 | 272 |
| 142 | iso_pu_bacteria | 2839094727 | 2839098688 | 272 |
| 143 | iso_pu_bacteria | 2852618963 | 2852619350 | 272 |
| 144 | iso_pu_bacteria | 2856287931 | 2856292321 | 272 |
| 145 | iso_pu_bacteria | 2857357740 | 2857365466 | 272 |
| 146 | iso_pu_bacteria | 2858688981 | 2858698061 | 272 |
| 147 | iso_pu_bacteria | 2883087390 | 2883096222 | 272 |
| 148 | iso_pu_bacteria | 2884811622 | 2884812065 | 272 |
| 149 | iso_pu_bacteria | 2884836552 | 2884838535 | 272 |
| 150 | iso_pu_bacteria | 2884852848 | 2884854826 | 272 |
| 151 | iso_pu_bacteria | 2896154374 | 2896156505 | 272 |
| 152 | iso_pu_bacteria | 2901300506 | 2901304086 | 272 |
| 153 | iso_pu_bacteria | 2904439833 | 2904440731 | 272 |
| 154 | iso_pu_bacteria | 2904530477 | 2904535330 | 272 |
| 155 | iso_pu_bacteria | 2904584206 | 2904589191 | 272 |
| 156 | iso_pu_bacteria | 2904589729 | 2904594591 | 272 |
| 157 | iso_pu_bacteria | 2904601388 | 2904605818 | 272 |
| 158 | iso_pu_bacteria | 2919046199 | 2919048896 | 272 |
| 159 | iso_pu_bacteria | 2919079590 | 2919084099 | 272 |
| 160 | iso_pu_bacteria | 2923510766 | 2923513981 | 272 |
| 161 | iso_pu_bacteria | 2928058823 | 2928060769 | 272 |
| 162 | iso_pu_bacteria | 2928163908 | 2928170282 | 272 |
| 163 | iso_pu_bacteria | 644736347 | 644746524 | 272 |
| 164 | iso_pu_bacteria | 8003400568 | 8003401927 | 272 |
| 165 | iso_pu_bacteria | 8003955200 | 8003960314 | 272 |
| 166 | iso_pu_bacteria | 8020807995 | 8020812577 | 272 |
| 167 | iso_pu_bacteria | 8040167225 | 8040172493 | 272 |
| 168 | iso_pu_bacteria | 8040173305 | 8040177097 | 272 |
| 169 | 3300003316 | rootH1_10009708 | rootH1_1000970815 | 273 |
| 170 | 3300003316 | rootH1_10046862 | rootH1_100468622 | 273 |
| 171 | 3300003320 | rootH2_10003807 | rootH2_100038072 | 273 |
| 172 | 3300003322 | rootL2_10001066 | rootL2_100010663 | 273 |
| 173 | 3300003322 | rootL2_10093618 | rootL2_100936185 | 273 |
| 174 | 3300003759 | Ga0055525_1000054 | Ga0055525_1000054138 | 273 |
| 175 | 3300003771 | Ga0055526_1007791 | Ga0055526_10077913 | 273 |
| 176 | 3300003775 | Ga0055524_1000550 | Ga0055524_100055027 | 273 |
| 177 | 3300003794 | Ga0055531_10000042 | Ga0055531_1000004223 | 273 |
| 178 | 3300005262 | Ga0065165_1000474 | Ga0065165_100047447 | 273 |
| 179 | 3300005262 | Ga0065165_1000621 | Ga0065165_100062124 | 273 |
| 180 | 3300005337 | Ga0070682_100064094 | Ga0070682_1000640943 | 273 |
| 181 | 3300006353 | Ga0075370_10000595 | Ga0075370_1000059511 | 273 |
| 182 | 3300006353 | Ga0075370_10027042 | Ga0075370_100270423 | 273 |
| 183 | 3300006944 | Ga0099823_1000559 | Ga0099823_100055923 | 273 |
| 184 | 3300009148 | Ga0105243_10107642 | Ga0105243_101076423 | 273 |
| 185 | 3300010375 | Ga0105239_10138089 | Ga0105239_101380892 | 273 |
| 186 | 3300012497 | Ga0157319_1000005 | Ga0157319_1000005118 | 273 |
| 187 | 3300013307 | Ga0157372_10107117 | Ga0157372_101071174 | 273 |
| 188 | 3300021361 | Ga0213872_10000861 | Ga0213872_1000086119 | 273 |
| 189 | 3300021361 | Ga0213872_10000883 | Ga0213872_1000088312 | 273 |
| 190 | 3300021361 | Ga0213872_10000982 | Ga0213872_100009828 | 273 |
| 191 | 3300021361 | Ga0213872_10007165 | Ga0213872_100071655 | 273 |
| 192 | 3300025230 | Ga0209563_100075 | Ga0209563_10007558 | 273 |
| 193 | 3300025273 | Ga0209673_1004669 | Ga0209673_10046693 | 273 |
| 194 | 3300025273 | Ga0209673_1009458 | Ga0209673_10094583 | 273 |
| 195 | 3300025295 | Ga0209564_1000021 | Ga0209564_100002167 | 273 |
| 196 | 3300025298 | Ga0209050_1001572 | Ga0209050_10015729 | 273 |
| 197 | 3300025299 | Ga0209256_1000309 | Ga0209256_10003093 | 273 |
| 198 | 3300025299 | Ga0209256_1012735 | Ga0209256_10127353 | 273 |
| 199 | 3300025303 | Ga0209051_1002025 | Ga0209051_10020252 | 273 |
| 200 | 3300025303 | Ga0209051_1003442 | Ga0209051_10034424 | 273 |
| 201 | 3300025304 | Ga0209257_1000016 | Ga0209257_1000016255 | 273 |
| 202 | 3300025304 | Ga0209257_1000981 | Ga0209257_100098128 | 273 |
| 203 | 3300025304 | Ga0209257_1003659 | Ga0209257_10036592 | 273 |
| 204 | 3300025935 | Ga0207709_10077907 | Ga0207709_100779073 | 273 |
| 205 | 3300025972 | Ga0207668_10272165 | Ga0207668_102721652 | 273 |
| 206 | 3300026023 | Ga0207677_10195898 | Ga0207677_101958982 | 273 |
| 207 | 3300027296 | Ga0209389_1006254 | Ga0209389_10062548 | 273 |
| 208 | 3300028794 | Ga0307515_10007484 | Ga0307515_1000748410 | 273 |
| 209 | 3300028794 | Ga0307515_10080610 | Ga0307515_100806102 | 273 |
| 210 | 3300031456 | Ga0307513_10016545 | Ga0307513_100165453 | 273 |
| 211 | 3300031548 | Ga0307408_100000006 | Ga0307408_100000006360 | 273 |
| 212 | 3300031548 | Ga0307408_100051736 | Ga0307408_1000517362 | 273 |
| 213 | 3300031995 | Ga0307409_100336573 | Ga0307409_1003365732 | 273 |
| 214 | 3300032004 | Ga0307414_10042417 | Ga0307414_100424173 | 273 |
| 215 | 3300032005 | Ga0307411_10000288 | Ga0307411_100002883 | 273 |
| 216 | 3300033180 | Ga0307510_10249400 | Ga0307510_102494002 | 273 |
| 217 | 3300035114 | Ga0373939_0000019 | Ga0373939_0000019_31838_32677 | 273 |
| 218 | 3300035121 | Ga0373960_0000625 | Ga0373960_0000625_2965_3804 | 273 |
| 219 | 3300035691 | Ga0373931_0000679 | Ga0373931_0000679_13216_14055 | 273 |
| 220 | 3300037312 | Ga0395899_0004383 | Ga0395899_0004383_4433_5266 | 273 |
| 221 | 3300037418 | Ga0395900_0013773 | Ga0395900_0013773_2829_3662 | 273 |
| 222 | 3300037418 | Ga0395900_0228891 | Ga0395900_0228891_836_1663 | 273 |
| 223 | 3300037418 | Ga0395900_0452826 | Ga0395900_0452826_289_1116 | 273 |
| 224 | 3300037466 | Ga0395898_0012659 | Ga0395898_0012659_1630_2463 | 273 |
| 225 | 3300037466 | Ga0395898_0021873 | Ga0395898_0021873_3163_3990 | 273 |
| 226 | 3300037471 | Ga0395905_0001424 | Ga0395905_0001424_19323_20156 | 273 |
| 227 | 3300037471 | Ga0395905_0001639 | Ga0395905_0001639_17591_18424 | 273 |
| 228 | 3300037471 | Ga0395905_0003250 | Ga0395905_0003250_3777_4616 | 273 |
| 229 | 3300037471 | Ga0395905_0342059 | Ga0395905_0342059_421_1251 | 273 |
| 230 | 3300038443 | Ga0395901_0007843 | Ga0395901_0007843_2078_2911 | 273 |
| 231 | 3300038443 | Ga0395901_0125401 | Ga0395901_0125401_1313_2140 | 273 |
| 232 | 3300038443 | Ga0395901_0258231 | Ga0395901_0258231_667_1494 | 273 |
| 233 | 3300038727 | Ga0400491_02286 | Ga0400491_02286_363_1208 | 273 |
| 234 | 3300039447 | Ga0436361_0027317 | Ga0436361_0027317_53944_54825 | 273 |
| 235 | 3300039447 | Ga0436361_0046388 | Ga0436361_0046388_12820_13671 | 273 |
| 236 | 3300039447 | Ga0436361_0799645 | Ga0436361_0799645_15333_16190 | 273 |
| 237 | 3300039447 | Ga0436361_0968600 | Ga0436361_0968600_5145_5996 | 273 |
| 238 | 3300041410 | Ga0439461_0007811 | Ga0439461_0007811_400_1233 | 273 |
| 239 | 3300041512 | Ga0451853_3142898 | Ga0451853_3142898_710_1549 | 273 |
| 240 | 3300042120 | Ga0450917_000993 | Ga0450917_000993_197_1036 | 273 |
| 241 | 3300042126 | Ga0450888_000191 | Ga0450888_000191_3702_4541 | 273 |
| 242 | 3300042129 | Ga0450891_000071 | Ga0450891_000071_5313_6152 | 273 |
| 243 | 3300042142 | Ga0450905_004917 | Ga0450905_004917_302_1141 | 273 |
| 244 | 3300042144 | Ga0450889_000069 | Ga0450889_000069_7019_7858 | 273 |
| 245 | 3300042438 | Ga0439459_0001762 | Ga0439459_0001762_1249_2088 | 273 |
| 246 | 3300042532 | Ga0450893_0001280 | Ga0450893_0001280_2113_2952 | 273 |
| 247 | 3300042876 | Ga0451577_0033629 | Ga0451577_0033629_3508_4338 | 273 |
| 248 | 3300044694 | Ga0466963_0016316 | Ga0466963_0016316_3157_3996 | 273 |
| 249 | 3300044712 | Ga0453684_0034698 | Ga0453684_0034698_5032_5862 | 273 |
| 250 | 3300045051 | Ga0451576_0168250 | Ga0451576_0168250_866_1705 | 273 |
| 251 | 3300045836 | Ga0466958_0151304 | Ga0466958_0151304_40_867 | 273 |
| 252 | 3300046471 | Ga0495650_0061097 | Ga0495650_0061097_248_1087 | 273 |
| 253 | 3300046691 | Ga0495670_0026463 | Ga0495670_0026463_522_1361 | 273 |
| 254 | 3300048927 | Ga0496124_0066161 | Ga0496124_0066161_1902_2741 | 273 |
| 255 | 3300049520 | Ga0501297_000437 | Ga0501297_000437_597_1436 | 273 |
| 256 | 3300049523 | Ga0501300_005125 | Ga0501300_005125_855_1694 | 273 |
| 257 | 3300049534 | Ga0501318_005591 | Ga0501318_005591_396_1235 | 273 |
| 258 | 3300049579 | Ga0501043_0257990 | Ga0501043_0257990_444_1271 | 273 |
| 259 | 3300049580 | Ga0501046_0037420 | Ga0501046_0037420_554_1381 | 273 |
| 260 | 3300049581 | Ga0501047_0027508 | Ga0501047_0027508_72_899 | 273 |
| 261 | 3300049658 | Ga0501211_001859 | Ga0501211_001859_778_1617 | 273 |
| 262 | 3300049662 | Ga0501222_000600 | Ga0501222_000600_3840_4679 | 273 |
| 263 | 3300049663 | Ga0501223_008762 | Ga0501223_008762_758_1597 | 273 |
| 264 | 3300049669 | Ga0501235_006815 | Ga0501235_006815_851_1690 | 273 |
| 265 | 3300049704 | Ga0501221_000150 | Ga0501221_000150_6813_7652 | 273 |
| 266 | 3300049705 | Ga0501225_0018533 | Ga0501225_0018533_595_1434 | 273 |
| 267 | 3300049757 | Ga0501232_001083 | Ga0501232_001083_541_1380 | 273 |
| 268 | 3300049759 | Ga0501262_001378 | Ga0501262_001378_1093_1932 | 273 |
| 269 | 3300049762 | Ga0501265_001507 | Ga0501265_001507_730_1569 | 273 |
| 270 | 3300049764 | Ga0501267_001311 | Ga0501267_001311_377_1216 | 273 |
| 271 | 3300049769 | Ga0501272_004940 | Ga0501272_004940_309_1148 | 273 |
| 272 | 3300049778 | Ga0501282_006018 | Ga0501282_006018_92_931 | 273 |
| 273 | 3300049779 | Ga0501283_005329 | Ga0501283_005329_644_1483 | 273 |
| 274 | 3300049822 | Ga0501035_0208416 | Ga0501035_0208416_577_1404 | 273 |
| 275 | 3300049823 | Ga0501044_0273189 | Ga0501044_0273189_240_1067 | 273 |
| 276 | 3300050496 | nmdc:mga07m45_1517_c1 | nmdc:mga07m45_1517_c1_5663_6502 | 273 |
| 277 | 3300050496 | nmdc:mga07m45_43356_c1 | nmdc:mga07m45_43356_c1_105_944 | 273 |
| 278 | 3300050496 | nmdc:mga07m45_61286_c1 | nmdc:mga07m45_61286_c1_1177_2016 | 273 |
| 279 | 3300050496 | nmdc:mga07m45_7007_c1 | nmdc:mga07m45_7007_c1_155_994 | 273 |
| 280 | 3300053117 | Ga0500593_001896 | Ga0500593_001896_946_1788 | 273 |
| 281 | 3300053117 | Ga0500593_007810 | Ga0500593_007810_2392_3297 | 273 |
| 282 | 3300053156 | Ga0500622_0002460 | Ga0500622_0002460_1508_2347 | 273 |
| 283 | iso_pu_bacteria | 2894023352 | 2894024001 | 273 |
| 284 | iso_pu_bacteria | 8048746797 | 8048747194 | 273 |
| 285 | 3300003347 | JGI26128J50194_1001242 | JGI26128J50194_10012421 | 274 |
| 286 | 3300005339 | Ga0070660_100181019 | Ga0070660_1001810192 | 274 |
| 287 | 3300005436 | Ga0070713_100095071 | Ga0070713_1000950713 | 274 |
| 288 | 3300005719 | Ga0068861_100173269 | Ga0068861_1001732692 | 274 |
| 289 | 3300005844 | Ga0068862_100039734 | Ga0068862_1000397343 | 274 |
| 290 | 3300025928 | Ga0207700_10059448 | Ga0207700_100594482 | 274 |
| 291 | 3300025944 | Ga0207661_10146534 | Ga0207661_101465342 | 274 |
| 292 | 3300028794 | Ga0307515_10000089 | Ga0307515_100000898 | 274 |
| 293 | 3300028794 | Ga0307515_10089153 | Ga0307515_100891536 | 274 |
| 294 | 3300031344 | Ga0265316_10309929 | Ga0265316_103099292 | 274 |
| 295 | 3300031344 | Ga0265316_10326724 | Ga0265316_103267242 | 274 |
| 296 | 3300031456 | Ga0307513_10005057 | Ga0307513_100050572 | 274 |
| 297 | 3300031711 | Ga0265314_10166143 | Ga0265314_101661432 | 274 |
| 298 | 3300031824 | Ga0307413_10052421 | Ga0307413_100524213 | 274 |
| 299 | 3300035086 | Ga0373934_0074756 | Ga0373934_0074756_198_1031 | 274 |
| 300 | 3300037068 | Ga0373925_0003513 | Ga0373925_0003513_8164_9000 | 274 |
| 301 | 3300037853 | Ga0436364_1473161 | Ga0436364_1473161_742_1608 | 274 |
| 302 | 3300044712 | Ga0453684_0005486 | Ga0453684_0005486_22132_22956 | 274 |
| 303 | 3300044712 | Ga0453684_0159885 | Ga0453684_0159885_1535_2374 | 274 |
| 304 | 3300045051 | Ga0451576_0009103 | Ga0451576_0009103_10277_11101 | 274 |
| 305 | 3300045051 | Ga0451576_0118778 | Ga0451576_0118778_1365_2204 | 274 |
| 306 | 3300046681 | Ga0495647_0068643 | Ga0495647_0068643_150_986 | 274 |
| 307 | 3300048914 | Ga0496111_0345940 | Ga0496111_0345940_67_903 | 274 |
| 308 | iso_pu_bacteria | 2547132103 | 2547376340 | 274 |
| 309 | iso_pu_bacteria | 2643221660 | 2644338510 | 274 |
| 310 | iso_pu_bacteria | 2843690924 | 2843694597 | 274 |
| 311 | iso_pu_bacteria | 2846033681 | 2846035025 | 274 |
| 312 | iso_pu_bacteria | 2928130867 | 2928134745 | 274 |
| 313 | 3300003771 | Ga0055526_1002077 | Ga0055526_100207713 | 275 |
| 314 | 3300003773 | Ga0055537_1000114 | Ga0055537_100011450 | 275 |
| 315 | 3300003775 | Ga0055524_1015430 | Ga0055524_10154303 | 275 |
| 316 | 3300003784 | Ga0055534_1000259 | Ga0055534_100025916 | 275 |
| 317 | 3300003790 | Ga0055528_1000059 | Ga0055528_100005932 | 275 |
| 318 | 3300005327 | Ga0070658_10027022 | Ga0070658_100270223 | 275 |
| 319 | 3300005328 | Ga0070676_10000434 | Ga0070676_100004344 | 275 |
| 320 | 3300005330 | Ga0070690_100001931 | Ga0070690_1000019312 | 275 |
| 321 | 3300005331 | Ga0070670_100023566 | Ga0070670_1000235666 | 275 |
| 322 | 3300005331 | Ga0070670_100024473 | Ga0070670_1000244735 | 275 |
| 323 | 3300005331 | Ga0070670_100309540 | Ga0070670_1003095402 | 275 |
| 324 | 3300005331 | Ga0070670_100420808 | Ga0070670_1004208082 | 275 |
| 325 | 3300005333 | Ga0070677_10088019 | Ga0070677_100880192 | 275 |
| 326 | 3300005334 | Ga0068869_100073084 | Ga0068869_1000730843 | 275 |
| 327 | 3300005334 | Ga0068869_100150690 | Ga0068869_1001506902 | 275 |
| 328 | 3300005335 | Ga0070666_10002319 | Ga0070666_100023192 | 275 |
| 329 | 3300005335 | Ga0070666_10255356 | Ga0070666_102553562 | 275 |
| 330 | 3300005336 | Ga0070680_100001090 | Ga0070680_1000010903 | 275 |
| 331 | 3300005338 | Ga0068868_100022383 | Ga0068868_1000223835 | 275 |
| 332 | 3300005338 | Ga0068868_100045059 | Ga0068868_1000450593 | 275 |
| 333 | 3300005338 | Ga0068868_100211881 | Ga0068868_1002118812 | 275 |
| 334 | 3300005340 | Ga0070689_100189617 | Ga0070689_1001896171 | 275 |
| 335 | 3300005343 | Ga0070687_100001074 | Ga0070687_1000010748 | 275 |
| 336 | 3300005347 | Ga0070668_100000210 | Ga0070668_10000021015 | 275 |
| 337 | 3300005347 | Ga0070668_100047815 | Ga0070668_1000478152 | 275 |
| 338 | 3300005353 | Ga0070669_100000370 | Ga0070669_10000037026 | 275 |
| 339 | 3300005353 | Ga0070669_100030221 | Ga0070669_1000302212 | 275 |
| 340 | 3300005353 | Ga0070669_100152920 | Ga0070669_1001529202 | 275 |
| 341 | 3300005353 | Ga0070669_100277617 | Ga0070669_1002776172 | 275 |
| 342 | 3300005354 | Ga0070675_100024652 | Ga0070675_1000246523 | 275 |
| 343 | 3300005354 | Ga0070675_100171157 | Ga0070675_1001711572 | 275 |
| 344 | 3300005354 | Ga0070675_100441032 | Ga0070675_1004410322 | 275 |
| 345 | 3300005355 | Ga0070671_100001030 | Ga0070671_10000103018 | 275 |
| 346 | 3300005355 | Ga0070671_100048387 | Ga0070671_1000483874 | 275 |
| 347 | 3300005355 | Ga0070671_100148744 | Ga0070671_1001487442 | 275 |
| 348 | 3300005355 | Ga0070671_100189936 | Ga0070671_1001899362 | 275 |
| 349 | 3300005356 | Ga0070674_100001560 | Ga0070674_10000156012 | 275 |
| 350 | 3300005356 | Ga0070674_100031238 | Ga0070674_1000312383 | 275 |
| 351 | 3300005356 | Ga0070674_100353523 | Ga0070674_1003535231 | 275 |
| 352 | 3300005364 | Ga0070673_100044461 | Ga0070673_1000444613 | 275 |
| 353 | 3300005367 | Ga0070667_100000294 | Ga0070667_10000029414 | 275 |
| 354 | 3300005367 | Ga0070667_100022091 | Ga0070667_1000220915 | 275 |
| 355 | 3300005367 | Ga0070667_100137649 | Ga0070667_1001376492 | 275 |
| 356 | 3300005367 | Ga0070667_100144573 | Ga0070667_1001445732 | 275 |
| 357 | 3300005367 | Ga0070667_100369742 | Ga0070667_1003697421 | 275 |
| 358 | 3300005438 | Ga0070701_10065313 | Ga0070701_100653132 | 275 |
| 359 | 3300005445 | Ga0070708_100639403 | Ga0070708_1006394031 | 275 |
| 360 | 3300005456 | Ga0070678_100002211 | Ga0070678_1000022118 | 275 |
| 361 | 3300005456 | Ga0070678_100091383 | Ga0070678_1000913833 | 275 |
| 362 | 3300005456 | Ga0070678_100208545 | Ga0070678_1002085451 | 275 |
| 363 | 3300005457 | Ga0070662_100014012 | Ga0070662_1000140126 | 275 |
| 364 | 3300005457 | Ga0070662_100046171 | Ga0070662_1000461712 | 275 |
| 365 | 3300005457 | Ga0070662_100195539 | Ga0070662_1001955391 | 275 |
| 366 | 3300005459 | Ga0068867_100001702 | Ga0068867_10000170213 | 275 |
| 367 | 3300005459 | Ga0068867_100025546 | Ga0068867_1000255462 | 275 |
| 368 | 3300005459 | Ga0068867_100034937 | Ga0068867_1000349373 | 275 |
| 369 | 3300005459 | Ga0068867_100184109 | Ga0068867_1001841092 | 275 |
| 370 | 3300005459 | Ga0068867_100240701 | Ga0068867_1002407012 | 275 |
| 371 | 3300005467 | Ga0070706_100003301 | Ga0070706_1000033012 | 275 |
| 372 | 3300005468 | Ga0070707_100035771 | Ga0070707_1000357713 | 275 |
| 373 | 3300005539 | Ga0068853_100009360 | Ga0068853_1000093607 | 275 |
| 374 | 3300005543 | Ga0070672_100000286 | Ga0070672_10000028613 | 275 |
| 375 | 3300005543 | Ga0070672_100006372 | Ga0070672_1000063727 | 275 |
| 376 | 3300005543 | Ga0070672_100018646 | Ga0070672_1000186463 | 275 |
| 377 | 3300005543 | Ga0070672_100027706 | Ga0070672_1000277062 | 275 |
| 378 | 3300005543 | Ga0070672_100109913 | Ga0070672_1001099132 | 275 |
| 379 | 3300005548 | Ga0070665_100330310 | Ga0070665_1003303102 | 275 |
| 380 | 3300005548 | Ga0070665_100639660 | Ga0070665_1006396602 | 275 |
| 381 | 3300005577 | Ga0068857_100048044 | Ga0068857_1000480442 | 275 |
| 382 | 3300005577 | Ga0068857_100299431 | Ga0068857_1002994312 | 275 |
| 383 | 3300005578 | Ga0068854_100061897 | Ga0068854_1000618973 | 275 |
| 384 | 3300005578 | Ga0068854_100173028 | Ga0068854_1001730282 | 275 |
| 385 | 3300005615 | Ga0070702_100172958 | Ga0070702_1001729582 | 275 |
| 386 | 3300005615 | Ga0070702_100254733 | Ga0070702_1002547331 | 275 |
| 387 | 3300005616 | Ga0068852_100071258 | Ga0068852_1000712583 | 275 |
| 388 | 3300005616 | Ga0068852_100170213 | Ga0068852_1001702132 | 275 |
| 389 | 3300005616 | Ga0068852_100477932 | Ga0068852_1004779322 | 275 |
| 390 | 3300005617 | Ga0068859_100176440 | Ga0068859_1001764403 | 275 |
| 391 | 3300005617 | Ga0068859_100378623 | Ga0068859_1003786232 | 275 |
| 392 | 3300005618 | Ga0068864_100018136 | Ga0068864_1000181365 | 275 |
| 393 | 3300005618 | Ga0068864_100071218 | Ga0068864_1000712182 | 275 |
| 394 | 3300005618 | Ga0068864_100110450 | Ga0068864_1001104502 | 275 |
| 395 | 3300005618 | Ga0068864_100569551 | Ga0068864_1005695511 | 275 |
| 396 | 3300005718 | Ga0068866_10005226 | Ga0068866_100052266 | 275 |
| 397 | 3300005719 | Ga0068861_100000398 | Ga0068861_10000039826 | 275 |
| 398 | 3300005719 | Ga0068861_100010875 | Ga0068861_1000108753 | 275 |
| 399 | 3300005719 | Ga0068861_100027316 | Ga0068861_1000273162 | 275 |
| 400 | 3300005841 | Ga0068863_100000638 | Ga0068863_10000063814 | 275 |
| 401 | 3300005841 | Ga0068863_100021605 | Ga0068863_1000216058 | 275 |
| 402 | 3300005841 | Ga0068863_100095002 | Ga0068863_1000950023 | 275 |
| 403 | 3300005841 | Ga0068863_100116455 | Ga0068863_1001164551 | 275 |
| 404 | 3300005842 | Ga0068858_100000623 | Ga0068858_1000006238 | 275 |
| 405 | 3300005842 | Ga0068858_100004551 | Ga0068858_10000455111 | 275 |
| 406 | 3300005843 | Ga0068860_100001020 | Ga0068860_10000102012 | 275 |
| 407 | 3300005843 | Ga0068860_100002539 | Ga0068860_1000025394 | 275 |
| 408 | 3300005843 | Ga0068860_100047148 | Ga0068860_1000471482 | 275 |
| 409 | 3300005844 | Ga0068862_100003087 | Ga0068862_10000308711 | 275 |
| 410 | 3300005844 | Ga0068862_100053450 | Ga0068862_1000534504 | 275 |
| 411 | 3300005844 | Ga0068862_100098908 | Ga0068862_1000989083 | 275 |
| 412 | 3300006042 | Ga0075368_10010902 | Ga0075368_100109023 | 275 |
| 413 | 3300006042 | Ga0075368_10015811 | Ga0075368_100158112 | 275 |
| 414 | 3300006048 | Ga0075363_100086454 | Ga0075363_1000864542 | 275 |
| 415 | 3300006051 | Ga0075364_10067075 | Ga0075364_100670753 | 275 |
| 416 | 3300006177 | Ga0075362_10018818 | Ga0075362_100188183 | 275 |
| 417 | 3300006178 | Ga0075367_10027649 | Ga0075367_100276493 | 275 |
| 418 | 3300006178 | Ga0075367_10048135 | Ga0075367_100481352 | 275 |
| 419 | 3300006195 | Ga0075366_10003944 | Ga0075366_100039444 | 275 |
| 420 | 3300006195 | Ga0075366_10004375 | Ga0075366_100043756 | 275 |
| 421 | 3300006195 | Ga0075366_10016373 | Ga0075366_100163734 | 275 |
| 422 | 3300006195 | Ga0075366_10027032 | Ga0075366_100270323 | 275 |
| 423 | 3300006195 | Ga0075366_10085433 | Ga0075366_100854332 | 275 |
| 424 | 3300006237 | Ga0097621_100010671 | Ga0097621_1000106714 | 275 |
| 425 | 3300006237 | Ga0097621_100031314 | Ga0097621_1000313142 | 275 |
| 426 | 3300006237 | Ga0097621_100253122 | Ga0097621_1002531222 | 275 |
| 427 | 3300006237 | Ga0097621_100260001 | Ga0097621_1002600011 | 275 |
| 428 | 3300006353 | Ga0075370_10000291 | Ga0075370_100002913 | 275 |
| 429 | 3300006353 | Ga0075370_10006650 | Ga0075370_100066506 | 275 |
| 430 | 3300006353 | Ga0075370_10041151 | Ga0075370_100411513 | 275 |
| 431 | 3300006871 | Ga0075434_100685126 | Ga0075434_1006851262 | 275 |
| 432 | 3300006881 | Ga0068865_100000504 | Ga0068865_10000050423 | 275 |
| 433 | 3300006881 | Ga0068865_100006531 | Ga0068865_1000065313 | 275 |
| 434 | 3300006881 | Ga0068865_100104594 | Ga0068865_1001045942 | 275 |
| 435 | 3300006931 | Ga0097620_100176445 | Ga0097620_1001764453 | 275 |
| 436 | 3300006931 | Ga0097620_100378658 | Ga0097620_1003786582 | 275 |
| 437 | 3300009093 | Ga0105240_10077623 | Ga0105240_100776231 | 275 |
| 438 | 3300009093 | Ga0105240_10196467 | Ga0105240_101964673 | 275 |
| 439 | 3300009098 | Ga0105245_10012144 | Ga0105245_100121443 | 275 |
| 440 | 3300009098 | Ga0105245_10046369 | Ga0105245_100463692 | 275 |
| 441 | 3300009098 | Ga0105245_10197412 | Ga0105245_101974122 | 275 |
| 442 | 3300009148 | Ga0105243_10039272 | Ga0105243_100392722 | 275 |
| 443 | 3300009148 | Ga0105243_10119821 | Ga0105243_101198213 | 275 |
| 444 | 3300009174 | Ga0105241_10348034 | Ga0105241_103480341 | 275 |
| 445 | 3300009176 | Ga0105242_10018196 | Ga0105242_100181966 | 275 |
| 446 | 3300009177 | Ga0105248_10027320 | Ga0105248_100273206 | 275 |
| 447 | 3300009177 | Ga0105248_10116277 | Ga0105248_101162774 | 275 |
| 448 | 3300009177 | Ga0105248_10150457 | Ga0105248_101504572 | 275 |
| 449 | 3300009545 | Ga0105237_10080569 | Ga0105237_100805693 | 275 |
| 450 | 3300009553 | Ga0105249_10002938 | Ga0105249_100029387 | 275 |
| 451 | 3300009553 | Ga0105249_10052983 | Ga0105249_100529833 | 275 |
| 452 | 3300009553 | Ga0105249_10166150 | Ga0105249_101661503 | 275 |
| 453 | 3300013296 | Ga0157374_10024366 | Ga0157374_100243666 | 275 |
| 454 | 3300013296 | Ga0157374_10130406 | Ga0157374_101304062 | 275 |
| 455 | 3300013297 | Ga0157378_10053754 | Ga0157378_100537543 | 275 |
| 456 | 3300013297 | Ga0157378_10382849 | Ga0157378_103828492 | 275 |
| 457 | 3300013306 | Ga0163162_10000701 | Ga0163162_1000070111 | 275 |
| 458 | 3300013306 | Ga0163162_10051946 | Ga0163162_100519462 | 275 |
| 459 | 3300013306 | Ga0163162_10274052 | Ga0163162_102740524 | 275 |
| 460 | 3300013306 | Ga0163162_10563620 | Ga0163162_105636202 | 275 |
| 461 | 3300013308 | Ga0157375_10006514 | Ga0157375_100065149 | 275 |
| 462 | 3300013308 | Ga0157375_10009924 | Ga0157375_100099243 | 275 |
| 463 | 3300013308 | Ga0157375_10153266 | Ga0157375_101532662 | 275 |
| 464 | 3300014325 | Ga0163163_10195108 | Ga0163163_101951082 | 275 |
| 465 | 3300014325 | Ga0163163_10231195 | Ga0163163_102311953 | 275 |
| 466 | 3300014326 | Ga0157380_10000472 | Ga0157380_1000047214 | 275 |
| 467 | 3300014326 | Ga0157380_10033017 | Ga0157380_100330172 | 275 |
| 468 | 3300014745 | Ga0157377_10039116 | Ga0157377_100391163 | 275 |
| 469 | 3300014968 | Ga0157379_10001128 | Ga0157379_1000112818 | 275 |
| 470 | 3300014968 | Ga0157379_10002106 | Ga0157379_100021063 | 275 |
| 471 | 3300014968 | Ga0157379_10050097 | Ga0157379_100500973 | 275 |
| 472 | 3300014968 | Ga0157379_10072142 | Ga0157379_100721423 | 275 |
| 473 | 3300014969 | Ga0157376_10021689 | Ga0157376_100216892 | 275 |
| 474 | 3300014969 | Ga0157376_10039629 | Ga0157376_100396292 | 275 |
| 475 | 3300014969 | Ga0157376_10236372 | Ga0157376_102363722 | 275 |
| 476 | 3300014969 | Ga0157376_10360986 | Ga0157376_103609862 | 275 |
| 477 | 3300017792 | Ga0163161_10001102 | Ga0163161_1000110217 | 275 |
| 478 | 3300021361 | Ga0213872_10006327 | Ga0213872_100063275 | 275 |
| 479 | 3300025263 | Ga0209565_1000032 | Ga0209565_100003221 | 275 |
| 480 | 3300025271 | Ga0207666_1013333 | Ga0207666_10133332 | 275 |
| 481 | 3300025273 | Ga0209673_1000029 | Ga0209673_100002946 | 275 |
| 482 | 3300025291 | Ga0209675_1000019 | Ga0209675_1000019297 | 275 |
| 483 | 3300025295 | Ga0209564_1000291 | Ga0209564_100029191 | 275 |
| 484 | 3300025299 | Ga0209256_1001175 | Ga0209256_100117521 | 275 |
| 485 | 3300025304 | Ga0209257_1021536 | Ga0209257_10215363 | 275 |
| 486 | 3300025893 | Ga0207682_10067497 | Ga0207682_100674971 | 275 |
| 487 | 3300025899 | Ga0207642_10005579 | Ga0207642_100055793 | 275 |
| 488 | 3300025899 | Ga0207642_10014175 | Ga0207642_100141752 | 275 |
| 489 | 3300025899 | Ga0207642_10041206 | Ga0207642_100412061 | 275 |
| 490 | 3300025901 | Ga0207688_10055694 | Ga0207688_100556942 | 275 |
| 491 | 3300025903 | Ga0207680_10002133 | Ga0207680_100021332 | 275 |
| 492 | 3300025907 | Ga0207645_10002041 | Ga0207645_1000204113 | 275 |
| 493 | 3300025907 | Ga0207645_10004182 | Ga0207645_1000418210 | 275 |
| 494 | 3300025907 | Ga0207645_10163414 | Ga0207645_101634142 | 275 |
| 495 | 3300025908 | Ga0207643_10263413 | Ga0207643_102634132 | 275 |
| 496 | 3300025909 | Ga0207705_10053592 | Ga0207705_100535922 | 275 |
| 497 | 3300025910 | Ga0207684_10012702 | Ga0207684_100127022 | 275 |
| 498 | 3300025911 | Ga0207654_10065427 | Ga0207654_100654273 | 275 |
| 499 | 3300025914 | Ga0207671_10182234 | Ga0207671_101822342 | 275 |
| 500 | 3300025917 | Ga0207660_10006825 | Ga0207660_100068253 | 275 |
| 501 | 3300025918 | Ga0207662_10163295 | Ga0207662_101632952 | 275 |
| 502 | 3300025919 | Ga0207657_10127064 | Ga0207657_101270642 | 275 |
| 503 | 3300025920 | Ga0207649_10095109 | Ga0207649_100951092 | 275 |
| 504 | 3300025923 | Ga0207681_10001157 | Ga0207681_100011575 | 275 |
| 505 | 3300025924 | Ga0207694_10145325 | Ga0207694_101453252 | 275 |
| 506 | 3300025925 | Ga0207650_10000603 | Ga0207650_100006039 | 275 |
| 507 | 3300025925 | Ga0207650_10032175 | Ga0207650_100321752 | 275 |
| 508 | 3300025925 | Ga0207650_10048101 | Ga0207650_100481012 | 275 |
| 509 | 3300025925 | Ga0207650_10320901 | Ga0207650_103209012 | 275 |
| 510 | 3300025926 | Ga0207659_10003135 | Ga0207659_100031359 | 275 |
| 511 | 3300025926 | Ga0207659_10038095 | Ga0207659_100380953 | 275 |
| 512 | 3300025926 | Ga0207659_10162824 | Ga0207659_101628242 | 275 |
| 513 | 3300025927 | Ga0207687_10019791 | Ga0207687_100197915 | 275 |
| 514 | 3300025927 | Ga0207687_10022125 | Ga0207687_100221252 | 275 |
| 515 | 3300025931 | Ga0207644_10019134 | Ga0207644_100191343 | 275 |
| 516 | 3300025931 | Ga0207644_10183703 | Ga0207644_101837032 | 275 |
| 517 | 3300025932 | Ga0207690_10061546 | Ga0207690_100615463 | 275 |
| 518 | 3300025933 | Ga0207706_10005604 | Ga0207706_1000560411 | 275 |
| 519 | 3300025933 | Ga0207706_10023257 | Ga0207706_100232576 | 275 |
| 520 | 3300025934 | Ga0207686_10161890 | Ga0207686_101618901 | 275 |
| 521 | 3300025935 | Ga0207709_10166238 | Ga0207709_101662381 | 275 |
| 522 | 3300025937 | Ga0207669_10002675 | Ga0207669_100026752 | 275 |
| 523 | 3300025938 | Ga0207704_10002511 | Ga0207704_100025113 | 275 |
| 524 | 3300025938 | Ga0207704_10003713 | Ga0207704_100037136 | 275 |
| 525 | 3300025939 | Ga0207665_10275322 | Ga0207665_102753222 | 275 |
| 526 | 3300025940 | Ga0207691_10002589 | Ga0207691_100025892 | 275 |
| 527 | 3300025940 | Ga0207691_10026069 | Ga0207691_100260694 | 275 |
| 528 | 3300025940 | Ga0207691_10029199 | Ga0207691_100291995 | 275 |
| 529 | 3300025940 | Ga0207691_10066955 | Ga0207691_100669552 | 275 |
| 530 | 3300025940 | Ga0207691_10076817 | Ga0207691_100768173 | 275 |
| 531 | 3300025940 | Ga0207691_10105579 | Ga0207691_101055793 | 275 |
| 532 | 3300025941 | Ga0207711_10009121 | Ga0207711_100091213 | 275 |
| 533 | 3300025941 | Ga0207711_10057113 | Ga0207711_100571133 | 275 |
| 534 | 3300025941 | Ga0207711_10604105 | Ga0207711_106041052 | 275 |
| 535 | 3300025942 | Ga0207689_10000415 | Ga0207689_1000041510 | 275 |
| 536 | 3300025942 | Ga0207689_10205596 | Ga0207689_102055962 | 275 |
| 537 | 3300025942 | Ga0207689_10217162 | Ga0207689_102171622 | 275 |
| 538 | 3300025945 | Ga0207679_10368181 | Ga0207679_103681812 | 275 |
| 539 | 3300025961 | Ga0207712_10002826 | Ga0207712_100028266 | 275 |
| 540 | 3300025961 | Ga0207712_10046807 | Ga0207712_100468072 | 275 |
| 541 | 3300025961 | Ga0207712_10188467 | Ga0207712_101884672 | 275 |
| 542 | 3300025961 | Ga0207712_10328714 | Ga0207712_103287142 | 275 |
| 543 | 3300025972 | Ga0207668_10257076 | Ga0207668_102570762 | 275 |
| 544 | 3300025981 | Ga0207640_10567072 | Ga0207640_105670721 | 275 |
| 545 | 3300025986 | Ga0207658_10000212 | Ga0207658_1000021241 | 275 |
| 546 | 3300025986 | Ga0207658_10030972 | Ga0207658_100309722 | 275 |
| 547 | 3300025986 | Ga0207658_10136734 | Ga0207658_101367342 | 275 |
| 548 | 3300026023 | Ga0207677_10107251 | Ga0207677_101072512 | 275 |
| 549 | 3300026023 | Ga0207677_10267004 | Ga0207677_102670042 | 275 |
| 550 | 3300026035 | Ga0207703_10002429 | Ga0207703_1000242913 | 275 |
| 551 | 3300026035 | Ga0207703_10003032 | Ga0207703_1000303214 | 275 |
| 552 | 3300026035 | Ga0207703_10413025 | Ga0207703_104130252 | 275 |
| 553 | 3300026041 | Ga0207639_10054234 | Ga0207639_100542342 | 275 |
| 554 | 3300026041 | Ga0207639_10151752 | Ga0207639_101517522 | 275 |
| 555 | 3300026041 | Ga0207639_10166052 | Ga0207639_101660522 | 275 |
| 556 | 3300026067 | Ga0207678_10063109 | Ga0207678_100631094 | 275 |
| 557 | 3300026075 | Ga0207708_10043164 | Ga0207708_100431642 | 275 |
| 558 | 3300026088 | Ga0207641_10097769 | Ga0207641_100977693 | 275 |
| 559 | 3300026088 | Ga0207641_10153136 | Ga0207641_101531362 | 275 |
| 560 | 3300026088 | Ga0207641_10205166 | Ga0207641_102051662 | 275 |
| 561 | 3300026088 | Ga0207641_10396913 | Ga0207641_103969132 | 275 |
| 562 | 3300026089 | Ga0207648_10037529 | Ga0207648_100375292 | 275 |
| 563 | 3300026089 | Ga0207648_10142370 | Ga0207648_101423702 | 275 |
| 564 | 3300026089 | Ga0207648_10251892 | Ga0207648_102518922 | 275 |
| 565 | 3300026095 | Ga0207676_10039147 | Ga0207676_100391472 | 275 |
| 566 | 3300026095 | Ga0207676_10044261 | Ga0207676_100442614 | 275 |
| 567 | 3300026095 | Ga0207676_10057970 | Ga0207676_100579702 | 275 |
| 568 | 3300026095 | Ga0207676_10083234 | Ga0207676_100832342 | 275 |
| 569 | 3300026095 | Ga0207676_10296744 | Ga0207676_102967442 | 275 |
| 570 | 3300026116 | Ga0207674_10010925 | Ga0207674_100109253 | 275 |
| 571 | 3300026116 | Ga0207674_10336626 | Ga0207674_103366262 | 275 |
| 572 | 3300026118 | Ga0207675_100000177 | Ga0207675_10000017732 | 275 |
| 573 | 3300026118 | Ga0207675_100002649 | Ga0207675_1000026493 | 275 |
| 574 | 3300026118 | Ga0207675_100006060 | Ga0207675_1000060605 | 275 |
| 575 | 3300026121 | Ga0207683_10056721 | Ga0207683_100567212 | 275 |
| 576 | 3300026121 | Ga0207683_10105509 | Ga0207683_101055093 | 275 |
| 577 | 3300026142 | Ga0207698_10005873 | Ga0207698_100058733 | 275 |
| 578 | 3300026142 | Ga0207698_10104678 | Ga0207698_101046783 | 275 |
| 579 | 3300027395 | Ga0209996_1007401 | Ga0209996_10074012 | 275 |
| 580 | 3300027526 | Ga0209968_1000442 | Ga0209968_10004425 | 275 |
| 581 | 3300027866 | Ga0209813_10097025 | Ga0209813_100970251 | 275 |
| 582 | 3300027907 | Ga0207428_10174560 | Ga0207428_101745602 | 275 |
| 583 | 3300028379 | Ga0268266_10254014 | Ga0268266_102540142 | 275 |
| 584 | 3300028379 | Ga0268266_10280483 | Ga0268266_102804832 | 275 |
| 585 | 3300028379 | Ga0268266_10421137 | Ga0268266_104211372 | 275 |
| 586 | 3300028380 | Ga0268265_10038444 | Ga0268265_100384442 | 275 |
| 587 | 3300028380 | Ga0268265_10042591 | Ga0268265_100425914 | 275 |
| 588 | 3300028380 | Ga0268265_10089362 | Ga0268265_100893622 | 275 |
| 589 | 3300028380 | Ga0268265_10103325 | Ga0268265_101033252 | 275 |
| 590 | 3300028381 | Ga0268264_10004393 | Ga0268264_1000439313 | 275 |
| 591 | 3300028381 | Ga0268264_10020354 | Ga0268264_100203542 | 275 |
| 592 | 3300028786 | Ga0307517_10012331 | Ga0307517_100123312 | 275 |
| 593 | 3300028794 | Ga0307515_10297510 | Ga0307515_102975102 | 275 |
| 594 | 3300030522 | Ga0307512_10051922 | Ga0307512_100519224 | 275 |
| 595 | 3300030522 | Ga0307512_10052334 | Ga0307512_100523343 | 275 |
| 596 | 3300031251 | Ga0265327_10017033 | Ga0265327_100170333 | 275 |
| 597 | 3300031456 | Ga0307513_10035292 | Ga0307513_100352923 | 275 |
| 598 | 3300031507 | Ga0307509_10001647 | Ga0307509_1000164731 | 275 |
| 599 | 3300031507 | Ga0307509_10006706 | Ga0307509_1000670610 | 275 |
| 600 | 3300031507 | Ga0307509_10013664 | Ga0307509_100136646 | 275 |
| 601 | 3300031616 | Ga0307508_10000028 | Ga0307508_10000028105 | 275 |
| 602 | 3300031616 | Ga0307508_10001377 | Ga0307508_1000137724 | 275 |
| 603 | 3300031616 | Ga0307508_10065069 | Ga0307508_100650693 | 275 |
| 604 | 3300031665 | Ga0316575_10000063 | Ga0316575_1000006312 | 275 |
| 605 | 3300031730 | Ga0307516_10177718 | Ga0307516_101777182 | 275 |
| 606 | 3300031731 | Ga0307405_10089539 | Ga0307405_100895392 | 275 |
| 607 | 3300031911 | Ga0307412_10034330 | Ga0307412_100343304 | 275 |
| 608 | 3300031995 | Ga0307409_100019603 | Ga0307409_1000196032 | 275 |
| 609 | 3300032002 | Ga0307416_100017160 | Ga0307416_1000171602 | 275 |
| 610 | 3300032002 | Ga0307416_100243962 | Ga0307416_1002439622 | 275 |
| 611 | 3300032004 | Ga0307414_10333943 | Ga0307414_103339432 | 275 |
| 612 | 3300032004 | Ga0307414_10608346 | Ga0307414_106083461 | 275 |
| 613 | 3300032005 | Ga0307411_10006128 | Ga0307411_100061283 | 275 |
| 614 | 3300032126 | Ga0307415_100109353 | Ga0307415_1001093533 | 275 |
| 615 | 3300033180 | Ga0307510_10060241 | Ga0307510_100602415 | 275 |
| 616 | 3300033180 | Ga0307510_10094301 | Ga0307510_100943012 | 275 |
| 617 | 3300035088 | Ga0373940_0013736 | Ga0373940_0013736_1028_1924 | 275 |
| 618 | 3300035170 | Ga0373943_0211349 | Ga0373943_0211349_203_1045 | 275 |
| 619 | 3300035171 | Ga0373946_0062880 | Ga0373946_0062880_450_1301 | 275 |
| 620 | 3300035691 | Ga0373931_0048610 | Ga0373931_0048610_1235_2131 | 275 |
| 621 | 3300035725 | Ga0373947_0043758 | Ga0373947_0043758_1273_2115 | 275 |
| 622 | 3300036401 | Ga0373937_0073412 | Ga0373937_0073412_1378_2226 | 275 |
| 623 | 3300036401 | Ga0373937_0084748 | Ga0373937_0084748_397_1428 | 275 |
| 624 | 3300036401 | Ga0373937_0094160 | Ga0373937_0094160_162_1004 | 275 |
| 625 | 3300037418 | Ga0395900_0124976 | Ga0395900_0124976_1205_2044 | 275 |
| 626 | 3300038443 | Ga0395901_0081520 | Ga0395901_0081520_1352_2179 | 275 |
| 627 | 3300039447 | Ga0436361_0004926 | Ga0436361_0004926_2599_3435 | 275 |
| 628 | 3300041503 | Ga0451847_0330048 | Ga0451847_0330048_370_1209 | 275 |
| 629 | 3300041512 | Ga0451853_3427827 | Ga0451853_3427827_71_913 | 275 |
| 630 | 3300042876 | Ga0451577_0022885 | Ga0451577_0022885_502_1338 | 275 |
| 631 | 3300042876 | Ga0451577_0235067 | Ga0451577_0235067_580_1416 | 275 |
| 632 | 3300042876 | Ga0451577_0344687 | Ga0451577_0344687_76_918 | 275 |
| 633 | 3300042876 | Ga0451577_0583350 | Ga0451577_0583350_142_990 | 275 |
| 634 | 3300044712 | Ga0453684_0008430 | Ga0453684_0008430_7489_8325 | 275 |
| 635 | 3300044712 | Ga0453684_0042904 | Ga0453684_0042904_3783_4631 | 275 |
| 636 | 3300044712 | Ga0453684_0117420 | Ga0453684_0117420_711_1544 | 275 |
| 637 | 3300044712 | Ga0453684_0454880 | Ga0453684_0454880_318_1166 | 275 |
| 638 | 3300045051 | Ga0451576_0001760 | Ga0451576_0001760_33822_34655 | 275 |
| 639 | 3300045051 | Ga0451576_0015201 | Ga0451576_0015201_7554_8390 | 275 |
| 640 | 3300045051 | Ga0451576_0111564 | Ga0451576_0111564_497_1333 | 275 |
| 641 | 3300045051 | Ga0451576_0202520 | Ga0451576_0202520_350_1246 | 275 |
| 642 | 3300045051 | Ga0451576_0261405 | Ga0451576_0261405_694_1539 | 275 |
| 643 | 3300045976 | Ga0466967_0546697 | Ga0466967_0546697_160_1005 | 275 |
| 644 | 3300046454 | Ga0495592_0019120 | Ga0495592_0019120_1547_2383 | 275 |
| 645 | 3300046457 | Ga0495590_0003935 | Ga0495590_0003935_4922_5767 | 275 |
| 646 | 3300046457 | Ga0495590_0036912 | Ga0495590_0036912_91_921 | 275 |
| 647 | 3300046457 | Ga0495590_0062264 | Ga0495590_0062264_425_1252 | 275 |
| 648 | 3300046459 | Ga0495629_0047432 | Ga0495629_0047432_1191_2033 | 275 |
| 649 | 3300046460 | Ga0495638_0062244 | Ga0495638_0062244_1232_2068 | 275 |
| 650 | 3300046471 | Ga0495650_0024295 | Ga0495650_0024295_1257_2099 | 275 |
| 651 | 3300046474 | Ga0495605_0061328 | Ga0495605_0061328_108_935 | 275 |
| 652 | 3300046477 | Ga0495664_0325460 | Ga0495664_0325460_31_879 | 275 |
| 653 | 3300046491 | Ga0495584_0010102 | Ga0495584_0010102_318_1145 | 275 |
| 654 | 3300046500 | Ga0495596_0134958 | Ga0495596_0134958_26_871 | 275 |
| 655 | 3300046501 | Ga0495607_0077829 | Ga0495607_0077829_227_1054 | 275 |
| 656 | 3300046506 | Ga0495583_0040632 | Ga0495583_0040632_1005_1832 | 275 |
| 657 | 3300046515 | Ga0495620_0031763 | Ga0495620_0031763_920_1756 | 275 |
| 658 | 3300046519 | Ga0495632_0009387 | Ga0495632_0009387_4847_5692 | 275 |
| 659 | 3300046528 | Ga0495642_0022222 | Ga0495642_0022222_366_1193 | 275 |
| 660 | 3300046529 | Ga0495652_0123393 | Ga0495652_0123393_879_1721 | 275 |
| 661 | 3300046538 | Ga0495609_0000136 | Ga0495609_0000136_58414_59241 | 275 |
| 662 | 3300046539 | Ga0495621_0006088 | Ga0495621_0006088_1945_2814 | 275 |
| 663 | 3300046542 | Ga0495597_0012048 | Ga0495597_0012048_1206_2051 | 275 |
| 664 | 3300046543 | Ga0495645_0026599 | Ga0495645_0026599_2480_3322 | 275 |
| 665 | 3300046559 | Ga0495667_0129864 | Ga0495667_0129864_711_1553 | 275 |
| 666 | 3300046616 | Ga0495668_0000029 | Ga0495668_0000029_52467_53294 | 275 |
| 667 | 3300046616 | Ga0495668_0033309 | Ga0495668_0033309_1842_2669 | 275 |
| 668 | 3300046616 | Ga0495668_0085564 | Ga0495668_0085564_502_1347 | 275 |
| 669 | 3300046660 | Ga0495625_0022770 | Ga0495625_0022770_1025_1852 | 275 |
| 670 | 3300046660 | Ga0495625_0033839 | Ga0495625_0033839_917_1762 | 275 |
| 671 | 3300046663 | Ga0495635_0061843 | Ga0495635_0061843_893_1735 | 275 |
| 672 | 3300046684 | Ga0495669_0001803 | Ga0495669_0001803_5984_6811 | 275 |
| 673 | 3300046692 | Ga0495671_0125627 | Ga0495671_0125627_36_881 | 275 |
| 674 | 3300046694 | Ga0495649_0000541 | Ga0495649_0000541_30386_31231 | 275 |
| 675 | 3300046694 | Ga0495649_0059878 | Ga0495649_0059878_1194_2021 | 275 |
| 676 | 3300046794 | Ga0495589_0071998 | Ga0495589_0071998_313_1143 | 275 |
| 677 | 3300046809 | Ga0495600_0110953 | Ga0495600_0110953_394_1236 | 275 |
| 678 | 3300046810 | Ga0495660_0063546 | Ga0495660_0063546_1019_1846 | 275 |
| 679 | 3300046810 | Ga0495660_0108014 | Ga0495660_0108014_313_1158 | 275 |
| 680 | 3300047318 | Ga0495636_0022950 | Ga0495636_0022950_277_1104 | 275 |
| 681 | 3300047319 | Ga0495674_0013839 | Ga0495674_0013839_295_1125 | 275 |
| 682 | 3300047323 | Ga0495683_0196721 | Ga0495683_0196721_12_842 | 275 |
| 683 | 3300047443 | Ga0495687_001991 | Ga0495687_001991_15318_16163 | 275 |
| 684 | 3300047443 | Ga0495687_006560 | Ga0495687_006560_1011_1856 | 275 |
| 685 | 3300047443 | Ga0495687_014896 | Ga0495687_014896_1011_1856 | 275 |
| 686 | 3300047443 | Ga0495687_062118 | Ga0495687_062118_425_1255 | 275 |
| 687 | 3300047446 | Ga0495679_006268 | Ga0495679_006268_230_1057 | 275 |
| 688 | 3300047447 | Ga0495685_008022 | Ga0495685_008022_277_1104 | 275 |
| 689 | 3300047469 | Ga0495673_0146820 | Ga0495673_0146820_44_880 | 275 |
| 690 | 3300047470 | Ga0495681_0014798 | Ga0495681_0014798_845_1672 | 275 |
| 691 | 3300047471 | Ga0495684_0062323 | Ga0495684_0062323_1515_2357 | 275 |
| 692 | 3300047472 | Ga0495686_0007111 | Ga0495686_0007111_1400_2239 | 275 |
| 693 | 3300048091 | Ga0495626_0089455 | Ga0495626_0089455_373_1218 | 275 |
| 694 | 3300048903 | Ga0496100_0023701 | Ga0496100_0023701_1920_2816 | 275 |
| 695 | 3300048904 | Ga0496101_0013511 | Ga0496101_0013511_3811_4707 | 275 |
| 696 | 3300048905 | Ga0496102_0033963 | Ga0496102_0033963_558_1454 | 275 |
| 697 | 3300048907 | Ga0496104_0044408 | Ga0496104_0044408_47_877 | 275 |
| 698 | 3300048907 | Ga0496104_0215855 | Ga0496104_0215855_534_1430 | 275 |
| 699 | 3300048907 | Ga0496104_0279502 | Ga0496104_0279502_297_1148 | 275 |
| 700 | 3300048908 | Ga0496105_0110051 | Ga0496105_0110051_407_1303 | 275 |
| 701 | 3300048909 | Ga0496106_0006072 | Ga0496106_0006072_962_1858 | 275 |
| 702 | 3300048910 | Ga0496107_0141916 | Ga0496107_0141916_767_1663 | 275 |
| 703 | 3300048910 | Ga0496107_0208243 | Ga0496107_0208243_266_1096 | 275 |
| 704 | 3300048911 | Ga0496108_0017021 | Ga0496108_0017021_3810_4706 | 275 |
| 705 | 3300048913 | Ga0496110_0007472 | Ga0496110_0007472_7324_8220 | 275 |
| 706 | 3300048914 | Ga0496111_0205344 | Ga0496111_0205344_237_1130 | 275 |
| 707 | 3300048917 | Ga0496114_0164755 | Ga0496114_0164755_639_1481 | 275 |
| 708 | 3300048918 | Ga0496115_0007917 | Ga0496115_0007917_1068_1964 | 275 |
| 709 | 3300048924 | Ga0496121_0265552 | Ga0496121_0265552_48_878 | 275 |
| 710 | 3300048929 | Ga0496126_0026637 | Ga0496126_0026637_2423_3256 | 275 |
| 711 | 3300049460 | Ga0495682_0084323 | Ga0495682_0084323_222_1058 | 275 |
| 712 | 3300049824 | Ga0501045_0312017 | Ga0501045_0312017_321_1160 | 275 |
| 713 | 3300050489 | nmdc:mga03683_113732_c1 | nmdc:mga03683_113732_c1_14_859 | 275 |
| 714 | 3300050489 | nmdc:mga03683_41512_c1 | nmdc:mga03683_41512_c1_570_1427 | 275 |
| 715 | 3300050492 | nmdc:mga0yw44_64903_c1 | nmdc:mga0yw44_64903_c1_747_1592 | 275 |
| 716 | 3300050493 | nmdc:mga0k408_121887_c1 | nmdc:mga0k408_121887_c1_597_1442 | 275 |
| 717 | 3300050493 | nmdc:mga0k408_19056_c1 | nmdc:mga0k408_19056_c1_94_939 | 275 |
| 718 | 3300050493 | nmdc:mga0k408_20391_c1 | nmdc:mga0k408_20391_c1_425_1270 | 275 |
| 719 | 3300050493 | nmdc:mga0k408_23723_c1 | nmdc:mga0k408_23723_c1_406_1260 | 275 |
| 720 | 3300050493 | nmdc:mga0k408_370_c1 | nmdc:mga0k408_370_c1_22401_23246 | 275 |
| 721 | 3300050494 | nmdc:mga06z11_34181_c1 | nmdc:mga06z11_34181_c1_946_1791 | 275 |
| 722 | 3300050494 | nmdc:mga06z11_80032_c1 | nmdc:mga06z11_80032_c1_414_1271 | 275 |
| 723 | 3300050495 | nmdc:mga04h51_9044_c1 | nmdc:mga04h51_9044_c1_933_1790 | 275 |
| 724 | 3300050496 | nmdc:mga07m45_110530_c1 | nmdc:mga07m45_110530_c1_547_1404 | 275 |
| 725 | 3300050496 | nmdc:mga07m45_14825_c1 | nmdc:mga07m45_14825_c1_170_1006 | 275 |
| 726 | 3300050496 | nmdc:mga07m45_25005_c1 | nmdc:mga07m45_25005_c1_205_1062 | 275 |
| 727 | 3300050496 | nmdc:mga07m45_32728_c1 | nmdc:mga07m45_32728_c1_731_1576 | 275 |
| 728 | 3300050496 | nmdc:mga07m45_54331_c1 | nmdc:mga07m45_54331_c1_1170_2015 | 275 |
| 729 | 3300050516 | nmdc:mga0sz30_26990_c2 | nmdc:mga0sz30_26990_c2_743_1588 | 275 |
| 730 | 3300053077 | Ga0495601_0055940 | Ga0495601_0055940_713_1555 | 275 |
| 731 | 3300053078 | Ga0495612_0039580 | Ga0495612_0039580_477_1319 | 275 |
| 732 | 3300053084 | Ga0495595_0057445 | Ga0495595_0057445_436_1278 | 275 |
| 733 | 3300053092 | Ga0500583_0104323 | Ga0500583_0104323_292_1128 | 275 |
| 734 | 3300053093 | Ga0500651_0080149 | Ga0500651_0080149_485_1321 | 275 |
| 735 | 3300053098 | Ga0500650_0073375 | Ga0500650_0073375_723_1559 | 275 |
| 736 | 3300053118 | Ga0500594_0001004 | Ga0500594_0001004_247_1083 | 275 |
| 737 | 3300053134 | Ga0500658_0008109 | Ga0500658_0008109_757_1602 | 275 |
| 738 | 3300053136 | Ga0500559_0000694 | Ga0500559_0000694_19971_20807 | 275 |
| 739 | 3300053138 | Ga0500564_019933 | Ga0500564_019933_694_1530 | 275 |
| 740 | 3300053139 | Ga0500568_0033439 | Ga0500568_0033439_475_1320 | 275 |
| 741 | 3300053154 | Ga0500619_003712 | Ga0500619_003712_515_1351 | 275 |
| 742 | 3300053156 | Ga0500622_0005187 | Ga0500622_0005187_449_1285 | 275 |
| 743 | 3300053739 | Ga0500587_003270 | Ga0500587_003270_916_1752 | 275 |
| 744 | 3300061734 | Ga0530510_0350864 | Ga0530510_0350864_95_934 | 275 |
| 745 | iso_pu_bacteria | 2519103095 | 2519457415 | 275 |
| 746 | iso_pu_bacteria | 2643221654 | 2644301121 | 275 |
| 747 | 3300001915 | JGI24741J21665_1000659 | JGI24741J21665_10006595 | 276 |
| 748 | 3300001979 | JGI24740J21852_10003369 | JGI24740J21852_100033693 | 276 |
| 749 | 3300002704 | JGI25155J39150_1000249 | JGI25155J39150_10002493 | 276 |
| 750 | 3300002704 | JGI25155J39150_1000328 | JGI25155J39150_100032812 | 276 |
| 751 | 3300002704 | JGI25155J39150_1000403 | JGI25155J39150_10004038 | 276 |
| 752 | 3300002705 | JGI25156J39149_1000117 | JGI25156J39149_10001179 | 276 |
| 753 | 3300002705 | JGI25156J39149_1001439 | JGI25156J39149_10014398 | 276 |
| 754 | 3300002737 | JGI25162J39368_1000148 | JGI25162J39368_100014853 | 276 |
| 755 | 3300002737 | JGI25162J39368_1004924 | JGI25162J39368_10049243 | 276 |
| 756 | 3300002738 | JGI25154J39366_1000107 | JGI25154J39366_100010772 | 276 |
| 757 | 3300002738 | JGI25154J39366_1000440 | JGI25154J39366_100044012 | 276 |
| 758 | 3300002738 | JGI25154J39366_1000661 | JGI25154J39366_10006616 | 276 |
| 759 | 3300002741 | JGI25157J39369_1000884 | JGI25157J39369_10008843 | 276 |
| 760 | 3300003187 | JGI25151J46595_10001412 | JGI25151J46595_1000141215 | 276 |
| 761 | 3300003214 | JGI25165J46597_1000030 | JGI25165J46597_100003021 | 276 |
| 762 | 3300003316 | rootH1_10091210 | rootH1_100912103 | 276 |
| 763 | 3300003322 | rootL2_10044783 | rootL2_100447833 | 276 |
| 764 | 3300003322 | rootL2_10123098 | rootL2_101230981 | 276 |
| 765 | 3300003354 | JGI25160J50197_1000367 | JGI25160J50197_10003671 | 276 |
| 766 | 3300003479 | Ga0006556J51387_1023961 | Ga0006556J51387_10239613 | 276 |
| 767 | 3300003565 | Ga0006560J51390_1017447 | Ga0006560J51390_10174473 | 276 |
| 768 | 3300003751 | Ga0055538_1000017 | Ga0055538_1000017279 | 276 |
| 769 | 3300003751 | Ga0055538_1000085 | Ga0055538_100008527 | 276 |
| 770 | 3300003751 | Ga0055538_1003429 | Ga0055538_10034293 | 276 |
| 771 | 3300003752 | Ga0055539_1000022 | Ga0055539_1000022279 | 276 |
| 772 | 3300003752 | Ga0055539_1000126 | Ga0055539_100012627 | 276 |
| 773 | 3300003752 | Ga0055539_1000214 | Ga0055539_100021415 | 276 |
| 774 | 3300003756 | Ga0055533_1000030 | Ga0055533_1000030279 | 276 |
| 775 | 3300003756 | Ga0055533_1000133 | Ga0055533_100013327 | 276 |
| 776 | 3300003756 | Ga0055533_1000605 | Ga0055533_100060511 | 276 |
| 777 | 3300003756 | Ga0055533_1001088 | Ga0055533_10010883 | 276 |
| 778 | 3300003758 | Ga0055532_1000040 | Ga0055532_1000040112 | 276 |
| 779 | 3300003758 | Ga0055532_1000044 | Ga0055532_1000044149 | 276 |
| 780 | 3300003759 | Ga0055525_1000034 | Ga0055525_1000034279 | 276 |
| 781 | 3300003759 | Ga0055525_1000174 | Ga0055525_100017427 | 276 |
| 782 | 3300003759 | Ga0055525_1000420 | Ga0055525_10004203 | 276 |
| 783 | 3300003761 | Ga0055535_1000029 | Ga0055535_1000029112 | 276 |
| 784 | 3300003762 | Ga0055542_1006798 | Ga0055542_10067983 | 276 |
| 785 | 3300003763 | Ga0055529_1000055 | Ga0055529_100005571 | 276 |
| 786 | 3300003763 | Ga0055529_1000945 | Ga0055529_100094510 | 276 |
| 787 | 3300003771 | Ga0055526_1003730 | Ga0055526_10037303 | 276 |
| 788 | 3300003775 | Ga0055524_1001670 | Ga0055524_100167011 | 276 |
| 789 | 3300003775 | Ga0055524_1013761 | Ga0055524_10137613 | 276 |
| 790 | 3300003781 | Ga0055536_1000031 | Ga0055536_100003165 | 276 |
| 791 | 3300003784 | Ga0055534_1001330 | Ga0055534_10013303 | 276 |
| 792 | 3300003784 | Ga0055534_1002212 | Ga0055534_10022126 | 276 |
| 793 | 3300003784 | Ga0055534_1004644 | Ga0055534_10046443 | 276 |
| 794 | 3300003841 | Ga0055541_1000015 | Ga0055541_1000015279 | 276 |
| 795 | 3300003841 | Ga0055541_1000085 | Ga0055541_100008550 | 276 |
| 796 | 3300003841 | Ga0055541_1000760 | Ga0055541_10007607 | 276 |
| 797 | 3300005262 | Ga0065165_1001219 | Ga0065165_100121929 | 276 |
| 798 | 3300005331 | Ga0070670_100011920 | Ga0070670_1000119203 | 276 |
| 799 | 3300005331 | Ga0070670_100030033 | Ga0070670_1000300332 | 276 |
| 800 | 3300005331 | Ga0070670_100057768 | Ga0070670_1000577683 | 276 |
| 801 | 3300005333 | Ga0070677_10002998 | Ga0070677_100029984 | 276 |
| 802 | 3300005333 | Ga0070677_10134184 | Ga0070677_101341842 | 276 |
| 803 | 3300005334 | Ga0068869_100052968 | Ga0068869_1000529683 | 276 |
| 804 | 3300005338 | Ga0068868_100235499 | Ga0068868_1002354992 | 276 |
| 805 | 3300005340 | Ga0070689_100140805 | Ga0070689_1001408052 | 276 |
| 806 | 3300005344 | Ga0070661_100000037 | Ga0070661_10000003729 | 276 |
| 807 | 3300005347 | Ga0070668_100169199 | Ga0070668_1001691992 | 276 |
| 808 | 3300005354 | Ga0070675_100014685 | Ga0070675_1000146851 | 276 |
| 809 | 3300005355 | Ga0070671_100025332 | Ga0070671_1000253324 | 276 |
| 810 | 3300005355 | Ga0070671_100052291 | Ga0070671_1000522912 | 276 |
| 811 | 3300005356 | Ga0070674_100017826 | Ga0070674_1000178264 | 276 |
| 812 | 3300005364 | Ga0070673_100005042 | Ga0070673_1000050424 | 276 |
| 813 | 3300005364 | Ga0070673_100017993 | Ga0070673_1000179933 | 276 |
| 814 | 3300005366 | Ga0070659_100000268 | Ga0070659_1000002683 | 276 |
| 815 | 3300005367 | Ga0070667_100398929 | Ga0070667_1003989292 | 276 |
| 816 | 3300005455 | Ga0070663_100000001 | Ga0070663_100000001186 | 276 |
| 817 | 3300005456 | Ga0070678_100004854 | Ga0070678_1000048546 | 276 |
| 818 | 3300005459 | Ga0068867_100002661 | Ga0068867_1000026618 | 276 |
| 819 | 3300005459 | Ga0068867_100008359 | Ga0068867_1000083597 | 276 |
| 820 | 3300005459 | Ga0068867_100127994 | Ga0068867_1001279942 | 276 |
| 821 | 3300005539 | Ga0068853_100478194 | Ga0068853_1004781942 | 276 |
| 822 | 3300005543 | Ga0070672_100000712 | Ga0070672_1000007124 | 276 |
| 823 | 3300005563 | Ga0068855_100005276 | Ga0068855_1000052768 | 276 |
| 824 | 3300005563 | Ga0068855_100170676 | Ga0068855_1001706761 | 276 |
| 825 | 3300005563 | Ga0068855_100175969 | Ga0068855_1001759693 | 276 |
| 826 | 3300005563 | Ga0068855_100354541 | Ga0068855_1003545412 | 276 |
| 827 | 3300005564 | Ga0070664_100000006 | Ga0070664_10000000663 | 276 |
| 828 | 3300005564 | Ga0070664_100262573 | Ga0070664_1002625732 | 276 |
| 829 | 3300005577 | Ga0068857_100097295 | Ga0068857_1000972952 | 276 |
| 830 | 3300005577 | Ga0068857_100122293 | Ga0068857_1001222933 | 276 |
| 831 | 3300005578 | Ga0068854_100002991 | Ga0068854_1000029917 | 276 |
| 832 | 3300005614 | Ga0068856_100000032 | Ga0068856_10000003291 | 276 |
| 833 | 3300005616 | Ga0068852_100024872 | Ga0068852_1000248724 | 276 |
| 834 | 3300005616 | Ga0068852_100054367 | Ga0068852_1000543673 | 276 |
| 835 | 3300005840 | Ga0068870_10055112 | Ga0068870_100551123 | 276 |
| 836 | 3300005840 | Ga0068870_10221762 | Ga0068870_102217621 | 276 |
| 837 | 3300005842 | Ga0068858_100353339 | Ga0068858_1003533392 | 276 |
| 838 | 3300006195 | Ga0075366_10004423 | Ga0075366_100044233 | 276 |
| 839 | 3300006195 | Ga0075366_10209799 | Ga0075366_102097991 | 276 |
| 840 | 3300006237 | Ga0097621_100138552 | Ga0097621_1001385523 | 276 |
| 841 | 3300006358 | Ga0068871_100094720 | Ga0068871_1000947202 | 276 |
| 842 | 3300006846 | Ga0075430_100211114 | Ga0075430_1002111142 | 276 |
| 843 | 3300006880 | Ga0075429_100000224 | Ga0075429_10000022431 | 276 |
| 844 | 3300006881 | Ga0068865_100051687 | Ga0068865_1000516874 | 276 |
| 845 | 3300006946 | Ga0079104_1010957 | Ga0079104_10109572 | 276 |
| 846 | 3300009011 | Ga0105251_10072277 | Ga0105251_100722772 | 276 |
| 847 | 3300009011 | Ga0105251_10149572 | Ga0105251_101495721 | 276 |
| 848 | 3300009093 | Ga0105240_10015068 | Ga0105240_100150688 | 276 |
| 849 | 3300009093 | Ga0105240_10022053 | Ga0105240_100220536 | 276 |
| 850 | 3300009093 | Ga0105240_10174543 | Ga0105240_101745433 | 276 |
| 851 | 3300009093 | Ga0105240_10295608 | Ga0105240_102956081 | 276 |
| 852 | 3300009093 | Ga0105240_10413203 | Ga0105240_104132032 | 276 |
| 853 | 3300009093 | Ga0105240_10413204 | Ga0105240_104132042 | 276 |
| 854 | 3300009147 | Ga0114129_10975478 | Ga0114129_109754782 | 276 |
| 855 | 3300009148 | Ga0105243_10006497 | Ga0105243_100064978 | 276 |
| 856 | 3300009545 | Ga0105237_10033144 | Ga0105237_100331443 | 276 |
| 857 | 3300009545 | Ga0105237_10097519 | Ga0105237_100975193 | 276 |
| 858 | 3300009551 | Ga0105238_10000038 | Ga0105238_1000003828 | 276 |
| 859 | 3300010375 | Ga0105239_10004364 | Ga0105239_100043643 | 276 |
| 860 | 3300013100 | Ga0157373_10080356 | Ga0157373_100803563 | 276 |
| 861 | 3300013100 | Ga0157373_10364764 | Ga0157373_103647641 | 276 |
| 862 | 3300013102 | Ga0157371_10000106 | Ga0157371_10000106114 | 276 |
| 863 | 3300013104 | Ga0157370_10000062 | Ga0157370_10000062106 | 276 |
| 864 | 3300013297 | Ga0157378_10736485 | Ga0157378_107364851 | 276 |
| 865 | 3300013307 | Ga0157372_10000108 | Ga0157372_100001083 | 276 |
| 866 | 3300014326 | Ga0157380_10145419 | Ga0157380_101454192 | 276 |
| 867 | 3300014497 | Ga0182008_10042885 | Ga0182008_100428852 | 276 |
| 868 | 3300014497 | Ga0182008_10112057 | Ga0182008_101120572 | 276 |
| 869 | 3300014745 | Ga0157377_10000034 | Ga0157377_1000003432 | 276 |
| 870 | 3300014968 | Ga0157379_10422105 | Ga0157379_104221052 | 276 |
| 871 | 3300014969 | Ga0157376_10185936 | Ga0157376_101859361 | 276 |
| 872 | 3300014969 | Ga0157376_10552731 | Ga0157376_105527312 | 276 |
| 873 | 3300015261 | Ga0182006_1001438 | Ga0182006_10014383 | 276 |
| 874 | 3300015261 | Ga0182006_1012816 | Ga0182006_10128163 | 276 |
| 875 | 3300015261 | Ga0182006_1020296 | Ga0182006_10202963 | 276 |
| 876 | 3300015261 | Ga0182006_1028442 | Ga0182006_10284423 | 276 |
| 877 | 3300015261 | Ga0182006_1076641 | Ga0182006_10766412 | 276 |
| 878 | 3300015262 | Ga0182007_10013248 | Ga0182007_100132483 | 276 |
| 879 | 3300015262 | Ga0182007_10020262 | Ga0182007_100202622 | 276 |
| 880 | 3300015265 | Ga0182005_1000142 | Ga0182005_100014233 | 276 |
| 881 | 3300016635 | Ga0183361_10001 | Ga0183361_10001763 | 276 |
| 882 | 3300017792 | Ga0163161_10012016 | Ga0163161_100120163 | 276 |
| 883 | 3300017792 | Ga0163161_10076474 | Ga0163161_100764743 | 276 |
| 884 | 3300020076 | Ga0206355_1625393 | Ga0206355_16253932 | 276 |
| 885 | 3300020077 | Ga0206351_10698205 | Ga0206351_106982053 | 276 |
| 886 | 3300020610 | Ga0154015_1545624 | Ga0154015_15456243 | 276 |
| 887 | 3300021361 | Ga0213872_10004235 | Ga0213872_100042353 | 276 |
| 888 | 3300025206 | Ga0209435_100004 | Ga0209435_100004558 | 276 |
| 889 | 3300025206 | Ga0209435_100891 | Ga0209435_1008913 | 276 |
| 890 | 3300025207 | Ga0209760_101145 | Ga0209760_1011453 | 276 |
| 891 | 3300025224 | Ga0209784_100006 | Ga0209784_100006407 | 276 |
| 892 | 3300025224 | Ga0209784_100021 | Ga0209784_10002180 | 276 |
| 893 | 3300025224 | Ga0209784_100034 | Ga0209784_10003421 | 276 |
| 894 | 3300025224 | Ga0209784_100559 | Ga0209784_1005593 | 276 |
| 895 | 3300025225 | Ga0209566_100002 | Ga0209566_100002407 | 276 |
| 896 | 3300025225 | Ga0209566_100038 | Ga0209566_100038278 | 276 |
| 897 | 3300025225 | Ga0209566_100039 | Ga0209566_10003981 | 276 |
| 898 | 3300025225 | Ga0209566_100678 | Ga0209566_1006787 | 276 |
| 899 | 3300025225 | Ga0209566_102039 | Ga0209566_1020395 | 276 |
| 900 | 3300025225 | Ga0209566_102609 | Ga0209566_1026095 | 276 |
| 901 | 3300025226 | Ga0209674_100010 | Ga0209674_100010730 | 276 |
| 902 | 3300025226 | Ga0209674_100036 | Ga0209674_10003680 | 276 |
| 903 | 3300025226 | Ga0209674_100056 | Ga0209674_10005621 | 276 |
| 904 | 3300025226 | Ga0209674_100060 | Ga0209674_100060102 | 276 |
| 905 | 3300025226 | Ga0209674_100076 | Ga0209674_100076103 | 276 |
| 906 | 3300025226 | Ga0209674_106794 | Ga0209674_1067942 | 276 |
| 907 | 3300025228 | Ga0209672_101956 | Ga0209672_1019565 | 276 |
| 908 | 3300025228 | Ga0209672_108353 | Ga0209672_1083532 | 276 |
| 909 | 3300025229 | Ga0209147_100011 | Ga0209147_100011627 | 276 |
| 910 | 3300025229 | Ga0209147_100018 | Ga0209147_100018113 | 276 |
| 911 | 3300025230 | Ga0209563_100040 | Ga0209563_10004080 | 276 |
| 912 | 3300025230 | Ga0209563_100041 | Ga0209563_10004165 | 276 |
| 913 | 3300025230 | Ga0209563_100057 | Ga0209563_100057278 | 276 |
| 914 | 3300025230 | Ga0209563_106287 | Ga0209563_1062872 | 276 |
| 915 | 3300025231 | Ga0207427_103609 | Ga0207427_1036093 | 276 |
| 916 | 3300025233 | Ga0209437_100071 | Ga0209437_100071278 | 276 |
| 917 | 3300025233 | Ga0209437_100393 | Ga0209437_10039323 | 276 |
| 918 | 3300025242 | Ga0209258_100028 | Ga0209258_100028113 | 276 |
| 919 | 3300025242 | Ga0209258_106057 | Ga0209258_1060573 | 276 |
| 920 | 3300025246 | Ga0209646_1000043 | Ga0209646_1000043121 | 276 |
| 921 | 3300025246 | Ga0209646_1000149 | Ga0209646_100014948 | 276 |
| 922 | 3300025246 | Ga0209646_1000191 | Ga0209646_100019117 | 276 |
| 923 | 3300025246 | Ga0209646_1000233 | Ga0209646_10002339 | 276 |
| 924 | 3300025250 | Ga0209026_1000066 | Ga0209026_100006618 | 276 |
| 925 | 3300025250 | Ga0209026_1002225 | Ga0209026_10022258 | 276 |
| 926 | 3300025250 | Ga0209026_1009862 | Ga0209026_10098622 | 276 |
| 927 | 3300025253 | Ga0209677_100007 | Ga0209677_100007407 | 276 |
| 928 | 3300025253 | Ga0209677_100023 | Ga0209677_10002380 | 276 |
| 929 | 3300025253 | Ga0209677_100035 | Ga0209677_10003521 | 276 |
| 930 | 3300025253 | Ga0209677_102676 | Ga0209677_1026766 | 276 |
| 931 | 3300025254 | Ga0209148_1000162 | Ga0209148_100016216 | 276 |
| 932 | 3300025256 | Ga0209759_1000072 | Ga0209759_100007252 | 276 |
| 933 | 3300025256 | Ga0209759_1000182 | Ga0209759_100018248 | 276 |
| 934 | 3300025256 | Ga0209759_1001347 | Ga0209759_100134716 | 276 |
| 935 | 3300025256 | Ga0209759_1003723 | Ga0209759_10037236 | 276 |
| 936 | 3300025261 | Ga0209233_1000094 | Ga0209233_1000094278 | 276 |
| 937 | 3300025263 | Ga0209565_1000611 | Ga0209565_100061114 | 276 |
| 938 | 3300025272 | Ga0209455_1000065 | Ga0209455_1000065113 | 276 |
| 939 | 3300025272 | Ga0209455_1001116 | Ga0209455_10011164 | 276 |
| 940 | 3300025272 | Ga0209455_1010351 | Ga0209455_10103512 | 276 |
| 941 | 3300025291 | Ga0209675_1000231 | Ga0209675_100023144 | 276 |
| 942 | 3300025291 | Ga0209675_1001472 | Ga0209675_10014726 | 276 |
| 943 | 3300025291 | Ga0209675_1009719 | Ga0209675_10097193 | 276 |
| 944 | 3300025292 | Ga0209676_1000036 | Ga0209676_1000036292 | 276 |
| 945 | 3300025294 | Ga0209025_1000345 | Ga0209025_100034511 | 276 |
| 946 | 3300025294 | Ga0209025_1000860 | Ga0209025_100086018 | 276 |
| 947 | 3300025294 | Ga0209025_1000885 | Ga0209025_100088516 | 276 |
| 948 | 3300025294 | Ga0209025_1003617 | Ga0209025_10036177 | 276 |
| 949 | 3300025294 | Ga0209025_1020816 | Ga0209025_10208164 | 276 |
| 950 | 3300025295 | Ga0209564_1001814 | Ga0209564_100181411 | 276 |
| 951 | 3300025295 | Ga0209564_1002897 | Ga0209564_10028973 | 276 |
| 952 | 3300025295 | Ga0209564_1003347 | Ga0209564_10033473 | 276 |
| 953 | 3300025297 | Ga0209758_1014888 | Ga0209758_10148884 | 276 |
| 954 | 3300025299 | Ga0209256_1000244 | Ga0209256_100024411 | 276 |
| 955 | 3300025299 | Ga0209256_1003136 | Ga0209256_10031364 | 276 |
| 956 | 3300025302 | Ga0207426_1000007 | Ga0207426_1000007802 | 276 |
| 957 | 3300025315 | Ga0207697_10005788 | Ga0207697_100057882 | 276 |
| 958 | 3300025321 | Ga0207656_10049107 | Ga0207656_100491072 | 276 |
| 959 | 3300025735 | Ga0207713_1077262 | Ga0207713_10772622 | 276 |
| 960 | 3300025893 | Ga0207682_10001283 | Ga0207682_100012834 | 276 |
| 961 | 3300025893 | Ga0207682_10066783 | Ga0207682_100667832 | 276 |
| 962 | 3300025903 | Ga0207680_10283664 | Ga0207680_102836642 | 276 |
| 963 | 3300025904 | Ga0207647_10053550 | Ga0207647_100535504 | 276 |
| 964 | 3300025907 | Ga0207645_10001321 | Ga0207645_1000132121 | 276 |
| 965 | 3300025907 | Ga0207645_10034575 | Ga0207645_100345753 | 276 |
| 966 | 3300025908 | Ga0207643_10159082 | Ga0207643_101590822 | 276 |
| 967 | 3300025913 | Ga0207695_10000979 | Ga0207695_100009799 | 276 |
| 968 | 3300025913 | Ga0207695_10001817 | Ga0207695_1000181723 | 276 |
| 969 | 3300025913 | Ga0207695_10002079 | Ga0207695_1000207921 | 276 |
| 970 | 3300025913 | Ga0207695_10082442 | Ga0207695_100824424 | 276 |
| 971 | 3300025913 | Ga0207695_10108766 | Ga0207695_101087663 | 276 |
| 972 | 3300025913 | Ga0207695_10550327 | Ga0207695_105503271 | 276 |
| 973 | 3300025914 | Ga0207671_10001710 | Ga0207671_1000171015 | 276 |
| 974 | 3300025920 | Ga0207649_10000477 | Ga0207649_100004775 | 276 |
| 975 | 3300025923 | Ga0207681_10012075 | Ga0207681_100120755 | 276 |
| 976 | 3300025924 | Ga0207694_10000069 | Ga0207694_1000006979 | 276 |
| 977 | 3300025924 | Ga0207694_10025608 | Ga0207694_100256083 | 276 |
| 978 | 3300025925 | Ga0207650_10001006 | Ga0207650_100010067 | 276 |
| 979 | 3300025926 | Ga0207659_10000488 | Ga0207659_100004887 | 276 |
| 980 | 3300025931 | Ga0207644_10043820 | Ga0207644_100438203 | 276 |
| 981 | 3300025932 | Ga0207690_10001542 | Ga0207690_100015428 | 276 |
| 982 | 3300025936 | Ga0207670_10137243 | Ga0207670_101372433 | 276 |
| 983 | 3300025937 | Ga0207669_10010185 | Ga0207669_100101854 | 276 |
| 984 | 3300025938 | Ga0207704_10164572 | Ga0207704_101645722 | 276 |
| 985 | 3300025940 | Ga0207691_10001925 | Ga0207691_1000192513 | 276 |
| 986 | 3300025940 | Ga0207691_10044567 | Ga0207691_100445675 | 276 |
| 987 | 3300025942 | Ga0207689_10032225 | Ga0207689_100322256 | 276 |
| 988 | 3300025945 | Ga0207679_10000012 | Ga0207679_10000012114 | 276 |
| 989 | 3300025945 | Ga0207679_10072028 | Ga0207679_100720282 | 276 |
| 990 | 3300025949 | Ga0207667_10000043 | Ga0207667_10000043225 | 276 |
| 991 | 3300025949 | Ga0207667_10025668 | Ga0207667_100256684 | 276 |
| 992 | 3300025949 | Ga0207667_10066892 | Ga0207667_100668923 | 276 |
| 993 | 3300025949 | Ga0207667_10268643 | Ga0207667_102686432 | 276 |
| 994 | 3300025960 | Ga0207651_10031644 | Ga0207651_100316442 | 276 |
| 995 | 3300025960 | Ga0207651_10062810 | Ga0207651_100628103 | 276 |
| 996 | 3300025981 | Ga0207640_10000012 | Ga0207640_10000012210 | 276 |
| 997 | 3300025981 | Ga0207640_10007512 | Ga0207640_100075123 | 276 |
| 998 | 3300025986 | Ga0207658_10534647 | Ga0207658_105346471 | 276 |
| 999 | 3300026023 | Ga0207677_10007613 | Ga0207677_100076134 | 276 |
| 1000 | 3300026067 | Ga0207678_10000009 | Ga0207678_1000000925 | 276 |
| 1001 | 3300026067 | Ga0207678_10006113 | Ga0207678_100061135 | 276 |
| 1002 | 3300026067 | Ga0207678_10584938 | Ga0207678_105849382 | 276 |
| 1003 | 3300026078 | Ga0207702_10000028 | Ga0207702_10000028114 | 276 |
| 1004 | 3300026089 | Ga0207648_10000054 | Ga0207648_100000542 | 276 |
| 1005 | 3300026089 | Ga0207648_10005336 | Ga0207648_1000533614 | 276 |
| 1006 | 3300026089 | Ga0207648_10008160 | Ga0207648_1000816010 | 276 |
| 1007 | 3300026089 | Ga0207648_10120747 | Ga0207648_101207474 | 276 |
| 1008 | 3300026095 | Ga0207676_10078899 | Ga0207676_100788993 | 276 |
| 1009 | 3300026116 | Ga0207674_10068252 | Ga0207674_100682524 | 276 |
| 1010 | 3300026116 | Ga0207674_10093730 | Ga0207674_100937305 | 276 |
| 1011 | 3300026116 | Ga0207674_10573987 | Ga0207674_105739872 | 276 |
| 1012 | 3300026121 | Ga0207683_10011037 | Ga0207683_100110373 | 276 |
| 1013 | 3300026142 | Ga0207698_10006654 | Ga0207698_100066543 | 276 |
| 1014 | 3300026142 | Ga0207698_10016463 | Ga0207698_100164634 | 276 |
| 1015 | 3300026142 | Ga0207698_10040883 | Ga0207698_100408833 | 276 |
| 1016 | 3300027111 | Ga0209281_1007147 | Ga0209281_10071473 | 276 |
| 1017 | 3300027666 | Ga0209282_1000021 | Ga0209282_1000021162 | 276 |
| 1018 | 3300027876 | Ga0209974_10090038 | Ga0209974_100900381 | 276 |
| 1019 | 3300028794 | Ga0307515_10041885 | Ga0307515_100418852 | 276 |
| 1020 | 3300028800 | Ga0265338_10000258 | Ga0265338_1000025829 | 276 |
| 1021 | 3300028800 | Ga0265338_10001135 | Ga0265338_100011359 | 276 |
| 1022 | 3300029957 | Ga0265324_10002038 | Ga0265324_100020385 | 276 |
| 1023 | 3300029957 | Ga0265324_10035527 | Ga0265324_100355272 | 276 |
| 1024 | 3300031238 | Ga0265332_10049707 | Ga0265332_100497072 | 276 |
| 1025 | 3300031241 | Ga0265325_10010371 | Ga0265325_100103712 | 276 |
| 1026 | 3300031507 | Ga0307509_10000032 | Ga0307509_10000032106 | 276 |
| 1027 | 3300031548 | Ga0307408_100037196 | Ga0307408_1000371962 | 276 |
| 1028 | 3300031711 | Ga0265314_10003091 | Ga0265314_100030914 | 276 |
| 1029 | 3300031711 | Ga0265314_10032720 | Ga0265314_100327202 | 276 |
| 1030 | 3300031711 | Ga0265314_10043851 | Ga0265314_100438513 | 276 |
| 1031 | 3300031730 | Ga0307516_10001972 | Ga0307516_100019723 | 276 |
| 1032 | 3300031731 | Ga0307405_10028317 | Ga0307405_100283174 | 276 |
| 1033 | 3300031731 | Ga0307405_10413528 | Ga0307405_104135281 | 276 |
| 1034 | 3300031903 | Ga0307407_10442262 | Ga0307407_104422621 | 276 |
| 1035 | 3300031911 | Ga0307412_10117010 | Ga0307412_101170102 | 276 |
| 1036 | 3300031995 | Ga0307409_100084584 | Ga0307409_1000845842 | 276 |
| 1037 | 3300032002 | Ga0307416_100032323 | Ga0307416_1000323234 | 276 |
| 1038 | 3300032005 | Ga0307411_10008111 | Ga0307411_100081112 | 276 |
| 1039 | 3300032005 | Ga0307411_10329331 | Ga0307411_103293312 | 276 |
| 1040 | 3300033180 | Ga0307510_10038927 | Ga0307510_100389273 | 276 |
| 1041 | 3300033180 | Ga0307510_10251756 | Ga0307510_102517561 | 276 |
| 1042 | 3300035112 | Ga0373932_0065646 | Ga0373932_0065646_59_901 | 276 |
| 1043 | 3300035118 | Ga0373954_0012937 | Ga0373954_0012937_2097_2942 | 276 |
| 1044 | 3300037471 | Ga0395905_0000176 | Ga0395905_0000176_71075_71905 | 276 |
| 1045 | 3300037471 | Ga0395905_0056444 | Ga0395905_0056444_933_1763 | 276 |
| 1046 | 3300037471 | Ga0395905_0099973 | Ga0395905_0099973_1083_1937 | 276 |
| 1047 | 3300037471 | Ga0395905_0182943 | Ga0395905_0182943_1070_1903 | 276 |
| 1048 | 3300039447 | Ga0436361_1048468 | Ga0436361_1048468_89_919 | 276 |
| 1049 | 3300039453 | Ga0436362_0709755 | Ga0436362_0709755_282_1118 | 276 |
| 1050 | 3300041410 | Ga0439461_0019390 | Ga0439461_0019390_335_1183 | 276 |
| 1051 | 3300042876 | Ga0451577_0000002 | Ga0451577_0000002_1485083_1485922 | 276 |
| 1052 | 3300042876 | Ga0451577_0001738 | Ga0451577_0001738_16814_17659 | 276 |
| 1053 | 3300042876 | Ga0451577_0002438 | Ga0451577_0002438_20755_21606 | 276 |
| 1054 | 3300042876 | Ga0451577_0174819 | Ga0451577_0174819_366_1208 | 276 |
| 1055 | 3300042876 | Ga0451577_0273374 | Ga0451577_0273374_54_932 | 276 |
| 1056 | 3300042876 | Ga0451577_0273461 | Ga0451577_0273461_31_873 | 276 |
| 1057 | 3300042876 | Ga0451577_0312740 | Ga0451577_0312740_274_1119 | 276 |
| 1058 | 3300044650 | Ga0466986_0063558 | Ga0466986_0063558_1681_2511 | 276 |
| 1059 | 3300044656 | Ga0466969_0000929 | Ga0466969_0000929_7919_8749 | 276 |
| 1060 | 3300044656 | Ga0466969_0044748 | Ga0466969_0044748_267_1097 | 276 |
| 1061 | 3300044666 | Ga0466977_0000690 | Ga0466977_0000690_10092_10922 | 276 |
| 1062 | 3300044673 | Ga0453683_0000013 | Ga0453683_0000013_125640_126479 | 276 |
| 1063 | 3300044683 | Ga0466965_0000237 | Ga0466965_0000237_8658_9488 | 276 |
| 1064 | 3300044684 | Ga0466966_0002735 | Ga0466966_0002735_2295_3137 | 276 |
| 1065 | 3300044693 | Ga0466961_0012022 | Ga0466961_0012022_228_1058 | 276 |
| 1066 | 3300044693 | Ga0466961_0142232 | Ga0466961_0142232_571_1413 | 276 |
| 1067 | 3300044694 | Ga0466963_0031985 | Ga0466963_0031985_544_1374 | 276 |
| 1068 | 3300044712 | Ga0453684_0000002 | Ga0453684_0000002_245454_246293 | 276 |
| 1069 | 3300044712 | Ga0453684_0093099 | Ga0453684_0093099_1950_2807 | 276 |
| 1070 | 3300044719 | Ga0466971_0002984 | Ga0466971_0002984_4098_4928 | 276 |
| 1071 | 3300044735 | Ga0466968_0004214 | Ga0466968_0004214_1169_2011 | 276 |
| 1072 | 3300044765 | Ga0466970_0027008 | Ga0466970_0027008_853_1683 | 276 |
| 1073 | 3300044842 | Ga0466957_0000447 | Ga0466957_0000447_8176_9006 | 276 |
| 1074 | 3300044842 | Ga0466957_0125266 | Ga0466957_0125266_305_1135 | 276 |
| 1075 | 3300045049 | Ga0466959_0027748 | Ga0466959_0027748_2236_3066 | 276 |
| 1076 | 3300045049 | Ga0466959_0073287 | Ga0466959_0073287_507_1349 | 276 |
| 1077 | 3300045051 | Ga0451576_0000037 | Ga0451576_0000037_125881_126720 | 276 |
| 1078 | 3300045051 | Ga0451576_0002464 | Ga0451576_0002464_10303_11181 | 276 |
| 1079 | 3300045836 | Ga0466958_0090299 | Ga0466958_0090299_147_977 | 276 |
| 1080 | 3300046454 | Ga0495592_0034924 | Ga0495592_0034924_1292_2137 | 276 |
| 1081 | 3300046454 | Ga0495592_0188472 | Ga0495592_0188472_441_1295 | 276 |
| 1082 | 3300046462 | Ga0495651_0005769 | Ga0495651_0005769_6996_7838 | 276 |
| 1083 | 3300046462 | Ga0495651_0072318 | Ga0495651_0072318_518_1372 | 276 |
| 1084 | 3300046462 | Ga0495651_0221611 | Ga0495651_0221611_129_983 | 276 |
| 1085 | 3300046463 | Ga0495653_0034300 | Ga0495653_0034300_299_1153 | 276 |
| 1086 | 3300046473 | Ga0495582_0042043 | Ga0495582_0042043_932_1774 | 276 |
| 1087 | 3300046474 | Ga0495605_0006736 | Ga0495605_0006736_903_1733 | 276 |
| 1088 | 3300046500 | Ga0495596_0000385 | Ga0495596_0000385_889_1719 | 276 |
| 1089 | 3300046507 | Ga0495606_0012870 | Ga0495606_0012870_22_867 | 276 |
| 1090 | 3300046511 | Ga0495608_0265627 | Ga0495608_0265627_192_1046 | 276 |
| 1091 | 3300046512 | Ga0495610_0009756 | Ga0495610_0009756_4378_5208 | 276 |
| 1092 | 3300046513 | Ga0495616_0003889 | Ga0495616_0003889_888_1718 | 276 |
| 1093 | 3300046516 | Ga0495628_0001234 | Ga0495628_0001234_709_1551 | 276 |
| 1094 | 3300046516 | Ga0495628_0048653 | Ga0495628_0048653_762_1616 | 276 |
| 1095 | 3300046516 | Ga0495628_0064766 | Ga0495628_0064766_529_1383 | 276 |
| 1096 | 3300046517 | Ga0495630_0041291 | Ga0495630_0041291_592_1434 | 276 |
| 1097 | 3300046528 | Ga0495642_0033764 | Ga0495642_0033764_357_1205 | 276 |
| 1098 | 3300046529 | Ga0495652_0223499 | Ga0495652_0223499_212_1066 | 276 |
| 1099 | 3300046538 | Ga0495609_0001940 | Ga0495609_0001940_11737_12567 | 276 |
| 1100 | 3300046558 | Ga0495633_0040028 | Ga0495633_0040028_90_941 | 276 |
| 1101 | 3300046660 | Ga0495625_0002966 | Ga0495625_0002966_2562_3404 | 276 |
| 1102 | 3300046680 | Ga0495646_0004580 | Ga0495646_0004580_7038_7892 | 276 |
| 1103 | 3300046680 | Ga0495646_0070868 | Ga0495646_0070868_886_1740 | 276 |
| 1104 | 3300046809 | Ga0495600_0065179 | Ga0495600_0065179_589_1443 | 276 |
| 1105 | 3300047317 | Ga0495604_0149320 | Ga0495604_0149320_407_1261 | 276 |
| 1106 | 3300047318 | Ga0495636_0008030 | Ga0495636_0008030_1234_2064 | 276 |
| 1107 | 3300047673 | Ga0495593_0056385 | Ga0495593_0056385_982_1824 | 276 |
| 1108 | 3300048088 | Ga0495602_0144374 | Ga0495602_0144374_643_1485 | 276 |
| 1109 | 3300048088 | Ga0495602_0170371 | Ga0495602_0170371_243_1097 | 276 |
| 1110 | 3300048903 | Ga0496100_0503784 | Ga0496100_0503784_63_905 | 276 |
| 1111 | 3300048904 | Ga0496101_0195147 | Ga0496101_0195147_614_1480 | 276 |
| 1112 | 3300048905 | Ga0496102_0027430 | Ga0496102_0027430_3603_4433 | 276 |
| 1113 | 3300048906 | Ga0496103_0055059 | Ga0496103_0055059_134_964 | 276 |
| 1114 | 3300048907 | Ga0496104_0314276 | Ga0496104_0314276_146_976 | 276 |
| 1115 | 3300048907 | Ga0496104_0481158 | Ga0496104_0481158_232_1062 | 276 |
| 1116 | 3300048909 | Ga0496106_0000011 | Ga0496106_0000011_115885_116715 | 276 |
| 1117 | 3300048916 | Ga0496113_0043484 | Ga0496113_0043484_140_994 | 276 |
| 1118 | 3300048917 | Ga0496114_0007646 | Ga0496114_0007646_7165_8016 | 276 |
| 1119 | 3300048917 | Ga0496114_0255612 | Ga0496114_0255612_358_1194 | 276 |
| 1120 | 3300048919 | Ga0496116_0021901 | Ga0496116_0021901_3042_3884 | 276 |
| 1121 | 3300048920 | Ga0496117_0028852 | Ga0496117_0028852_361_1191 | 276 |
| 1122 | 3300048921 | Ga0496118_0041792 | Ga0496118_0041792_523_1353 | 276 |
| 1123 | 3300048921 | Ga0496118_0101239 | Ga0496118_0101239_450_1280 | 276 |
| 1124 | 3300048921 | Ga0496118_0156283 | Ga0496118_0156283_24_866 | 276 |
| 1125 | 3300048922 | Ga0496119_0110012 | Ga0496119_0110012_314_1144 | 276 |
| 1126 | 3300048924 | Ga0496121_0010887 | Ga0496121_0010887_878_1723 | 276 |
| 1127 | 3300048924 | Ga0496121_0023777 | Ga0496121_0023777_2638_3468 | 276 |
| 1128 | 3300048924 | Ga0496121_0042796 | Ga0496121_0042796_2236_3066 | 276 |
| 1129 | 3300048924 | Ga0496121_0137378 | Ga0496121_0137378_724_1566 | 276 |
| 1130 | 3300048925 | Ga0496122_0003149 | Ga0496122_0003149_20291_21133 | 276 |
| 1131 | 3300048925 | Ga0496122_0021327 | Ga0496122_0021327_897_1727 | 276 |
| 1132 | 3300048926 | Ga0496123_0000916 | Ga0496123_0000916_20176_21018 | 276 |
| 1133 | 3300048926 | Ga0496123_0027948 | Ga0496123_0027948_857_1687 | 276 |
| 1134 | 3300048928 | Ga0496125_0004292 | Ga0496125_0004292_1925_2767 | 276 |
| 1135 | 3300048929 | Ga0496126_0002068 | Ga0496126_0002068_26675_27505 | 276 |
| 1136 | 3300048929 | Ga0496126_0194871 | Ga0496126_0194871_306_1157 | 276 |
| 1137 | 3300049515 | Ga0501292_005344 | Ga0501292_005344_193_1044 | 276 |
| 1138 | 3300049520 | Ga0501297_001705 | Ga0501297_001705_114_965 | 276 |
| 1139 | 3300049571 | Ga0501034_0000092 | Ga0501034_0000092_7956_8786 | 276 |
| 1140 | 3300049579 | Ga0501043_0000058 | Ga0501043_0000058_1490_2329 | 276 |
| 1141 | 3300049579 | Ga0501043_0104737 | Ga0501043_0104737_39_869 | 276 |
| 1142 | 3300049580 | Ga0501046_0000051 | Ga0501046_0000051_99749_100588 | 276 |
| 1143 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_407816_408655 | 276 |
| 1144 | 3300049582 | Ga0501048_0000321 | Ga0501048_0000321_1150_1989 | 276 |
| 1145 | 3300049649 | Ga0501198_000007 | Ga0501198_000007_27944_28795 | 276 |
| 1146 | 3300049662 | Ga0501222_000005 | Ga0501222_000005_100949_101800 | 276 |
| 1147 | 3300049822 | Ga0501035_0007072 | Ga0501035_0007072_2475_3317 | 276 |
| 1148 | 3300049823 | Ga0501044_0013104 | Ga0501044_0013104_5611_6453 | 276 |
| 1149 | 3300049824 | Ga0501045_0075630 | Ga0501045_0075630_1285_2124 | 276 |
| 1150 | 3300050493 | nmdc:mga0k408_4315_c1 | nmdc:mga0k408_4315_c1_5267_6124 | 276 |
| 1151 | 3300050508 | nmdc:mga09592_819_c1 | nmdc:mga09592_819_c1_1698_2549 | 276 |
| 1152 | 3300050509 | nmdc:mga0qj67_191552_c1 | nmdc:mga0qj67_191552_c1_641_1492 | 276 |
| 1153 | 3300053091 | Ga0500647_0117247 | Ga0500647_0117247_105_947 | 276 |
| 1154 | 3300053119 | Ga0500595_003933 | Ga0500595_003933_392_1246 | 276 |
| 1155 | 3300053125 | Ga0500618_000765 | Ga0500618_000765_782_1630 | 276 |
| 1156 | 3300053125 | Ga0500618_001461 | Ga0500618_001461_997_1839 | 276 |
| 1157 | 3300053148 | Ga0500590_023706 | Ga0500590_023706_595_1440 | 276 |
| 1158 | 3300059604 | Ga0587098_001158 | Ga0587098_001158_472_1302 | 276 |
| 1159 | 3300059640 | Ga0587067_000132 | Ga0587067_000132_1301_2131 | 276 |
| 1160 | 3300059643 | Ga0587072_000426 | Ga0587072_000426_2619_3449 | 276 |
| 1161 | iso_pu_bacteria | 2818991436 | 2819542336 | 276 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zpt-assembly1.cif.gz_A | escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25 | 0.9621 | 3 | 275 |
| 7th5-assembly1.cif.gz_B | thermus thermophilus methylenetetrahydrofolate reductase | 0.958 | 1 | 275 |
| 8eac-assembly1.cif.gz_B | thermus thermophilus methylenetetrahydrofolate reductase | 0.9562 | 4 | 275 |
| 3fst-assembly1.cif.gz_C | crystal structure of escherichia coli methylenetetrahydrofolate reductase mutant phe223leu at ph 7.4 | 0.9556 | 4 | 275 |
| 3fst-assembly1.cif.gz_E | crystal structure of escherichia coli methylenetetrahydrofolate reductase mutant phe223leu at ph 7.4 | 0.9529 | 3 | 275 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v93A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9509 | 4 | 276 | 3.20.20.220 |
| 1zp3B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9434 | 3 | 275 | 3.20.20.220 |
| af_Q75HE6_1_304_3.20.20.220 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9397 | 4 | 275 | 3.20.20.220 |
| af_Q5AEI0_1_296_3.20.20.220 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9391 | 2 | 275 | 3.20.20.220 |
| 1v93A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9375 | 4 | 276 | 3.20.20.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537CWC8-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9983 | 166 | 275 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A3D2SPX2-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9983 | 166 | 275 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A3D0SQY7-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9981 | 163 | 276 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A4V1TXD1-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9927 | 150 | 275 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A3D0K3A7-F1-model_v4 | deleted | 0.9911 | 187 | 276 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar