F491012

General Info

Members Datasets Scaffolds Average Seq Length
1161 559 1067 280

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0084748|Ga0373937_0084748_397_1428
Length 335
Sequence MTTRLPIPVSFEFFPPNTPVGSEKLKTVVSELATVEPEFFSVTYGAGGSTRDKTLATVSDIAALGQEAAPHLSCVGSTKDGISEILATYRAQKIRRLVALRGDLPSGTATAGEFRYASELISFIRETQGKDWFIEVAAYPEYHPQERYAKRDLQHFAAKVKAGADSAITQFFFNPDAYFHFVDEVRALGVEVPIVPGIMPFHNYAKIAQFAARDGIDIPRWVALKMEGFMDDAGSIRAFGLDVVTRLARRLIEGGAPGLHFYTLNQSPLTLELFKRLAGGFGGGLPPASGRCHITPSSVRSASSRNGRKPWVKLTPTVTGRGVSARSVRSKKPPP

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
8 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
9 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
10 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
11 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
12 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
13 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
14 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
15 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
16 2519103095 Burkholderia sp. KJ006 Isolate Nodule
17 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
18 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
19 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
20 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
21 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
22 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
23 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
24 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
25 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
26 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
27 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
28 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
29 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
30 2643221585 Pelomonas sp. Root662 Isolate Unclassified
31 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
32 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
33 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
34 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
35 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
36 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
37 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
38 2643221656 Pelomonas sp. Root405 Isolate Unclassified
39 2643221660 Methylibium sp. Root1272 Isolate Unclassified
40 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
41 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
42 2738541337 Pelomonas sp. BT06 Isolate Unclassified
43 2738543013 Variovorax sp. BT01 Isolate Unclassified
44 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
45 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
46 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
47 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
48 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
49 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
50 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
51 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
52 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
53 2818991436 Collimonas arenae 515 Isolate Unclassified
54 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
55 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
56 2831864461 Roseateles noduli HZ7 Isolate Nodule
57 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
58 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
59 2842711865 Duganella sp. R-73148 Isolate Unclassified
60 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
61 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
62 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
63 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
64 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
65 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
66 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
67 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
68 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
69 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
70 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
71 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
72 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
73 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
74 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
75 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
76 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
77 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
78 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
79 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
80 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
81 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
82 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
83 2928058823 Ralstonia sp. 1138 Isolate Unclassified
84 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
85 2928163908 Burkholderia sp. 567 Isolate Unclassified
86 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
87 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
88 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
89 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
90 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
91 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
92 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
93 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
94 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
95 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
96 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
97 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
98 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
99 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
100 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
101 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
102 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
103 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
104 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
105 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
106 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
107 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
108 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
109 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
110 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
111 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
112 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
113 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
114 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
115 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
116 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
117 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
118 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
119 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
120 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
121 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
122 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
123 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
124 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
125 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
126 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
127 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
128 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
129 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
130 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
131 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
132 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
133 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
134 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
135 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
136 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
137 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
138 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
139 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
140 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
141 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
142 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
143 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
144 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
145 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
146 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
147 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
148 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
149 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
150 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
151 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
152 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
153 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
154 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
155 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
156 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
157 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
158 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
159 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
160 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
161 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
162 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
163 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
164 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
165 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
166 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
167 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
168 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
169 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
170 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
171 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
172 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
173 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
174 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
175 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
176 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
177 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
178 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
179 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
180 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
181 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
182 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
183 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
184 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
185 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
186 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
187 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
188 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
189 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
190 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
191 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
192 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
193 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
194 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
195 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
196 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
197 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
198 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
199 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
200 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
201 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
202 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
203 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
204 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
205 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
206 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
207 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
208 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
209 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
210 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
211 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
212 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
213 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
214 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
215 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
216 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
217 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
218 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
219 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
220 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
221 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
222 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
223 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
224 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
226 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
227 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
228 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
235 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
236 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
238 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
239 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
242 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
243 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
244 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
245 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
248 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
249 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
251 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
252 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
253 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
255 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
256 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
317 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
318 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
321 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
322 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
324 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
328 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
329 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
330 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
331 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
332 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
333 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
334 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
335 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
336 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
337 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
338 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
339 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
340 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
341 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
342 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
343 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
344 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
345 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
346 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
347 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
348 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
349 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
350 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
351 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
352 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
353 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
354 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
355 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
356 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
357 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
358 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
359 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
360 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
361 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
362 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
363 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
364 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
365 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
366 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
367 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
368 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
369 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
370 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
371 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
372 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
373 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
374 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
375 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
376 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
377 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
378 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
379 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
380 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
381 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
382 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
383 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
384 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
385 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
386 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
387 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
388 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
389 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
390 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
391 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
392 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
393 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
394 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
395 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
396 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
397 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
398 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
399 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
400 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
401 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
402 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
403 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
404 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
405 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
406 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
407 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
408 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
409 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
410 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
411 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
412 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
413 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
414 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
415 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
416 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
417 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
418 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
419 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
420 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
421 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
422 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
423 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
424 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
425 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
426 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
427 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
428 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
429 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
430 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
431 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
432 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
433 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
434 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
435 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
436 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
437 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
438 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
439 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
440 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
441 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
442 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
443 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
444 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
445 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
446 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
447 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
448 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
449 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
450 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
451 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
452 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
453 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
454 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
455 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
456 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
457 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
458 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
459 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
460 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
461 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
462 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
463 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
464 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
465 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
466 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
467 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
468 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
469 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
470 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
471 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
472 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
473 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
474 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
475 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
476 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
477 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
478 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
479 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
480 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
481 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
482 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
483 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
484 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
485 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
486 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
487 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
488 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
489 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
490 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
491 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
492 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
493 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
494 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
495 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
496 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
497 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
498 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
502 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
503 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
504 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
505 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
506 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
507 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
508 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
509 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
510 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
511 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
512 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
513 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
514 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
515 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
516 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
517 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
518 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
521 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
522 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
523 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
524 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
525 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
526 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
527 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
528 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
529 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
530 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
531 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
532 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
533 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
534 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
535 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
536 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
537 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
538 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
539 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
540 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
541 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
542 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
543 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
544 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
545 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
546 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
547 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
548 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
549 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
553 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
554 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
555 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
556 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
557 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
558 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
559 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.04
Metatranscriptomes 0.78
Isolates 8.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.28
Nodule 1.72
Rhizoplane 2.5
Rhizosphere 68.13
Stem 0
Stem Tuber 0
Unclassified 11.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000659 3300001915 Bacteria 10436
2 JGI24740J21852_10003369 3300001979 Bacteria 7046
3 JGI25155J39150_1000249 3300002704 Bacteria 20726
4 JGI25155J39150_1000328 3300002704 Bacteria 15729
5 JGI25155J39150_1000403 3300002704 Bacteria 12058
6 JGI25156J39149_1000117 3300002705 Bacteria 57700
7 JGI25156J39149_1001439 3300002705 Bacteria 10102
8 JGI25162J39368_1000148 3300002737 Bacteria 76611
9 JGI25162J39368_1004924 3300002737 Bacteria 2850
10 JGI25154J39366_1000107 3300002738 Bacteria 73482
11 JGI25154J39366_1000440 3300002738 Bacteria 22091
12 JGI25154J39366_1000661 3300002738 Bacteria 16103
13 JGI25157J39369_1000884 3300002741 Bacteria 14427
14 JGI25151J46595_10001412 3300003187 Bacteria 16428
15 JGI25151J46595_10012502 3300003187 Bacteria 3858
16 JGI25165J46597_1000030 3300003214 Bacteria 305254
17 rootH1_10009708 3300003316 Bacteria 16787
18 rootH1_10046862 3300003316 Bacteria 1922
19 rootH1_10046862 3300003323 Bacteria 4327
20 rootH1_10091210 3300003316 Bacteria 2975
21 rootH2_10003807 3300003320 Bacteria 2237
22 rootL2_10001066 3300003322 Bacteria 89444
23 rootL2_10044783 3300003322 Bacteria 5369
24 rootL2_10093618 3300003322 Bacteria 6140
25 rootL2_10123098 3300003322 Bacteria 1657
26 JGI26128J50194_1001242 3300003347 Bacteria 1595
27 JGI25160J50197_1000367 3300003354 Bacteria 29519
28 Ga0006556J51387_1023961 3300003479 Bacteria 3016
29 Ga0006560J51390_1017447 3300003565 Bacteria 3203
30 Ga0055538_1000017 3300003751 Bacteria 305254
31 Ga0055538_1000085 3300003751 Bacteria 81616
32 Ga0055538_1003429 3300003751 Bacteria 2020
33 Ga0055539_1000022 3300003752 Bacteria 305254
34 Ga0055539_1000126 3300003752 Bacteria 81616
35 Ga0055539_1000214 3300003752 Bacteria 42035
36 Ga0055533_1000030 3300003756 Bacteria 305254
37 Ga0055533_1000133 3300003756 Bacteria 81616
38 Ga0055533_1000605 3300003756 Bacteria 12145
39 Ga0055533_1001088 3300003756 Bacteria 7785
40 Ga0055532_1000040 3300003758 Bacteria 198031
41 Ga0055532_1000044 3300003758 Bacteria 191110
42 Ga0055525_1000034 3300003759 Bacteria 305254
43 Ga0055525_1000054 3300003759 Bacteria 216523
44 Ga0055525_1000174 3300003759 Bacteria 81616
45 Ga0055525_1000420 3300003759 Bacteria 25543
46 Ga0055535_1000029 3300003761 Bacteria 198031
47 Ga0055542_1006798 3300003762 Bacteria 2399
48 Ga0055529_1000055 3300003763 Bacteria 197545
49 Ga0055529_1000945 3300003763 Bacteria 15337
50 Ga0055526_1002077 3300003771 Bacteria 13757
51 Ga0055526_1003730 3300003771 Bacteria 9514
52 Ga0055526_1007791 3300003771 Bacteria 5487
53 Ga0055537_1000114 3300003773 Bacteria 60836
54 Ga0055524_1000550 3300003775 Bacteria 28332
55 Ga0055524_1001670 3300003775 Bacteria 12366
56 Ga0055524_1013761 3300003775 Bacteria 3035
57 Ga0055524_1015430 3300003775 Bacteria 2785
58 Ga0055536_1000031 3300003781 Bacteria 151112
59 Ga0055534_1000259 3300003784 Bacteria 36742
60 Ga0055534_1001330 3300003784 Bacteria 9921
61 Ga0055534_1002212 3300003784 Bacteria 6901
62 Ga0055534_1004644 3300003784 Bacteria 3905
63 Ga0055528_1000059 3300003790 Bacteria 87695
64 Ga0055531_10000042 3300003794 Bacteria 134368
65 Ga0055541_1000015 3300003841 Bacteria 305254
66 Ga0055541_1000085 3300003841 Bacteria 81616
67 Ga0055541_1000760 3300003841 Bacteria 8177
68 Ga0065165_1000474 3300005262 Bacteria 62687
69 Ga0065165_1000621 3300005262 Bacteria 51523
70 Ga0065165_1001219 3300005262 Bacteria 29587
71 Ga0065165_1001544 3300005262 Bacteria 24046
72 Ga0070658_10027022 3300005327 Bacteria 4608
73 Ga0070658_10561836 3300005327 Bacteria 988
74 Ga0070676_10000434 3300005328 Bacteria 19840
75 Ga0070690_100001931 3300005330 Bacteria 11018
76 Ga0070670_100011920 3300005331 Bacteria 7434
77 Ga0070670_100023566 3300005331 Bacteria 5298
78 Ga0070670_100024473 3300005331 Bacteria 5192
79 Ga0070670_100030033 3300005331 Bacteria 4680
80 Ga0070670_100057768 3300005331 Bacteria 3330
81 Ga0070670_100139592 3300005331 Bacteria 2095
82 Ga0070670_100309540 3300005331 Bacteria 1382
83 Ga0070670_100420808 3300005331 Bacteria 1181
84 Ga0070677_10002998 3300005333 Bacteria 5427
85 Ga0070677_10088019 3300005333 Bacteria 1344
86 Ga0070677_10134184 3300005333 Bacteria 1134
87 Ga0068869_100035950 3300005334 Bacteria 3515
88 Ga0068869_100052968 3300005334 Bacteria 2948
89 Ga0068869_100073084 3300005334 Bacteria 2542
90 Ga0068869_100150690 3300005334 Bacteria 1803
91 Ga0070666_10002319 3300005335 Bacteria 11506
92 Ga0070666_10143697 3300005335 Bacteria 1662
93 Ga0070666_10255356 3300005335 Bacteria 1242
94 Ga0070680_100001090 3300005336 Bacteria 19474
95 Ga0070682_100064094 3300005337 Bacteria 2332
96 Ga0068868_100002885 3300005338 Bacteria 11932
97 Ga0068868_100022383 3300005338 Bacteria 4769
98 Ga0068868_100045059 3300005338 Bacteria 3450
99 Ga0068868_100211881 3300005338 Bacteria 1619
100 Ga0068868_100235499 3300005338 Bacteria 1537
101 Ga0070660_100062262 3300005339 Bacteria 2898
102 Ga0070660_100181019 3300005339 Bacteria 1705
103 Ga0070689_100140805 3300005340 Bacteria 1940
104 Ga0070689_100189617 3300005340 Bacteria 1674
105 Ga0070689_100262479 3300005340 Bacteria 1428
106 Ga0070687_100001074 3300005343 Bacteria 9366
107 Ga0070661_100000037 3300005344 Bacteria 107325
108 Ga0070668_100000210 3300005347 Bacteria 38311
109 Ga0070668_100047815 3300005347 Bacteria 3290
110 Ga0070668_100169199 3300005347 Bacteria 1778
111 Ga0070669_100000370 3300005353 Bacteria 34811
112 Ga0070669_100030221 3300005353 Bacteria 3908
113 Ga0070669_100152920 3300005353 Bacteria 1787
114 Ga0070669_100277617 3300005353 Bacteria 1342
115 Ga0070675_100000692 3300005354 Bacteria 23415
116 Ga0070675_100014685 3300005354 Bacteria 6177
117 Ga0070675_100024652 3300005354 Bacteria 4817
118 Ga0070675_100171157 3300005354 Bacteria 1873
119 Ga0070675_100441032 3300005354 Bacteria 1166
120 Ga0070671_100001030 3300005355 Bacteria 20495
121 Ga0070671_100025332 3300005355 Bacteria 4866
122 Ga0070671_100048387 3300005355 Bacteria 3535
123 Ga0070671_100052291 3300005355 Bacteria 3397
124 Ga0070671_100103137 3300005355 Bacteria 2393
125 Ga0070671_100148744 3300005355 Bacteria 1977
126 Ga0070671_100189936 3300005355 Bacteria 1741
127 Ga0070674_100001560 3300005356 Bacteria 12278
128 Ga0070674_100017826 3300005356 Bacteria 4474
129 Ga0070674_100031238 3300005356 Bacteria 3527
130 Ga0070674_100353523 3300005356 Bacteria 1187
131 Ga0070673_100005042 3300005364 Bacteria 8423
132 Ga0070673_100017993 3300005364 Bacteria 5038
133 Ga0070673_100044461 3300005364 Bacteria 3439
134 Ga0070688_100072165 3300005365 Bacteria 2211
135 Ga0070659_100000268 3300005366 Bacteria 40889
136 Ga0070667_100000294 3300005367 Bacteria 56218
137 Ga0070667_100003264 3300005367 Bacteria 13863
138 Ga0070667_100022091 3300005367 Bacteria 5277
139 Ga0070667_100137649 3300005367 Bacteria 2135
140 Ga0070667_100144573 3300005367 Bacteria 2085
141 Ga0070667_100369742 3300005367 Bacteria 1301
142 Ga0070667_100398929 3300005367 Bacteria 1252
143 Ga0070713_100095071 3300005436 Bacteria 2570
144 Ga0070701_10065313 3300005438 Bacteria 1931
145 Ga0070708_100639403 3300005445 Bacteria 1003
146 Ga0070663_100000001 3300005455 Bacteria 318372
147 Ga0070678_100002211 3300005456 Bacteria 10580
148 Ga0070678_100004854 3300005456 Bacteria 7679
149 Ga0070678_100064650 3300005456 Bacteria 2712
150 Ga0070678_100091383 3300005456 Bacteria 2336
151 Ga0070678_100208545 3300005456 Bacteria 1617
152 Ga0070662_100014012 3300005457 Bacteria 5344
153 Ga0070662_100046171 3300005457 Bacteria 3129
154 Ga0070662_100076345 3300005457 Bacteria 2483
155 Ga0070662_100195539 3300005457 Bacteria 1602
156 Ga0068867_100001702 3300005459 Bacteria 15330
157 Ga0068867_100002661 3300005459 Bacteria 12602
158 Ga0068867_100008359 3300005459 Bacteria 7304
159 Ga0068867_100025546 3300005459 Bacteria 4239
160 Ga0068867_100034937 3300005459 Bacteria 3645
161 Ga0068867_100127994 3300005459 Bacteria 1970
162 Ga0068867_100184109 3300005459 Bacteria 1662
163 Ga0068867_100203951 3300005459 Bacteria 1584
164 Ga0068867_100240701 3300005459 Bacteria 1467
165 Ga0070706_100003301 3300005467 Bacteria 15955
166 Ga0070707_100035771 3300005468 Bacteria 4739
167 Ga0068853_100009360 3300005539 Bacteria 7898
168 Ga0068853_100478194 3300005539 Bacteria 1174
169 Ga0070672_100000286 3300005543 Bacteria 28584
170 Ga0070672_100000712 3300005543 Bacteria 19713
171 Ga0070672_100006372 3300005543 Bacteria 7925
172 Ga0070672_100018646 3300005543 Bacteria 5022
173 Ga0070672_100027706 3300005543 Bacteria 4229
174 Ga0070672_100109913 3300005543 Bacteria 2246
175 Ga0070686_100247415 3300005544 Bacteria 1301
176 Ga0070693_100032105 3300005547 Bacteria 2884
177 Ga0070665_100330310 3300005548 Bacteria 1529
178 Ga0070665_100639660 3300005548 Bacteria 1077
179 Ga0068855_100005276 3300005563 Bacteria 15776
180 Ga0068855_100147077 3300005563 Bacteria 2681
181 Ga0068855_100170676 3300005563 Bacteria 2464
182 Ga0068855_100175969 3300005563 Bacteria 2421
183 Ga0068855_100354541 3300005563 Bacteria 1616
184 Ga0070664_100000006 3300005564 Bacteria 189856
185 Ga0070664_100262573 3300005564 Bacteria 1554
186 Ga0068857_100048044 3300005577 Bacteria 3789
187 Ga0068857_100097295 3300005577 Bacteria 2638
188 Ga0068857_100122293 3300005577 Bacteria 2344
189 Ga0068857_100299431 3300005577 Bacteria 1482
190 Ga0068854_100002991 3300005578 Bacteria 10487
191 Ga0068854_100061897 3300005578 Bacteria 2711
192 Ga0068854_100173028 3300005578 Bacteria 1681
193 Ga0068856_100000032 3300005614 Bacteria 124895
194 Ga0070702_100172958 3300005615 Bacteria 1407
195 Ga0070702_100254733 3300005615 Bacteria 1192
196 Ga0068852_100006988 3300005616 Bacteria 8214
197 Ga0068852_100024872 3300005616 Bacteria 4845
198 Ga0068852_100054367 3300005616 Bacteria 3451
199 Ga0068852_100071258 3300005616 Bacteria 3051
200 Ga0068852_100170213 3300005616 Bacteria 2041
201 Ga0068852_100477932 3300005616 Bacteria 1238
202 Ga0068859_100120053 3300005617 Bacteria 2695
203 Ga0068859_100176440 3300005617 Bacteria 2219
204 Ga0068859_100378623 3300005617 Bacteria 1511
205 Ga0068864_100000417 3300005618 Bacteria 36778
206 Ga0068864_100018136 3300005618 Bacteria 5873
207 Ga0068864_100071218 3300005618 Bacteria 3027
208 Ga0068864_100110450 3300005618 Bacteria 2448
209 Ga0068864_100569551 3300005618 Bacteria 1097
210 Ga0068866_10005226 3300005718 Bacteria 5348
211 Ga0068861_100000398 3300005719 Bacteria 25148
212 Ga0068861_100010875 3300005719 Bacteria 6323
213 Ga0068861_100027316 3300005719 Bacteria 4155
214 Ga0068861_100173269 3300005719 Bacteria 1790
215 Ga0068851_10008763 3300005834 Bacteria 4685
216 Ga0068870_10055112 3300005840 Bacteria 2117
217 Ga0068870_10221762 3300005840 Bacteria 1158
218 Ga0068863_100000638 3300005841 Bacteria 35489
219 Ga0068863_100021605 3300005841 Bacteria 6138
220 Ga0068863_100095002 3300005841 Bacteria 2830
221 Ga0068863_100116242 3300005841 Bacteria 2549
222 Ga0068863_100116455 3300005841 Bacteria 2546
223 Ga0068858_100000623 3300005842 Bacteria 36873
224 Ga0068858_100004551 3300005842 Bacteria 13580
225 Ga0068858_100042716 3300005842 Bacteria 4203
226 Ga0068858_100353339 3300005842 Bacteria 1408
227 Ga0068860_100001020 3300005843 Bacteria 30989
228 Ga0068860_100002539 3300005843 Bacteria 19101
229 Ga0068860_100047148 3300005843 Bacteria 4107
230 Ga0068862_100003087 3300005844 Bacteria 14521
231 Ga0068862_100039734 3300005844 Bacteria 3997
232 Ga0068862_100053450 3300005844 Bacteria 3458
233 Ga0068862_100098908 3300005844 Bacteria 2549
234 Ga0075368_10010902 3300006042 Bacteria 3296
235 Ga0075368_10015811 3300006042 Bacteria 2804
236 Ga0075363_100086454 3300006048 Bacteria 1721
237 Ga0075364_10067075 3300006051 Bacteria 2358
238 Ga0075362_10018818 3300006177 Bacteria 2863
239 Ga0075367_10027649 3300006178 Bacteria 3229
240 Ga0075367_10048135 3300006178 Bacteria 2510
241 Ga0075366_10003944 3300006195 Bacteria 7916
242 Ga0075366_10004375 3300006195 Bacteria 7579
243 Ga0075366_10004423 3300006195 Bacteria 7543
244 Ga0075366_10016373 3300006195 Bacteria 4261
245 Ga0075366_10027032 3300006195 Bacteria 3365
246 Ga0075366_10065018 3300006195 Bacteria 2169
247 Ga0075366_10085433 3300006195 Bacteria 1887
248 Ga0075366_10209799 3300006195 Bacteria 1186
249 Ga0097621_100010671 3300006237 Bacteria 6732
250 Ga0097621_100031314 3300006237 Bacteria 4220
251 Ga0097621_100138552 3300006237 Bacteria 2078
252 Ga0097621_100253122 3300006237 Bacteria 1543
253 Ga0097621_100260001 3300006237 Bacteria 1522
254 Ga0075370_10000291 3300006353 Bacteria 17999
255 Ga0075370_10000595 3300006353 Bacteria 13965
256 Ga0075370_10006650 3300006353 Bacteria 5831
257 Ga0075370_10027042 3300006353 Bacteria 3181
258 Ga0075370_10041151 3300006353 Bacteria 2608
259 Ga0068871_100094720 3300006358 Bacteria 2492
260 Ga0068871_100257770 3300006358 Bacteria 1520
261 Ga0075430_100211114 3300006846 Bacteria 1611
262 Ga0075434_100685126 3300006871 Bacteria 1043
263 Ga0075429_100000224 3300006880 Bacteria 38311
264 Ga0068865_100000504 3300006881 Bacteria 21850
265 Ga0068865_100006531 3300006881 Bacteria 7125
266 Ga0068865_100051687 3300006881 Bacteria 2846
267 Ga0068865_100104594 3300006881 Bacteria 2078
268 Ga0097620_100120048 3300006931 Bacteria 2695
269 Ga0097620_100176445 3300006931 Bacteria 2219
270 Ga0097620_100378658 3300006931 Bacteria 1511
271 Ga0099823_1000559 3300006944 Bacteria 25703
272 Ga0079104_1010957 3300006946 Bacteria 2948
273 Ga0105251_10072277 3300009011 Bacteria 1604
274 Ga0105251_10149572 3300009011 Bacteria 1055
275 Ga0105240_10015068 3300009093 Bacteria 10523
276 Ga0105240_10022053 3300009093 Bacteria 8454
277 Ga0105240_10077623 3300009093 Bacteria 4091
278 Ga0105240_10174543 3300009093 Bacteria 2542
279 Ga0105240_10196467 3300009093 Bacteria 2368
280 Ga0105240_10295608 3300009093 Bacteria 1855
281 Ga0105240_10413203 3300009093 Bacteria 1517
282 Ga0105240_10413204 3300009093 Bacteria 1517
283 Ga0105245_10012144 3300009098 Bacteria 7490
284 Ga0105245_10046369 3300009098 Bacteria 3884
285 Ga0105245_10197412 3300009098 Bacteria 1931
286 Ga0114129_10975478 3300009147 Bacteria 1069
287 Ga0105243_10006497 3300009148 Bacteria 9041
288 Ga0105243_10039272 3300009148 Bacteria 3688
289 Ga0105243_10107642 3300009148 Bacteria 2325
290 Ga0105243_10119821 3300009148 Bacteria 2216
291 Ga0105241_10348034 3300009174 Bacteria 1286
292 Ga0105242_10018196 3300009176 Bacteria 5490
293 Ga0105248_10027320 3300009177 Bacteria 6351
294 Ga0105248_10116277 3300009177 Bacteria 3016
295 Ga0105248_10150457 3300009177 Bacteria 2626
296 Ga0105237_10033144 3300009545 Bacteria 5233
297 Ga0105237_10080569 3300009545 Bacteria 3246
298 Ga0105237_10097519 3300009545 Bacteria 2930
299 Ga0105238_10000038 3300009551 Bacteria 162920
300 Ga0105238_10007405 3300009551 Bacteria 10994
301 Ga0105249_10002938 3300009553 Bacteria 14709
302 Ga0105249_10052983 3300009553 Bacteria 3707
303 Ga0105249_10166150 3300009553 Bacteria 2136
304 Ga0105239_10004364 3300010375 Bacteria 16946
305 Ga0105239_10138089 3300010375 Bacteria 2714
306 Ga0157319_1000005 3300012497 Bacteria 372810
307 Ga0157373_10079106 3300013100 Bacteria 2319
308 Ga0157373_10080356 3300013100 Bacteria 2299
309 Ga0157373_10364764 3300013100 Bacteria 1031
310 Ga0157371_10000106 3300013102 Bacteria 126567
311 Ga0157370_10000062 3300013104 Bacteria 115487
312 Ga0157369_10019944 3300013105 Bacteria 7498
313 Ga0157374_10024366 3300013296 Bacteria 5425
314 Ga0157374_10130406 3300013296 Bacteria 2433
315 Ga0157374_10253714 3300013296 Bacteria 1731
316 Ga0157378_10053754 3300013297 Bacteria 3585
317 Ga0157378_10382849 3300013297 Bacteria 1382
318 Ga0157378_10736485 3300013297 Bacteria 1008
319 Ga0163162_10000701 3300013306 Bacteria 30951
320 Ga0163162_10051946 3300013306 Bacteria 4115
321 Ga0163162_10274052 3300013306 Bacteria 1819
322 Ga0163162_10525009 3300013306 Bacteria 1313
323 Ga0163162_10563620 3300013306 Bacteria 1267
324 Ga0157372_10000108 3300013307 Bacteria 86863
325 Ga0157372_10107117 3300013307 Bacteria 3198
326 Ga0157375_10006514 3300013308 Bacteria 10163
327 Ga0157375_10009924 3300013308 Bacteria 8376
328 Ga0157375_10153266 3300013308 Bacteria 2442
329 Ga0163163_10195108 3300014325 Bacteria 2073
330 Ga0163163_10205725 3300014325 Bacteria 2016
331 Ga0163163_10231195 3300014325 Bacteria 1898
332 Ga0157380_10000472 3300014326 Bacteria 24494
333 Ga0157380_10033017 3300014326 Bacteria 3983
334 Ga0157380_10145419 3300014326 Bacteria 2042
335 Ga0182008_10042885 3300014497 Bacteria 2253
336 Ga0182008_10112057 3300014497 Bacteria 1352
337 Ga0157377_10000034 3300014745 Bacteria 117744
338 Ga0157377_10039116 3300014745 Bacteria 2622
339 Ga0157379_10001128 3300014968 Bacteria 21831
340 Ga0157379_10002106 3300014968 Bacteria 16495
341 Ga0157379_10005918 3300014968 Bacteria 10530
342 Ga0157379_10050097 3300014968 Bacteria 3727
343 Ga0157379_10072142 3300014968 Bacteria 3089
344 Ga0157379_10422105 3300014968 Bacteria 1228
345 Ga0157376_10021689 3300014969 Bacteria 4992
346 Ga0157376_10039629 3300014969 Bacteria 3844
347 Ga0157376_10185936 3300014969 Bacteria 1902
348 Ga0157376_10236372 3300014969 Bacteria 1700
349 Ga0157376_10360986 3300014969 Bacteria 1393
350 Ga0157376_10552731 3300014969 Bacteria 1139
351 Ga0182006_1001438 3300015261 Bacteria 14409
352 Ga0182006_1012816 3300015261 Bacteria 3658
353 Ga0182006_1020296 3300015261 Bacteria 2785
354 Ga0182006_1028442 3300015261 Bacteria 2273
355 Ga0182006_1076641 3300015261 Bacteria 1228
356 Ga0182007_10013248 3300015262 Bacteria 3150
357 Ga0182007_10020262 3300015262 Bacteria 2380
358 Ga0182005_1000142 3300015265 Bacteria 50650
359 Ga0183361_10001 3300016635 Bacteria 908583
360 Ga0163161_10001102 3300017792 Bacteria 20382
361 Ga0163161_10012016 3300017792 Bacteria 6007
362 Ga0163161_10076474 3300017792 Bacteria 2457
363 Ga0206355_1625393 3300020076 Bacteria 2024
364 Ga0206351_10698205 3300020077 Bacteria 5141
365 Ga0154015_1545624 3300020610 Bacteria 8382
366 Ga0213872_10000861 3300021361 Bacteria 21979
367 Ga0213872_10000883 3300021361 Bacteria 21687
368 Ga0213872_10000982 3300021361 Bacteria 19943
369 Ga0213872_10004235 3300021361 Bacteria 7693
370 Ga0213872_10006327 3300021361 Bacteria 5958
371 Ga0213872_10007165 3300021361 Bacteria 5512
372 Ga0209435_100004 3300025206 Bacteria 633417
373 Ga0209435_100891 3300025206 Bacteria 4560
374 Ga0209760_101145 3300025207 Bacteria 3003
375 Ga0209784_100006 3300025224 Bacteria 930704
376 Ga0209784_100021 3300025224 Bacteria 408534
377 Ga0209784_100034 3300025224 Bacteria 305504
378 Ga0209784_100559 3300025224 Bacteria 13132
379 Ga0209566_100002 3300025225 Bacteria 2614868
380 Ga0209566_100038 3300025225 Bacteria 305504
381 Ga0209566_100039 3300025225 Bacteria 303368
382 Ga0209566_100678 3300025225 Bacteria 20133
383 Ga0209566_102039 3300025225 Bacteria 4240
384 Ga0209566_102609 3300025225 Bacteria 3201
385 Ga0209674_100010 3300025226 Bacteria 1038638
386 Ga0209674_100036 3300025226 Bacteria 408534
387 Ga0209674_100056 3300025226 Bacteria 305504
388 Ga0209674_100060 3300025226 Bacteria 282102
389 Ga0209674_100076 3300025226 Bacteria 210323
390 Ga0209674_106794 3300025226 Bacteria 1511
391 Ga0209672_101956 3300025228 Bacteria 5797
392 Ga0209672_108353 3300025228 Bacteria 1538
393 Ga0209147_100011 3300025229 Bacteria 702140
394 Ga0209147_100018 3300025229 Bacteria 515719
395 Ga0209563_100040 3300025230 Bacteria 408534
396 Ga0209563_100041 3300025230 Bacteria 407467
397 Ga0209563_100057 3300025230 Bacteria 305604
398 Ga0209563_100075 3300025230 Bacteria 216575
399 Ga0209563_106287 3300025230 Bacteria 2053
400 Ga0207427_103609 3300025231 Bacteria 3136
401 Ga0209437_100071 3300025233 Bacteria 305604
402 Ga0209437_100393 3300025233 Bacteria 42190
403 Ga0209258_100028 3300025242 Bacteria 515719
404 Ga0209258_106057 3300025242 Bacteria 1948
405 Ga0209646_1000043 3300025246 Bacteria 343652
406 Ga0209646_1000149 3300025246 Bacteria 100004
407 Ga0209646_1000191 3300025246 Bacteria 75546
408 Ga0209646_1000233 3300025246 Bacteria 57776
409 Ga0209026_1000066 3300025250 Bacteria 207691
410 Ga0209026_1002225 3300025250 Bacteria 7491
411 Ga0209026_1009862 3300025250 Bacteria 1832
412 Ga0209677_100007 3300025253 Bacteria 1021332
413 Ga0209677_100023 3300025253 Bacteria 408534
414 Ga0209677_100035 3300025253 Bacteria 305504
415 Ga0209677_102676 3300025253 Bacteria 6432
416 Ga0209148_1000162 3300025254 Bacteria 138642
417 Ga0209759_1000072 3300025256 Bacteria 178206
418 Ga0209759_1000182 3300025256 Bacteria 102836
419 Ga0209759_1001347 3300025256 Bacteria 14286
420 Ga0209759_1003723 3300025256 Bacteria 5970
421 Ga0209129_1004031 3300025258 Bacteria 6006
422 Ga0209233_1000094 3300025261 Bacteria 305604
423 Ga0209565_1000032 3300025263 Bacteria 316777
424 Ga0209565_1000611 3300025263 Bacteria 23691
425 Ga0207666_1013333 3300025271 Bacteria 1153
426 Ga0209455_1000065 3300025272 Bacteria 321272
427 Ga0209455_1001116 3300025272 Bacteria 13109
428 Ga0209455_1010351 3300025272 Bacteria 2376
429 Ga0209673_1000029 3300025273 Bacteria 351978
430 Ga0209673_1004669 3300025273 Bacteria 7231
431 Ga0209673_1009458 3300025273 Bacteria 4218
432 Ga0209675_1000019 3300025291 Bacteria 351950
433 Ga0209675_1000231 3300025291 Bacteria 56755
434 Ga0209675_1001472 3300025291 Bacteria 13522
435 Ga0209675_1009719 3300025291 Bacteria 3368
436 Ga0209676_1000036 3300025292 Bacteria 457623
437 Ga0209025_1000345 3300025294 Bacteria 100876
438 Ga0209025_1000860 3300025294 Bacteria 47953
439 Ga0209025_1000885 3300025294 Bacteria 46908
440 Ga0209025_1002236 3300025294 Bacteria 21305
441 Ga0209025_1003617 3300025294 Bacteria 14389
442 Ga0209025_1020816 3300025294 Bacteria 3564
443 Ga0209564_1000021 3300025295 Bacteria 571316
444 Ga0209564_1000291 3300025295 Bacteria 101831
445 Ga0209564_1001814 3300025295 Bacteria 19671
446 Ga0209564_1002897 3300025295 Bacteria 12521
447 Ga0209564_1003347 3300025295 Bacteria 11112
448 Ga0209758_1014888 3300025297 Bacteria 4084
449 Ga0209050_1001572 3300025298 Bacteria 23718
450 Ga0209256_1000244 3300025299 Bacteria 96646
451 Ga0209256_1000309 3300025299 Bacteria 85294
452 Ga0209256_1001175 3300025299 Bacteria 29496
453 Ga0209256_1003136 3300025299 Bacteria 12042
454 Ga0209256_1012735 3300025299 Bacteria 3185
455 Ga0207426_1000007 3300025302 Bacteria 971011
456 Ga0209051_1002025 3300025303 Bacteria 15428
457 Ga0209051_1003442 3300025303 Bacteria 10373
458 Ga0209257_1000016 3300025304 Bacteria 908015
459 Ga0209257_1000981 3300025304 Bacteria 38736
460 Ga0209257_1003659 3300025304 Bacteria 12890
461 Ga0209257_1021536 3300025304 Bacteria 2337
462 Ga0207697_10005788 3300025315 Bacteria 5698
463 Ga0207656_10007965 3300025321 Bacteria 3885
464 Ga0207656_10049107 3300025321 Bacteria 1819
465 Ga0207713_1077262 3300025735 Bacteria 1209
466 Ga0207682_10001283 3300025893 Bacteria 11529
467 Ga0207682_10066783 3300025893 Bacteria 1516
468 Ga0207682_10067497 3300025893 Bacteria 1509
469 Ga0207682_10128893 3300025893 Bacteria 1128
470 Ga0207642_10005579 3300025899 Bacteria 4118
471 Ga0207642_10014175 3300025899 Bacteria 2933
472 Ga0207642_10041206 3300025899 Bacteria 2020
473 Ga0207688_10055694 3300025901 Bacteria 2220
474 Ga0207680_10002133 3300025903 Bacteria 9262
475 Ga0207680_10048731 3300025903 Bacteria 2518
476 Ga0207680_10283664 3300025903 Bacteria 1151
477 Ga0207647_10053550 3300025904 Bacteria 2486
478 Ga0207645_10001321 3300025907 Bacteria 20363
479 Ga0207645_10002041 3300025907 Bacteria 16211
480 Ga0207645_10004182 3300025907 Bacteria 10717
481 Ga0207645_10034575 3300025907 Bacteria 3247
482 Ga0207645_10163414 3300025907 Bacteria 1457
483 Ga0207643_10159082 3300025908 Bacteria 1358
484 Ga0207643_10263413 3300025908 Bacteria 1065
485 Ga0207705_10053592 3300025909 Bacteria 2906
486 Ga0207684_10012702 3300025910 Bacteria 7312
487 Ga0207654_10065427 3300025911 Bacteria 2140
488 Ga0207695_10000979 3300025913 Bacteria 50790
489 Ga0207695_10001817 3300025913 Bacteria 33592
490 Ga0207695_10002079 3300025913 Bacteria 30518
491 Ga0207695_10082442 3300025913 Bacteria 3251
492 Ga0207695_10108766 3300025913 Bacteria 2756
493 Ga0207695_10550327 3300025913 Bacteria 1035
494 Ga0207671_10001710 3300025914 Bacteria 24779
495 Ga0207671_10182234 3300025914 Bacteria 1635
496 Ga0207660_10006825 3300025917 Bacteria 7390
497 Ga0207662_10163295 3300025918 Bacteria 1424
498 Ga0207657_10127064 3300025919 Bacteria 2093
499 Ga0207649_10000477 3300025920 Bacteria 28564
500 Ga0207649_10095109 3300025920 Bacteria 1959
501 Ga0207681_10001157 3300025923 Bacteria 17033
502 Ga0207681_10012075 3300025923 Bacteria 5322
503 Ga0207694_10000069 3300025924 Bacteria 124500
504 Ga0207694_10011272 3300025924 Bacteria 6752
505 Ga0207694_10025608 3300025924 Bacteria 4484
506 Ga0207694_10145325 3300025924 Bacteria 1909
507 Ga0207650_10000603 3300025925 Bacteria 28763
508 Ga0207650_10001006 3300025925 Bacteria 21205
509 Ga0207650_10032175 3300025925 Bacteria 3794
510 Ga0207650_10048101 3300025925 Bacteria 3144
511 Ga0207650_10320901 3300025925 Bacteria 1268
512 Ga0207659_10000488 3300025926 Bacteria 23860
513 Ga0207659_10003135 3300025926 Bacteria 9880
514 Ga0207659_10033524 3300025926 Bacteria 3535
515 Ga0207659_10038095 3300025926 Bacteria 3342
516 Ga0207659_10162824 3300025926 Bacteria 1753
517 Ga0207687_10019791 3300025927 Bacteria 4463
518 Ga0207687_10022125 3300025927 Bacteria 4230
519 Ga0207700_10059448 3300025928 Bacteria 2891
520 Ga0207644_10019134 3300025931 Bacteria 4642
521 Ga0207644_10021105 3300025931 Bacteria 4434
522 Ga0207644_10043820 3300025931 Bacteria 3176
523 Ga0207644_10183703 3300025931 Bacteria 1640
524 Ga0207644_10386487 3300025931 Bacteria 1142
525 Ga0207690_10001542 3300025932 Bacteria 14419
526 Ga0207690_10061546 3300025932 Bacteria 2552
527 Ga0207706_10005604 3300025933 Bacteria 11696
528 Ga0207706_10023257 3300025933 Bacteria 5566
529 Ga0207706_10067960 3300025933 Bacteria 3136
530 Ga0207686_10161890 3300025934 Bacteria 1569
531 Ga0207709_10022617 3300025935 Bacteria 3567
532 Ga0207709_10077907 3300025935 Bacteria 2126
533 Ga0207709_10166238 3300025935 Bacteria 1544
534 Ga0207670_10137243 3300025936 Bacteria 1799
535 Ga0207670_10137759 3300025936 Bacteria 1796
536 Ga0207669_10002675 3300025937 Bacteria 7630
537 Ga0207669_10010185 3300025937 Bacteria 4516
538 Ga0207704_10002511 3300025938 Bacteria 8267
539 Ga0207704_10003713 3300025938 Bacteria 6943
540 Ga0207704_10164572 3300025938 Bacteria 1583
541 Ga0207665_10275322 3300025939 Bacteria 1251
542 Ga0207691_10001925 3300025940 Bacteria 20256
543 Ga0207691_10002589 3300025940 Bacteria 17678
544 Ga0207691_10026069 3300025940 Bacteria 5486
545 Ga0207691_10029199 3300025940 Bacteria 5159
546 Ga0207691_10044567 3300025940 Bacteria 4081
547 Ga0207691_10066955 3300025940 Bacteria 3248
548 Ga0207691_10076817 3300025940 Bacteria 3009
549 Ga0207691_10105579 3300025940 Bacteria 2509
550 Ga0207711_10009121 3300025941 Bacteria 8282
551 Ga0207711_10057113 3300025941 Bacteria 3355
552 Ga0207711_10469707 3300025941 Bacteria 1171
553 Ga0207711_10604105 3300025941 Bacteria 1024
554 Ga0207689_10000415 3300025942 Bacteria 39864
555 Ga0207689_10032225 3300025942 Bacteria 4360
556 Ga0207689_10205596 3300025942 Bacteria 1626
557 Ga0207689_10217162 3300025942 Bacteria 1580
558 Ga0207661_10146534 3300025944 Bacteria 2037
559 Ga0207679_10000012 3300025945 Bacteria 339773
560 Ga0207679_10021183 3300025945 Bacteria 4401
561 Ga0207679_10072028 3300025945 Bacteria 2609
562 Ga0207679_10368181 3300025945 Bacteria 1257
563 Ga0207667_10000043 3300025949 Bacteria 261426
564 Ga0207667_10025668 3300025949 Bacteria 6448
565 Ga0207667_10066892 3300025949 Bacteria 3745
566 Ga0207667_10268643 3300025949 Bacteria 1744
567 Ga0207651_10031644 3300025960 Bacteria 3385
568 Ga0207651_10062810 3300025960 Bacteria 2590
569 Ga0207712_10002826 3300025961 Bacteria 11123
570 Ga0207712_10046807 3300025961 Bacteria 3000
571 Ga0207712_10188467 3300025961 Bacteria 1626
572 Ga0207712_10328714 3300025961 Bacteria 1264
573 Ga0207668_10257076 3300025972 Bacteria 1421
574 Ga0207668_10272165 3300025972 Bacteria 1385
575 Ga0207640_10000012 3300025981 Bacteria 242060
576 Ga0207640_10007512 3300025981 Bacteria 6019
577 Ga0207640_10567072 3300025981 Bacteria 956
578 Ga0207658_10000212 3300025986 Bacteria 60851
579 Ga0207658_10006064 3300025986 Bacteria 8255
580 Ga0207658_10030972 3300025986 Bacteria 3794
581 Ga0207658_10136734 3300025986 Bacteria 1977
582 Ga0207658_10534647 3300025986 Bacteria 1047
583 Ga0207677_10007613 3300026023 Bacteria 6007
584 Ga0207677_10086434 3300026023 Bacteria 2267
585 Ga0207677_10107251 3300026023 Bacteria 2071
586 Ga0207677_10195898 3300026023 Bacteria 1602
587 Ga0207677_10267004 3300026023 Bacteria 1398
588 Ga0207703_10002429 3300026035 Bacteria 16148
589 Ga0207703_10003032 3300026035 Bacteria 14219
590 Ga0207703_10009710 3300026035 Bacteria 7551
591 Ga0207703_10413025 3300026035 Bacteria 1254
592 Ga0207639_10054234 3300026041 Bacteria 3063
593 Ga0207639_10151752 3300026041 Bacteria 1941
594 Ga0207639_10166052 3300026041 Bacteria 1865
595 Ga0207678_10000009 3300026067 Bacteria 156690
596 Ga0207678_10006113 3300026067 Bacteria 10709
597 Ga0207678_10063109 3300026067 Bacteria 3184
598 Ga0207678_10584938 3300026067 Bacteria 978
599 Ga0207708_10043164 3300026075 Bacteria 3437
600 Ga0207702_10000028 3300026078 Bacteria 183005
601 Ga0207641_10009276 3300026088 Bacteria 8114
602 Ga0207641_10097769 3300026088 Bacteria 2581
603 Ga0207641_10153136 3300026088 Bacteria 2089
604 Ga0207641_10205166 3300026088 Bacteria 1820
605 Ga0207641_10396913 3300026088 Bacteria 1323
606 Ga0207648_10000054 3300026089 Bacteria 106684
607 Ga0207648_10005336 3300026089 Bacteria 12956
608 Ga0207648_10008160 3300026089 Bacteria 10182
609 Ga0207648_10037529 3300026089 Bacteria 4268
610 Ga0207648_10120747 3300026089 Bacteria 2304
611 Ga0207648_10142370 3300026089 Bacteria 2114
612 Ga0207648_10251892 3300026089 Bacteria 1574
613 Ga0207676_10039147 3300026095 Bacteria 3624
614 Ga0207676_10044261 3300026095 Bacteria 3433
615 Ga0207676_10057970 3300026095 Bacteria 3052
616 Ga0207676_10075167 3300026095 Bacteria 2724
617 Ga0207676_10078899 3300026095 Bacteria 2668
618 Ga0207676_10083234 3300026095 Bacteria 2605
619 Ga0207676_10296744 3300026095 Bacteria 1474
620 Ga0207674_10010925 3300026116 Bacteria 10218
621 Ga0207674_10068252 3300026116 Bacteria 3578
622 Ga0207674_10093730 3300026116 Bacteria 2991
623 Ga0207674_10336626 3300026116 Bacteria 1459
624 Ga0207674_10573987 3300026116 Bacteria 1089
625 Ga0207675_100000177 3300026118 Bacteria 57433
626 Ga0207675_100002649 3300026118 Bacteria 17661
627 Ga0207675_100006060 3300026118 Bacteria 11505
628 Ga0207683_10011037 3300026121 Bacteria 7699
629 Ga0207683_10056721 3300026121 Bacteria 3437
630 Ga0207683_10105509 3300026121 Bacteria 2519
631 Ga0207683_10125588 3300026121 Bacteria 2305
632 Ga0207698_10005873 3300026142 Bacteria 7627
633 Ga0207698_10006654 3300026142 Bacteria 7222
634 Ga0207698_10016463 3300026142 Bacteria 4985
635 Ga0207698_10040883 3300026142 Bacteria 3450
636 Ga0207698_10104678 3300026142 Bacteria 2355
637 Ga0209281_1007147 3300027111 Bacteria 2821
638 Ga0209389_1006254 3300027296 Bacteria 10313
639 Ga0209996_1007401 3300027395 Bacteria 1427
640 Ga0209968_1000442 3300027526 Bacteria 6685
641 Ga0209282_1000021 3300027666 Bacteria 177705
642 Ga0209813_10097025 3300027866 Bacteria 998
643 Ga0209974_10090038 3300027876 Bacteria 1063
644 Ga0207428_10174560 3300027907 Bacteria 1626
645 Ga0268266_10254014 3300028379 Bacteria 1627
646 Ga0268266_10280483 3300028379 Bacteria 1549
647 Ga0268266_10421137 3300028379 Bacteria 1265
648 Ga0268265_10038444 3300028380 Bacteria 3520
649 Ga0268265_10042591 3300028380 Bacteria 3370
650 Ga0268265_10089362 3300028380 Bacteria 2457
651 Ga0268265_10103325 3300028380 Bacteria 2307
652 Ga0268264_10004393 3300028381 Bacteria 12027
653 Ga0268264_10020354 3300028381 Bacteria 5422
654 Ga0307517_10012331 3300028786 Bacteria 11744
655 Ga0307517_10142360 3300028786 Bacteria 1678
656 Ga0307515_10000089 3300028794 Bacteria 215736
657 Ga0307515_10000096 3300028794 Bacteria 206366
658 Ga0307515_10007484 3300028794 Bacteria 21573
659 Ga0307515_10041885 3300028794 Bacteria 7185
660 Ga0307515_10080610 3300028794 Bacteria 4242
661 Ga0307515_10089153 3300028794 Bacteria 3888
662 Ga0307515_10297510 3300028794 Bacteria 1302
663 Ga0265338_10000258 3300028800 Bacteria 96517
664 Ga0265338_10001135 3300028800 Bacteria 44081
665 Ga0265324_10002038 3300029957 Bacteria 10739
666 Ga0265324_10035527 3300029957 Bacteria 1735
667 Ga0307512_10051922 3300030522 Bacteria 3275
668 Ga0307512_10052334 3300030522 Bacteria 3257
669 Ga0265332_10049707 3300031238 Bacteria 1803
670 Ga0265328_10006255 3300031239 Bacteria 5058
671 Ga0265325_10010371 3300031241 Bacteria 5400
672 Ga0265331_10006099 3300031250 Bacteria 7172
673 Ga0265327_10000080 3300031251 Bacteria 206086
674 Ga0265327_10017033 3300031251 Bacteria 4581
675 Ga0265316_10309929 3300031344 Bacteria 1148
676 Ga0265316_10326724 3300031344 Bacteria 1113
677 Ga0307513_10005057 3300031456 Bacteria 17459
678 Ga0307513_10016545 3300031456 Bacteria 8890
679 Ga0307513_10035292 3300031456 Bacteria 5596
680 Ga0307509_10000032 3300031507 Bacteria 202919
681 Ga0307509_10001647 3300031507 Bacteria 37422
682 Ga0307509_10006706 3300031507 Bacteria 15360
683 Ga0307509_10013664 3300031507 Bacteria 9594
684 Ga0307408_100000006 3300031548 Bacteria 472824
685 Ga0307408_100037196 3300031548 Bacteria 3427
686 Ga0307408_100051736 3300031548 Bacteria 2960
687 Ga0307508_10000028 3300031616 Bacteria 168639
688 Ga0307508_10001377 3300031616 Bacteria 27383
689 Ga0307508_10065069 3300031616 Bacteria 3213
690 Ga0316575_10000063 3300031665 Bacteria 26008
691 Ga0265314_10003091 3300031711 Bacteria 16392
692 Ga0265314_10032720 3300031711 Bacteria 3821
693 Ga0265314_10043851 3300031711 Bacteria 3175
694 Ga0265314_10166143 3300031711 Bacteria 1337
695 Ga0307516_10001972 3300031730 Bacteria 28094
696 Ga0307516_10177718 3300031730 Bacteria 1864
697 Ga0307405_10028317 3300031731 Bacteria 3261
698 Ga0307405_10089539 3300031731 Bacteria 2033
699 Ga0307405_10413528 3300031731 Bacteria 1059
700 Ga0307413_10052421 3300031824 Bacteria 2464
701 Ga0307407_10442262 3300031903 Bacteria 942
702 Ga0307412_10034330 3300031911 Bacteria 3233
703 Ga0307412_10117010 3300031911 Bacteria 1913
704 Ga0307409_100019603 3300031995 Bacteria 4585
705 Ga0307409_100084584 3300031995 Bacteria 2576
706 Ga0307409_100336573 3300031995 Bacteria 1418
707 Ga0307416_100017160 3300032002 Bacteria 5055
708 Ga0307416_100032323 3300032002 Bacteria 3952
709 Ga0307416_100243962 3300032002 Bacteria 1743
710 Ga0307414_10042417 3300032004 Bacteria 3091
711 Ga0307414_10333943 3300032004 Bacteria 1295
712 Ga0307414_10608346 3300032004 Bacteria 981
713 Ga0307411_10000288 3300032005 Bacteria 16790
714 Ga0307411_10006128 3300032005 Bacteria 5982
715 Ga0307411_10008111 3300032005 Bacteria 5415
716 Ga0307411_10329331 3300032005 Bacteria 1237
717 Ga0307415_100109353 3300032126 Bacteria 2047
718 Ga0307510_10038927 3300033180 Bacteria 5248
719 Ga0307510_10060241 3300033180 Bacteria 3909
720 Ga0307510_10094301 3300033180 Bacteria 2819
721 Ga0307510_10249400 3300033180 Bacteria 1264
722 Ga0307510_10251756 3300033180 Bacteria 1254
723 Ga0373934_0074756 3300035086 Bacteria 1358
724 Ga0373940_0013736 3300035088 Bacteria 1966
725 Ga0373932_0065646 3300035112 Bacteria 1113
726 Ga0373939_0000019 3300035114 Bacteria 59562
727 Ga0373954_0012937 3300035118 Bacteria 3715
728 Ga0373960_0000625 3300035121 Bacteria 7251
729 Ga0373943_0211349 3300035170 Bacteria 1077
730 Ga0373946_0062880 3300035171 Bacteria 1584
731 Ga0373931_0000679 3300035691 Bacteria 14119
732 Ga0373931_0048610 3300035691 Bacteria 2249
733 Ga0373947_0043758 3300035725 Bacteria 2675
734 Ga0373937_0073412 3300036401 Bacteria 3156
735 Ga0373937_0084748 3300036401 Bacteria 2932
736 Ga0373937_0094160 3300036401 Bacteria 2777
737 Ga0373925_0003513 3300037068 Bacteria 12109
738 Ga0395899_0004383 3300037312 Bacteria 11004
739 Ga0395899_0175410 3300037312 Bacteria 1508
740 Ga0395900_0013773 3300037418 Bacteria 8255
741 Ga0395900_0124976 3300037418 Bacteria 2638
742 Ga0395900_0195119 3300037418 Bacteria 2052
743 Ga0395900_0228891 3300037418 Bacteria 1870
744 Ga0395900_0452826 3300037418 Bacteria 1239
745 Ga0395898_0012659 3300037466 Bacteria 8720
746 Ga0395898_0021873 3300037466 Bacteria 6479
747 Ga0395898_0227363 3300037466 Bacteria 1780
748 Ga0395905_0000176 3300037471 Bacteria 102060
749 Ga0395905_0001424 3300037471 Bacteria 28863
750 Ga0395905_0001639 3300037471 Bacteria 26517
751 Ga0395905_0003250 3300037471 Bacteria 17474
752 Ga0395905_0056444 3300037471 Bacteria 3674
753 Ga0395905_0099973 3300037471 Bacteria 2723
754 Ga0395905_0182943 3300037471 Bacteria 1967
755 Ga0395905_0342059 3300037471 Bacteria 1387
756 Ga0436364_1473161 3300037853 Bacteria 2163
757 Ga0395901_0007843 3300038443 Bacteria 10769
758 Ga0395901_0081520 3300038443 Bacteria 3379
759 Ga0395901_0125401 3300038443 Bacteria 2698
760 Ga0395901_0258231 3300038443 Bacteria 1814
761 Ga0400491_02286 3300038727 Bacteria 1850
762 Ga0436361_0004926 3300039447 Bacteria 16512
763 Ga0436361_0027317 3300039447 Bacteria 79578
764 Ga0436361_0046388 3300039447 Bacteria 28554
765 Ga0436361_0799645 3300039447 Bacteria 27063
766 Ga0436361_0968600 3300039447 Bacteria 8144
767 Ga0436361_1048468 3300039447 Bacteria 939
768 Ga0436362_0709755 3300039453 Bacteria 1463
769 Ga0439436_0079053 3300041404 Bacteria 916
770 Ga0439453_0018184 3300041408 Bacteria 1241
771 Ga0439461_0007811 3300041410 Bacteria 1906
772 Ga0439461_0019390 3300041410 Bacteria 1339
773 Ga0451847_0330048 3300041503 Bacteria 1222
774 Ga0451853_3142898 3300041512 Bacteria 3143
775 Ga0451853_3427827 3300041512 Bacteria 957
776 Ga0450917_000993 3300042120 Bacteria 2095
777 Ga0450888_000191 3300042126 Bacteria 5385
778 Ga0450890_009711 3300042127 Bacteria 1236
779 Ga0450897_005099 3300042128 Bacteria 1125
780 Ga0450891_000071 3300042129 Bacteria 8281
781 Ga0450903_020238 3300042138 Bacteria 1029
782 Ga0450904_008647 3300042139 Bacteria 1005
783 Ga0450905_004917 3300042142 Bacteria 1787
784 Ga0450889_000069 3300042144 Bacteria 9191
785 Ga0439446_0014075 3300042156 Bacteria 2203
786 Ga0450909_009486 3300042185 Bacteria 1421
787 Ga0439459_0001762 3300042438 Bacteria 3239
788 Ga0439460_0012999 3300042461 Bacteria 2171
789 Ga0450893_0001280 3300042532 Bacteria 3804
790 Ga0451577_0000002 3300042876 Bacteria 1731375
791 Ga0451577_0001738 3300042876 Bacteria 28073
792 Ga0451577_0002438 3300042876 Bacteria 22187
793 Ga0451577_0022885 3300042876 Bacteria 5703
794 Ga0451577_0033629 3300042876 Bacteria 4622
795 Ga0451577_0174819 3300042876 Bacteria 1935
796 Ga0451577_0235067 3300042876 Bacteria 1657
797 Ga0451577_0273374 3300042876 Bacteria 1530
798 Ga0451577_0273461 3300042876 Bacteria 1530
799 Ga0451577_0312740 3300042876 Bacteria 1424
800 Ga0451577_0344687 3300042876 Bacteria 1351
801 Ga0451577_0395006 3300042876 Bacteria 1255
802 Ga0451577_0583350 3300042876 Bacteria 1015
803 Ga0466986_0063558 3300044650 Bacteria 2556
804 Ga0466969_0000929 3300044656 Bacteria 15821
805 Ga0466969_0044748 3300044656 Bacteria 2200
806 Ga0466977_0000690 3300044666 Bacteria 11950
807 Ga0453683_0000013 3300044673 Bacteria 371932
808 Ga0466965_0000237 3300044683 Bacteria 17680
809 Ga0466966_0002735 3300044684 Bacteria 11583
810 Ga0466966_0120370 3300044684 Bacteria 1613
811 Ga0466961_0012022 3300044693 Bacteria 5531
812 Ga0466961_0142232 3300044693 Bacteria 1501
813 Ga0466963_0016316 3300044694 Bacteria 4617
814 Ga0466963_0031985 3300044694 Bacteria 3403
815 Ga0453684_0000002 3300044712 Bacteria 1731375
816 Ga0453684_0005486 3300044712 Bacteria 25079
817 Ga0453684_0008430 3300044712 Bacteria 18462
818 Ga0453684_0034698 3300044712 Bacteria 6993
819 Ga0453684_0042904 3300044712 Bacteria 6088
820 Ga0453684_0093099 3300044712 Bacteria 3713
821 Ga0453684_0117420 3300044712 Bacteria 3220
822 Ga0453684_0159885 3300044712 Bacteria 2666
823 Ga0453684_0316764 3300044712 Bacteria 1768
824 Ga0453684_0454880 3300044712 Bacteria 1424
825 Ga0466971_0002984 3300044719 Bacteria 7188
826 Ga0466968_0004214 3300044735 Bacteria 5360
827 Ga0466970_0027008 3300044765 Bacteria 3010
828 Ga0466957_0000447 3300044842 Bacteria 20382
829 Ga0466957_0125266 3300044842 Bacteria 1641
830 Ga0466959_0027748 3300045049 Bacteria 4198
831 Ga0466959_0073287 3300045049 Bacteria 2477
832 Ga0451576_0000037 3300045051 Bacteria 372173
833 Ga0451576_0001760 3300045051 Bacteria 35546
834 Ga0451576_0002464 3300045051 Bacteria 27543
835 Ga0451576_0009103 3300045051 Bacteria 11553
836 Ga0451576_0015201 3300045051 Bacteria 8539
837 Ga0451576_0021486 3300045051 Bacteria 7014
838 Ga0451576_0111564 3300045051 Bacteria 2846
839 Ga0451576_0118778 3300045051 Bacteria 2752
840 Ga0451576_0168250 3300045051 Bacteria 2287
841 Ga0451576_0202520 3300045051 Bacteria 2073
842 Ga0451576_0261405 3300045051 Bacteria 1809
843 Ga0466958_0090299 3300045836 Bacteria 1895
844 Ga0466958_0151304 3300045836 Bacteria 1464
845 Ga0466967_0546697 3300045976 Bacteria 1140
846 Ga0495592_0019120 3300046454 Bacteria 5212
847 Ga0495592_0034924 3300046454 Bacteria 3789
848 Ga0495592_0188472 3300046454 Bacteria 1399
849 Ga0495590_0003935 3300046457 Bacteria 6041
850 Ga0495590_0036912 3300046457 Bacteria 1704
851 Ga0495590_0062264 3300046457 Bacteria 1306
852 Ga0495629_0047432 3300046459 Bacteria 3013
853 Ga0495638_0062244 3300046460 Bacteria 2304
854 Ga0495651_0005769 3300046462 Bacteria 9446
855 Ga0495651_0072318 3300046462 Bacteria 2619
856 Ga0495651_0221611 3300046462 Bacteria 1308
857 Ga0495653_0034300 3300046463 Bacteria 4015
858 Ga0495650_0024295 3300046471 Bacteria 2864
859 Ga0495650_0061097 3300046471 Bacteria 1511
860 Ga0495582_0042043 3300046473 Bacteria 2518
861 Ga0495605_0006736 3300046474 Bacteria 6569
862 Ga0495605_0061328 3300046474 Bacteria 1800
863 Ga0495664_0325460 3300046477 Bacteria 927
864 Ga0495584_0010102 3300046491 Bacteria 4847
865 Ga0495596_0000385 3300046500 Bacteria 28186
866 Ga0495596_0134958 3300046500 Bacteria 958
867 Ga0495607_0077829 3300046501 Bacteria 1831
868 Ga0495583_0040632 3300046506 Bacteria 2183
869 Ga0495606_0012870 3300046507 Bacteria 6663
870 Ga0495608_0265627 3300046511 Bacteria 1067
871 Ga0495610_0009756 3300046512 Bacteria 6036
872 Ga0495616_0003889 3300046513 Bacteria 9515
873 Ga0495620_0031763 3300046515 Bacteria 2415
874 Ga0495628_0001234 3300046516 Bacteria 23412
875 Ga0495628_0048653 3300046516 Bacteria 3360
876 Ga0495628_0064766 3300046516 Bacteria 2861
877 Ga0495630_0041291 3300046517 Bacteria 3444
878 Ga0495632_0009387 3300046519 Bacteria 5903
879 Ga0495642_0022222 3300046528 Bacteria 2499
880 Ga0495642_0033764 3300046528 Bacteria 2058
881 Ga0495652_0123393 3300046529 Bacteria 2062
882 Ga0495652_0223499 3300046529 Bacteria 1413
883 Ga0495609_0000136 3300046538 Bacteria 77986
884 Ga0495609_0001940 3300046538 Bacteria 13168
885 Ga0495609_0068091 3300046538 Bacteria 1567
886 Ga0495621_0006088 3300046539 Bacteria 3504
887 Ga0495597_0012048 3300046542 Bacteria 4179
888 Ga0495645_0026599 3300046543 Bacteria 4201
889 Ga0495633_0040028 3300046558 Bacteria 2235
890 Ga0495667_0129864 3300046559 Bacteria 1626
891 Ga0495668_0000029 3300046616 Bacteria 279128
892 Ga0495668_0033309 3300046616 Bacteria 2895
893 Ga0495668_0085564 3300046616 Bacteria 1729
894 Ga0495625_0002966 3300046660 Bacteria 17641
895 Ga0495625_0022770 3300046660 Bacteria 4795
896 Ga0495625_0033839 3300046660 Bacteria 3775
897 Ga0495635_0061843 3300046663 Bacteria 2571
898 Ga0495646_0004580 3300046680 Bacteria 8715
899 Ga0495646_0070868 3300046680 Bacteria 2052
900 Ga0495647_0068643 3300046681 Bacteria 1414
901 Ga0495669_0001803 3300046684 Bacteria 8750
902 Ga0495670_0026463 3300046691 Bacteria 2871
903 Ga0495671_0125627 3300046692 Bacteria 1251
904 Ga0495649_0000541 3300046694 Bacteria 32077
905 Ga0495649_0059878 3300046694 Bacteria 2049
906 Ga0495589_0071998 3300046794 Bacteria 1689
907 Ga0495600_0065179 3300046809 Bacteria 2381
908 Ga0495600_0110953 3300046809 Bacteria 1786
909 Ga0495660_0063546 3300046810 Bacteria 1976
910 Ga0495660_0108014 3300046810 Bacteria 1423
911 Ga0495604_0149320 3300047317 Bacteria 1662
912 Ga0495636_0008030 3300047318 Bacteria 4160
913 Ga0495636_0022950 3300047318 Bacteria 2524
914 Ga0495674_0013839 3300047319 Bacteria 7573
915 Ga0495683_0196721 3300047323 Bacteria 911
916 Ga0495687_001991 3300047443 Bacteria 17372
917 Ga0495687_006560 3300047443 Bacteria 7098
918 Ga0495687_014896 3300047443 Bacteria 3974
919 Ga0495687_062118 3300047443 Bacteria 1534
920 Ga0495679_006268 3300047446 Bacteria 5148
921 Ga0495685_008022 3300047447 Bacteria 3497
922 Ga0495673_0146820 3300047469 Bacteria 915
923 Ga0495681_0014798 3300047470 Bacteria 4451
924 Ga0495684_0062323 3300047471 Bacteria 2837
925 Ga0495686_0007111 3300047472 Bacteria 8434
926 Ga0495593_0056385 3300047673 Bacteria 2066
927 Ga0495602_0144374 3300048088 Bacteria 1880
928 Ga0495602_0170371 3300048088 Bacteria 1690
929 Ga0495626_0089455 3300048091 Bacteria 1356
930 Ga0496100_0023701 3300048903 Bacteria 3733
931 Ga0496100_0503784 3300048903 Bacteria 933
932 Ga0496101_0013511 3300048904 Bacteria 5473
933 Ga0496101_0195147 3300048904 Bacteria 1564
934 Ga0496102_0027430 3300048905 Bacteria 5085
935 Ga0496102_0033963 3300048905 Bacteria 4587
936 Ga0496103_0055059 3300048906 Bacteria 2466
937 Ga0496104_0044408 3300048907 Bacteria 4175
938 Ga0496104_0215855 3300048907 Bacteria 1830
939 Ga0496104_0279502 3300048907 Bacteria 1582
940 Ga0496104_0314276 3300048907 Bacteria 1479
941 Ga0496104_0481158 3300048907 Bacteria 1153
942 Ga0496105_0110051 3300048908 Bacteria 2274
943 Ga0496106_0000011 3300048909 Bacteria 222845
944 Ga0496106_0006072 3300048909 Bacteria 8940
945 Ga0496106_0459919 3300048909 Bacteria 1022
946 Ga0496107_0141916 3300048910 Bacteria 1775
947 Ga0496107_0208243 3300048910 Bacteria 1454
948 Ga0496108_0017021 3300048911 Bacteria 5942
949 Ga0496109_0129150 3300048912 Bacteria 2358
950 Ga0496110_0007472 3300048913 Bacteria 8735
951 Ga0496111_0205344 3300048914 Bacteria 1464
952 Ga0496111_0345940 3300048914 Bacteria 1101
953 Ga0496113_0043484 3300048916 Bacteria 3325
954 Ga0496114_0007646 3300048917 Bacteria 8547
955 Ga0496114_0164755 3300048917 Bacteria 1929
956 Ga0496114_0255612 3300048917 Bacteria 1542
957 Ga0496115_0007917 3300048918 Bacteria 7839
958 Ga0496116_0021901 3300048919 Bacteria 4806
959 Ga0496117_0028852 3300048920 Bacteria 4289
960 Ga0496118_0041792 3300048921 Bacteria 3625
961 Ga0496118_0101239 3300048921 Bacteria 1946
962 Ga0496118_0156283 3300048921 Bacteria 1418
963 Ga0496119_0110012 3300048922 Bacteria 1531
964 Ga0496121_0010887 3300048924 Bacteria 10167
965 Ga0496121_0023777 3300048924 Bacteria 5885
966 Ga0496121_0042796 3300048924 Bacteria 3933
967 Ga0496121_0137378 3300048924 Bacteria 1819
968 Ga0496121_0265552 3300048924 Bacteria 1182
969 Ga0496122_0003149 3300048925 Bacteria 22078
970 Ga0496122_0021327 3300048925 Bacteria 5804
971 Ga0496123_0000916 3300048926 Bacteria 46316
972 Ga0496123_0027948 3300048926 Bacteria 4187
973 Ga0496124_0066161 3300048927 Bacteria 3011
974 Ga0496125_0004292 3300048928 Bacteria 16553
975 Ga0496126_0002068 3300048929 Bacteria 28159
976 Ga0496126_0026637 3300048929 Bacteria 5540
977 Ga0496126_0194871 3300048929 Bacteria 1714
978 Ga0495682_0084323 3300049460 Bacteria 1142
979 Ga0501292_005344 3300049515 Bacteria 1789
980 Ga0501297_000437 3300049520 Bacteria 3798
981 Ga0501297_001705 3300049520 Bacteria 2052
982 Ga0501300_005125 3300049523 Bacteria 1939
983 Ga0501318_005591 3300049534 Bacteria 1253
984 Ga0501034_0000092 3300049571 Bacteria 164224
985 Ga0501043_0000058 3300049579 Bacteria 102030
986 Ga0501043_0104737 3300049579 Bacteria 2223
987 Ga0501043_0257990 3300049579 Bacteria 1341
988 Ga0501046_0000051 3300049580 Bacteria 133545
989 Ga0501046_0037420 3300049580 Bacteria 3899
990 Ga0501047_0000003 3300049581 Bacteria 508375
991 Ga0501047_0027508 3300049581 Bacteria 5479
992 Ga0501048_0000321 3300049582 Bacteria 32907
993 Ga0501198_000007 3300049649 Bacteria 129700
994 Ga0501211_001859 3300049658 Bacteria 2253
995 Ga0501222_000005 3300049662 Bacteria 129724
996 Ga0501222_000600 3300049662 Bacteria 5290
997 Ga0501223_008762 3300049663 Bacteria 2060
998 Ga0501235_006815 3300049669 Bacteria 2486
999 Ga0501221_000150 3300049704 Bacteria 9308
1000 Ga0501225_0018533 3300049705 Bacteria 1929
1001 Ga0501232_001083 3300049757 Bacteria 2058
1002 Ga0501262_001378 3300049759 Bacteria 2726
1003 Ga0501265_001507 3300049762 Bacteria 2618
1004 Ga0501267_001311 3300049764 Bacteria 2112
1005 Ga0501272_004940 3300049769 Bacteria 1395
1006 Ga0501282_006018 3300049778 Bacteria 1298
1007 Ga0501283_005329 3300049779 Bacteria 1766
1008 Ga0501035_0007072 3300049822 Bacteria 10489
1009 Ga0501035_0208416 3300049822 Bacteria 1673
1010 Ga0501044_0013104 3300049823 Bacteria 8975
1011 Ga0501044_0273189 3300049823 Bacteria 1625
1012 Ga0501045_0075630 3300049824 Bacteria 2480
1013 Ga0501045_0312017 3300049824 Bacteria 1170
1014 nmdc:mga03683_113732_c1 3300050489 Bacteria 1199
1015 nmdc:mga03683_41512_c1 3300050489 Bacteria 1890
1016 nmdc:mga0yw44_64903_c1 3300050492 Bacteria 2248
1017 nmdc:mga0k408_121887_c1 3300050493 Bacteria 1544
1018 nmdc:mga0k408_19056_c1 3300050493 Bacteria 3832
1019 nmdc:mga0k408_20391_c1 3300050493 Bacteria 2752
1020 nmdc:mga0k408_23723_c1 3300050493 Bacteria 3464
1021 nmdc:mga0k408_30466_c1 3300050493 Bacteria 3076
1022 nmdc:mga0k408_370_c1 3300050493 Bacteria 24649
1023 nmdc:mga0k408_4315_c1 3300050493 Bacteria 7552
1024 nmdc:mga06z11_181621_c1 3300050494 Bacteria 1213
1025 nmdc:mga06z11_34181_c1 3300050494 Bacteria 2494
1026 nmdc:mga06z11_80032_c1 3300050494 Bacteria 1751
1027 nmdc:mga04h51_9044_c1 3300050495 Bacteria 2685
1028 nmdc:mga07m45_110530_c1 3300050496 Bacteria 1583
1029 nmdc:mga07m45_14825_c1 3300050496 Bacteria 2056
1030 nmdc:mga07m45_1517_c1 3300050496 Bacteria 10644
1031 nmdc:mga07m45_18156_c1 3300050496 Bacteria 3791
1032 nmdc:mga07m45_25005_c1 3300050496 Bacteria 1239
1033 nmdc:mga07m45_32728_c1 3300050496 Bacteria 2884
1034 nmdc:mga07m45_43356_c1 3300050496 Bacteria 2522
1035 nmdc:mga07m45_54331_c1 3300050496 Bacteria 2264
1036 nmdc:mga07m45_61286_c1 3300050496 Bacteria 2131
1037 nmdc:mga07m45_7007_c1 3300050496 Bacteria 5734
1038 nmdc:mga09592_176549_c1 3300050508 Bacteria 1847
1039 nmdc:mga09592_819_c1 3300050508 Bacteria 24059
1040 nmdc:mga0qj67_191552_c1 3300050509 Bacteria 1662
1041 nmdc:mga0sz30_26990_c2 3300050516 Bacteria 1999
1042 Ga0495601_0055940 3300053077 Bacteria 2498
1043 Ga0495612_0039580 3300053078 Bacteria 1918
1044 Ga0495595_0057445 3300053084 Bacteria 1815
1045 Ga0500647_0117247 3300053091 Bacteria 1262
1046 Ga0500583_0104323 3300053092 Bacteria 1391
1047 Ga0500651_0080149 3300053093 Bacteria 2022
1048 Ga0500650_0073375 3300053098 Bacteria 1600
1049 Ga0500593_001896 3300053117 Bacteria 7524
1050 Ga0500593_007810 3300053117 Bacteria 4373
1051 Ga0500594_0001004 3300053118 Bacteria 6050
1052 Ga0500595_003933 3300053119 Bacteria 6805
1053 Ga0500618_000765 3300053125 Bacteria 18166
1054 Ga0500618_001461 3300053125 Bacteria 10499
1055 Ga0500658_0008109 3300053134 Bacteria 3883
1056 Ga0500559_0000694 3300053136 Bacteria 22155
1057 Ga0500564_019933 3300053138 Bacteria 3069
1058 Ga0500568_0033439 3300053139 Bacteria 2109
1059 Ga0500590_023706 3300053148 Bacteria 3185
1060 Ga0500619_003712 3300053154 Bacteria 3171
1061 Ga0500622_0002460 3300053156 Bacteria 13355
1062 Ga0500622_0005187 3300053156 Bacteria 7891
1063 Ga0500587_003270 3300053739 Bacteria 2274
1064 Ga0587098_001158 3300059604 Bacteria 1938
1065 Ga0587067_000132 3300059640 Bacteria 5020
1066 Ga0587072_000426 3300059643 Bacteria 4190
1067 Ga0530510_0350864 3300061734 Bacteria 1108

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0175410 Ga0395899_0175410_62_904 252
2 3300037418 Ga0395900_0195119 Ga0395900_0195119_88_930 252
3 3300037466 Ga0395898_0227363 Ga0395898_0227363_453_1295 252
4 3300028794 Ga0307515_10000096 Ga0307515_1000009663 261
5 3300025931 Ga0207644_10386487 Ga0207644_103864871 268
6 3300005327 Ga0070658_10561836 Ga0070658_105618361 270
7 3300005331 Ga0070670_100139592 Ga0070670_1001395921 270
8 3300005334 Ga0068869_100035950 Ga0068869_1000359503 270
9 3300005335 Ga0070666_10143697 Ga0070666_101436972 270
10 3300005338 Ga0068868_100002885 Ga0068868_1000028854 270
11 3300005339 Ga0070660_100062262 Ga0070660_1000622623 270
12 3300005340 Ga0070689_100262479 Ga0070689_1002624791 270
13 3300005354 Ga0070675_100000692 Ga0070675_10000069222 270
14 3300005355 Ga0070671_100103137 Ga0070671_1001031373 270
15 3300005365 Ga0070688_100072165 Ga0070688_1000721653 270
16 3300005367 Ga0070667_100003264 Ga0070667_1000032644 270
17 3300005456 Ga0070678_100064650 Ga0070678_1000646501 270
18 3300005457 Ga0070662_100076345 Ga0070662_1000763452 270
19 3300005459 Ga0068867_100203951 Ga0068867_1002039512 270
20 3300005544 Ga0070686_100247415 Ga0070686_1002474152 270
21 3300005547 Ga0070693_100032105 Ga0070693_1000321053 270
22 3300005563 Ga0068855_100147077 Ga0068855_1001470772 270
23 3300005616 Ga0068852_100006988 Ga0068852_1000069883 270
24 3300005617 Ga0068859_100120053 Ga0068859_1001200531 270
25 3300005618 Ga0068864_100000417 Ga0068864_10000041733 270
26 3300005834 Ga0068851_10008763 Ga0068851_100087634 270
27 3300005841 Ga0068863_100116242 Ga0068863_1001162423 270
28 3300005842 Ga0068858_100042716 Ga0068858_1000427164 270
29 3300006358 Ga0068871_100257770 Ga0068871_1002577702 270
30 3300006931 Ga0097620_100120048 Ga0097620_1001200481 270
31 3300009551 Ga0105238_10007405 Ga0105238_1000740511 270
32 3300013100 Ga0157373_10079106 Ga0157373_100791062 270
33 3300013105 Ga0157369_10019944 Ga0157369_1001994410 270
34 3300013296 Ga0157374_10253714 Ga0157374_102537142 270
35 3300013306 Ga0163162_10525009 Ga0163162_105250092 270
36 3300014325 Ga0163163_10205725 Ga0163163_102057253 270
37 3300014968 Ga0157379_10005918 Ga0157379_100059183 270
38 3300025321 Ga0207656_10007965 Ga0207656_100079653 270
39 3300025893 Ga0207682_10128893 Ga0207682_101288931 270
40 3300025903 Ga0207680_10048731 Ga0207680_100487313 270
41 3300025924 Ga0207694_10011272 Ga0207694_100112729 270
42 3300025926 Ga0207659_10033524 Ga0207659_100335243 270
43 3300025931 Ga0207644_10021105 Ga0207644_100211055 270
44 3300025933 Ga0207706_10067960 Ga0207706_100679604 270
45 3300025936 Ga0207670_10137759 Ga0207670_101377593 270
46 3300025941 Ga0207711_10469707 Ga0207711_104697072 270
47 3300025945 Ga0207679_10021183 Ga0207679_100211832 270
48 3300025986 Ga0207658_10006064 Ga0207658_100060647 270
49 3300026023 Ga0207677_10086434 Ga0207677_100864341 270
50 3300026035 Ga0207703_10009710 Ga0207703_100097101 270
51 3300026088 Ga0207641_10009276 Ga0207641_100092765 270
52 3300026095 Ga0207676_10075167 Ga0207676_100751673 270
53 3300026121 Ga0207683_10125588 Ga0207683_101255883 270
54 3300042876 Ga0451577_0395006 Ga0451577_0395006_310_1158 270
55 3300048909 Ga0496106_0459919 Ga0496106_0459919_98_949 270
56 3300048912 Ga0496109_0129150 Ga0496109_0129150_118_969 270
57 iso_pu_bacteria 2643221639 2644219799 270
58 3300044712 Ga0453684_0316764 Ga0453684_0316764_752_1600 271
59 3300045051 Ga0451576_0021486 Ga0451576_0021486_5130_5978 271
60 iso_pu_bacteria 2562617112 2563055625 271
61 iso_pu_bacteria 2643221544 2643744130 271
62 iso_pu_bacteria 2643221585 2643932397 271
63 iso_pu_bacteria 2643221646 2644256270 271
64 iso_pu_bacteria 2643221656 2644313648 271
65 iso_pu_bacteria 2711768613 2713478727 271
66 iso_pu_bacteria 2738541337 2739054699 271
67 iso_pu_bacteria 2738543013 2739249710 271
68 iso_pu_bacteria 2842711865 2842717422 271
69 iso_pu_bacteria 2886848708 2886849101 271
70 iso_pu_bacteria 2886848708 2886850283 271
71 iso_pu_bacteria 2886848708 2886850446 271
72 iso_pu_bacteria 2886848708 2886853446 271
73 iso_pu_bacteria 2921643360 2921653674 271
74 3300003187 JGI25151J46595_10012502 JGI25151J46595_100125023 272
75 3300005262 Ga0065165_1001544 Ga0065165_10015442 272
76 3300006195 Ga0075366_10065018 Ga0075366_100650183 272
77 3300025258 Ga0209129_1004031 Ga0209129_10040315 272
78 3300025294 Ga0209025_1002236 Ga0209025_10022363 272
79 3300025935 Ga0207709_10022617 Ga0207709_100226173 272
80 3300028786 Ga0307517_10142360 Ga0307517_101423602 272
81 3300031239 Ga0265328_10006255 Ga0265328_100062553 272
82 3300031250 Ga0265331_10006099 Ga0265331_100060994 272
83 3300031251 Ga0265327_10000080 Ga0265327_10000080111 272
84 3300041404 Ga0439436_0079053 Ga0439436_0079053_44_868 272
85 3300041408 Ga0439453_0018184 Ga0439453_0018184_19_843 272
86 3300042127 Ga0450890_009711 Ga0450890_009711_47_871 272
87 3300042128 Ga0450897_005099 Ga0450897_005099_73_897 272
88 3300042138 Ga0450903_020238 Ga0450903_020238_70_894 272
89 3300042139 Ga0450904_008647 Ga0450904_008647_126_950 272
90 3300042156 Ga0439446_0014075 Ga0439446_0014075_288_1112 272
91 3300042185 Ga0450909_009486 Ga0450909_009486_529_1353 272
92 3300042461 Ga0439460_0012999 Ga0439460_0012999_1181_2008 272
93 3300044684 Ga0466966_0120370 Ga0466966_0120370_519_1346 272
94 3300046538 Ga0495609_0068091 Ga0495609_0068091_517_1368 272
95 3300050493 nmdc:mga0k408_30466_c1 nmdc:mga0k408_30466_c1_1064_1915 272
96 3300050494 nmdc:mga06z11_181621_c1 nmdc:mga06z11_181621_c1_176_1027 272
97 3300050496 nmdc:mga07m45_18156_c1 nmdc:mga07m45_18156_c1_1915_2766 272
98 3300050508 nmdc:mga09592_176549_c1 nmdc:mga09592_176549_c1_304_1128 272
99 iso_pu_bacteria 2501025501 2501073722 272
100 iso_pu_bacteria 2501025502 2501078483 272
101 iso_pu_bacteria 2501025504 2501410241 272
102 iso_pu_bacteria 2510917013 2511090177 272
103 iso_pu_bacteria 2510917014 2511095559 272
104 iso_pu_bacteria 2510917015 2511102196 272
105 iso_pu_bacteria 2511231003 2511249570 272
106 iso_pu_bacteria 2511231026 2511384104 272
107 iso_pu_bacteria 2513237082 2513554616 272
108 iso_pu_bacteria 2513237083 2513563567 272
109 iso_pu_bacteria 2513237150 2513957329 272
110 iso_pu_bacteria 2513237165 2514044772 272
111 iso_pu_bacteria 2513237166 2514050637 272
112 iso_pu_bacteria 2515154123 2515688179 272
113 iso_pu_bacteria 2515154189 2516018595 272
114 iso_pu_bacteria 2521172590 2521560228 272
115 iso_pu_bacteria 2548876994 2550695367 272
116 iso_pu_bacteria 2551306416 2553005030 272
117 iso_pu_bacteria 2582581311 2585292034 272
118 iso_pu_bacteria 2585428057 2587725981 272
119 iso_pu_bacteria 2585428058 2587735643 272
120 iso_pu_bacteria 2588253510 2588292810 272
121 iso_pu_bacteria 2596583598 2597029377 272
122 iso_pu_bacteria 2599185178 2599447397 272
123 iso_pu_bacteria 2600255067 2600813160 272
124 iso_pu_bacteria 2643221592 2643967918 272
125 iso_pu_bacteria 2643221603 2644028182 272
126 iso_pu_bacteria 2643221625 2644143182 272
127 iso_pu_bacteria 2643221648 2644271730 272
128 iso_pu_bacteria 2721755763 2723875888 272
129 iso_pu_bacteria 2751185846 2753568769 272
130 iso_pu_bacteria 2765235838 2765571400 272
131 iso_pu_bacteria 2791355137 2792836902 272
132 iso_pu_bacteria 2808606386 2808982437 272
133 iso_pu_bacteria 2808606415 2809129736 272
134 iso_pu_bacteria 2808606419 2809149209 272
135 iso_pu_bacteria 2816332253 2817259609 272
136 iso_pu_bacteria 2816332256 2817277276 272
137 iso_pu_bacteria 2816332286 2817452248 272
138 iso_pu_bacteria 2818991445 2819592953 272
139 iso_pu_bacteria 2818991449 2819616585 272
140 iso_pu_bacteria 2831864461 2831867658 272
141 iso_pu_bacteria 2834641062 2834644221 272
142 iso_pu_bacteria 2839094727 2839098688 272
143 iso_pu_bacteria 2852618963 2852619350 272
144 iso_pu_bacteria 2856287931 2856292321 272
145 iso_pu_bacteria 2857357740 2857365466 272
146 iso_pu_bacteria 2858688981 2858698061 272
147 iso_pu_bacteria 2883087390 2883096222 272
148 iso_pu_bacteria 2884811622 2884812065 272
149 iso_pu_bacteria 2884836552 2884838535 272
150 iso_pu_bacteria 2884852848 2884854826 272
151 iso_pu_bacteria 2896154374 2896156505 272
152 iso_pu_bacteria 2901300506 2901304086 272
153 iso_pu_bacteria 2904439833 2904440731 272
154 iso_pu_bacteria 2904530477 2904535330 272
155 iso_pu_bacteria 2904584206 2904589191 272
156 iso_pu_bacteria 2904589729 2904594591 272
157 iso_pu_bacteria 2904601388 2904605818 272
158 iso_pu_bacteria 2919046199 2919048896 272
159 iso_pu_bacteria 2919079590 2919084099 272
160 iso_pu_bacteria 2923510766 2923513981 272
161 iso_pu_bacteria 2928058823 2928060769 272
162 iso_pu_bacteria 2928163908 2928170282 272
163 iso_pu_bacteria 644736347 644746524 272
164 iso_pu_bacteria 8003400568 8003401927 272
165 iso_pu_bacteria 8003955200 8003960314 272
166 iso_pu_bacteria 8020807995 8020812577 272
167 iso_pu_bacteria 8040167225 8040172493 272
168 iso_pu_bacteria 8040173305 8040177097 272
169 3300003316 rootH1_10009708 rootH1_1000970815 273
170 3300003316 rootH1_10046862 rootH1_100468622 273
171 3300003320 rootH2_10003807 rootH2_100038072 273
172 3300003322 rootL2_10001066 rootL2_100010663 273
173 3300003322 rootL2_10093618 rootL2_100936185 273
174 3300003759 Ga0055525_1000054 Ga0055525_1000054138 273
175 3300003771 Ga0055526_1007791 Ga0055526_10077913 273
176 3300003775 Ga0055524_1000550 Ga0055524_100055027 273
177 3300003794 Ga0055531_10000042 Ga0055531_1000004223 273
178 3300005262 Ga0065165_1000474 Ga0065165_100047447 273
179 3300005262 Ga0065165_1000621 Ga0065165_100062124 273
180 3300005337 Ga0070682_100064094 Ga0070682_1000640943 273
181 3300006353 Ga0075370_10000595 Ga0075370_1000059511 273
182 3300006353 Ga0075370_10027042 Ga0075370_100270423 273
183 3300006944 Ga0099823_1000559 Ga0099823_100055923 273
184 3300009148 Ga0105243_10107642 Ga0105243_101076423 273
185 3300010375 Ga0105239_10138089 Ga0105239_101380892 273
186 3300012497 Ga0157319_1000005 Ga0157319_1000005118 273
187 3300013307 Ga0157372_10107117 Ga0157372_101071174 273
188 3300021361 Ga0213872_10000861 Ga0213872_1000086119 273
189 3300021361 Ga0213872_10000883 Ga0213872_1000088312 273
190 3300021361 Ga0213872_10000982 Ga0213872_100009828 273
191 3300021361 Ga0213872_10007165 Ga0213872_100071655 273
192 3300025230 Ga0209563_100075 Ga0209563_10007558 273
193 3300025273 Ga0209673_1004669 Ga0209673_10046693 273
194 3300025273 Ga0209673_1009458 Ga0209673_10094583 273
195 3300025295 Ga0209564_1000021 Ga0209564_100002167 273
196 3300025298 Ga0209050_1001572 Ga0209050_10015729 273
197 3300025299 Ga0209256_1000309 Ga0209256_10003093 273
198 3300025299 Ga0209256_1012735 Ga0209256_10127353 273
199 3300025303 Ga0209051_1002025 Ga0209051_10020252 273
200 3300025303 Ga0209051_1003442 Ga0209051_10034424 273
201 3300025304 Ga0209257_1000016 Ga0209257_1000016255 273
202 3300025304 Ga0209257_1000981 Ga0209257_100098128 273
203 3300025304 Ga0209257_1003659 Ga0209257_10036592 273
204 3300025935 Ga0207709_10077907 Ga0207709_100779073 273
205 3300025972 Ga0207668_10272165 Ga0207668_102721652 273
206 3300026023 Ga0207677_10195898 Ga0207677_101958982 273
207 3300027296 Ga0209389_1006254 Ga0209389_10062548 273
208 3300028794 Ga0307515_10007484 Ga0307515_1000748410 273
209 3300028794 Ga0307515_10080610 Ga0307515_100806102 273
210 3300031456 Ga0307513_10016545 Ga0307513_100165453 273
211 3300031548 Ga0307408_100000006 Ga0307408_100000006360 273
212 3300031548 Ga0307408_100051736 Ga0307408_1000517362 273
213 3300031995 Ga0307409_100336573 Ga0307409_1003365732 273
214 3300032004 Ga0307414_10042417 Ga0307414_100424173 273
215 3300032005 Ga0307411_10000288 Ga0307411_100002883 273
216 3300033180 Ga0307510_10249400 Ga0307510_102494002 273
217 3300035114 Ga0373939_0000019 Ga0373939_0000019_31838_32677 273
218 3300035121 Ga0373960_0000625 Ga0373960_0000625_2965_3804 273
219 3300035691 Ga0373931_0000679 Ga0373931_0000679_13216_14055 273
220 3300037312 Ga0395899_0004383 Ga0395899_0004383_4433_5266 273
221 3300037418 Ga0395900_0013773 Ga0395900_0013773_2829_3662 273
222 3300037418 Ga0395900_0228891 Ga0395900_0228891_836_1663 273
223 3300037418 Ga0395900_0452826 Ga0395900_0452826_289_1116 273
224 3300037466 Ga0395898_0012659 Ga0395898_0012659_1630_2463 273
225 3300037466 Ga0395898_0021873 Ga0395898_0021873_3163_3990 273
226 3300037471 Ga0395905_0001424 Ga0395905_0001424_19323_20156 273
227 3300037471 Ga0395905_0001639 Ga0395905_0001639_17591_18424 273
228 3300037471 Ga0395905_0003250 Ga0395905_0003250_3777_4616 273
229 3300037471 Ga0395905_0342059 Ga0395905_0342059_421_1251 273
230 3300038443 Ga0395901_0007843 Ga0395901_0007843_2078_2911 273
231 3300038443 Ga0395901_0125401 Ga0395901_0125401_1313_2140 273
232 3300038443 Ga0395901_0258231 Ga0395901_0258231_667_1494 273
233 3300038727 Ga0400491_02286 Ga0400491_02286_363_1208 273
234 3300039447 Ga0436361_0027317 Ga0436361_0027317_53944_54825 273
235 3300039447 Ga0436361_0046388 Ga0436361_0046388_12820_13671 273
236 3300039447 Ga0436361_0799645 Ga0436361_0799645_15333_16190 273
237 3300039447 Ga0436361_0968600 Ga0436361_0968600_5145_5996 273
238 3300041410 Ga0439461_0007811 Ga0439461_0007811_400_1233 273
239 3300041512 Ga0451853_3142898 Ga0451853_3142898_710_1549 273
240 3300042120 Ga0450917_000993 Ga0450917_000993_197_1036 273
241 3300042126 Ga0450888_000191 Ga0450888_000191_3702_4541 273
242 3300042129 Ga0450891_000071 Ga0450891_000071_5313_6152 273
243 3300042142 Ga0450905_004917 Ga0450905_004917_302_1141 273
244 3300042144 Ga0450889_000069 Ga0450889_000069_7019_7858 273
245 3300042438 Ga0439459_0001762 Ga0439459_0001762_1249_2088 273
246 3300042532 Ga0450893_0001280 Ga0450893_0001280_2113_2952 273
247 3300042876 Ga0451577_0033629 Ga0451577_0033629_3508_4338 273
248 3300044694 Ga0466963_0016316 Ga0466963_0016316_3157_3996 273
249 3300044712 Ga0453684_0034698 Ga0453684_0034698_5032_5862 273
250 3300045051 Ga0451576_0168250 Ga0451576_0168250_866_1705 273
251 3300045836 Ga0466958_0151304 Ga0466958_0151304_40_867 273
252 3300046471 Ga0495650_0061097 Ga0495650_0061097_248_1087 273
253 3300046691 Ga0495670_0026463 Ga0495670_0026463_522_1361 273
254 3300048927 Ga0496124_0066161 Ga0496124_0066161_1902_2741 273
255 3300049520 Ga0501297_000437 Ga0501297_000437_597_1436 273
256 3300049523 Ga0501300_005125 Ga0501300_005125_855_1694 273
257 3300049534 Ga0501318_005591 Ga0501318_005591_396_1235 273
258 3300049579 Ga0501043_0257990 Ga0501043_0257990_444_1271 273
259 3300049580 Ga0501046_0037420 Ga0501046_0037420_554_1381 273
260 3300049581 Ga0501047_0027508 Ga0501047_0027508_72_899 273
261 3300049658 Ga0501211_001859 Ga0501211_001859_778_1617 273
262 3300049662 Ga0501222_000600 Ga0501222_000600_3840_4679 273
263 3300049663 Ga0501223_008762 Ga0501223_008762_758_1597 273
264 3300049669 Ga0501235_006815 Ga0501235_006815_851_1690 273
265 3300049704 Ga0501221_000150 Ga0501221_000150_6813_7652 273
266 3300049705 Ga0501225_0018533 Ga0501225_0018533_595_1434 273
267 3300049757 Ga0501232_001083 Ga0501232_001083_541_1380 273
268 3300049759 Ga0501262_001378 Ga0501262_001378_1093_1932 273
269 3300049762 Ga0501265_001507 Ga0501265_001507_730_1569 273
270 3300049764 Ga0501267_001311 Ga0501267_001311_377_1216 273
271 3300049769 Ga0501272_004940 Ga0501272_004940_309_1148 273
272 3300049778 Ga0501282_006018 Ga0501282_006018_92_931 273
273 3300049779 Ga0501283_005329 Ga0501283_005329_644_1483 273
274 3300049822 Ga0501035_0208416 Ga0501035_0208416_577_1404 273
275 3300049823 Ga0501044_0273189 Ga0501044_0273189_240_1067 273
276 3300050496 nmdc:mga07m45_1517_c1 nmdc:mga07m45_1517_c1_5663_6502 273
277 3300050496 nmdc:mga07m45_43356_c1 nmdc:mga07m45_43356_c1_105_944 273
278 3300050496 nmdc:mga07m45_61286_c1 nmdc:mga07m45_61286_c1_1177_2016 273
279 3300050496 nmdc:mga07m45_7007_c1 nmdc:mga07m45_7007_c1_155_994 273
280 3300053117 Ga0500593_001896 Ga0500593_001896_946_1788 273
281 3300053117 Ga0500593_007810 Ga0500593_007810_2392_3297 273
282 3300053156 Ga0500622_0002460 Ga0500622_0002460_1508_2347 273
283 iso_pu_bacteria 2894023352 2894024001 273
284 iso_pu_bacteria 8048746797 8048747194 273
285 3300003347 JGI26128J50194_1001242 JGI26128J50194_10012421 274
286 3300005339 Ga0070660_100181019 Ga0070660_1001810192 274
287 3300005436 Ga0070713_100095071 Ga0070713_1000950713 274
288 3300005719 Ga0068861_100173269 Ga0068861_1001732692 274
289 3300005844 Ga0068862_100039734 Ga0068862_1000397343 274
290 3300025928 Ga0207700_10059448 Ga0207700_100594482 274
291 3300025944 Ga0207661_10146534 Ga0207661_101465342 274
292 3300028794 Ga0307515_10000089 Ga0307515_100000898 274
293 3300028794 Ga0307515_10089153 Ga0307515_100891536 274
294 3300031344 Ga0265316_10309929 Ga0265316_103099292 274
295 3300031344 Ga0265316_10326724 Ga0265316_103267242 274
296 3300031456 Ga0307513_10005057 Ga0307513_100050572 274
297 3300031711 Ga0265314_10166143 Ga0265314_101661432 274
298 3300031824 Ga0307413_10052421 Ga0307413_100524213 274
299 3300035086 Ga0373934_0074756 Ga0373934_0074756_198_1031 274
300 3300037068 Ga0373925_0003513 Ga0373925_0003513_8164_9000 274
301 3300037853 Ga0436364_1473161 Ga0436364_1473161_742_1608 274
302 3300044712 Ga0453684_0005486 Ga0453684_0005486_22132_22956 274
303 3300044712 Ga0453684_0159885 Ga0453684_0159885_1535_2374 274
304 3300045051 Ga0451576_0009103 Ga0451576_0009103_10277_11101 274
305 3300045051 Ga0451576_0118778 Ga0451576_0118778_1365_2204 274
306 3300046681 Ga0495647_0068643 Ga0495647_0068643_150_986 274
307 3300048914 Ga0496111_0345940 Ga0496111_0345940_67_903 274
308 iso_pu_bacteria 2547132103 2547376340 274
309 iso_pu_bacteria 2643221660 2644338510 274
310 iso_pu_bacteria 2843690924 2843694597 274
311 iso_pu_bacteria 2846033681 2846035025 274
312 iso_pu_bacteria 2928130867 2928134745 274
313 3300003771 Ga0055526_1002077 Ga0055526_100207713 275
314 3300003773 Ga0055537_1000114 Ga0055537_100011450 275
315 3300003775 Ga0055524_1015430 Ga0055524_10154303 275
316 3300003784 Ga0055534_1000259 Ga0055534_100025916 275
317 3300003790 Ga0055528_1000059 Ga0055528_100005932 275
318 3300005327 Ga0070658_10027022 Ga0070658_100270223 275
319 3300005328 Ga0070676_10000434 Ga0070676_100004344 275
320 3300005330 Ga0070690_100001931 Ga0070690_1000019312 275
321 3300005331 Ga0070670_100023566 Ga0070670_1000235666 275
322 3300005331 Ga0070670_100024473 Ga0070670_1000244735 275
323 3300005331 Ga0070670_100309540 Ga0070670_1003095402 275
324 3300005331 Ga0070670_100420808 Ga0070670_1004208082 275
325 3300005333 Ga0070677_10088019 Ga0070677_100880192 275
326 3300005334 Ga0068869_100073084 Ga0068869_1000730843 275
327 3300005334 Ga0068869_100150690 Ga0068869_1001506902 275
328 3300005335 Ga0070666_10002319 Ga0070666_100023192 275
329 3300005335 Ga0070666_10255356 Ga0070666_102553562 275
330 3300005336 Ga0070680_100001090 Ga0070680_1000010903 275
331 3300005338 Ga0068868_100022383 Ga0068868_1000223835 275
332 3300005338 Ga0068868_100045059 Ga0068868_1000450593 275
333 3300005338 Ga0068868_100211881 Ga0068868_1002118812 275
334 3300005340 Ga0070689_100189617 Ga0070689_1001896171 275
335 3300005343 Ga0070687_100001074 Ga0070687_1000010748 275
336 3300005347 Ga0070668_100000210 Ga0070668_10000021015 275
337 3300005347 Ga0070668_100047815 Ga0070668_1000478152 275
338 3300005353 Ga0070669_100000370 Ga0070669_10000037026 275
339 3300005353 Ga0070669_100030221 Ga0070669_1000302212 275
340 3300005353 Ga0070669_100152920 Ga0070669_1001529202 275
341 3300005353 Ga0070669_100277617 Ga0070669_1002776172 275
342 3300005354 Ga0070675_100024652 Ga0070675_1000246523 275
343 3300005354 Ga0070675_100171157 Ga0070675_1001711572 275
344 3300005354 Ga0070675_100441032 Ga0070675_1004410322 275
345 3300005355 Ga0070671_100001030 Ga0070671_10000103018 275
346 3300005355 Ga0070671_100048387 Ga0070671_1000483874 275
347 3300005355 Ga0070671_100148744 Ga0070671_1001487442 275
348 3300005355 Ga0070671_100189936 Ga0070671_1001899362 275
349 3300005356 Ga0070674_100001560 Ga0070674_10000156012 275
350 3300005356 Ga0070674_100031238 Ga0070674_1000312383 275
351 3300005356 Ga0070674_100353523 Ga0070674_1003535231 275
352 3300005364 Ga0070673_100044461 Ga0070673_1000444613 275
353 3300005367 Ga0070667_100000294 Ga0070667_10000029414 275
354 3300005367 Ga0070667_100022091 Ga0070667_1000220915 275
355 3300005367 Ga0070667_100137649 Ga0070667_1001376492 275
356 3300005367 Ga0070667_100144573 Ga0070667_1001445732 275
357 3300005367 Ga0070667_100369742 Ga0070667_1003697421 275
358 3300005438 Ga0070701_10065313 Ga0070701_100653132 275
359 3300005445 Ga0070708_100639403 Ga0070708_1006394031 275
360 3300005456 Ga0070678_100002211 Ga0070678_1000022118 275
361 3300005456 Ga0070678_100091383 Ga0070678_1000913833 275
362 3300005456 Ga0070678_100208545 Ga0070678_1002085451 275
363 3300005457 Ga0070662_100014012 Ga0070662_1000140126 275
364 3300005457 Ga0070662_100046171 Ga0070662_1000461712 275
365 3300005457 Ga0070662_100195539 Ga0070662_1001955391 275
366 3300005459 Ga0068867_100001702 Ga0068867_10000170213 275
367 3300005459 Ga0068867_100025546 Ga0068867_1000255462 275
368 3300005459 Ga0068867_100034937 Ga0068867_1000349373 275
369 3300005459 Ga0068867_100184109 Ga0068867_1001841092 275
370 3300005459 Ga0068867_100240701 Ga0068867_1002407012 275
371 3300005467 Ga0070706_100003301 Ga0070706_1000033012 275
372 3300005468 Ga0070707_100035771 Ga0070707_1000357713 275
373 3300005539 Ga0068853_100009360 Ga0068853_1000093607 275
374 3300005543 Ga0070672_100000286 Ga0070672_10000028613 275
375 3300005543 Ga0070672_100006372 Ga0070672_1000063727 275
376 3300005543 Ga0070672_100018646 Ga0070672_1000186463 275
377 3300005543 Ga0070672_100027706 Ga0070672_1000277062 275
378 3300005543 Ga0070672_100109913 Ga0070672_1001099132 275
379 3300005548 Ga0070665_100330310 Ga0070665_1003303102 275
380 3300005548 Ga0070665_100639660 Ga0070665_1006396602 275
381 3300005577 Ga0068857_100048044 Ga0068857_1000480442 275
382 3300005577 Ga0068857_100299431 Ga0068857_1002994312 275
383 3300005578 Ga0068854_100061897 Ga0068854_1000618973 275
384 3300005578 Ga0068854_100173028 Ga0068854_1001730282 275
385 3300005615 Ga0070702_100172958 Ga0070702_1001729582 275
386 3300005615 Ga0070702_100254733 Ga0070702_1002547331 275
387 3300005616 Ga0068852_100071258 Ga0068852_1000712583 275
388 3300005616 Ga0068852_100170213 Ga0068852_1001702132 275
389 3300005616 Ga0068852_100477932 Ga0068852_1004779322 275
390 3300005617 Ga0068859_100176440 Ga0068859_1001764403 275
391 3300005617 Ga0068859_100378623 Ga0068859_1003786232 275
392 3300005618 Ga0068864_100018136 Ga0068864_1000181365 275
393 3300005618 Ga0068864_100071218 Ga0068864_1000712182 275
394 3300005618 Ga0068864_100110450 Ga0068864_1001104502 275
395 3300005618 Ga0068864_100569551 Ga0068864_1005695511 275
396 3300005718 Ga0068866_10005226 Ga0068866_100052266 275
397 3300005719 Ga0068861_100000398 Ga0068861_10000039826 275
398 3300005719 Ga0068861_100010875 Ga0068861_1000108753 275
399 3300005719 Ga0068861_100027316 Ga0068861_1000273162 275
400 3300005841 Ga0068863_100000638 Ga0068863_10000063814 275
401 3300005841 Ga0068863_100021605 Ga0068863_1000216058 275
402 3300005841 Ga0068863_100095002 Ga0068863_1000950023 275
403 3300005841 Ga0068863_100116455 Ga0068863_1001164551 275
404 3300005842 Ga0068858_100000623 Ga0068858_1000006238 275
405 3300005842 Ga0068858_100004551 Ga0068858_10000455111 275
406 3300005843 Ga0068860_100001020 Ga0068860_10000102012 275
407 3300005843 Ga0068860_100002539 Ga0068860_1000025394 275
408 3300005843 Ga0068860_100047148 Ga0068860_1000471482 275
409 3300005844 Ga0068862_100003087 Ga0068862_10000308711 275
410 3300005844 Ga0068862_100053450 Ga0068862_1000534504 275
411 3300005844 Ga0068862_100098908 Ga0068862_1000989083 275
412 3300006042 Ga0075368_10010902 Ga0075368_100109023 275
413 3300006042 Ga0075368_10015811 Ga0075368_100158112 275
414 3300006048 Ga0075363_100086454 Ga0075363_1000864542 275
415 3300006051 Ga0075364_10067075 Ga0075364_100670753 275
416 3300006177 Ga0075362_10018818 Ga0075362_100188183 275
417 3300006178 Ga0075367_10027649 Ga0075367_100276493 275
418 3300006178 Ga0075367_10048135 Ga0075367_100481352 275
419 3300006195 Ga0075366_10003944 Ga0075366_100039444 275
420 3300006195 Ga0075366_10004375 Ga0075366_100043756 275
421 3300006195 Ga0075366_10016373 Ga0075366_100163734 275
422 3300006195 Ga0075366_10027032 Ga0075366_100270323 275
423 3300006195 Ga0075366_10085433 Ga0075366_100854332 275
424 3300006237 Ga0097621_100010671 Ga0097621_1000106714 275
425 3300006237 Ga0097621_100031314 Ga0097621_1000313142 275
426 3300006237 Ga0097621_100253122 Ga0097621_1002531222 275
427 3300006237 Ga0097621_100260001 Ga0097621_1002600011 275
428 3300006353 Ga0075370_10000291 Ga0075370_100002913 275
429 3300006353 Ga0075370_10006650 Ga0075370_100066506 275
430 3300006353 Ga0075370_10041151 Ga0075370_100411513 275
431 3300006871 Ga0075434_100685126 Ga0075434_1006851262 275
432 3300006881 Ga0068865_100000504 Ga0068865_10000050423 275
433 3300006881 Ga0068865_100006531 Ga0068865_1000065313 275
434 3300006881 Ga0068865_100104594 Ga0068865_1001045942 275
435 3300006931 Ga0097620_100176445 Ga0097620_1001764453 275
436 3300006931 Ga0097620_100378658 Ga0097620_1003786582 275
437 3300009093 Ga0105240_10077623 Ga0105240_100776231 275
438 3300009093 Ga0105240_10196467 Ga0105240_101964673 275
439 3300009098 Ga0105245_10012144 Ga0105245_100121443 275
440 3300009098 Ga0105245_10046369 Ga0105245_100463692 275
441 3300009098 Ga0105245_10197412 Ga0105245_101974122 275
442 3300009148 Ga0105243_10039272 Ga0105243_100392722 275
443 3300009148 Ga0105243_10119821 Ga0105243_101198213 275
444 3300009174 Ga0105241_10348034 Ga0105241_103480341 275
445 3300009176 Ga0105242_10018196 Ga0105242_100181966 275
446 3300009177 Ga0105248_10027320 Ga0105248_100273206 275
447 3300009177 Ga0105248_10116277 Ga0105248_101162774 275
448 3300009177 Ga0105248_10150457 Ga0105248_101504572 275
449 3300009545 Ga0105237_10080569 Ga0105237_100805693 275
450 3300009553 Ga0105249_10002938 Ga0105249_100029387 275
451 3300009553 Ga0105249_10052983 Ga0105249_100529833 275
452 3300009553 Ga0105249_10166150 Ga0105249_101661503 275
453 3300013296 Ga0157374_10024366 Ga0157374_100243666 275
454 3300013296 Ga0157374_10130406 Ga0157374_101304062 275
455 3300013297 Ga0157378_10053754 Ga0157378_100537543 275
456 3300013297 Ga0157378_10382849 Ga0157378_103828492 275
457 3300013306 Ga0163162_10000701 Ga0163162_1000070111 275
458 3300013306 Ga0163162_10051946 Ga0163162_100519462 275
459 3300013306 Ga0163162_10274052 Ga0163162_102740524 275
460 3300013306 Ga0163162_10563620 Ga0163162_105636202 275
461 3300013308 Ga0157375_10006514 Ga0157375_100065149 275
462 3300013308 Ga0157375_10009924 Ga0157375_100099243 275
463 3300013308 Ga0157375_10153266 Ga0157375_101532662 275
464 3300014325 Ga0163163_10195108 Ga0163163_101951082 275
465 3300014325 Ga0163163_10231195 Ga0163163_102311953 275
466 3300014326 Ga0157380_10000472 Ga0157380_1000047214 275
467 3300014326 Ga0157380_10033017 Ga0157380_100330172 275
468 3300014745 Ga0157377_10039116 Ga0157377_100391163 275
469 3300014968 Ga0157379_10001128 Ga0157379_1000112818 275
470 3300014968 Ga0157379_10002106 Ga0157379_100021063 275
471 3300014968 Ga0157379_10050097 Ga0157379_100500973 275
472 3300014968 Ga0157379_10072142 Ga0157379_100721423 275
473 3300014969 Ga0157376_10021689 Ga0157376_100216892 275
474 3300014969 Ga0157376_10039629 Ga0157376_100396292 275
475 3300014969 Ga0157376_10236372 Ga0157376_102363722 275
476 3300014969 Ga0157376_10360986 Ga0157376_103609862 275
477 3300017792 Ga0163161_10001102 Ga0163161_1000110217 275
478 3300021361 Ga0213872_10006327 Ga0213872_100063275 275
479 3300025263 Ga0209565_1000032 Ga0209565_100003221 275
480 3300025271 Ga0207666_1013333 Ga0207666_10133332 275
481 3300025273 Ga0209673_1000029 Ga0209673_100002946 275
482 3300025291 Ga0209675_1000019 Ga0209675_1000019297 275
483 3300025295 Ga0209564_1000291 Ga0209564_100029191 275
484 3300025299 Ga0209256_1001175 Ga0209256_100117521 275
485 3300025304 Ga0209257_1021536 Ga0209257_10215363 275
486 3300025893 Ga0207682_10067497 Ga0207682_100674971 275
487 3300025899 Ga0207642_10005579 Ga0207642_100055793 275
488 3300025899 Ga0207642_10014175 Ga0207642_100141752 275
489 3300025899 Ga0207642_10041206 Ga0207642_100412061 275
490 3300025901 Ga0207688_10055694 Ga0207688_100556942 275
491 3300025903 Ga0207680_10002133 Ga0207680_100021332 275
492 3300025907 Ga0207645_10002041 Ga0207645_1000204113 275
493 3300025907 Ga0207645_10004182 Ga0207645_1000418210 275
494 3300025907 Ga0207645_10163414 Ga0207645_101634142 275
495 3300025908 Ga0207643_10263413 Ga0207643_102634132 275
496 3300025909 Ga0207705_10053592 Ga0207705_100535922 275
497 3300025910 Ga0207684_10012702 Ga0207684_100127022 275
498 3300025911 Ga0207654_10065427 Ga0207654_100654273 275
499 3300025914 Ga0207671_10182234 Ga0207671_101822342 275
500 3300025917 Ga0207660_10006825 Ga0207660_100068253 275
501 3300025918 Ga0207662_10163295 Ga0207662_101632952 275
502 3300025919 Ga0207657_10127064 Ga0207657_101270642 275
503 3300025920 Ga0207649_10095109 Ga0207649_100951092 275
504 3300025923 Ga0207681_10001157 Ga0207681_100011575 275
505 3300025924 Ga0207694_10145325 Ga0207694_101453252 275
506 3300025925 Ga0207650_10000603 Ga0207650_100006039 275
507 3300025925 Ga0207650_10032175 Ga0207650_100321752 275
508 3300025925 Ga0207650_10048101 Ga0207650_100481012 275
509 3300025925 Ga0207650_10320901 Ga0207650_103209012 275
510 3300025926 Ga0207659_10003135 Ga0207659_100031359 275
511 3300025926 Ga0207659_10038095 Ga0207659_100380953 275
512 3300025926 Ga0207659_10162824 Ga0207659_101628242 275
513 3300025927 Ga0207687_10019791 Ga0207687_100197915 275
514 3300025927 Ga0207687_10022125 Ga0207687_100221252 275
515 3300025931 Ga0207644_10019134 Ga0207644_100191343 275
516 3300025931 Ga0207644_10183703 Ga0207644_101837032 275
517 3300025932 Ga0207690_10061546 Ga0207690_100615463 275
518 3300025933 Ga0207706_10005604 Ga0207706_1000560411 275
519 3300025933 Ga0207706_10023257 Ga0207706_100232576 275
520 3300025934 Ga0207686_10161890 Ga0207686_101618901 275
521 3300025935 Ga0207709_10166238 Ga0207709_101662381 275
522 3300025937 Ga0207669_10002675 Ga0207669_100026752 275
523 3300025938 Ga0207704_10002511 Ga0207704_100025113 275
524 3300025938 Ga0207704_10003713 Ga0207704_100037136 275
525 3300025939 Ga0207665_10275322 Ga0207665_102753222 275
526 3300025940 Ga0207691_10002589 Ga0207691_100025892 275
527 3300025940 Ga0207691_10026069 Ga0207691_100260694 275
528 3300025940 Ga0207691_10029199 Ga0207691_100291995 275
529 3300025940 Ga0207691_10066955 Ga0207691_100669552 275
530 3300025940 Ga0207691_10076817 Ga0207691_100768173 275
531 3300025940 Ga0207691_10105579 Ga0207691_101055793 275
532 3300025941 Ga0207711_10009121 Ga0207711_100091213 275
533 3300025941 Ga0207711_10057113 Ga0207711_100571133 275
534 3300025941 Ga0207711_10604105 Ga0207711_106041052 275
535 3300025942 Ga0207689_10000415 Ga0207689_1000041510 275
536 3300025942 Ga0207689_10205596 Ga0207689_102055962 275
537 3300025942 Ga0207689_10217162 Ga0207689_102171622 275
538 3300025945 Ga0207679_10368181 Ga0207679_103681812 275
539 3300025961 Ga0207712_10002826 Ga0207712_100028266 275
540 3300025961 Ga0207712_10046807 Ga0207712_100468072 275
541 3300025961 Ga0207712_10188467 Ga0207712_101884672 275
542 3300025961 Ga0207712_10328714 Ga0207712_103287142 275
543 3300025972 Ga0207668_10257076 Ga0207668_102570762 275
544 3300025981 Ga0207640_10567072 Ga0207640_105670721 275
545 3300025986 Ga0207658_10000212 Ga0207658_1000021241 275
546 3300025986 Ga0207658_10030972 Ga0207658_100309722 275
547 3300025986 Ga0207658_10136734 Ga0207658_101367342 275
548 3300026023 Ga0207677_10107251 Ga0207677_101072512 275
549 3300026023 Ga0207677_10267004 Ga0207677_102670042 275
550 3300026035 Ga0207703_10002429 Ga0207703_1000242913 275
551 3300026035 Ga0207703_10003032 Ga0207703_1000303214 275
552 3300026035 Ga0207703_10413025 Ga0207703_104130252 275
553 3300026041 Ga0207639_10054234 Ga0207639_100542342 275
554 3300026041 Ga0207639_10151752 Ga0207639_101517522 275
555 3300026041 Ga0207639_10166052 Ga0207639_101660522 275
556 3300026067 Ga0207678_10063109 Ga0207678_100631094 275
557 3300026075 Ga0207708_10043164 Ga0207708_100431642 275
558 3300026088 Ga0207641_10097769 Ga0207641_100977693 275
559 3300026088 Ga0207641_10153136 Ga0207641_101531362 275
560 3300026088 Ga0207641_10205166 Ga0207641_102051662 275
561 3300026088 Ga0207641_10396913 Ga0207641_103969132 275
562 3300026089 Ga0207648_10037529 Ga0207648_100375292 275
563 3300026089 Ga0207648_10142370 Ga0207648_101423702 275
564 3300026089 Ga0207648_10251892 Ga0207648_102518922 275
565 3300026095 Ga0207676_10039147 Ga0207676_100391472 275
566 3300026095 Ga0207676_10044261 Ga0207676_100442614 275
567 3300026095 Ga0207676_10057970 Ga0207676_100579702 275
568 3300026095 Ga0207676_10083234 Ga0207676_100832342 275
569 3300026095 Ga0207676_10296744 Ga0207676_102967442 275
570 3300026116 Ga0207674_10010925 Ga0207674_100109253 275
571 3300026116 Ga0207674_10336626 Ga0207674_103366262 275
572 3300026118 Ga0207675_100000177 Ga0207675_10000017732 275
573 3300026118 Ga0207675_100002649 Ga0207675_1000026493 275
574 3300026118 Ga0207675_100006060 Ga0207675_1000060605 275
575 3300026121 Ga0207683_10056721 Ga0207683_100567212 275
576 3300026121 Ga0207683_10105509 Ga0207683_101055093 275
577 3300026142 Ga0207698_10005873 Ga0207698_100058733 275
578 3300026142 Ga0207698_10104678 Ga0207698_101046783 275
579 3300027395 Ga0209996_1007401 Ga0209996_10074012 275
580 3300027526 Ga0209968_1000442 Ga0209968_10004425 275
581 3300027866 Ga0209813_10097025 Ga0209813_100970251 275
582 3300027907 Ga0207428_10174560 Ga0207428_101745602 275
583 3300028379 Ga0268266_10254014 Ga0268266_102540142 275
584 3300028379 Ga0268266_10280483 Ga0268266_102804832 275
585 3300028379 Ga0268266_10421137 Ga0268266_104211372 275
586 3300028380 Ga0268265_10038444 Ga0268265_100384442 275
587 3300028380 Ga0268265_10042591 Ga0268265_100425914 275
588 3300028380 Ga0268265_10089362 Ga0268265_100893622 275
589 3300028380 Ga0268265_10103325 Ga0268265_101033252 275
590 3300028381 Ga0268264_10004393 Ga0268264_1000439313 275
591 3300028381 Ga0268264_10020354 Ga0268264_100203542 275
592 3300028786 Ga0307517_10012331 Ga0307517_100123312 275
593 3300028794 Ga0307515_10297510 Ga0307515_102975102 275
594 3300030522 Ga0307512_10051922 Ga0307512_100519224 275
595 3300030522 Ga0307512_10052334 Ga0307512_100523343 275
596 3300031251 Ga0265327_10017033 Ga0265327_100170333 275
597 3300031456 Ga0307513_10035292 Ga0307513_100352923 275
598 3300031507 Ga0307509_10001647 Ga0307509_1000164731 275
599 3300031507 Ga0307509_10006706 Ga0307509_1000670610 275
600 3300031507 Ga0307509_10013664 Ga0307509_100136646 275
601 3300031616 Ga0307508_10000028 Ga0307508_10000028105 275
602 3300031616 Ga0307508_10001377 Ga0307508_1000137724 275
603 3300031616 Ga0307508_10065069 Ga0307508_100650693 275
604 3300031665 Ga0316575_10000063 Ga0316575_1000006312 275
605 3300031730 Ga0307516_10177718 Ga0307516_101777182 275
606 3300031731 Ga0307405_10089539 Ga0307405_100895392 275
607 3300031911 Ga0307412_10034330 Ga0307412_100343304 275
608 3300031995 Ga0307409_100019603 Ga0307409_1000196032 275
609 3300032002 Ga0307416_100017160 Ga0307416_1000171602 275
610 3300032002 Ga0307416_100243962 Ga0307416_1002439622 275
611 3300032004 Ga0307414_10333943 Ga0307414_103339432 275
612 3300032004 Ga0307414_10608346 Ga0307414_106083461 275
613 3300032005 Ga0307411_10006128 Ga0307411_100061283 275
614 3300032126 Ga0307415_100109353 Ga0307415_1001093533 275
615 3300033180 Ga0307510_10060241 Ga0307510_100602415 275
616 3300033180 Ga0307510_10094301 Ga0307510_100943012 275
617 3300035088 Ga0373940_0013736 Ga0373940_0013736_1028_1924 275
618 3300035170 Ga0373943_0211349 Ga0373943_0211349_203_1045 275
619 3300035171 Ga0373946_0062880 Ga0373946_0062880_450_1301 275
620 3300035691 Ga0373931_0048610 Ga0373931_0048610_1235_2131 275
621 3300035725 Ga0373947_0043758 Ga0373947_0043758_1273_2115 275
622 3300036401 Ga0373937_0073412 Ga0373937_0073412_1378_2226 275
623 3300036401 Ga0373937_0084748 Ga0373937_0084748_397_1428 275
624 3300036401 Ga0373937_0094160 Ga0373937_0094160_162_1004 275
625 3300037418 Ga0395900_0124976 Ga0395900_0124976_1205_2044 275
626 3300038443 Ga0395901_0081520 Ga0395901_0081520_1352_2179 275
627 3300039447 Ga0436361_0004926 Ga0436361_0004926_2599_3435 275
628 3300041503 Ga0451847_0330048 Ga0451847_0330048_370_1209 275
629 3300041512 Ga0451853_3427827 Ga0451853_3427827_71_913 275
630 3300042876 Ga0451577_0022885 Ga0451577_0022885_502_1338 275
631 3300042876 Ga0451577_0235067 Ga0451577_0235067_580_1416 275
632 3300042876 Ga0451577_0344687 Ga0451577_0344687_76_918 275
633 3300042876 Ga0451577_0583350 Ga0451577_0583350_142_990 275
634 3300044712 Ga0453684_0008430 Ga0453684_0008430_7489_8325 275
635 3300044712 Ga0453684_0042904 Ga0453684_0042904_3783_4631 275
636 3300044712 Ga0453684_0117420 Ga0453684_0117420_711_1544 275
637 3300044712 Ga0453684_0454880 Ga0453684_0454880_318_1166 275
638 3300045051 Ga0451576_0001760 Ga0451576_0001760_33822_34655 275
639 3300045051 Ga0451576_0015201 Ga0451576_0015201_7554_8390 275
640 3300045051 Ga0451576_0111564 Ga0451576_0111564_497_1333 275
641 3300045051 Ga0451576_0202520 Ga0451576_0202520_350_1246 275
642 3300045051 Ga0451576_0261405 Ga0451576_0261405_694_1539 275
643 3300045976 Ga0466967_0546697 Ga0466967_0546697_160_1005 275
644 3300046454 Ga0495592_0019120 Ga0495592_0019120_1547_2383 275
645 3300046457 Ga0495590_0003935 Ga0495590_0003935_4922_5767 275
646 3300046457 Ga0495590_0036912 Ga0495590_0036912_91_921 275
647 3300046457 Ga0495590_0062264 Ga0495590_0062264_425_1252 275
648 3300046459 Ga0495629_0047432 Ga0495629_0047432_1191_2033 275
649 3300046460 Ga0495638_0062244 Ga0495638_0062244_1232_2068 275
650 3300046471 Ga0495650_0024295 Ga0495650_0024295_1257_2099 275
651 3300046474 Ga0495605_0061328 Ga0495605_0061328_108_935 275
652 3300046477 Ga0495664_0325460 Ga0495664_0325460_31_879 275
653 3300046491 Ga0495584_0010102 Ga0495584_0010102_318_1145 275
654 3300046500 Ga0495596_0134958 Ga0495596_0134958_26_871 275
655 3300046501 Ga0495607_0077829 Ga0495607_0077829_227_1054 275
656 3300046506 Ga0495583_0040632 Ga0495583_0040632_1005_1832 275
657 3300046515 Ga0495620_0031763 Ga0495620_0031763_920_1756 275
658 3300046519 Ga0495632_0009387 Ga0495632_0009387_4847_5692 275
659 3300046528 Ga0495642_0022222 Ga0495642_0022222_366_1193 275
660 3300046529 Ga0495652_0123393 Ga0495652_0123393_879_1721 275
661 3300046538 Ga0495609_0000136 Ga0495609_0000136_58414_59241 275
662 3300046539 Ga0495621_0006088 Ga0495621_0006088_1945_2814 275
663 3300046542 Ga0495597_0012048 Ga0495597_0012048_1206_2051 275
664 3300046543 Ga0495645_0026599 Ga0495645_0026599_2480_3322 275
665 3300046559 Ga0495667_0129864 Ga0495667_0129864_711_1553 275
666 3300046616 Ga0495668_0000029 Ga0495668_0000029_52467_53294 275
667 3300046616 Ga0495668_0033309 Ga0495668_0033309_1842_2669 275
668 3300046616 Ga0495668_0085564 Ga0495668_0085564_502_1347 275
669 3300046660 Ga0495625_0022770 Ga0495625_0022770_1025_1852 275
670 3300046660 Ga0495625_0033839 Ga0495625_0033839_917_1762 275
671 3300046663 Ga0495635_0061843 Ga0495635_0061843_893_1735 275
672 3300046684 Ga0495669_0001803 Ga0495669_0001803_5984_6811 275
673 3300046692 Ga0495671_0125627 Ga0495671_0125627_36_881 275
674 3300046694 Ga0495649_0000541 Ga0495649_0000541_30386_31231 275
675 3300046694 Ga0495649_0059878 Ga0495649_0059878_1194_2021 275
676 3300046794 Ga0495589_0071998 Ga0495589_0071998_313_1143 275
677 3300046809 Ga0495600_0110953 Ga0495600_0110953_394_1236 275
678 3300046810 Ga0495660_0063546 Ga0495660_0063546_1019_1846 275
679 3300046810 Ga0495660_0108014 Ga0495660_0108014_313_1158 275
680 3300047318 Ga0495636_0022950 Ga0495636_0022950_277_1104 275
681 3300047319 Ga0495674_0013839 Ga0495674_0013839_295_1125 275
682 3300047323 Ga0495683_0196721 Ga0495683_0196721_12_842 275
683 3300047443 Ga0495687_001991 Ga0495687_001991_15318_16163 275
684 3300047443 Ga0495687_006560 Ga0495687_006560_1011_1856 275
685 3300047443 Ga0495687_014896 Ga0495687_014896_1011_1856 275
686 3300047443 Ga0495687_062118 Ga0495687_062118_425_1255 275
687 3300047446 Ga0495679_006268 Ga0495679_006268_230_1057 275
688 3300047447 Ga0495685_008022 Ga0495685_008022_277_1104 275
689 3300047469 Ga0495673_0146820 Ga0495673_0146820_44_880 275
690 3300047470 Ga0495681_0014798 Ga0495681_0014798_845_1672 275
691 3300047471 Ga0495684_0062323 Ga0495684_0062323_1515_2357 275
692 3300047472 Ga0495686_0007111 Ga0495686_0007111_1400_2239 275
693 3300048091 Ga0495626_0089455 Ga0495626_0089455_373_1218 275
694 3300048903 Ga0496100_0023701 Ga0496100_0023701_1920_2816 275
695 3300048904 Ga0496101_0013511 Ga0496101_0013511_3811_4707 275
696 3300048905 Ga0496102_0033963 Ga0496102_0033963_558_1454 275
697 3300048907 Ga0496104_0044408 Ga0496104_0044408_47_877 275
698 3300048907 Ga0496104_0215855 Ga0496104_0215855_534_1430 275
699 3300048907 Ga0496104_0279502 Ga0496104_0279502_297_1148 275
700 3300048908 Ga0496105_0110051 Ga0496105_0110051_407_1303 275
701 3300048909 Ga0496106_0006072 Ga0496106_0006072_962_1858 275
702 3300048910 Ga0496107_0141916 Ga0496107_0141916_767_1663 275
703 3300048910 Ga0496107_0208243 Ga0496107_0208243_266_1096 275
704 3300048911 Ga0496108_0017021 Ga0496108_0017021_3810_4706 275
705 3300048913 Ga0496110_0007472 Ga0496110_0007472_7324_8220 275
706 3300048914 Ga0496111_0205344 Ga0496111_0205344_237_1130 275
707 3300048917 Ga0496114_0164755 Ga0496114_0164755_639_1481 275
708 3300048918 Ga0496115_0007917 Ga0496115_0007917_1068_1964 275
709 3300048924 Ga0496121_0265552 Ga0496121_0265552_48_878 275
710 3300048929 Ga0496126_0026637 Ga0496126_0026637_2423_3256 275
711 3300049460 Ga0495682_0084323 Ga0495682_0084323_222_1058 275
712 3300049824 Ga0501045_0312017 Ga0501045_0312017_321_1160 275
713 3300050489 nmdc:mga03683_113732_c1 nmdc:mga03683_113732_c1_14_859 275
714 3300050489 nmdc:mga03683_41512_c1 nmdc:mga03683_41512_c1_570_1427 275
715 3300050492 nmdc:mga0yw44_64903_c1 nmdc:mga0yw44_64903_c1_747_1592 275
716 3300050493 nmdc:mga0k408_121887_c1 nmdc:mga0k408_121887_c1_597_1442 275
717 3300050493 nmdc:mga0k408_19056_c1 nmdc:mga0k408_19056_c1_94_939 275
718 3300050493 nmdc:mga0k408_20391_c1 nmdc:mga0k408_20391_c1_425_1270 275
719 3300050493 nmdc:mga0k408_23723_c1 nmdc:mga0k408_23723_c1_406_1260 275
720 3300050493 nmdc:mga0k408_370_c1 nmdc:mga0k408_370_c1_22401_23246 275
721 3300050494 nmdc:mga06z11_34181_c1 nmdc:mga06z11_34181_c1_946_1791 275
722 3300050494 nmdc:mga06z11_80032_c1 nmdc:mga06z11_80032_c1_414_1271 275
723 3300050495 nmdc:mga04h51_9044_c1 nmdc:mga04h51_9044_c1_933_1790 275
724 3300050496 nmdc:mga07m45_110530_c1 nmdc:mga07m45_110530_c1_547_1404 275
725 3300050496 nmdc:mga07m45_14825_c1 nmdc:mga07m45_14825_c1_170_1006 275
726 3300050496 nmdc:mga07m45_25005_c1 nmdc:mga07m45_25005_c1_205_1062 275
727 3300050496 nmdc:mga07m45_32728_c1 nmdc:mga07m45_32728_c1_731_1576 275
728 3300050496 nmdc:mga07m45_54331_c1 nmdc:mga07m45_54331_c1_1170_2015 275
729 3300050516 nmdc:mga0sz30_26990_c2 nmdc:mga0sz30_26990_c2_743_1588 275
730 3300053077 Ga0495601_0055940 Ga0495601_0055940_713_1555 275
731 3300053078 Ga0495612_0039580 Ga0495612_0039580_477_1319 275
732 3300053084 Ga0495595_0057445 Ga0495595_0057445_436_1278 275
733 3300053092 Ga0500583_0104323 Ga0500583_0104323_292_1128 275
734 3300053093 Ga0500651_0080149 Ga0500651_0080149_485_1321 275
735 3300053098 Ga0500650_0073375 Ga0500650_0073375_723_1559 275
736 3300053118 Ga0500594_0001004 Ga0500594_0001004_247_1083 275
737 3300053134 Ga0500658_0008109 Ga0500658_0008109_757_1602 275
738 3300053136 Ga0500559_0000694 Ga0500559_0000694_19971_20807 275
739 3300053138 Ga0500564_019933 Ga0500564_019933_694_1530 275
740 3300053139 Ga0500568_0033439 Ga0500568_0033439_475_1320 275
741 3300053154 Ga0500619_003712 Ga0500619_003712_515_1351 275
742 3300053156 Ga0500622_0005187 Ga0500622_0005187_449_1285 275
743 3300053739 Ga0500587_003270 Ga0500587_003270_916_1752 275
744 3300061734 Ga0530510_0350864 Ga0530510_0350864_95_934 275
745 iso_pu_bacteria 2519103095 2519457415 275
746 iso_pu_bacteria 2643221654 2644301121 275
747 3300001915 JGI24741J21665_1000659 JGI24741J21665_10006595 276
748 3300001979 JGI24740J21852_10003369 JGI24740J21852_100033693 276
749 3300002704 JGI25155J39150_1000249 JGI25155J39150_10002493 276
750 3300002704 JGI25155J39150_1000328 JGI25155J39150_100032812 276
751 3300002704 JGI25155J39150_1000403 JGI25155J39150_10004038 276
752 3300002705 JGI25156J39149_1000117 JGI25156J39149_10001179 276
753 3300002705 JGI25156J39149_1001439 JGI25156J39149_10014398 276
754 3300002737 JGI25162J39368_1000148 JGI25162J39368_100014853 276
755 3300002737 JGI25162J39368_1004924 JGI25162J39368_10049243 276
756 3300002738 JGI25154J39366_1000107 JGI25154J39366_100010772 276
757 3300002738 JGI25154J39366_1000440 JGI25154J39366_100044012 276
758 3300002738 JGI25154J39366_1000661 JGI25154J39366_10006616 276
759 3300002741 JGI25157J39369_1000884 JGI25157J39369_10008843 276
760 3300003187 JGI25151J46595_10001412 JGI25151J46595_1000141215 276
761 3300003214 JGI25165J46597_1000030 JGI25165J46597_100003021 276
762 3300003316 rootH1_10091210 rootH1_100912103 276
763 3300003322 rootL2_10044783 rootL2_100447833 276
764 3300003322 rootL2_10123098 rootL2_101230981 276
765 3300003354 JGI25160J50197_1000367 JGI25160J50197_10003671 276
766 3300003479 Ga0006556J51387_1023961 Ga0006556J51387_10239613 276
767 3300003565 Ga0006560J51390_1017447 Ga0006560J51390_10174473 276
768 3300003751 Ga0055538_1000017 Ga0055538_1000017279 276
769 3300003751 Ga0055538_1000085 Ga0055538_100008527 276
770 3300003751 Ga0055538_1003429 Ga0055538_10034293 276
771 3300003752 Ga0055539_1000022 Ga0055539_1000022279 276
772 3300003752 Ga0055539_1000126 Ga0055539_100012627 276
773 3300003752 Ga0055539_1000214 Ga0055539_100021415 276
774 3300003756 Ga0055533_1000030 Ga0055533_1000030279 276
775 3300003756 Ga0055533_1000133 Ga0055533_100013327 276
776 3300003756 Ga0055533_1000605 Ga0055533_100060511 276
777 3300003756 Ga0055533_1001088 Ga0055533_10010883 276
778 3300003758 Ga0055532_1000040 Ga0055532_1000040112 276
779 3300003758 Ga0055532_1000044 Ga0055532_1000044149 276
780 3300003759 Ga0055525_1000034 Ga0055525_1000034279 276
781 3300003759 Ga0055525_1000174 Ga0055525_100017427 276
782 3300003759 Ga0055525_1000420 Ga0055525_10004203 276
783 3300003761 Ga0055535_1000029 Ga0055535_1000029112 276
784 3300003762 Ga0055542_1006798 Ga0055542_10067983 276
785 3300003763 Ga0055529_1000055 Ga0055529_100005571 276
786 3300003763 Ga0055529_1000945 Ga0055529_100094510 276
787 3300003771 Ga0055526_1003730 Ga0055526_10037303 276
788 3300003775 Ga0055524_1001670 Ga0055524_100167011 276
789 3300003775 Ga0055524_1013761 Ga0055524_10137613 276
790 3300003781 Ga0055536_1000031 Ga0055536_100003165 276
791 3300003784 Ga0055534_1001330 Ga0055534_10013303 276
792 3300003784 Ga0055534_1002212 Ga0055534_10022126 276
793 3300003784 Ga0055534_1004644 Ga0055534_10046443 276
794 3300003841 Ga0055541_1000015 Ga0055541_1000015279 276
795 3300003841 Ga0055541_1000085 Ga0055541_100008550 276
796 3300003841 Ga0055541_1000760 Ga0055541_10007607 276
797 3300005262 Ga0065165_1001219 Ga0065165_100121929 276
798 3300005331 Ga0070670_100011920 Ga0070670_1000119203 276
799 3300005331 Ga0070670_100030033 Ga0070670_1000300332 276
800 3300005331 Ga0070670_100057768 Ga0070670_1000577683 276
801 3300005333 Ga0070677_10002998 Ga0070677_100029984 276
802 3300005333 Ga0070677_10134184 Ga0070677_101341842 276
803 3300005334 Ga0068869_100052968 Ga0068869_1000529683 276
804 3300005338 Ga0068868_100235499 Ga0068868_1002354992 276
805 3300005340 Ga0070689_100140805 Ga0070689_1001408052 276
806 3300005344 Ga0070661_100000037 Ga0070661_10000003729 276
807 3300005347 Ga0070668_100169199 Ga0070668_1001691992 276
808 3300005354 Ga0070675_100014685 Ga0070675_1000146851 276
809 3300005355 Ga0070671_100025332 Ga0070671_1000253324 276
810 3300005355 Ga0070671_100052291 Ga0070671_1000522912 276
811 3300005356 Ga0070674_100017826 Ga0070674_1000178264 276
812 3300005364 Ga0070673_100005042 Ga0070673_1000050424 276
813 3300005364 Ga0070673_100017993 Ga0070673_1000179933 276
814 3300005366 Ga0070659_100000268 Ga0070659_1000002683 276
815 3300005367 Ga0070667_100398929 Ga0070667_1003989292 276
816 3300005455 Ga0070663_100000001 Ga0070663_100000001186 276
817 3300005456 Ga0070678_100004854 Ga0070678_1000048546 276
818 3300005459 Ga0068867_100002661 Ga0068867_1000026618 276
819 3300005459 Ga0068867_100008359 Ga0068867_1000083597 276
820 3300005459 Ga0068867_100127994 Ga0068867_1001279942 276
821 3300005539 Ga0068853_100478194 Ga0068853_1004781942 276
822 3300005543 Ga0070672_100000712 Ga0070672_1000007124 276
823 3300005563 Ga0068855_100005276 Ga0068855_1000052768 276
824 3300005563 Ga0068855_100170676 Ga0068855_1001706761 276
825 3300005563 Ga0068855_100175969 Ga0068855_1001759693 276
826 3300005563 Ga0068855_100354541 Ga0068855_1003545412 276
827 3300005564 Ga0070664_100000006 Ga0070664_10000000663 276
828 3300005564 Ga0070664_100262573 Ga0070664_1002625732 276
829 3300005577 Ga0068857_100097295 Ga0068857_1000972952 276
830 3300005577 Ga0068857_100122293 Ga0068857_1001222933 276
831 3300005578 Ga0068854_100002991 Ga0068854_1000029917 276
832 3300005614 Ga0068856_100000032 Ga0068856_10000003291 276
833 3300005616 Ga0068852_100024872 Ga0068852_1000248724 276
834 3300005616 Ga0068852_100054367 Ga0068852_1000543673 276
835 3300005840 Ga0068870_10055112 Ga0068870_100551123 276
836 3300005840 Ga0068870_10221762 Ga0068870_102217621 276
837 3300005842 Ga0068858_100353339 Ga0068858_1003533392 276
838 3300006195 Ga0075366_10004423 Ga0075366_100044233 276
839 3300006195 Ga0075366_10209799 Ga0075366_102097991 276
840 3300006237 Ga0097621_100138552 Ga0097621_1001385523 276
841 3300006358 Ga0068871_100094720 Ga0068871_1000947202 276
842 3300006846 Ga0075430_100211114 Ga0075430_1002111142 276
843 3300006880 Ga0075429_100000224 Ga0075429_10000022431 276
844 3300006881 Ga0068865_100051687 Ga0068865_1000516874 276
845 3300006946 Ga0079104_1010957 Ga0079104_10109572 276
846 3300009011 Ga0105251_10072277 Ga0105251_100722772 276
847 3300009011 Ga0105251_10149572 Ga0105251_101495721 276
848 3300009093 Ga0105240_10015068 Ga0105240_100150688 276
849 3300009093 Ga0105240_10022053 Ga0105240_100220536 276
850 3300009093 Ga0105240_10174543 Ga0105240_101745433 276
851 3300009093 Ga0105240_10295608 Ga0105240_102956081 276
852 3300009093 Ga0105240_10413203 Ga0105240_104132032 276
853 3300009093 Ga0105240_10413204 Ga0105240_104132042 276
854 3300009147 Ga0114129_10975478 Ga0114129_109754782 276
855 3300009148 Ga0105243_10006497 Ga0105243_100064978 276
856 3300009545 Ga0105237_10033144 Ga0105237_100331443 276
857 3300009545 Ga0105237_10097519 Ga0105237_100975193 276
858 3300009551 Ga0105238_10000038 Ga0105238_1000003828 276
859 3300010375 Ga0105239_10004364 Ga0105239_100043643 276
860 3300013100 Ga0157373_10080356 Ga0157373_100803563 276
861 3300013100 Ga0157373_10364764 Ga0157373_103647641 276
862 3300013102 Ga0157371_10000106 Ga0157371_10000106114 276
863 3300013104 Ga0157370_10000062 Ga0157370_10000062106 276
864 3300013297 Ga0157378_10736485 Ga0157378_107364851 276
865 3300013307 Ga0157372_10000108 Ga0157372_100001083 276
866 3300014326 Ga0157380_10145419 Ga0157380_101454192 276
867 3300014497 Ga0182008_10042885 Ga0182008_100428852 276
868 3300014497 Ga0182008_10112057 Ga0182008_101120572 276
869 3300014745 Ga0157377_10000034 Ga0157377_1000003432 276
870 3300014968 Ga0157379_10422105 Ga0157379_104221052 276
871 3300014969 Ga0157376_10185936 Ga0157376_101859361 276
872 3300014969 Ga0157376_10552731 Ga0157376_105527312 276
873 3300015261 Ga0182006_1001438 Ga0182006_10014383 276
874 3300015261 Ga0182006_1012816 Ga0182006_10128163 276
875 3300015261 Ga0182006_1020296 Ga0182006_10202963 276
876 3300015261 Ga0182006_1028442 Ga0182006_10284423 276
877 3300015261 Ga0182006_1076641 Ga0182006_10766412 276
878 3300015262 Ga0182007_10013248 Ga0182007_100132483 276
879 3300015262 Ga0182007_10020262 Ga0182007_100202622 276
880 3300015265 Ga0182005_1000142 Ga0182005_100014233 276
881 3300016635 Ga0183361_10001 Ga0183361_10001763 276
882 3300017792 Ga0163161_10012016 Ga0163161_100120163 276
883 3300017792 Ga0163161_10076474 Ga0163161_100764743 276
884 3300020076 Ga0206355_1625393 Ga0206355_16253932 276
885 3300020077 Ga0206351_10698205 Ga0206351_106982053 276
886 3300020610 Ga0154015_1545624 Ga0154015_15456243 276
887 3300021361 Ga0213872_10004235 Ga0213872_100042353 276
888 3300025206 Ga0209435_100004 Ga0209435_100004558 276
889 3300025206 Ga0209435_100891 Ga0209435_1008913 276
890 3300025207 Ga0209760_101145 Ga0209760_1011453 276
891 3300025224 Ga0209784_100006 Ga0209784_100006407 276
892 3300025224 Ga0209784_100021 Ga0209784_10002180 276
893 3300025224 Ga0209784_100034 Ga0209784_10003421 276
894 3300025224 Ga0209784_100559 Ga0209784_1005593 276
895 3300025225 Ga0209566_100002 Ga0209566_100002407 276
896 3300025225 Ga0209566_100038 Ga0209566_100038278 276
897 3300025225 Ga0209566_100039 Ga0209566_10003981 276
898 3300025225 Ga0209566_100678 Ga0209566_1006787 276
899 3300025225 Ga0209566_102039 Ga0209566_1020395 276
900 3300025225 Ga0209566_102609 Ga0209566_1026095 276
901 3300025226 Ga0209674_100010 Ga0209674_100010730 276
902 3300025226 Ga0209674_100036 Ga0209674_10003680 276
903 3300025226 Ga0209674_100056 Ga0209674_10005621 276
904 3300025226 Ga0209674_100060 Ga0209674_100060102 276
905 3300025226 Ga0209674_100076 Ga0209674_100076103 276
906 3300025226 Ga0209674_106794 Ga0209674_1067942 276
907 3300025228 Ga0209672_101956 Ga0209672_1019565 276
908 3300025228 Ga0209672_108353 Ga0209672_1083532 276
909 3300025229 Ga0209147_100011 Ga0209147_100011627 276
910 3300025229 Ga0209147_100018 Ga0209147_100018113 276
911 3300025230 Ga0209563_100040 Ga0209563_10004080 276
912 3300025230 Ga0209563_100041 Ga0209563_10004165 276
913 3300025230 Ga0209563_100057 Ga0209563_100057278 276
914 3300025230 Ga0209563_106287 Ga0209563_1062872 276
915 3300025231 Ga0207427_103609 Ga0207427_1036093 276
916 3300025233 Ga0209437_100071 Ga0209437_100071278 276
917 3300025233 Ga0209437_100393 Ga0209437_10039323 276
918 3300025242 Ga0209258_100028 Ga0209258_100028113 276
919 3300025242 Ga0209258_106057 Ga0209258_1060573 276
920 3300025246 Ga0209646_1000043 Ga0209646_1000043121 276
921 3300025246 Ga0209646_1000149 Ga0209646_100014948 276
922 3300025246 Ga0209646_1000191 Ga0209646_100019117 276
923 3300025246 Ga0209646_1000233 Ga0209646_10002339 276
924 3300025250 Ga0209026_1000066 Ga0209026_100006618 276
925 3300025250 Ga0209026_1002225 Ga0209026_10022258 276
926 3300025250 Ga0209026_1009862 Ga0209026_10098622 276
927 3300025253 Ga0209677_100007 Ga0209677_100007407 276
928 3300025253 Ga0209677_100023 Ga0209677_10002380 276
929 3300025253 Ga0209677_100035 Ga0209677_10003521 276
930 3300025253 Ga0209677_102676 Ga0209677_1026766 276
931 3300025254 Ga0209148_1000162 Ga0209148_100016216 276
932 3300025256 Ga0209759_1000072 Ga0209759_100007252 276
933 3300025256 Ga0209759_1000182 Ga0209759_100018248 276
934 3300025256 Ga0209759_1001347 Ga0209759_100134716 276
935 3300025256 Ga0209759_1003723 Ga0209759_10037236 276
936 3300025261 Ga0209233_1000094 Ga0209233_1000094278 276
937 3300025263 Ga0209565_1000611 Ga0209565_100061114 276
938 3300025272 Ga0209455_1000065 Ga0209455_1000065113 276
939 3300025272 Ga0209455_1001116 Ga0209455_10011164 276
940 3300025272 Ga0209455_1010351 Ga0209455_10103512 276
941 3300025291 Ga0209675_1000231 Ga0209675_100023144 276
942 3300025291 Ga0209675_1001472 Ga0209675_10014726 276
943 3300025291 Ga0209675_1009719 Ga0209675_10097193 276
944 3300025292 Ga0209676_1000036 Ga0209676_1000036292 276
945 3300025294 Ga0209025_1000345 Ga0209025_100034511 276
946 3300025294 Ga0209025_1000860 Ga0209025_100086018 276
947 3300025294 Ga0209025_1000885 Ga0209025_100088516 276
948 3300025294 Ga0209025_1003617 Ga0209025_10036177 276
949 3300025294 Ga0209025_1020816 Ga0209025_10208164 276
950 3300025295 Ga0209564_1001814 Ga0209564_100181411 276
951 3300025295 Ga0209564_1002897 Ga0209564_10028973 276
952 3300025295 Ga0209564_1003347 Ga0209564_10033473 276
953 3300025297 Ga0209758_1014888 Ga0209758_10148884 276
954 3300025299 Ga0209256_1000244 Ga0209256_100024411 276
955 3300025299 Ga0209256_1003136 Ga0209256_10031364 276
956 3300025302 Ga0207426_1000007 Ga0207426_1000007802 276
957 3300025315 Ga0207697_10005788 Ga0207697_100057882 276
958 3300025321 Ga0207656_10049107 Ga0207656_100491072 276
959 3300025735 Ga0207713_1077262 Ga0207713_10772622 276
960 3300025893 Ga0207682_10001283 Ga0207682_100012834 276
961 3300025893 Ga0207682_10066783 Ga0207682_100667832 276
962 3300025903 Ga0207680_10283664 Ga0207680_102836642 276
963 3300025904 Ga0207647_10053550 Ga0207647_100535504 276
964 3300025907 Ga0207645_10001321 Ga0207645_1000132121 276
965 3300025907 Ga0207645_10034575 Ga0207645_100345753 276
966 3300025908 Ga0207643_10159082 Ga0207643_101590822 276
967 3300025913 Ga0207695_10000979 Ga0207695_100009799 276
968 3300025913 Ga0207695_10001817 Ga0207695_1000181723 276
969 3300025913 Ga0207695_10002079 Ga0207695_1000207921 276
970 3300025913 Ga0207695_10082442 Ga0207695_100824424 276
971 3300025913 Ga0207695_10108766 Ga0207695_101087663 276
972 3300025913 Ga0207695_10550327 Ga0207695_105503271 276
973 3300025914 Ga0207671_10001710 Ga0207671_1000171015 276
974 3300025920 Ga0207649_10000477 Ga0207649_100004775 276
975 3300025923 Ga0207681_10012075 Ga0207681_100120755 276
976 3300025924 Ga0207694_10000069 Ga0207694_1000006979 276
977 3300025924 Ga0207694_10025608 Ga0207694_100256083 276
978 3300025925 Ga0207650_10001006 Ga0207650_100010067 276
979 3300025926 Ga0207659_10000488 Ga0207659_100004887 276
980 3300025931 Ga0207644_10043820 Ga0207644_100438203 276
981 3300025932 Ga0207690_10001542 Ga0207690_100015428 276
982 3300025936 Ga0207670_10137243 Ga0207670_101372433 276
983 3300025937 Ga0207669_10010185 Ga0207669_100101854 276
984 3300025938 Ga0207704_10164572 Ga0207704_101645722 276
985 3300025940 Ga0207691_10001925 Ga0207691_1000192513 276
986 3300025940 Ga0207691_10044567 Ga0207691_100445675 276
987 3300025942 Ga0207689_10032225 Ga0207689_100322256 276
988 3300025945 Ga0207679_10000012 Ga0207679_10000012114 276
989 3300025945 Ga0207679_10072028 Ga0207679_100720282 276
990 3300025949 Ga0207667_10000043 Ga0207667_10000043225 276
991 3300025949 Ga0207667_10025668 Ga0207667_100256684 276
992 3300025949 Ga0207667_10066892 Ga0207667_100668923 276
993 3300025949 Ga0207667_10268643 Ga0207667_102686432 276
994 3300025960 Ga0207651_10031644 Ga0207651_100316442 276
995 3300025960 Ga0207651_10062810 Ga0207651_100628103 276
996 3300025981 Ga0207640_10000012 Ga0207640_10000012210 276
997 3300025981 Ga0207640_10007512 Ga0207640_100075123 276
998 3300025986 Ga0207658_10534647 Ga0207658_105346471 276
999 3300026023 Ga0207677_10007613 Ga0207677_100076134 276
1000 3300026067 Ga0207678_10000009 Ga0207678_1000000925 276
1001 3300026067 Ga0207678_10006113 Ga0207678_100061135 276
1002 3300026067 Ga0207678_10584938 Ga0207678_105849382 276
1003 3300026078 Ga0207702_10000028 Ga0207702_10000028114 276
1004 3300026089 Ga0207648_10000054 Ga0207648_100000542 276
1005 3300026089 Ga0207648_10005336 Ga0207648_1000533614 276
1006 3300026089 Ga0207648_10008160 Ga0207648_1000816010 276
1007 3300026089 Ga0207648_10120747 Ga0207648_101207474 276
1008 3300026095 Ga0207676_10078899 Ga0207676_100788993 276
1009 3300026116 Ga0207674_10068252 Ga0207674_100682524 276
1010 3300026116 Ga0207674_10093730 Ga0207674_100937305 276
1011 3300026116 Ga0207674_10573987 Ga0207674_105739872 276
1012 3300026121 Ga0207683_10011037 Ga0207683_100110373 276
1013 3300026142 Ga0207698_10006654 Ga0207698_100066543 276
1014 3300026142 Ga0207698_10016463 Ga0207698_100164634 276
1015 3300026142 Ga0207698_10040883 Ga0207698_100408833 276
1016 3300027111 Ga0209281_1007147 Ga0209281_10071473 276
1017 3300027666 Ga0209282_1000021 Ga0209282_1000021162 276
1018 3300027876 Ga0209974_10090038 Ga0209974_100900381 276
1019 3300028794 Ga0307515_10041885 Ga0307515_100418852 276
1020 3300028800 Ga0265338_10000258 Ga0265338_1000025829 276
1021 3300028800 Ga0265338_10001135 Ga0265338_100011359 276
1022 3300029957 Ga0265324_10002038 Ga0265324_100020385 276
1023 3300029957 Ga0265324_10035527 Ga0265324_100355272 276
1024 3300031238 Ga0265332_10049707 Ga0265332_100497072 276
1025 3300031241 Ga0265325_10010371 Ga0265325_100103712 276
1026 3300031507 Ga0307509_10000032 Ga0307509_10000032106 276
1027 3300031548 Ga0307408_100037196 Ga0307408_1000371962 276
1028 3300031711 Ga0265314_10003091 Ga0265314_100030914 276
1029 3300031711 Ga0265314_10032720 Ga0265314_100327202 276
1030 3300031711 Ga0265314_10043851 Ga0265314_100438513 276
1031 3300031730 Ga0307516_10001972 Ga0307516_100019723 276
1032 3300031731 Ga0307405_10028317 Ga0307405_100283174 276
1033 3300031731 Ga0307405_10413528 Ga0307405_104135281 276
1034 3300031903 Ga0307407_10442262 Ga0307407_104422621 276
1035 3300031911 Ga0307412_10117010 Ga0307412_101170102 276
1036 3300031995 Ga0307409_100084584 Ga0307409_1000845842 276
1037 3300032002 Ga0307416_100032323 Ga0307416_1000323234 276
1038 3300032005 Ga0307411_10008111 Ga0307411_100081112 276
1039 3300032005 Ga0307411_10329331 Ga0307411_103293312 276
1040 3300033180 Ga0307510_10038927 Ga0307510_100389273 276
1041 3300033180 Ga0307510_10251756 Ga0307510_102517561 276
1042 3300035112 Ga0373932_0065646 Ga0373932_0065646_59_901 276
1043 3300035118 Ga0373954_0012937 Ga0373954_0012937_2097_2942 276
1044 3300037471 Ga0395905_0000176 Ga0395905_0000176_71075_71905 276
1045 3300037471 Ga0395905_0056444 Ga0395905_0056444_933_1763 276
1046 3300037471 Ga0395905_0099973 Ga0395905_0099973_1083_1937 276
1047 3300037471 Ga0395905_0182943 Ga0395905_0182943_1070_1903 276
1048 3300039447 Ga0436361_1048468 Ga0436361_1048468_89_919 276
1049 3300039453 Ga0436362_0709755 Ga0436362_0709755_282_1118 276
1050 3300041410 Ga0439461_0019390 Ga0439461_0019390_335_1183 276
1051 3300042876 Ga0451577_0000002 Ga0451577_0000002_1485083_1485922 276
1052 3300042876 Ga0451577_0001738 Ga0451577_0001738_16814_17659 276
1053 3300042876 Ga0451577_0002438 Ga0451577_0002438_20755_21606 276
1054 3300042876 Ga0451577_0174819 Ga0451577_0174819_366_1208 276
1055 3300042876 Ga0451577_0273374 Ga0451577_0273374_54_932 276
1056 3300042876 Ga0451577_0273461 Ga0451577_0273461_31_873 276
1057 3300042876 Ga0451577_0312740 Ga0451577_0312740_274_1119 276
1058 3300044650 Ga0466986_0063558 Ga0466986_0063558_1681_2511 276
1059 3300044656 Ga0466969_0000929 Ga0466969_0000929_7919_8749 276
1060 3300044656 Ga0466969_0044748 Ga0466969_0044748_267_1097 276
1061 3300044666 Ga0466977_0000690 Ga0466977_0000690_10092_10922 276
1062 3300044673 Ga0453683_0000013 Ga0453683_0000013_125640_126479 276
1063 3300044683 Ga0466965_0000237 Ga0466965_0000237_8658_9488 276
1064 3300044684 Ga0466966_0002735 Ga0466966_0002735_2295_3137 276
1065 3300044693 Ga0466961_0012022 Ga0466961_0012022_228_1058 276
1066 3300044693 Ga0466961_0142232 Ga0466961_0142232_571_1413 276
1067 3300044694 Ga0466963_0031985 Ga0466963_0031985_544_1374 276
1068 3300044712 Ga0453684_0000002 Ga0453684_0000002_245454_246293 276
1069 3300044712 Ga0453684_0093099 Ga0453684_0093099_1950_2807 276
1070 3300044719 Ga0466971_0002984 Ga0466971_0002984_4098_4928 276
1071 3300044735 Ga0466968_0004214 Ga0466968_0004214_1169_2011 276
1072 3300044765 Ga0466970_0027008 Ga0466970_0027008_853_1683 276
1073 3300044842 Ga0466957_0000447 Ga0466957_0000447_8176_9006 276
1074 3300044842 Ga0466957_0125266 Ga0466957_0125266_305_1135 276
1075 3300045049 Ga0466959_0027748 Ga0466959_0027748_2236_3066 276
1076 3300045049 Ga0466959_0073287 Ga0466959_0073287_507_1349 276
1077 3300045051 Ga0451576_0000037 Ga0451576_0000037_125881_126720 276
1078 3300045051 Ga0451576_0002464 Ga0451576_0002464_10303_11181 276
1079 3300045836 Ga0466958_0090299 Ga0466958_0090299_147_977 276
1080 3300046454 Ga0495592_0034924 Ga0495592_0034924_1292_2137 276
1081 3300046454 Ga0495592_0188472 Ga0495592_0188472_441_1295 276
1082 3300046462 Ga0495651_0005769 Ga0495651_0005769_6996_7838 276
1083 3300046462 Ga0495651_0072318 Ga0495651_0072318_518_1372 276
1084 3300046462 Ga0495651_0221611 Ga0495651_0221611_129_983 276
1085 3300046463 Ga0495653_0034300 Ga0495653_0034300_299_1153 276
1086 3300046473 Ga0495582_0042043 Ga0495582_0042043_932_1774 276
1087 3300046474 Ga0495605_0006736 Ga0495605_0006736_903_1733 276
1088 3300046500 Ga0495596_0000385 Ga0495596_0000385_889_1719 276
1089 3300046507 Ga0495606_0012870 Ga0495606_0012870_22_867 276
1090 3300046511 Ga0495608_0265627 Ga0495608_0265627_192_1046 276
1091 3300046512 Ga0495610_0009756 Ga0495610_0009756_4378_5208 276
1092 3300046513 Ga0495616_0003889 Ga0495616_0003889_888_1718 276
1093 3300046516 Ga0495628_0001234 Ga0495628_0001234_709_1551 276
1094 3300046516 Ga0495628_0048653 Ga0495628_0048653_762_1616 276
1095 3300046516 Ga0495628_0064766 Ga0495628_0064766_529_1383 276
1096 3300046517 Ga0495630_0041291 Ga0495630_0041291_592_1434 276
1097 3300046528 Ga0495642_0033764 Ga0495642_0033764_357_1205 276
1098 3300046529 Ga0495652_0223499 Ga0495652_0223499_212_1066 276
1099 3300046538 Ga0495609_0001940 Ga0495609_0001940_11737_12567 276
1100 3300046558 Ga0495633_0040028 Ga0495633_0040028_90_941 276
1101 3300046660 Ga0495625_0002966 Ga0495625_0002966_2562_3404 276
1102 3300046680 Ga0495646_0004580 Ga0495646_0004580_7038_7892 276
1103 3300046680 Ga0495646_0070868 Ga0495646_0070868_886_1740 276
1104 3300046809 Ga0495600_0065179 Ga0495600_0065179_589_1443 276
1105 3300047317 Ga0495604_0149320 Ga0495604_0149320_407_1261 276
1106 3300047318 Ga0495636_0008030 Ga0495636_0008030_1234_2064 276
1107 3300047673 Ga0495593_0056385 Ga0495593_0056385_982_1824 276
1108 3300048088 Ga0495602_0144374 Ga0495602_0144374_643_1485 276
1109 3300048088 Ga0495602_0170371 Ga0495602_0170371_243_1097 276
1110 3300048903 Ga0496100_0503784 Ga0496100_0503784_63_905 276
1111 3300048904 Ga0496101_0195147 Ga0496101_0195147_614_1480 276
1112 3300048905 Ga0496102_0027430 Ga0496102_0027430_3603_4433 276
1113 3300048906 Ga0496103_0055059 Ga0496103_0055059_134_964 276
1114 3300048907 Ga0496104_0314276 Ga0496104_0314276_146_976 276
1115 3300048907 Ga0496104_0481158 Ga0496104_0481158_232_1062 276
1116 3300048909 Ga0496106_0000011 Ga0496106_0000011_115885_116715 276
1117 3300048916 Ga0496113_0043484 Ga0496113_0043484_140_994 276
1118 3300048917 Ga0496114_0007646 Ga0496114_0007646_7165_8016 276
1119 3300048917 Ga0496114_0255612 Ga0496114_0255612_358_1194 276
1120 3300048919 Ga0496116_0021901 Ga0496116_0021901_3042_3884 276
1121 3300048920 Ga0496117_0028852 Ga0496117_0028852_361_1191 276
1122 3300048921 Ga0496118_0041792 Ga0496118_0041792_523_1353 276
1123 3300048921 Ga0496118_0101239 Ga0496118_0101239_450_1280 276
1124 3300048921 Ga0496118_0156283 Ga0496118_0156283_24_866 276
1125 3300048922 Ga0496119_0110012 Ga0496119_0110012_314_1144 276
1126 3300048924 Ga0496121_0010887 Ga0496121_0010887_878_1723 276
1127 3300048924 Ga0496121_0023777 Ga0496121_0023777_2638_3468 276
1128 3300048924 Ga0496121_0042796 Ga0496121_0042796_2236_3066 276
1129 3300048924 Ga0496121_0137378 Ga0496121_0137378_724_1566 276
1130 3300048925 Ga0496122_0003149 Ga0496122_0003149_20291_21133 276
1131 3300048925 Ga0496122_0021327 Ga0496122_0021327_897_1727 276
1132 3300048926 Ga0496123_0000916 Ga0496123_0000916_20176_21018 276
1133 3300048926 Ga0496123_0027948 Ga0496123_0027948_857_1687 276
1134 3300048928 Ga0496125_0004292 Ga0496125_0004292_1925_2767 276
1135 3300048929 Ga0496126_0002068 Ga0496126_0002068_26675_27505 276
1136 3300048929 Ga0496126_0194871 Ga0496126_0194871_306_1157 276
1137 3300049515 Ga0501292_005344 Ga0501292_005344_193_1044 276
1138 3300049520 Ga0501297_001705 Ga0501297_001705_114_965 276
1139 3300049571 Ga0501034_0000092 Ga0501034_0000092_7956_8786 276
1140 3300049579 Ga0501043_0000058 Ga0501043_0000058_1490_2329 276
1141 3300049579 Ga0501043_0104737 Ga0501043_0104737_39_869 276
1142 3300049580 Ga0501046_0000051 Ga0501046_0000051_99749_100588 276
1143 3300049581 Ga0501047_0000003 Ga0501047_0000003_407816_408655 276
1144 3300049582 Ga0501048_0000321 Ga0501048_0000321_1150_1989 276
1145 3300049649 Ga0501198_000007 Ga0501198_000007_27944_28795 276
1146 3300049662 Ga0501222_000005 Ga0501222_000005_100949_101800 276
1147 3300049822 Ga0501035_0007072 Ga0501035_0007072_2475_3317 276
1148 3300049823 Ga0501044_0013104 Ga0501044_0013104_5611_6453 276
1149 3300049824 Ga0501045_0075630 Ga0501045_0075630_1285_2124 276
1150 3300050493 nmdc:mga0k408_4315_c1 nmdc:mga0k408_4315_c1_5267_6124 276
1151 3300050508 nmdc:mga09592_819_c1 nmdc:mga09592_819_c1_1698_2549 276
1152 3300050509 nmdc:mga0qj67_191552_c1 nmdc:mga0qj67_191552_c1_641_1492 276
1153 3300053091 Ga0500647_0117247 Ga0500647_0117247_105_947 276
1154 3300053119 Ga0500595_003933 Ga0500595_003933_392_1246 276
1155 3300053125 Ga0500618_000765 Ga0500618_000765_782_1630 276
1156 3300053125 Ga0500618_001461 Ga0500618_001461_997_1839 276
1157 3300053148 Ga0500590_023706 Ga0500590_023706_595_1440 276
1158 3300059604 Ga0587098_001158 Ga0587098_001158_472_1302 276
1159 3300059640 Ga0587067_000132 Ga0587067_000132_1301_2131 276
1160 3300059643 Ga0587072_000426 Ga0587072_000426_2619_3449 276
1161 iso_pu_bacteria 2818991436 2819542336 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02219

MTHFR

Methylenetetrahydrofolate reductase

4

278

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zpt-assembly1.cif.gz_A escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25 0.9621 3 275
7th5-assembly1.cif.gz_B thermus thermophilus methylenetetrahydrofolate reductase 0.958 1 275
8eac-assembly1.cif.gz_B thermus thermophilus methylenetetrahydrofolate reductase 0.9562 4 275
3fst-assembly1.cif.gz_C crystal structure of escherichia coli methylenetetrahydrofolate reductase mutant phe223leu at ph 7.4 0.9556 4 275
3fst-assembly1.cif.gz_E crystal structure of escherichia coli methylenetetrahydrofolate reductase mutant phe223leu at ph 7.4 0.9529 3 275
ID Description Score Start End Superfamily
1v93A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9509 4 276 3.20.20.220
1zp3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9434 3 275 3.20.20.220
af_Q75HE6_1_304_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9397 4 275 3.20.20.220
af_Q5AEI0_1_296_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9391 2 275 3.20.20.220
1v93A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9375 4 276 3.20.20.220
ID Description Score Start End GO Terms
AF-A0A537CWC8-F1-model_v4 Methylenetetrahydrofolate reductase 0.9983 166 275 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A3D2SPX2-F1-model_v4 Methylenetetrahydrofolate reductase 0.9983 166 275 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A3D0SQY7-F1-model_v4 Methylenetetrahydrofolate reductase 0.9981 163 276 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A4V1TXD1-F1-model_v4 Methylenetetrahydrofolate reductase 0.9927 150 275 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A3D0K3A7-F1-model_v4 deleted 0.9911 187 276

Feature Viewer

pLDDT pTM Quality
91.12 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map