F490968
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1158 | 472 | 1143 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300025294|Ga0209025_1066093|Ga0209025_10660931 |
| Length | 311 |
| Sequence | MHCTQALTALARPALPWHAKYRRGCAPFVTDKVFMFSAISPGELAFLAASLIVAGAITGILAGLFGVGGGAVIVPILYEIFRIIGVPEEVRMPLCVGTSLAIIIPTSIRSFNAHRAKGLVDLSILKIWAVPVVLGVLAGSYIARFAPPDLFKIIFVLVAVLSALRLLFAADKWKFGEDLPGKPVMVGYGGLIGVLSALMGIGGGQLSSLFMTFYGRPIHQAIATSSGLGVLISIPGALGFIYAGWPKMDLLPPLSLGYVSFIGFLLFIPTSIWMAPVGARMAHRLSKRKLEVVFGIFLLTVAGRFIWSLLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 3 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 4 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 5 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 6 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 7 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 8 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 9 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 10 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 11 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 12 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 13 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 14 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 15 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 16 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 17 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 18 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 19 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 20 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 21 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 22 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 25 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 26 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 27 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 28 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 29 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 30 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 31 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 32 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 33 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 34 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 38 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 39 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 42 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 51 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 85 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 87 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 99 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 101 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 102 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 103 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 105 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 106 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 107 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 108 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 109 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 110 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 111 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 112 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 113 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 114 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 115 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 116 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 117 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 118 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 119 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 121 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 122 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 123 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 127 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 128 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 130 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 131 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 132 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 133 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 134 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 135 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 136 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 137 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 138 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 139 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 141 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 157 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 161 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 173 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 174 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 256 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 257 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 261 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 262 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 263 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 264 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 265 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 266 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 267 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 268 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 269 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 270 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 271 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 272 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 273 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 274 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 275 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 276 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 277 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 278 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 279 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 280 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 281 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 282 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 283 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 284 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 286 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 289 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 290 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 291 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 292 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 293 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 294 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 295 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 297 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 299 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 302 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 303 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 304 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 305 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 306 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 307 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 308 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 309 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 311 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 312 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 313 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 314 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 315 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 316 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 317 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 318 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 319 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 320 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 321 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 322 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 323 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 324 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 325 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 326 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 391 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 392 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 393 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 394 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 395 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 396 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 399 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 400 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 401 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 402 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 403 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 404 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 405 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 406 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 407 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 408 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 435 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 436 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 437 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 438 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 439 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 440 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 452 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 455 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 456 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 457 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 458 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 459 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 460 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 461 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 462 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 463 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 464 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 465 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 466 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 467 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 470 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 471 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 472 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.7 |
| Metatranscriptomes | 0 |
| Isolates | 1.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.53 |
| Nodule | 0.52 |
| Rhizoplane | 4.66 |
| Rhizosphere | 87.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214767425 | 2209111006 | Bacteria | 2786 |
| 2 | ARcpr5oldR_c000015 | 3300000041 | Bacteria | 37040 |
| 3 | ARSoilYngRDRAFT_c00006 | 3300000042 | Bacteria | 34836 |
| 4 | ARcpr5yngRDRAFT_c000041 | 3300000043 | Bacteria | 20456 |
| 5 | ARSoilOldRDRAFT_c000020 | 3300000044 | Bacteria | 36475 |
| 6 | ARCol0oldRDRAFT_c00041 | 3300000045 | Bacteria | 9974 |
| 7 | ARCol0yngRDRAFT_1000465 | 3300000652 | Bacteria | 4874 |
| 8 | JGI24746J21847_1001428 | 3300001977 | Bacteria | 3802 |
| 9 | JGI24747J21853_1002861 | 3300001978 | Unclassified | 1451 |
| 10 | JGI24739J22299_10000344 | 3300001989 | Bacteria | 15875 |
| 11 | JGI24737J22298_10000203 | 3300001990 | Bacteria | 19319 |
| 12 | JGI24737J22298_10023970 | 3300001990 | Bacteria | 1933 |
| 13 | JGI24750J21931_1000159 | 3300002070 | Bacteria | 11336 |
| 14 | JGI24745J21846_1000003 | 3300002073 | Bacteria | 15974 |
| 15 | JGI24748J21848_1000190 | 3300002074 | Bacteria | 7872 |
| 16 | JGI24738J21930_10000042 | 3300002075 | Bacteria | 24954 |
| 17 | JGI24749J21850_1000350 | 3300002076 | Bacteria | 6870 |
| 18 | JGI24035J26624_1000010 | 3300002126 | Bacteria | 13491 |
| 19 | JGI24742J22300_10000016 | 3300002244 | Bacteria | 26706 |
| 20 | JGI25159J45721_1004563 | 3300002987 | Bacteria | 4563 |
| 21 | JGI25151J46595_10000040 | 3300003187 | Bacteria | 176750 |
| 22 | JGI25404J52841_10000207 | 3300003659 | Bacteria | 7108 |
| 23 | Ga0055526_1000351 | 3300003771 | Bacteria | 37413 |
| 24 | Ga0055526_1001693 | 3300003771 | Bacteria | 15409 |
| 25 | Ga0055526_1003504 | 3300003771 | Bacteria | 9924 |
| 26 | Ga0055524_1000023 | 3300003775 | Bacteria | 221408 |
| 27 | JGI25405J52794_10003103 | 3300003911 | Bacteria | 2892 |
| 28 | Ga0065165_1000218 | 3300005262 | Bacteria | 100161 |
| 29 | Ga0065717_1002525 | 3300005276 | Bacteria | 1865 |
| 30 | Ga0065716_1002178 | 3300005277 | Bacteria | 2134 |
| 31 | Ga0065704_10073457 | 3300005289 | Bacteria | 7145 |
| 32 | Ga0065712_10002616 | 3300005290 | Bacteria | 7662 |
| 33 | Ga0065712_10068673 | 3300005290 | Bacteria | 9438 |
| 34 | Ga0065712_10116506 | 3300005290 | Bacteria | 1735 |
| 35 | Ga0065712_10119855 | 3300005290 | Bacteria | 1682 |
| 36 | Ga0065715_10001423 | 3300005293 | Bacteria | 13648 |
| 37 | Ga0065715_10088987 | 3300005293 | Bacteria | 18087 |
| 38 | Ga0065715_10200234 | 3300005293 | Unclassified | 1365 |
| 39 | Ga0065707_10107116 | 3300005295 | Bacteria | 2568 |
| 40 | Ga0070658_10146191 | 3300005327 | Bacteria | 1977 |
| 41 | Ga0070658_10344368 | 3300005327 | Bacteria | 1275 |
| 42 | Ga0070676_10000784 | 3300005328 | Bacteria | 15682 |
| 43 | Ga0070676_10016846 | 3300005328 | Bacteria | 4040 |
| 44 | Ga0070683_100000114 | 3300005329 | Bacteria | 52980 |
| 45 | Ga0070683_100088017 | 3300005329 | Bacteria | 2913 |
| 46 | Ga0070683_100173151 | 3300005329 | Bacteria | 2049 |
| 47 | Ga0070683_100232230 | 3300005329 | Bacteria | 1754 |
| 48 | Ga0070683_100335950 | 3300005329 | Unclassified | 1438 |
| 49 | Ga0070690_100000064 | 3300005330 | Bacteria | 53027 |
| 50 | Ga0070690_100015359 | 3300005330 | Plasmid | 4566 |
| 51 | Ga0070690_100056719 | 3300005330 | Bacteria | 2512 |
| 52 | Ga0070670_100002373 | 3300005331 | Bacteria | 15518 |
| 53 | Ga0070670_100005338 | 3300005331 | Bacteria | 10835 |
| 54 | Ga0070670_100054895 | 3300005331 | Bacteria | 3420 |
| 55 | Ga0070670_100509442 | 3300005331 | Bacteria | 1071 |
| 56 | Ga0070670_100524850 | 3300005331 | Unclassified | 1055 |
| 57 | Ga0070677_10000193 | 3300005333 | Bacteria | 20923 |
| 58 | Ga0068869_100000020 | 3300005334 | Bacteria | 66561 |
| 59 | Ga0070666_10005751 | 3300005335 | Bacteria | 7616 |
| 60 | Ga0070680_100000242 | 3300005336 | Bacteria | 36144 |
| 61 | Ga0070680_100049833 | 3300005336 | Bacteria | 3415 |
| 62 | Ga0070680_100059770 | 3300005336 | Bacteria | 3119 |
| 63 | Ga0070680_100192106 | 3300005336 | Bacteria | 1720 |
| 64 | Ga0070680_100362109 | 3300005336 | Bacteria | 1234 |
| 65 | Ga0070682_100000224 | 3300005337 | Bacteria | 41040 |
| 66 | Ga0070682_100016367 | 3300005337 | Bacteria | 4310 |
| 67 | Ga0070682_100075915 | 3300005337 | Unclassified | 2162 |
| 68 | Ga0070682_100318486 | 3300005337 | Bacteria | 1148 |
| 69 | Ga0068868_100003038 | 3300005338 | Bacteria | 11683 |
| 70 | Ga0068868_100005421 | 3300005338 | Bacteria | 8962 |
| 71 | Ga0068868_100327527 | 3300005338 | Bacteria | 1306 |
| 72 | Ga0070660_100000123 | 3300005339 | Bacteria | 48796 |
| 73 | Ga0070660_100075002 | 3300005339 | Bacteria | 2647 |
| 74 | Ga0070660_100480214 | 3300005339 | Unclassified | 1033 |
| 75 | Ga0070689_100000685 | 3300005340 | Bacteria | 20556 |
| 76 | Ga0070689_100010928 | 3300005340 | Bacteria | 6487 |
| 77 | Ga0070691_10001254 | 3300005341 | Bacteria | 10708 |
| 78 | Ga0070691_10088293 | 3300005341 | Bacteria | 1526 |
| 79 | Ga0070687_100000351 | 3300005343 | Bacteria | 15646 |
| 80 | Ga0070687_100016686 | 3300005343 | Bacteria | 3358 |
| 81 | Ga0070661_100000039 | 3300005344 | Bacteria | 102990 |
| 82 | Ga0070661_100144629 | 3300005344 | Bacteria | 1794 |
| 83 | Ga0070692_10062423 | 3300005345 | Bacteria | 1966 |
| 84 | Ga0070668_100003586 | 3300005347 | Bacteria | 11452 |
| 85 | Ga0070668_100128113 | 3300005347 | Unclassified | 2035 |
| 86 | Ga0070669_100000176 | 3300005353 | Bacteria | 55540 |
| 87 | Ga0070669_100073632 | 3300005353 | Bacteria | 2531 |
| 88 | Ga0070669_100204124 | 3300005353 | Bacteria | 1557 |
| 89 | Ga0070675_100000259 | 3300005354 | Bacteria | 34661 |
| 90 | Ga0070675_100254869 | 3300005354 | Bacteria | 1536 |
| 91 | Ga0070671_100005757 | 3300005355 | Bacteria | 9872 |
| 92 | Ga0070674_100000099 | 3300005356 | Bacteria | 40231 |
| 93 | Ga0070674_100018430 | 3300005356 | Bacteria | 4414 |
| 94 | Ga0070674_100193057 | 3300005356 | Bacteria | 1568 |
| 95 | Ga0070673_100018362 | 3300005364 | Bacteria | 4993 |
| 96 | Ga0070673_100359816 | 3300005364 | Bacteria | 1293 |
| 97 | Ga0070688_100000329 | 3300005365 | Bacteria | 24316 |
| 98 | Ga0070688_100050563 | 3300005365 | Bacteria | 2590 |
| 99 | Ga0070688_100207204 | 3300005365 | Bacteria | 1375 |
| 100 | Ga0070688_100368481 | 3300005365 | Bacteria | 1056 |
| 101 | Ga0070659_100005453 | 3300005366 | Bacteria | 9138 |
| 102 | Ga0070659_100094545 | 3300005366 | Bacteria | 2400 |
| 103 | Ga0070659_100323349 | 3300005366 | Bacteria | 1290 |
| 104 | Ga0070667_100001075 | 3300005367 | Bacteria | 24994 |
| 105 | Ga0070667_100021496 | 3300005367 | Bacteria | 5356 |
| 106 | Ga0070667_100267163 | 3300005367 | Bacteria | 1533 |
| 107 | Ga0070709_10002443 | 3300005434 | Bacteria | 10067 |
| 108 | Ga0070709_10029823 | 3300005434 | Bacteria | 3267 |
| 109 | Ga0070709_10205339 | 3300005434 | Bacteria | 1398 |
| 110 | Ga0070709_10221187 | 3300005434 | Bacteria | 1350 |
| 111 | Ga0070714_100015432 | 3300005435 | Bacteria | 6147 |
| 112 | Ga0070714_100015694 | 3300005435 | Bacteria | 6098 |
| 113 | Ga0070714_100035280 | 3300005435 | Bacteria | 4191 |
| 114 | Ga0070714_100043358 | 3300005435 | Bacteria | 3804 |
| 115 | Ga0070714_100138726 | 3300005435 | Bacteria | 2180 |
| 116 | Ga0070714_100311042 | 3300005435 | Bacteria | 1471 |
| 117 | Ga0070714_100543000 | 3300005435 | Bacteria | 1112 |
| 118 | Ga0070713_100000654 | 3300005436 | Bacteria | 22167 |
| 119 | Ga0070713_100001555 | 3300005436 | Bacteria | 14678 |
| 120 | Ga0070713_100014148 | 3300005436 | Bacteria | 5912 |
| 121 | Ga0070713_100060404 | 3300005436 | Bacteria | 3168 |
| 122 | Ga0070713_100066169 | 3300005436 | Bacteria | 3038 |
| 123 | Ga0070710_10000619 | 3300005437 | Bacteria | 16925 |
| 124 | Ga0070710_10003937 | 3300005437 | Bacteria | 7037 |
| 125 | Ga0070710_10025993 | 3300005437 | Bacteria | 3106 |
| 126 | Ga0070710_10044111 | 3300005437 | Bacteria | 2473 |
| 127 | Ga0070701_10000025 | 3300005438 | Bacteria | 38966 |
| 128 | Ga0070711_100010734 | 3300005439 | Bacteria | 5677 |
| 129 | Ga0070711_100024053 | 3300005439 | Bacteria | 3969 |
| 130 | Ga0070711_100041441 | 3300005439 | Bacteria | 3110 |
| 131 | Ga0070711_100058358 | 3300005439 | Bacteria | 2676 |
| 132 | Ga0070711_100073806 | 3300005439 | Bacteria | 2412 |
| 133 | Ga0070711_100090065 | 3300005439 | Bacteria | 2208 |
| 134 | Ga0070711_100138772 | 3300005439 | Bacteria | 1820 |
| 135 | Ga0070705_100037650 | 3300005440 | Bacteria | 2730 |
| 136 | Ga0070705_100130307 | 3300005440 | Bacteria | 1639 |
| 137 | Ga0070700_100002215 | 3300005441 | Bacteria | 9887 |
| 138 | Ga0070694_100006957 | 3300005444 | Bacteria | 6869 |
| 139 | Ga0070708_100023192 | 3300005445 | Bacteria | 5274 |
| 140 | Ga0070663_100000064 | 3300005455 | Bacteria | 45232 |
| 141 | Ga0070663_100014208 | 3300005455 | Bacteria | 5105 |
| 142 | Ga0070663_100060234 | 3300005455 | Bacteria | 2730 |
| 143 | Ga0070678_100001526 | 3300005456 | Bacteria | 12364 |
| 144 | Ga0070678_100043310 | 3300005456 | Bacteria | 3205 |
| 145 | Ga0070678_100043991 | 3300005456 | Bacteria | 3185 |
| 146 | Ga0070662_100023064 | 3300005457 | Bacteria | 4271 |
| 147 | Ga0070662_100025880 | 3300005457 | Bacteria | 4057 |
| 148 | Ga0070662_100051625 | 3300005457 | Bacteria | 2970 |
| 149 | Ga0070662_100141585 | 3300005457 | Bacteria | 1864 |
| 150 | Ga0070662_100271400 | 3300005457 | Bacteria | 1370 |
| 151 | Ga0070662_100448009 | 3300005457 | Bacteria | 1071 |
| 152 | Ga0070681_10000435 | 3300005458 | Bacteria | 33975 |
| 153 | Ga0070681_10032023 | 3300005458 | Bacteria | 5278 |
| 154 | Ga0070681_10051421 | 3300005458 | Bacteria | 4110 |
| 155 | Ga0070681_10063320 | 3300005458 | Bacteria | 3670 |
| 156 | Ga0070681_10074981 | 3300005458 | Bacteria | 3343 |
| 157 | Ga0070681_10125790 | 3300005458 | Bacteria | 2496 |
| 158 | Ga0068867_100002108 | 3300005459 | Bacteria | 13947 |
| 159 | Ga0068867_100025717 | 3300005459 | Bacteria | 4225 |
| 160 | Ga0070685_10003445 | 3300005466 | Bacteria | 8045 |
| 161 | Ga0070685_10012156 | 3300005466 | Bacteria | 4516 |
| 162 | Ga0074259_10047191 | 3300005507 | Bacteria | 1695 |
| 163 | Ga0070699_100361940 | 3300005518 | Bacteria | 1308 |
| 164 | Ga0070679_100002876 | 3300005530 | Bacteria | 15657 |
| 165 | Ga0070679_100117245 | 3300005530 | Bacteria | 2647 |
| 166 | Ga0070684_100001610 | 3300005535 | Bacteria | 16308 |
| 167 | Ga0070684_100142642 | 3300005535 | Bacteria | 2167 |
| 168 | Ga0070684_100178374 | 3300005535 | Bacteria | 1931 |
| 169 | Ga0070684_100207569 | 3300005535 | Bacteria | 1785 |
| 170 | Ga0070684_100359223 | 3300005535 | Bacteria | 1340 |
| 171 | Ga0068853_100005553 | 3300005539 | Bacteria | 9895 |
| 172 | Ga0068853_100323476 | 3300005539 | Bacteria | 1430 |
| 173 | Ga0070672_100000011 | 3300005543 | Bacteria | 80761 |
| 174 | Ga0070672_100129130 | 3300005543 | Bacteria | 2076 |
| 175 | Ga0070672_100263855 | 3300005543 | Bacteria | 1453 |
| 176 | Ga0070672_100304859 | 3300005543 | Bacteria | 1351 |
| 177 | Ga0070686_100000076 | 3300005544 | Bacteria | 71207 |
| 178 | Ga0070686_100002194 | 3300005544 | Bacteria | 10784 |
| 179 | Ga0070686_100067747 | 3300005544 | Bacteria | 2327 |
| 180 | Ga0070686_100115683 | 3300005544 | Bacteria | 1834 |
| 181 | Ga0070695_100003381 | 3300005545 | Bacteria | 9327 |
| 182 | Ga0070695_100018163 | 3300005545 | Bacteria | 4269 |
| 183 | Ga0070695_100025754 | 3300005545 | Bacteria | 3634 |
| 184 | Ga0070695_100237271 | 3300005545 | Bacteria | 1321 |
| 185 | Ga0070696_100038461 | 3300005546 | Bacteria | 3302 |
| 186 | Ga0070693_100000122 | 3300005547 | Bacteria | 34819 |
| 187 | Ga0070693_100074358 | 3300005547 | Bacteria | 2010 |
| 188 | Ga0070665_100034452 | 3300005548 | Bacteria | 5092 |
| 189 | Ga0070704_100002018 | 3300005549 | Bacteria | 11242 |
| 190 | Ga0070704_100008020 | 3300005549 | Bacteria | 6307 |
| 191 | Ga0070704_100017468 | 3300005549 | Bacteria | 4562 |
| 192 | Ga0070704_100051139 | 3300005549 | Bacteria | 2908 |
| 193 | Ga0070704_100105130 | 3300005549 | Bacteria | 2137 |
| 194 | Ga0068855_100035734 | 3300005563 | Bacteria | 5918 |
| 195 | Ga0068855_100246086 | 3300005563 | Bacteria | 1996 |
| 196 | Ga0070664_100000112 | 3300005564 | Bacteria | 53506 |
| 197 | Ga0070664_100227925 | 3300005564 | Bacteria | 1669 |
| 198 | Ga0070664_100320227 | 3300005564 | Unclassified | 1405 |
| 199 | Ga0070664_100483617 | 3300005564 | Bacteria | 1139 |
| 200 | Ga0068857_100000023 | 3300005577 | Bacteria | 86999 |
| 201 | Ga0068854_100004158 | 3300005578 | Bacteria | 9099 |
| 202 | Ga0068856_100000099 | 3300005614 | Bacteria | 83061 |
| 203 | Ga0068856_100127057 | 3300005614 | Unclassified | 2553 |
| 204 | Ga0068856_100169702 | 3300005614 | Unclassified | 2194 |
| 205 | Ga0068856_100907814 | 3300005614 | Unclassified | 900 |
| 206 | Ga0070702_100000005 | 3300005615 | Bacteria | 70200 |
| 207 | Ga0070702_100021306 | 3300005615 | Plasmid | 3408 |
| 208 | Ga0068852_100004502 | 3300005616 | Bacteria | 9856 |
| 209 | Ga0068852_100085751 | 3300005616 | Bacteria | 2806 |
| 210 | Ga0068852_100262158 | 3300005616 | Bacteria | 1660 |
| 211 | Ga0068852_100283878 | 3300005616 | Bacteria | 1597 |
| 212 | Ga0068859_100000503 | 3300005617 | Bacteria | 38475 |
| 213 | Ga0068859_100039458 | 3300005617 | Plasmid | 4736 |
| 214 | Ga0068859_100040577 | 3300005617 | Bacteria | 4671 |
| 215 | Ga0068859_100611665 | 3300005617 | Bacteria | 1182 |
| 216 | Ga0068864_100000112 | 3300005618 | Bacteria | 79688 |
| 217 | Ga0068864_100018108 | 3300005618 | Bacteria | 5878 |
| 218 | Ga0068864_100308582 | 3300005618 | Bacteria | 1483 |
| 219 | Ga0068864_100574723 | 3300005618 | Unclassified | 1091 |
| 220 | Ga0068866_10000977 | 3300005718 | Bacteria | 12586 |
| 221 | Ga0068866_10008375 | 3300005718 | Bacteria | 4356 |
| 222 | Ga0068866_10106410 | 3300005718 | Bacteria | 1557 |
| 223 | Ga0068861_100002096 | 3300005719 | Bacteria | 12937 |
| 224 | Ga0068861_100118714 | 3300005719 | Bacteria | 2131 |
| 225 | Ga0068851_10097376 | 3300005834 | Bacteria | 1557 |
| 226 | Ga0068870_10000021 | 3300005840 | Bacteria | 56319 |
| 227 | Ga0068870_10087663 | 3300005840 | Bacteria | 1733 |
| 228 | Ga0068863_100000227 | 3300005841 | Bacteria | 59675 |
| 229 | Ga0068863_100076196 | 3300005841 | Unclassified | 3173 |
| 230 | Ga0068858_100120781 | 3300005842 | Unclassified | 2450 |
| 231 | Ga0068858_100353397 | 3300005842 | Bacteria | 1408 |
| 232 | Ga0068858_100495126 | 3300005842 | Bacteria | 1180 |
| 233 | Ga0068860_100000511 | 3300005843 | Bacteria | 47927 |
| 234 | Ga0068860_100201784 | 3300005843 | Bacteria | 1927 |
| 235 | Ga0068860_100345907 | 3300005843 | Bacteria | 1463 |
| 236 | Ga0068860_100577693 | 3300005843 | Bacteria | 1128 |
| 237 | Ga0068862_100001866 | 3300005844 | Bacteria | 19089 |
| 238 | Ga0068862_100340316 | 3300005844 | Bacteria | 1389 |
| 239 | Ga0068862_100437335 | 3300005844 | Bacteria | 1230 |
| 240 | Ga0081455_10000153 | 3300005937 | Bacteria | 83186 |
| 241 | Ga0081455_10002775 | 3300005937 | Bacteria | 20627 |
| 242 | Ga0081455_10192128 | 3300005937 | Bacteria | 1536 |
| 243 | Ga0081538_10047178 | 3300005981 | Bacteria | 2645 |
| 244 | Ga0081540_1000008 | 3300005983 | Bacteria | 203702 |
| 245 | Ga0081540_1001662 | 3300005983 | Bacteria | 18923 |
| 246 | Ga0081540_1012674 | 3300005983 | Bacteria | 5531 |
| 247 | Ga0081540_1052135 | 3300005983 | Bacteria | 2017 |
| 248 | Ga0081539_10000423 | 3300005985 | Bacteria | 89970 |
| 249 | Ga0070717_10349038 | 3300006028 | Bacteria | 1323 |
| 250 | Ga0075365_10004253 | 3300006038 | Bacteria | 7549 |
| 251 | Ga0075365_10054906 | 3300006038 | Bacteria | 2643 |
| 252 | Ga0075365_10230580 | 3300006038 | Bacteria | 1300 |
| 253 | Ga0075365_10234229 | 3300006038 | Bacteria | 1289 |
| 254 | Ga0075365_10247944 | 3300006038 | Bacteria | 1251 |
| 255 | Ga0075363_100010796 | 3300006048 | Bacteria | 4354 |
| 256 | Ga0075363_100115199 | 3300006048 | Bacteria | 1496 |
| 257 | Ga0075432_10004763 | 3300006058 | Bacteria | 4618 |
| 258 | Ga0070715_10012842 | 3300006163 | Unclassified | 3060 |
| 259 | Ga0070715_10071977 | 3300006163 | Bacteria | 1547 |
| 260 | Ga0070716_100015557 | 3300006173 | Bacteria | 3912 |
| 261 | Ga0070716_100054784 | 3300006173 | Unclassified | 2279 |
| 262 | Ga0070712_100054314 | 3300006175 | Unclassified | 2800 |
| 263 | Ga0070712_100205026 | 3300006175 | Bacteria | 1552 |
| 264 | Ga0075367_10003172 | 3300006178 | Bacteria | 7754 |
| 265 | Ga0075367_10003813 | 3300006178 | Bacteria | 7267 |
| 266 | Ga0075367_10045316 | 3300006178 | Bacteria | 2581 |
| 267 | Ga0075367_10052558 | 3300006178 | Bacteria | 2412 |
| 268 | Ga0075366_10185370 | 3300006195 | Bacteria | 1264 |
| 269 | Ga0097621_100000013 | 3300006237 | Bacteria | 103062 |
| 270 | Ga0097621_100001495 | 3300006237 | Bacteria | 16032 |
| 271 | Ga0097621_100038999 | 3300006237 | Bacteria | 3814 |
| 272 | Ga0075370_10036683 | 3300006353 | Bacteria | 2754 |
| 273 | Ga0075370_10038169 | 3300006353 | Bacteria | 2703 |
| 274 | Ga0068871_100000064 | 3300006358 | Bacteria | 58283 |
| 275 | Ga0068871_100023154 | 3300006358 | Bacteria | 4799 |
| 276 | Ga0068871_100035623 | 3300006358 | Bacteria | 3956 |
| 277 | Ga0075428_100067278 | 3300006844 | Bacteria | 3922 |
| 278 | Ga0075428_100435492 | 3300006844 | Bacteria | 1405 |
| 279 | Ga0075430_100000646 | 3300006846 | Bacteria | 26596 |
| 280 | Ga0075430_100040915 | 3300006846 | Bacteria | 3922 |
| 281 | Ga0075430_100300780 | 3300006846 | Bacteria | 1327 |
| 282 | Ga0075431_100096301 | 3300006847 | Bacteria | 3055 |
| 283 | Ga0075431_100189975 | 3300006847 | Bacteria | 2105 |
| 284 | Ga0075433_10003920 | 3300006852 | Bacteria | 11526 |
| 285 | Ga0075433_10209676 | 3300006852 | Bacteria | 1732 |
| 286 | Ga0075433_10245366 | 3300006852 | Unclassified | 1590 |
| 287 | Ga0075434_100000109 | 3300006871 | Bacteria | 46918 |
| 288 | Ga0075434_100043968 | 3300006871 | Bacteria | 4431 |
| 289 | Ga0075434_100068843 | 3300006871 | Bacteria | 3527 |
| 290 | Ga0075434_100095466 | 3300006871 | Bacteria | 2979 |
| 291 | Ga0075429_100041545 | 3300006880 | Bacteria | 4005 |
| 292 | Ga0068865_100000088 | 3300006881 | Bacteria | 48315 |
| 293 | Ga0068865_100010435 | 3300006881 | Bacteria | 5782 |
| 294 | Ga0068865_100097144 | 3300006881 | Bacteria | 2149 |
| 295 | Ga0068865_100337805 | 3300006881 | Bacteria | 1216 |
| 296 | Ga0075436_100021761 | 3300006914 | Bacteria | 4401 |
| 297 | Ga0075436_100162541 | 3300006914 | Bacteria | 1574 |
| 298 | Ga0075436_100206844 | 3300006914 | Bacteria | 1391 |
| 299 | Ga0097620_100000503 | 3300006931 | Bacteria | 38475 |
| 300 | Ga0097620_100039461 | 3300006931 | Plasmid | 4736 |
| 301 | Ga0097620_100040574 | 3300006931 | Bacteria | 4671 |
| 302 | Ga0097620_100611664 | 3300006931 | Bacteria | 1182 |
| 303 | Ga0075435_100072374 | 3300007076 | Bacteria | 2816 |
| 304 | Ga0075435_100093336 | 3300007076 | Bacteria | 2487 |
| 305 | Ga0075435_100119913 | 3300007076 | Bacteria | 2194 |
| 306 | Ga0105251_10010716 | 3300009011 | Bacteria | 5288 |
| 307 | Ga0105240_10017252 | 3300009093 | Bacteria | 9739 |
| 308 | Ga0105240_10296212 | 3300009093 | Bacteria | 1852 |
| 309 | Ga0111539_10000196 | 3300009094 | Bacteria | 70998 |
| 310 | Ga0111539_10000376 | 3300009094 | Bacteria | 55320 |
| 311 | Ga0111539_10001836 | 3300009094 | Bacteria | 28237 |
| 312 | Ga0111539_10168910 | 3300009094 | Bacteria | 2556 |
| 313 | Ga0111539_10413268 | 3300009094 | Bacteria | 1571 |
| 314 | Ga0105245_10001381 | 3300009098 | Bacteria | 21973 |
| 315 | Ga0105245_10150658 | 3300009098 | Bacteria | 2199 |
| 316 | Ga0105245_10182194 | 3300009098 | Unclassified | 2007 |
| 317 | Ga0105247_10010673 | 3300009101 | Bacteria | 5546 |
| 318 | Ga0105247_10057028 | 3300009101 | Bacteria | 2414 |
| 319 | Ga0114129_10029360 | 3300009147 | Bacteria | 7790 |
| 320 | Ga0114129_10157162 | 3300009147 | Bacteria | 3108 |
| 321 | Ga0114129_10179567 | 3300009147 | Bacteria | 2882 |
| 322 | Ga0105243_10002817 | 3300009148 | Bacteria | 14441 |
| 323 | Ga0105243_10200057 | 3300009148 | Bacteria | 1751 |
| 324 | Ga0105241_10007352 | 3300009174 | Bacteria | 8100 |
| 325 | Ga0105241_10007728 | 3300009174 | Bacteria | 7903 |
| 326 | Ga0105241_10049693 | 3300009174 | Bacteria | 3195 |
| 327 | Ga0105242_10009592 | 3300009176 | Bacteria | 7420 |
| 328 | Ga0105242_10046720 | 3300009176 | Unclassified | 3513 |
| 329 | Ga0105248_10001979 | 3300009177 | Bacteria | 22762 |
| 330 | Ga0105248_10048562 | 3300009177 | Bacteria | 4761 |
| 331 | Ga0105248_10170960 | 3300009177 | Bacteria | 2449 |
| 332 | Ga0105248_10261581 | 3300009177 | Unclassified | 1948 |
| 333 | Ga0105248_10303982 | 3300009177 | Bacteria | 1796 |
| 334 | Ga0105237_10014351 | 3300009545 | Bacteria | 8289 |
| 335 | Ga0105237_10281731 | 3300009545 | Bacteria | 1665 |
| 336 | Ga0105237_10366520 | 3300009545 | Bacteria | 1445 |
| 337 | Ga0105237_10394327 | 3300009545 | Bacteria | 1389 |
| 338 | Ga0105237_10559544 | 3300009545 | Bacteria | 1150 |
| 339 | Ga0105238_10018663 | 3300009551 | Bacteria | 7063 |
| 340 | Ga0105238_10078408 | 3300009551 | Bacteria | 3293 |
| 341 | Ga0105238_10082426 | 3300009551 | Bacteria | 3206 |
| 342 | Ga0105238_10731992 | 3300009551 | Unclassified | 1002 |
| 343 | Ga0105249_10002341 | 3300009553 | Bacteria | 16462 |
| 344 | Ga0105249_10002423 | 3300009553 | Bacteria | 16185 |
| 345 | Ga0105249_10168013 | 3300009553 | Bacteria | 2125 |
| 346 | Ga0105239_10009150 | 3300010375 | Bacteria | 11204 |
| 347 | Ga0105239_10097931 | 3300010375 | Bacteria | 3242 |
| 348 | Ga0105239_10173160 | 3300010375 | Bacteria | 2414 |
| 349 | Ga0105246_10000016 | 3300011119 | Bacteria | 65781 |
| 350 | Ga0105246_10029004 | 3300011119 | Bacteria | 3639 |
| 351 | Ga0105246_10059942 | 3300011119 | Unclassified | 2643 |
| 352 | Ga0105246_10060818 | 3300011119 | Bacteria | 2626 |
| 353 | Ga0105246_10243873 | 3300011119 | Bacteria | 1422 |
| 354 | Ga0157326_1007973 | 3300012513 | Bacteria | 1149 |
| 355 | Ga0157371_10073102 | 3300013102 | Unclassified | 2428 |
| 356 | Ga0157371_10098120 | 3300013102 | Bacteria | 2077 |
| 357 | Ga0157371_10183656 | 3300013102 | Bacteria | 1496 |
| 358 | Ga0157370_10194757 | 3300013104 | Bacteria | 1881 |
| 359 | Ga0157370_10198962 | 3300013104 | Bacteria | 1859 |
| 360 | Ga0157369_10001827 | 3300013105 | Bacteria | 25725 |
| 361 | Ga0157369_10242552 | 3300013105 | Bacteria | 1882 |
| 362 | Ga0171462_1045 | 3300013250 | Bacteria | 50984 |
| 363 | Ga0157374_10000092 | 3300013296 | Bacteria | 85738 |
| 364 | Ga0157374_10064745 | 3300013296 | Bacteria | 3432 |
| 365 | Ga0157374_10163775 | 3300013296 | Bacteria | 2167 |
| 366 | Ga0157378_10023667 | 3300013297 | Bacteria | 5402 |
| 367 | Ga0157378_10094379 | 3300013297 | Unclassified | 2724 |
| 368 | Ga0163162_10010092 | 3300013306 | Bacteria | 9182 |
| 369 | Ga0163162_10014928 | 3300013306 | Bacteria | 7586 |
| 370 | Ga0163162_10652125 | 3300013306 | Bacteria | 1176 |
| 371 | Ga0157372_10019004 | 3300013307 | Bacteria | 7396 |
| 372 | Ga0157372_10123167 | 3300013307 | Bacteria | 2980 |
| 373 | Ga0157372_10766573 | 3300013307 | Unclassified | 1122 |
| 374 | Ga0157375_10000124 | 3300013308 | Bacteria | 76003 |
| 375 | Ga0157375_10018849 | 3300013308 | Bacteria | 6264 |
| 376 | Ga0157375_10343210 | 3300013308 | Bacteria | 1659 |
| 377 | Ga0163163_10001343 | 3300014325 | Bacteria | 20762 |
| 378 | Ga0163163_10016562 | 3300014325 | Bacteria | 6855 |
| 379 | Ga0163163_10119365 | 3300014325 | Bacteria | 2670 |
| 380 | Ga0163163_10213341 | 3300014325 | Bacteria | 1979 |
| 381 | Ga0157380_10001027 | 3300014326 | Bacteria | 17807 |
| 382 | Ga0157380_10291143 | 3300014326 | Bacteria | 1499 |
| 383 | Ga0157380_10777937 | 3300014326 | Bacteria | 972 |
| 384 | Ga0157377_10000121 | 3300014745 | Bacteria | 51192 |
| 385 | Ga0157379_10000321 | 3300014968 | Bacteria | 38296 |
| 386 | Ga0157379_10030133 | 3300014968 | Bacteria | 4827 |
| 387 | Ga0157379_10277886 | 3300014968 | Bacteria | 1524 |
| 388 | Ga0157376_10000034 | 3300014969 | Bacteria | 161526 |
| 389 | Ga0157376_10205183 | 3300014969 | Bacteria | 1816 |
| 390 | Ga0163161_10000801 | 3300017792 | Bacteria | 24605 |
| 391 | Ga0163161_10012127 | 3300017792 | Bacteria | 5979 |
| 392 | Ga0163161_10299547 | 3300017792 | Bacteria | 1266 |
| 393 | Ga0213876_10017304 | 3300021384 | Bacteria | 3805 |
| 394 | Ga0224572_1006700 | 3300024225 | Bacteria | 2089 |
| 395 | Ga0207666_1000004 | 3300025271 | Bacteria | 56747 |
| 396 | Ga0209673_1024132 | 3300025273 | Bacteria | 2051 |
| 397 | Ga0209130_1000212 | 3300025284 | Bacteria | 76696 |
| 398 | Ga0207673_1000537 | 3300025290 | Bacteria | 4047 |
| 399 | Ga0209675_1012821 | 3300025291 | Bacteria | 2672 |
| 400 | Ga0209676_1021497 | 3300025292 | Bacteria | 2165 |
| 401 | Ga0209025_1000016 | 3300025294 | Bacteria | 770739 |
| 402 | Ga0209025_1001538 | 3300025294 | Bacteria | 29419 |
| 403 | Ga0209025_1026823 | 3300025294 | Bacteria | 2877 |
| 404 | Ga0209025_1028362 | 3300025294 | Bacteria | 2746 |
| 405 | Ga0209025_1066093 | 3300025294 | Bacteria | 1316 |
| 406 | Ga0209564_1000075 | 3300025295 | Bacteria | 285760 |
| 407 | Ga0209564_1000076 | 3300025295 | Bacteria | 283602 |
| 408 | Ga0209256_1000083 | 3300025299 | Bacteria | 221460 |
| 409 | Ga0209256_1002896 | 3300025299 | Bacteria | 13002 |
| 410 | Ga0207426_1006805 | 3300025302 | Bacteria | 4890 |
| 411 | Ga0207697_10001888 | 3300025315 | Bacteria | 11200 |
| 412 | Ga0207697_10016615 | 3300025315 | Bacteria | 3031 |
| 413 | Ga0207656_10052113 | 3300025321 | Bacteria | 1771 |
| 414 | Ga0207653_10016325 | 3300025885 | Bacteria | 2332 |
| 415 | Ga0207682_10000016 | 3300025893 | Bacteria | 78971 |
| 416 | Ga0207682_10001712 | 3300025893 | Bacteria | 10043 |
| 417 | Ga0207692_10025783 | 3300025898 | Unclassified | 2751 |
| 418 | Ga0207692_10036390 | 3300025898 | Bacteria | 2400 |
| 419 | Ga0207692_10105306 | 3300025898 | Bacteria | 1556 |
| 420 | Ga0207692_10127427 | 3300025898 | Bacteria | 1433 |
| 421 | Ga0207642_10000454 | 3300025899 | Bacteria | 12480 |
| 422 | Ga0207710_10000475 | 3300025900 | Bacteria | 25581 |
| 423 | Ga0207710_10006786 | 3300025900 | Bacteria | 4876 |
| 424 | Ga0207688_10000038 | 3300025901 | Bacteria | 45000 |
| 425 | Ga0207680_10026076 | 3300025903 | Bacteria | 3234 |
| 426 | Ga0207680_10098159 | 3300025903 | Bacteria | 1877 |
| 427 | Ga0207680_10426422 | 3300025903 | Bacteria | 940 |
| 428 | Ga0207647_10012357 | 3300025904 | Bacteria | 5944 |
| 429 | Ga0207647_10128683 | 3300025904 | Unclassified | 1489 |
| 430 | Ga0207685_10006686 | 3300025905 | Plasmid | 3161 |
| 431 | Ga0207699_10001265 | 3300025906 | Bacteria | 12020 |
| 432 | Ga0207699_10016301 | 3300025906 | Bacteria | 3884 |
| 433 | Ga0207699_10041260 | 3300025906 | Unclassified | 2664 |
| 434 | Ga0207699_10129922 | 3300025906 | Bacteria | 1642 |
| 435 | Ga0207645_10000138 | 3300025907 | Bacteria | 55917 |
| 436 | Ga0207645_10015193 | 3300025907 | Bacteria | 5126 |
| 437 | Ga0207645_10063855 | 3300025907 | Bacteria | 2353 |
| 438 | Ga0207643_10000075 | 3300025908 | Bacteria | 64981 |
| 439 | Ga0207654_10000985 | 3300025911 | Bacteria | 15621 |
| 440 | Ga0207707_10000809 | 3300025912 | Bacteria | 30640 |
| 441 | Ga0207707_10047322 | 3300025912 | Bacteria | 3745 |
| 442 | Ga0207707_10073592 | 3300025912 | Bacteria | 2979 |
| 443 | Ga0207707_10211104 | 3300025912 | Bacteria | 1691 |
| 444 | Ga0207707_10241502 | 3300025912 | Bacteria | 1570 |
| 445 | Ga0207695_10069458 | 3300025913 | Bacteria | 3604 |
| 446 | Ga0207695_10509378 | 3300025913 | Bacteria | 1085 |
| 447 | Ga0207671_10004109 | 3300025914 | Bacteria | 14077 |
| 448 | Ga0207671_10254704 | 3300025914 | Bacteria | 1380 |
| 449 | Ga0207693_10000975 | 3300025915 | Bacteria | 25758 |
| 450 | Ga0207693_10003947 | 3300025915 | Bacteria | 12607 |
| 451 | Ga0207693_10005875 | 3300025915 | Bacteria | 10184 |
| 452 | Ga0207693_10006027 | 3300025915 | Bacteria | 10049 |
| 453 | Ga0207693_10012124 | 3300025915 | Bacteria | 6967 |
| 454 | Ga0207693_10026173 | 3300025915 | Bacteria | 4619 |
| 455 | Ga0207693_10036273 | 3300025915 | Bacteria | 3886 |
| 456 | Ga0207663_10035307 | 3300025916 | Bacteria | 2998 |
| 457 | Ga0207663_10132999 | 3300025916 | Bacteria | 1722 |
| 458 | Ga0207663_10151500 | 3300025916 | Bacteria | 1627 |
| 459 | Ga0207663_10159114 | 3300025916 | Bacteria | 1592 |
| 460 | Ga0207663_10177367 | 3300025916 | Bacteria | 1519 |
| 461 | Ga0207663_10199742 | 3300025916 | Unclassified | 1442 |
| 462 | Ga0207660_10000023 | 3300025917 | Bacteria | 71712 |
| 463 | Ga0207660_10040536 | 3300025917 | Bacteria | 3261 |
| 464 | Ga0207660_10132052 | 3300025917 | Bacteria | 1902 |
| 465 | Ga0207660_10300450 | 3300025917 | Bacteria | 1278 |
| 466 | Ga0207662_10001542 | 3300025918 | Bacteria | 11239 |
| 467 | Ga0207657_10007478 | 3300025919 | Bacteria | 11195 |
| 468 | Ga0207657_10088330 | 3300025919 | Bacteria | 2591 |
| 469 | Ga0207657_10104542 | 3300025919 | Bacteria | 2345 |
| 470 | Ga0207657_10309910 | 3300025919 | Bacteria | 1250 |
| 471 | Ga0207649_10000122 | 3300025920 | Bacteria | 65841 |
| 472 | Ga0207649_10388455 | 3300025920 | Bacteria | 1042 |
| 473 | Ga0207652_10001146 | 3300025921 | Bacteria | 23846 |
| 474 | Ga0207652_10145121 | 3300025921 | Bacteria | 2123 |
| 475 | Ga0207652_10396905 | 3300025921 | Archaea | 1245 |
| 476 | Ga0207652_10412109 | 3300025921 | Bacteria | 1219 |
| 477 | Ga0207681_10000240 | 3300025923 | Bacteria | 42226 |
| 478 | Ga0207681_10043511 | 3300025923 | Bacteria | 3006 |
| 479 | Ga0207681_10216487 | 3300025923 | Bacteria | 1479 |
| 480 | Ga0207681_10224220 | 3300025923 | Bacteria | 1456 |
| 481 | Ga0207681_10301757 | 3300025923 | Unclassified | 1267 |
| 482 | Ga0207694_10020818 | 3300025924 | Bacteria | 4965 |
| 483 | Ga0207694_10078340 | 3300025924 | Bacteria | 2590 |
| 484 | Ga0207650_10005524 | 3300025925 | Bacteria | 8625 |
| 485 | Ga0207650_10124270 | 3300025925 | Bacteria | 2012 |
| 486 | Ga0207650_10161700 | 3300025925 | Bacteria | 1774 |
| 487 | Ga0207650_10450762 | 3300025925 | Bacteria | 1071 |
| 488 | Ga0207659_10000017 | 3300025926 | Bacteria | 159908 |
| 489 | Ga0207659_10047489 | 3300025926 | Plasmid | 3037 |
| 490 | Ga0207659_10071667 | 3300025926 | Bacteria | 2531 |
| 491 | Ga0207687_10000077 | 3300025927 | Bacteria | 71218 |
| 492 | Ga0207687_10017126 | 3300025927 | Plasmid | 4764 |
| 493 | Ga0207687_10100894 | 3300025927 | Bacteria | 2124 |
| 494 | Ga0207687_10354477 | 3300025927 | Bacteria | 1196 |
| 495 | Ga0207700_10004665 | 3300025928 | Bacteria | 8119 |
| 496 | Ga0207700_10024792 | 3300025928 | Bacteria | 4156 |
| 497 | Ga0207700_10106898 | 3300025928 | Bacteria | 2244 |
| 498 | Ga0207700_10174358 | 3300025928 | Bacteria | 1796 |
| 499 | Ga0207664_10095566 | 3300025929 | Unclassified | 2445 |
| 500 | Ga0207664_10184284 | 3300025929 | Bacteria | 1794 |
| 501 | Ga0207644_10001298 | 3300025931 | Bacteria | 16078 |
| 502 | Ga0207644_10004246 | 3300025931 | Bacteria | 9300 |
| 503 | Ga0207644_10009440 | 3300025931 | Bacteria | 6406 |
| 504 | Ga0207644_10102780 | 3300025931 | Bacteria | 2150 |
| 505 | Ga0207644_10113593 | 3300025931 | Bacteria | 2051 |
| 506 | Ga0207644_10200522 | 3300025931 | Bacteria | 1574 |
| 507 | Ga0207690_10003164 | 3300025932 | Bacteria | 9891 |
| 508 | Ga0207690_10237055 | 3300025932 | Bacteria | 1403 |
| 509 | Ga0207706_10004420 | 3300025933 | Bacteria | 13211 |
| 510 | Ga0207706_10021501 | 3300025933 | Bacteria | 5794 |
| 511 | Ga0207706_10047907 | 3300025933 | Bacteria | 3780 |
| 512 | Ga0207706_10165096 | 3300025933 | Bacteria | 1946 |
| 513 | Ga0207706_10202177 | 3300025933 | Bacteria | 1742 |
| 514 | Ga0207686_10000294 | 3300025934 | Bacteria | 36711 |
| 515 | Ga0207686_10021024 | 3300025934 | Bacteria | 3738 |
| 516 | Ga0207686_10100217 | 3300025934 | Bacteria | 1932 |
| 517 | Ga0207709_10000126 | 3300025935 | Bacteria | 114049 |
| 518 | Ga0207670_10000086 | 3300025936 | Bacteria | 63570 |
| 519 | Ga0207670_10010357 | 3300025936 | Bacteria | 5365 |
| 520 | Ga0207670_10022750 | 3300025936 | Bacteria | 3890 |
| 521 | Ga0207670_10073621 | 3300025936 | Bacteria | 2369 |
| 522 | Ga0207670_10102713 | 3300025936 | Unclassified | 2044 |
| 523 | Ga0207669_10000188 | 3300025937 | Bacteria | 28047 |
| 524 | Ga0207669_10022673 | 3300025937 | Unclassified | 3340 |
| 525 | Ga0207669_10090912 | 3300025937 | Bacteria | 1986 |
| 526 | Ga0207669_10255555 | 3300025937 | Bacteria | 1307 |
| 527 | Ga0207669_10349661 | 3300025937 | Unclassified | 1141 |
| 528 | Ga0207704_10002897 | 3300025938 | Bacteria | 7760 |
| 529 | Ga0207704_10024840 | 3300025938 | Bacteria | 3259 |
| 530 | Ga0207665_10001963 | 3300025939 | Bacteria | 13843 |
| 531 | Ga0207665_10093222 | 3300025939 | Bacteria | 2091 |
| 532 | Ga0207665_10098860 | 3300025939 | Bacteria | 2034 |
| 533 | Ga0207665_10378181 | 3300025939 | Unclassified | 1074 |
| 534 | Ga0207691_10000526 | 3300025940 | Bacteria | 38205 |
| 535 | Ga0207691_10147463 | 3300025940 | Bacteria | 2070 |
| 536 | Ga0207691_10513282 | 3300025940 | Bacteria | 1017 |
| 537 | Ga0207711_10007634 | 3300025941 | Bacteria | 9044 |
| 538 | Ga0207711_10018226 | 3300025941 | Bacteria | 5836 |
| 539 | Ga0207711_10094081 | 3300025941 | Bacteria | 2640 |
| 540 | Ga0207711_10297674 | 3300025941 | Bacteria | 1488 |
| 541 | Ga0207711_10490964 | 3300025941 | Bacteria | 1144 |
| 542 | Ga0207689_10000140 | 3300025942 | Bacteria | 62258 |
| 543 | Ga0207689_10025320 | 3300025942 | Bacteria | 4972 |
| 544 | Ga0207689_10157363 | 3300025942 | Bacteria | 1873 |
| 545 | Ga0207661_10000074 | 3300025944 | Bacteria | 68047 |
| 546 | Ga0207661_10157080 | 3300025944 | Bacteria | 1971 |
| 547 | Ga0207679_10000031 | 3300025945 | Bacteria | 165962 |
| 548 | Ga0207679_10287255 | 3300025945 | Bacteria | 1413 |
| 549 | Ga0207667_10033121 | 3300025949 | Bacteria | 5559 |
| 550 | Ga0207667_10035215 | 3300025949 | Bacteria | 5371 |
| 551 | Ga0207651_10001805 | 3300025960 | Bacteria | 9959 |
| 552 | Ga0207651_10054533 | 3300025960 | Bacteria | 2740 |
| 553 | Ga0207712_10000279 | 3300025961 | Bacteria | 48635 |
| 554 | Ga0207712_10004811 | 3300025961 | Bacteria | 8532 |
| 555 | Ga0207668_10613158 | 3300025972 | Bacteria | 949 |
| 556 | Ga0207640_10000105 | 3300025981 | Bacteria | 64812 |
| 557 | Ga0207640_10000216 | 3300025981 | Bacteria | 40557 |
| 558 | Ga0207658_10001907 | 3300025986 | Bacteria | 15607 |
| 559 | Ga0207658_10042886 | 3300025986 | Unclassified | 3285 |
| 560 | Ga0207658_10110243 | 3300025986 | Unclassified | 2174 |
| 561 | Ga0207658_10281385 | 3300025986 | Bacteria | 1426 |
| 562 | Ga0207658_10400945 | 3300025986 | Bacteria | 1206 |
| 563 | Ga0207677_10007306 | 3300026023 | Bacteria | 6101 |
| 564 | Ga0207677_10023683 | 3300026023 | Plasmid | 3798 |
| 565 | Ga0207677_10573746 | 3300026023 | Unclassified | 986 |
| 566 | Ga0207703_10000418 | 3300026035 | Bacteria | 45072 |
| 567 | Ga0207703_10152080 | 3300026035 | Bacteria | 2019 |
| 568 | Ga0207703_10343520 | 3300026035 | Bacteria | 1372 |
| 569 | Ga0207639_10000599 | 3300026041 | Bacteria | 24821 |
| 570 | Ga0207639_10121380 | 3300026041 | Unclassified | 2148 |
| 571 | Ga0207639_10228155 | 3300026041 | Bacteria | 1612 |
| 572 | Ga0207678_10003953 | 3300026067 | Bacteria | 13331 |
| 573 | Ga0207678_10022090 | 3300026067 | Bacteria | 5575 |
| 574 | Ga0207708_10010311 | 3300026075 | Bacteria | 6939 |
| 575 | Ga0207708_10449315 | 3300026075 | Bacteria | 1073 |
| 576 | Ga0207702_10000753 | 3300026078 | Bacteria | 34590 |
| 577 | Ga0207702_10146394 | 3300026078 | Unclassified | 2144 |
| 578 | Ga0207641_10001634 | 3300026088 | Bacteria | 21851 |
| 579 | Ga0207641_10019340 | 3300026088 | Bacteria | 5589 |
| 580 | Ga0207648_10006918 | 3300026089 | Bacteria | 11239 |
| 581 | Ga0207648_10053413 | 3300026089 | Bacteria | 3532 |
| 582 | Ga0207648_10106853 | 3300026089 | Bacteria | 2456 |
| 583 | Ga0207676_10000133 | 3300026095 | Bacteria | 65766 |
| 584 | Ga0207676_10087401 | 3300026095 | Bacteria | 2549 |
| 585 | Ga0207676_10089435 | 3300026095 | Bacteria | 2523 |
| 586 | Ga0207674_10001514 | 3300026116 | Bacteria | 29977 |
| 587 | Ga0207674_10030742 | 3300026116 | Bacteria | 5644 |
| 588 | Ga0207675_100000570 | 3300026118 | Bacteria | 36090 |
| 589 | Ga0207675_100185284 | 3300026118 | Bacteria | 1995 |
| 590 | Ga0207683_10000004 | 3300026121 | Bacteria | 188086 |
| 591 | Ga0207683_10011279 | 3300026121 | Bacteria | 7619 |
| 592 | Ga0207683_10020739 | 3300026121 | Bacteria | 5622 |
| 593 | Ga0207683_10043398 | 3300026121 | Bacteria | 3930 |
| 594 | Ga0207683_10505246 | 3300026121 | Bacteria | 1117 |
| 595 | Ga0207698_10007207 | 3300026142 | Bacteria | 6968 |
| 596 | Ga0207698_10260534 | 3300026142 | Bacteria | 1593 |
| 597 | Ga0207698_10304142 | 3300026142 | Bacteria | 1486 |
| 598 | Ga0210002_1000183 | 3300027617 | Bacteria | 9003 |
| 599 | Ga0209971_1003472 | 3300027682 | Bacteria | 3736 |
| 600 | Ga0209966_1001288 | 3300027695 | Bacteria | 4443 |
| 601 | Ga0209966_1030379 | 3300027695 | Bacteria | 1092 |
| 602 | Ga0209998_10001130 | 3300027717 | Bacteria | 6609 |
| 603 | Ga0209998_10001412 | 3300027717 | Bacteria | 5820 |
| 604 | Ga0209998_10002862 | 3300027717 | Bacteria | 3872 |
| 605 | Ga0209813_10015791 | 3300027866 | Bacteria | 2052 |
| 606 | Ga0209974_10002488 | 3300027876 | Bacteria | 6667 |
| 607 | Ga0209974_10038892 | 3300027876 | Bacteria | 1582 |
| 608 | Ga0207428_10000218 | 3300027907 | Bacteria | 79728 |
| 609 | Ga0207428_10000250 | 3300027907 | Bacteria | 73217 |
| 610 | Ga0207428_10000777 | 3300027907 | Bacteria | 36251 |
| 611 | Ga0265357_1003621 | 3300028023 | Bacteria | 1348 |
| 612 | Ga0268266_10013746 | 3300028379 | Bacteria | 6970 |
| 613 | Ga0268266_10037440 | 3300028379 | Bacteria | 4133 |
| 614 | Ga0268265_10000194 | 3300028380 | Bacteria | 70928 |
| 615 | Ga0268265_10063302 | 3300028380 | Bacteria | 2845 |
| 616 | Ga0268265_10121161 | 3300028380 | Unclassified | 2155 |
| 617 | Ga0268264_10000393 | 3300028381 | Bacteria | 63015 |
| 618 | Ga0268264_10206938 | 3300028381 | Bacteria | 1799 |
| 619 | Ga0268264_10375726 | 3300028381 | Bacteria | 1360 |
| 620 | Ga0265337_1003879 | 3300028556 | Bacteria | 6343 |
| 621 | Ga0265338_10006566 | 3300028800 | Bacteria | 14761 |
| 622 | Ga0265338_10269461 | 3300028800 | Bacteria | 1248 |
| 623 | Ga0265338_10269689 | 3300028800 | Bacteria | 1247 |
| 624 | Ga0265325_10000039 | 3300031241 | Bacteria | 93014 |
| 625 | Ga0265325_10005389 | 3300031241 | Bacteria | 7903 |
| 626 | Ga0265325_10006452 | 3300031241 | Bacteria | 7111 |
| 627 | Ga0265325_10013324 | 3300031241 | Bacteria | 4684 |
| 628 | Ga0265325_10089525 | 3300031241 | Bacteria | 1519 |
| 629 | Ga0265339_10000071 | 3300031249 | Bacteria | 88416 |
| 630 | Ga0265339_10011771 | 3300031249 | Bacteria | 5368 |
| 631 | Ga0265339_10096653 | 3300031249 | Bacteria | 1541 |
| 632 | Ga0265316_10060342 | 3300031344 | Bacteria | 2948 |
| 633 | Ga0265316_10106018 | 3300031344 | Bacteria | 2132 |
| 634 | Ga0265316_10119851 | 3300031344 | Bacteria | 1988 |
| 635 | Ga0265313_10000057 | 3300031595 | Bacteria | 108544 |
| 636 | Ga0265313_10000415 | 3300031595 | Bacteria | 45805 |
| 637 | Ga0265313_10001341 | 3300031595 | Bacteria | 23197 |
| 638 | Ga0265313_10001740 | 3300031595 | Bacteria | 20008 |
| 639 | Ga0265313_10039367 | 3300031595 | Bacteria | 2345 |
| 640 | Ga0265314_10003150 | 3300031711 | Bacteria | 16185 |
| 641 | Ga0265314_10024673 | 3300031711 | Bacteria | 4553 |
| 642 | Ga0265342_10010642 | 3300031712 | Bacteria | 6361 |
| 643 | Ga0307405_10008563 | 3300031731 | Bacteria | 5196 |
| 644 | Ga0307409_100381988 | 3300031995 | Bacteria | 1339 |
| 645 | Ga0307416_100216204 | 3300032002 | Bacteria | 1833 |
| 646 | Ga0307416_100276325 | 3300032002 | Bacteria | 1653 |
| 647 | Ga0316583_10000158 | 3300032133 | Bacteria | 16588 |
| 648 | Ga0373930_0001167 | 3300034816 | Bacteria | 3842 |
| 649 | Ga0373930_0015641 | 3300034816 | Bacteria | 1426 |
| 650 | Ga0373948_0000190 | 3300034817 | Bacteria | 7039 |
| 651 | Ga0373948_0007388 | 3300034817 | Bacteria | 1847 |
| 652 | Ga0373950_0000342 | 3300034818 | Bacteria | 5805 |
| 653 | Ga0373950_0003250 | 3300034818 | Bacteria | 2307 |
| 654 | Ga0373958_0000055 | 3300034819 | Bacteria | 11096 |
| 655 | Ga0373958_0002208 | 3300034819 | Bacteria | 2705 |
| 656 | Ga0373959_0005211 | 3300034820 | Bacteria | 2128 |
| 657 | Ga0373938_0003013 | 3300034957 | Bacteria | 2732 |
| 658 | Ga0373938_0004580 | 3300034957 | Bacteria | 2318 |
| 659 | Ga0373938_0027998 | 3300034957 | Bacteria | 1189 |
| 660 | Ga0373926_0049144 | 3300035083 | Bacteria | 1518 |
| 661 | Ga0373926_0099066 | 3300035083 | Bacteria | 1089 |
| 662 | Ga0373928_0000361 | 3300035084 | Bacteria | 9079 |
| 663 | Ga0373928_0003934 | 3300035084 | Bacteria | 2834 |
| 664 | Ga0373928_0037247 | 3300035084 | Unclassified | 1103 |
| 665 | Ga0373929_0000927 | 3300035085 | Bacteria | 5708 |
| 666 | Ga0373929_0005221 | 3300035085 | Bacteria | 2335 |
| 667 | Ga0373940_0000594 | 3300035088 | Bacteria | 5745 |
| 668 | Ga0373940_0019435 | 3300035088 | Unclassified | 1716 |
| 669 | Ga0373940_0027313 | 3300035088 | Unclassified | 1499 |
| 670 | Ga0373944_0026503 | 3300035089 | Bacteria | 1712 |
| 671 | Ga0373949_0000308 | 3300035090 | Bacteria | 17544 |
| 672 | Ga0373949_0001125 | 3300035090 | Bacteria | 8093 |
| 673 | Ga0373949_0003075 | 3300035090 | Bacteria | 4081 |
| 674 | Ga0373951_0000393 | 3300035091 | Bacteria | 12972 |
| 675 | Ga0373951_0005644 | 3300035091 | Bacteria | 2897 |
| 676 | Ga0373952_0000208 | 3300035092 | Bacteria | 9305 |
| 677 | Ga0373952_0003614 | 3300035092 | Bacteria | 2789 |
| 678 | Ga0373923_0040203 | 3300035111 | Unclassified | 1923 |
| 679 | Ga0373923_0054218 | 3300035111 | Bacteria | 1687 |
| 680 | Ga0373923_0067162 | 3300035111 | Bacteria | 1533 |
| 681 | Ga0373932_0000031 | 3300035112 | Bacteria | 38730 |
| 682 | Ga0373932_0001291 | 3300035112 | Bacteria | 7088 |
| 683 | Ga0373932_0002778 | 3300035112 | Bacteria | 4345 |
| 684 | Ga0373936_0041267 | 3300035113 | Bacteria | 1851 |
| 685 | Ga0373939_0000083 | 3300035114 | Bacteria | 30438 |
| 686 | Ga0373939_0002536 | 3300035114 | Bacteria | 4293 |
| 687 | Ga0373939_0006676 | 3300035114 | Bacteria | 2786 |
| 688 | Ga0373941_0000540 | 3300035115 | Bacteria | 7532 |
| 689 | Ga0373941_0003276 | 3300035115 | Bacteria | 3654 |
| 690 | Ga0373941_0006891 | 3300035115 | Bacteria | 2759 |
| 691 | Ga0373953_0038456 | 3300035117 | Bacteria | 1892 |
| 692 | Ga0373953_0087433 | 3300035117 | Unclassified | 1301 |
| 693 | Ga0373954_0002212 | 3300035118 | Bacteria | 8084 |
| 694 | Ga0373954_0014077 | 3300035118 | Bacteria | 3566 |
| 695 | Ga0373954_0017610 | 3300035118 | Bacteria | 3210 |
| 696 | Ga0373954_0063059 | 3300035118 | Bacteria | 1751 |
| 697 | Ga0373956_0036600 | 3300035119 | Bacteria | 2166 |
| 698 | Ga0373957_0004504 | 3300035120 | Bacteria | 4241 |
| 699 | Ga0373957_0004989 | 3300035120 | Bacteria | 4090 |
| 700 | Ga0373957_0010202 | 3300035120 | Bacteria | 3098 |
| 701 | Ga0373957_0051454 | 3300035120 | Unclassified | 1576 |
| 702 | Ga0373960_0000088 | 3300035121 | Bacteria | 13897 |
| 703 | Ga0373960_0016046 | 3300035121 | Bacteria | 1921 |
| 704 | Ga0373960_0020821 | 3300035121 | Bacteria | 1738 |
| 705 | Ga0373943_0036171 | 3300035170 | Bacteria | 2364 |
| 706 | Ga0373943_0169942 | 3300035170 | Bacteria | 1192 |
| 707 | Ga0373946_0015402 | 3300035171 | Bacteria | 2899 |
| 708 | Ga0373946_0017067 | 3300035171 | Bacteria | 2773 |
| 709 | Ga0373946_0018220 | 3300035171 | Bacteria | 2694 |
| 710 | Ga0373946_0181357 | 3300035171 | Unclassified | 999 |
| 711 | Ga0373955_0005908 | 3300035172 | Bacteria | 5537 |
| 712 | Ga0373955_0006095 | 3300035172 | Bacteria | 5476 |
| 713 | Ga0373955_0229157 | 3300035172 | Bacteria | 1111 |
| 714 | Ga0373942_0001977 | 3300035207 | Bacteria | 5119 |
| 715 | Ga0373942_0005072 | 3300035207 | Bacteria | 3054 |
| 716 | Ga0373942_0015853 | 3300035207 | Bacteria | 1842 |
| 717 | Ga0373961_0000539 | 3300035241 | Bacteria | 14412 |
| 718 | Ga0373961_0021041 | 3300035241 | Bacteria | 1731 |
| 719 | Ga0373962_0000715 | 3300035242 | Bacteria | 7504 |
| 720 | Ga0373962_0001826 | 3300035242 | Bacteria | 5069 |
| 721 | Ga0373924_0037005 | 3300035410 | Bacteria | 1985 |
| 722 | Ga0373924_0053076 | 3300035410 | Bacteria | 1683 |
| 723 | Ga0373924_0060690 | 3300035410 | Bacteria | 1581 |
| 724 | Ga0373931_0000034 | 3300035691 | Bacteria | 86665 |
| 725 | Ga0373931_0001752 | 3300035691 | Bacteria | 9420 |
| 726 | Ga0373931_0002007 | 3300035691 | Bacteria | 8956 |
| 727 | Ga0373931_0029793 | 3300035691 | Unclassified | 2805 |
| 728 | Ga0373935_0036652 | 3300035692 | Bacteria | 3067 |
| 729 | Ga0373935_0060269 | 3300035692 | Bacteria | 2427 |
| 730 | Ga0373927_0027484 | 3300035695 | Bacteria | 3714 |
| 731 | Ga0373927_0062736 | 3300035695 | Bacteria | 2403 |
| 732 | Ga0373927_0090003 | 3300035695 | Bacteria | 1993 |
| 733 | Ga0373927_0102664 | 3300035695 | Bacteria | 1860 |
| 734 | Ga0373933_0002026 | 3300035724 | Bacteria | 11656 |
| 735 | Ga0373933_0005149 | 3300035724 | Bacteria | 7132 |
| 736 | Ga0373933_0014886 | 3300035724 | Bacteria | 4330 |
| 737 | Ga0373933_0077918 | 3300035724 | Bacteria | 2027 |
| 738 | Ga0373933_0123954 | 3300035724 | Bacteria | 1620 |
| 739 | Ga0373947_0022290 | 3300035725 | Bacteria | 3671 |
| 740 | Ga0373947_0022926 | 3300035725 | Plasmid | 3626 |
| 741 | Ga0373947_0247239 | 3300035725 | Bacteria | 1178 |
| 742 | Ga0373937_0022992 | 3300036401 | Bacteria | 5606 |
| 743 | Ga0373937_0048237 | 3300036401 | Bacteria | 3898 |
| 744 | Ga0373937_0218789 | 3300036401 | Bacteria | 1792 |
| 745 | Ga0373937_0283598 | 3300036401 | Bacteria | 1564 |
| 746 | Ga0373937_0680185 | 3300036401 | Bacteria | 975 |
| 747 | Ga0373925_0008801 | 3300037068 | Bacteria | 7350 |
| 748 | Ga0373925_0038910 | 3300037068 | Bacteria | 3518 |
| 749 | Ga0373925_0085861 | 3300037068 | Bacteria | 2399 |
| 750 | Ga0373925_0183584 | 3300037068 | Bacteria | 1657 |
| 751 | Ga0373925_0318438 | 3300037068 | Bacteria | 1258 |
| 752 | Ga0395899_0021560 | 3300037312 | Bacteria | 4886 |
| 753 | Ga0395899_0023051 | 3300037312 | Bacteria | 4718 |
| 754 | Ga0395900_0075230 | 3300037418 | Bacteria | 3471 |
| 755 | Ga0395900_0080585 | 3300037418 | Bacteria | 3345 |
| 756 | Ga0395898_0004062 | 3300037466 | Bacteria | 16073 |
| 757 | Ga0395898_0198304 | 3300037466 | Bacteria | 1917 |
| 758 | Ga0395898_0274050 | 3300037466 | Bacteria | 1609 |
| 759 | Ga0395901_0005167 | 3300038443 | Bacteria | 13174 |
| 760 | Ga0395901_0412868 | 3300038443 | Bacteria | 1385 |
| 761 | Ga0436365_0014752 | 3300039437 | Bacteria | 19903 |
| 762 | Ga0436365_0360126 | 3300039437 | Bacteria | 4261 |
| 763 | Ga0436365_1470399 | 3300039437 | Bacteria | 2288 |
| 764 | Ga0436365_1671729 | 3300039437 | Bacteria | 6475 |
| 765 | Ga0436360_0147686 | 3300039438 | Bacteria | 984 |
| 766 | Ga0436361_0129874 | 3300039447 | Bacteria | 1093 |
| 767 | Ga0436363_1165521 | 3300039450 | Unclassified | 1313 |
| 768 | Ga0436362_0145276 | 3300039453 | Bacteria | 1240 |
| 769 | Ga0436362_0884639 | 3300039453 | Bacteria | 3007 |
| 770 | Ga0439441_010949 | 3300042001 | Bacteria | 1532 |
| 771 | Ga0439460_0028728 | 3300042461 | Bacteria | 1571 |
| 772 | Ga0466963_0276756 | 3300044694 | Bacteria | 1179 |
| 773 | Ga0466959_0150081 | 3300045049 | Bacteria | 1643 |
| 774 | Ga0451576_0012930 | 3300045051 | Bacteria | 9352 |
| 775 | Ga0466958_0162141 | 3300045836 | Bacteria | 1413 |
| 776 | Ga0466967_0461870 | 3300045976 | Bacteria | 1242 |
| 777 | Ga0495617_009118 | 3300046452 | Bacteria | 3413 |
| 778 | Ga0495592_0003774 | 3300046454 | Bacteria | 10932 |
| 779 | Ga0495592_0009503 | 3300046454 | Bacteria | 7314 |
| 780 | Ga0495592_0175787 | 3300046454 | Bacteria | 1462 |
| 781 | Ga0495592_0261722 | 3300046454 | Unclassified | 1139 |
| 782 | Ga0495603_0164686 | 3300046455 | Bacteria | 1285 |
| 783 | Ga0495629_0000690 | 3300046459 | Bacteria | 27325 |
| 784 | Ga0495629_0004882 | 3300046459 | Bacteria | 10064 |
| 785 | Ga0495629_0041679 | 3300046459 | Bacteria | 3229 |
| 786 | Ga0495641_0059768 | 3300046461 | Bacteria | 1722 |
| 787 | Ga0495651_0014052 | 3300046462 | Bacteria | 6193 |
| 788 | Ga0495651_0018759 | 3300046462 | Bacteria | 5359 |
| 789 | Ga0495651_0073846 | 3300046462 | Unclassified | 2588 |
| 790 | Ga0495651_0189868 | 3300046462 | Bacteria | 1447 |
| 791 | Ga0495653_0004104 | 3300046463 | Bacteria | 11776 |
| 792 | Ga0495653_0011137 | 3300046463 | Bacteria | 7355 |
| 793 | Ga0495653_0108867 | 3300046463 | Unclassified | 1995 |
| 794 | Ga0495653_0122163 | 3300046463 | Bacteria | 1854 |
| 795 | Ga0495580_0016533 | 3300046472 | Bacteria | 5533 |
| 796 | Ga0495582_0027132 | 3300046473 | Unclassified | 3138 |
| 797 | Ga0495582_0046935 | 3300046473 | Bacteria | 2378 |
| 798 | Ga0495605_0022132 | 3300046474 | Bacteria | 3361 |
| 799 | Ga0495639_0029813 | 3300046475 | Bacteria | 2422 |
| 800 | Ga0495639_0041470 | 3300046475 | Bacteria | 2073 |
| 801 | Ga0495664_0000935 | 3300046477 | Bacteria | 15082 |
| 802 | Ga0495664_0032161 | 3300046477 | Bacteria | 3077 |
| 803 | Ga0495584_0028985 | 3300046491 | Bacteria | 2806 |
| 804 | Ga0495585_0001893 | 3300046492 | Bacteria | 15772 |
| 805 | Ga0495594_0081117 | 3300046499 | Bacteria | 1811 |
| 806 | Ga0495607_0019327 | 3300046501 | Unclassified | 4329 |
| 807 | Ga0495608_0014494 | 3300046511 | Bacteria | 5467 |
| 808 | Ga0495608_0015397 | 3300046511 | Bacteria | 5304 |
| 809 | Ga0495608_0017107 | 3300046511 | Bacteria | 5019 |
| 810 | Ga0495608_0104192 | 3300046511 | Bacteria | 1827 |
| 811 | Ga0495610_0022484 | 3300046512 | Bacteria | 3449 |
| 812 | Ga0495618_0003011 | 3300046514 | Bacteria | 10648 |
| 813 | Ga0495618_0005170 | 3300046514 | Bacteria | 7973 |
| 814 | Ga0495628_0005583 | 3300046516 | Bacteria | 11013 |
| 815 | Ga0495628_0117214 | 3300046516 | Bacteria | 2045 |
| 816 | Ga0495628_0122395 | 3300046516 | Unclassified | 1995 |
| 817 | Ga0495630_0008623 | 3300046517 | Bacteria | 7317 |
| 818 | Ga0495630_0135201 | 3300046517 | Bacteria | 1873 |
| 819 | Ga0495643_0098844 | 3300046522 | Bacteria | 1498 |
| 820 | Ga0495643_0129308 | 3300046522 | Bacteria | 1269 |
| 821 | Ga0495644_0000609 | 3300046523 | Bacteria | 15027 |
| 822 | Ga0495652_0020631 | 3300046529 | Bacteria | 5857 |
| 823 | Ga0495652_0049073 | 3300046529 | Unclassified | 3615 |
| 824 | Ga0495652_0201207 | 3300046529 | Bacteria | 1511 |
| 825 | Ga0495665_0089355 | 3300046531 | Bacteria | 1618 |
| 826 | Ga0495640_0019188 | 3300046533 | Bacteria | 5051 |
| 827 | Ga0495640_0254059 | 3300046533 | Unclassified | 1100 |
| 828 | Ga0495640_0300195 | 3300046533 | Bacteria | 997 |
| 829 | Ga0495586_0031215 | 3300046535 | Bacteria | 2852 |
| 830 | Ga0495587_0001842 | 3300046536 | Bacteria | 14138 |
| 831 | Ga0495587_0014249 | 3300046536 | Bacteria | 4990 |
| 832 | Ga0495587_0040716 | 3300046536 | Bacteria | 2775 |
| 833 | Ga0495587_0132359 | 3300046536 | Bacteria | 1425 |
| 834 | Ga0495609_0114552 | 3300046538 | Unclassified | 1162 |
| 835 | Ga0495645_0000310 | 3300046543 | Bacteria | 35179 |
| 836 | Ga0495645_0008466 | 3300046543 | Bacteria | 7183 |
| 837 | Ga0495645_0313573 | 3300046543 | Bacteria | 1021 |
| 838 | Ga0495622_0013890 | 3300046557 | Bacteria | 3736 |
| 839 | Ga0495667_0000946 | 3300046559 | Bacteria | 18764 |
| 840 | Ga0495667_0020778 | 3300046559 | Bacteria | 4430 |
| 841 | Ga0495667_0078098 | 3300046559 | Bacteria | 2152 |
| 842 | Ga0495656_0000135 | 3300046615 | Bacteria | 27441 |
| 843 | Ga0495634_0007276 | 3300046642 | Bacteria | 8339 |
| 844 | Ga0495634_0007973 | 3300046642 | Bacteria | 7898 |
| 845 | Ga0495611_0089413 | 3300046648 | Bacteria | 1422 |
| 846 | Ga0495635_0002226 | 3300046663 | Bacteria | 13172 |
| 847 | Ga0495635_0010100 | 3300046663 | Bacteria | 6601 |
| 848 | Ga0495659_0001106 | 3300046664 | Bacteria | 9384 |
| 849 | Ga0495661_0057261 | 3300046665 | Bacteria | 2328 |
| 850 | Ga0495588_0024336 | 3300046674 | Bacteria | 3007 |
| 851 | Ga0495657_0009702 | 3300046675 | Bacteria | 7279 |
| 852 | Ga0495657_0018260 | 3300046675 | Bacteria | 5080 |
| 853 | Ga0495657_0091600 | 3300046675 | Bacteria | 1949 |
| 854 | Ga0495599_0014755 | 3300046678 | Bacteria | 4837 |
| 855 | Ga0495599_0082279 | 3300046678 | Bacteria | 2011 |
| 856 | Ga0495599_0088825 | 3300046678 | Bacteria | 1929 |
| 857 | Ga0495599_0118069 | 3300046678 | Bacteria | 1649 |
| 858 | Ga0495599_0196856 | 3300046678 | Bacteria | 1239 |
| 859 | Ga0495623_0047692 | 3300046679 | Unclassified | 2719 |
| 860 | Ga0495623_0183606 | 3300046679 | Bacteria | 1213 |
| 861 | Ga0495646_0000846 | 3300046680 | Bacteria | 17305 |
| 862 | Ga0495646_0005824 | 3300046680 | Bacteria | 7814 |
| 863 | Ga0495646_0186248 | 3300046680 | Bacteria | 1137 |
| 864 | Ga0495647_0017444 | 3300046681 | Bacteria | 2540 |
| 865 | Ga0495647_0057262 | 3300046681 | Bacteria | 1530 |
| 866 | Ga0495658_0003137 | 3300046683 | Bacteria | 8241 |
| 867 | Ga0495658_0007569 | 3300046683 | Bacteria | 5382 |
| 868 | Ga0495669_0026128 | 3300046684 | Bacteria | 2551 |
| 869 | Ga0495613_0061433 | 3300046689 | Bacteria | 2751 |
| 870 | Ga0495613_0077855 | 3300046689 | Bacteria | 2412 |
| 871 | Ga0495613_0326249 | 3300046689 | Bacteria | 1059 |
| 872 | Ga0495624_0009424 | 3300046690 | Bacteria | 6763 |
| 873 | Ga0495624_0095007 | 3300046690 | Bacteria | 1837 |
| 874 | Ga0495670_0000427 | 3300046691 | Bacteria | 20176 |
| 875 | Ga0495670_0137512 | 3300046691 | Bacteria | 1276 |
| 876 | Ga0495600_0000371 | 3300046809 | Bacteria | 23444 |
| 877 | Ga0495600_0002986 | 3300046809 | Bacteria | 9878 |
| 878 | Ga0495600_0144992 | 3300046809 | Unclassified | 1539 |
| 879 | Ga0495581_0073208 | 3300047315 | Bacteria | 1982 |
| 880 | Ga0495604_0008735 | 3300047317 | Bacteria | 8007 |
| 881 | Ga0495604_0018786 | 3300047317 | Bacteria | 5535 |
| 882 | Ga0495604_0026322 | 3300047317 | Bacteria | 4631 |
| 883 | Ga0495604_0064909 | 3300047317 | Bacteria | 2781 |
| 884 | Ga0495604_0392857 | 3300047317 | Bacteria | 914 |
| 885 | Ga0495674_0009124 | 3300047319 | Bacteria | 9424 |
| 886 | Ga0495674_0032652 | 3300047319 | Bacteria | 4720 |
| 887 | Ga0495674_0079445 | 3300047319 | Bacteria | 2817 |
| 888 | Ga0495674_0101085 | 3300047319 | Unclassified | 2453 |
| 889 | Ga0495672_0122671 | 3300047320 | Bacteria | 1379 |
| 890 | Ga0495676_0041026 | 3300047321 | Bacteria | 3814 |
| 891 | Ga0495680_0002891 | 3300047322 | Bacteria | 17259 |
| 892 | Ga0495680_0004911 | 3300047322 | Bacteria | 12666 |
| 893 | Ga0495680_0052511 | 3300047322 | Bacteria | 3177 |
| 894 | Ga0495680_0103218 | 3300047322 | Bacteria | 2122 |
| 895 | Ga0495680_0117477 | 3300047322 | Bacteria | 1966 |
| 896 | Ga0495675_0003232 | 3300047444 | Bacteria | 9803 |
| 897 | Ga0495675_0025771 | 3300047444 | Unclassified | 3747 |
| 898 | Ga0495675_0272805 | 3300047444 | Bacteria | 1010 |
| 899 | Ga0495685_011033 | 3300047447 | Bacteria | 3040 |
| 900 | Ga0495684_0001459 | 3300047471 | Bacteria | 18933 |
| 901 | Ga0495684_0097058 | 3300047471 | Bacteria | 2230 |
| 902 | Ga0495684_0115883 | 3300047471 | Bacteria | 2020 |
| 903 | Ga0495684_0124339 | 3300047471 | Bacteria | 1941 |
| 904 | Ga0495684_0166725 | 3300047471 | Bacteria | 1640 |
| 905 | Ga0495593_0005084 | 3300047673 | Bacteria | 7780 |
| 906 | Ga0495593_0017427 | 3300047673 | Bacteria | 4043 |
| 907 | Ga0495593_0045359 | 3300047673 | Bacteria | 2346 |
| 908 | Ga0495602_0035918 | 3300048088 | Bacteria | 4617 |
| 909 | Ga0495602_0059119 | 3300048088 | Bacteria | 3349 |
| 910 | Ga0495602_0091580 | 3300048088 | Bacteria | 2521 |
| 911 | Ga0495614_0013485 | 3300048089 | Bacteria | 3585 |
| 912 | Ga0496100_0000050 | 3300048903 | Bacteria | 75449 |
| 913 | Ga0496100_0077112 | 3300048903 | Bacteria | 2240 |
| 914 | Ga0496101_0000121 | 3300048904 | Bacteria | 76264 |
| 915 | Ga0496101_0000736 | 3300048904 | Bacteria | 19494 |
| 916 | Ga0496102_0003252 | 3300048905 | Bacteria | 13782 |
| 917 | Ga0496102_0085354 | 3300048905 | Bacteria | 2914 |
| 918 | Ga0496102_0088060 | 3300048905 | Bacteria | 2869 |
| 919 | Ga0496102_0117195 | 3300048905 | Bacteria | 2485 |
| 920 | Ga0496102_0327404 | 3300048905 | Bacteria | 1443 |
| 921 | Ga0496102_0409953 | 3300048905 | Unclassified | 1273 |
| 922 | Ga0496102_0466921 | 3300048905 | Unclassified | 1183 |
| 923 | Ga0496103_0000175 | 3300048906 | Bacteria | 65716 |
| 924 | Ga0496103_0115582 | 3300048906 | Bacteria | 1706 |
| 925 | Ga0496104_0000454 | 3300048907 | Bacteria | 35421 |
| 926 | Ga0496104_0107071 | 3300048907 | Bacteria | 2679 |
| 927 | Ga0496104_0128575 | 3300048907 | Bacteria | 2433 |
| 928 | Ga0496104_0143317 | 3300048907 | Bacteria | 2295 |
| 929 | Ga0496105_0027592 | 3300048908 | Bacteria | 4640 |
| 930 | Ga0496105_0072615 | 3300048908 | Bacteria | 2843 |
| 931 | Ga0496105_0121105 | 3300048908 | Bacteria | 2157 |
| 932 | Ga0496106_0000133 | 3300048909 | Bacteria | 55926 |
| 933 | Ga0496106_0014768 | 3300048909 | Bacteria | 5774 |
| 934 | Ga0496106_0024517 | 3300048909 | Bacteria | 4485 |
| 935 | Ga0496106_0025595 | 3300048909 | Unclassified | 4392 |
| 936 | Ga0496107_0000237 | 3300048910 | Bacteria | 29056 |
| 937 | Ga0496107_0018351 | 3300048910 | Bacteria | 4926 |
| 938 | Ga0496107_0046462 | 3300048910 | Bacteria | 3125 |
| 939 | Ga0496107_0106139 | 3300048910 | Unclassified | 2062 |
| 940 | Ga0496108_0017335 | 3300048911 | Bacteria | 5890 |
| 941 | Ga0496108_0036931 | 3300048911 | Bacteria | 4067 |
| 942 | Ga0496108_0124282 | 3300048911 | Unclassified | 2214 |
| 943 | Ga0496108_0164751 | 3300048911 | Bacteria | 1916 |
| 944 | Ga0496109_0007388 | 3300048912 | Bacteria | 9301 |
| 945 | Ga0496109_0026973 | 3300048912 | Bacteria | 5124 |
| 946 | Ga0496109_0431687 | 3300048912 | Bacteria | 1244 |
| 947 | Ga0496110_0009875 | 3300048913 | Bacteria | 7735 |
| 948 | Ga0496110_0074280 | 3300048913 | Bacteria | 3019 |
| 949 | Ga0496110_0103921 | 3300048913 | Plasmid | 2548 |
| 950 | Ga0496111_0066222 | 3300048914 | Bacteria | 2623 |
| 951 | Ga0496111_0160042 | 3300048914 | Unclassified | 1671 |
| 952 | Ga0496112_0229477 | 3300048915 | Bacteria | 1811 |
| 953 | Ga0496112_0247188 | 3300048915 | Unclassified | 1735 |
| 954 | Ga0496112_0593394 | 3300048915 | Bacteria | 1040 |
| 955 | Ga0496113_0190121 | 3300048916 | Bacteria | 1629 |
| 956 | Ga0496113_0227683 | 3300048916 | Bacteria | 1486 |
| 957 | Ga0496113_0265922 | 3300048916 | Bacteria | 1370 |
| 958 | Ga0496114_0002721 | 3300048917 | Bacteria | 13500 |
| 959 | Ga0496114_0012692 | 3300048917 | Bacteria | 6748 |
| 960 | Ga0496114_0032154 | 3300048917 | Bacteria | 4317 |
| 961 | Ga0496115_0066203 | 3300048918 | Bacteria | 2919 |
| 962 | Ga0496115_0081829 | 3300048918 | Bacteria | 2630 |
| 963 | Ga0496115_0084764 | 3300048918 | Bacteria | 2584 |
| 964 | Ga0496115_0129112 | 3300048918 | Bacteria | 2083 |
| 965 | Ga0496115_0212058 | 3300048918 | Unclassified | 1599 |
| 966 | Ga0496117_0036056 | 3300048920 | Bacteria | 3705 |
| 967 | Ga0496117_0052793 | 3300048920 | Bacteria | 2861 |
| 968 | Ga0496118_0134551 | 3300048921 | Bacteria | 1580 |
| 969 | Ga0496119_0188403 | 3300048922 | Bacteria | 1077 |
| 970 | Ga0496122_0022949 | 3300048925 | Bacteria | 5523 |
| 971 | Ga0496122_0081079 | 3300048925 | Bacteria | 2260 |
| 972 | Ga0501031_0086553 | 3300049568 | Bacteria | 2043 |
| 973 | Ga0501032_0028639 | 3300049569 | Bacteria | 3827 |
| 974 | Ga0501032_0090434 | 3300049569 | Bacteria | 2031 |
| 975 | Ga0501032_0126405 | 3300049569 | Bacteria | 1689 |
| 976 | Ga0501032_0150846 | 3300049569 | Bacteria | 1528 |
| 977 | Ga0501032_0194621 | 3300049569 | Bacteria | 1324 |
| 978 | Ga0501033_0014695 | 3300049570 | Bacteria | 5942 |
| 979 | Ga0501033_0022119 | 3300049570 | Bacteria | 4797 |
| 980 | Ga0501033_0054068 | 3300049570 | Bacteria | 2971 |
| 981 | Ga0501034_0000032 | 3300049571 | Bacteria | 243763 |
| 982 | Ga0501034_0042726 | 3300049571 | Bacteria | 4588 |
| 983 | Ga0501034_0060549 | 3300049571 | Bacteria | 3802 |
| 984 | Ga0501034_0060914 | 3300049571 | Bacteria | 3791 |
| 985 | Ga0501034_0090780 | 3300049571 | Bacteria | 3052 |
| 986 | Ga0501034_0151914 | 3300049571 | Bacteria | 2291 |
| 987 | Ga0501034_0167393 | 3300049571 | Bacteria | 2166 |
| 988 | Ga0501034_0264152 | 3300049571 | Bacteria | 1663 |
| 989 | Ga0501034_0387995 | 3300049571 | Bacteria | 1321 |
| 990 | Ga0501034_0468769 | 3300049571 | Bacteria | 1175 |
| 991 | Ga0501036_0003133 | 3300049572 | Bacteria | 13193 |
| 992 | Ga0501036_0026699 | 3300049572 | Bacteria | 4878 |
| 993 | Ga0501036_0059934 | 3300049572 | Bacteria | 3225 |
| 994 | Ga0501036_0133412 | 3300049572 | Bacteria | 2096 |
| 995 | Ga0501036_0503699 | 3300049572 | Bacteria | 1007 |
| 996 | Ga0501037_0014087 | 3300049573 | Bacteria | 5890 |
| 997 | Ga0501037_0034335 | 3300049573 | Bacteria | 3742 |
| 998 | Ga0501037_0074977 | 3300049573 | Bacteria | 2457 |
| 999 | Ga0501038_0012226 | 3300049574 | Bacteria | 7839 |
| 1000 | Ga0501038_0025621 | 3300049574 | Bacteria | 5255 |
| 1001 | Ga0501038_0064795 | 3300049574 | Bacteria | 3115 |
| 1002 | Ga0501038_0090496 | 3300049574 | Bacteria | 2564 |
| 1003 | Ga0501038_0125562 | 3300049574 | Bacteria | 2112 |
| 1004 | Ga0501038_0440615 | 3300049574 | Bacteria | 1003 |
| 1005 | Ga0501041_0296987 | 3300049577 | Bacteria | 1018 |
| 1006 | Ga0501042_0315851 | 3300049578 | Bacteria | 1129 |
| 1007 | Ga0501042_0420237 | 3300049578 | Bacteria | 969 |
| 1008 | Ga0501043_0002174 | 3300049579 | Bacteria | 16722 |
| 1009 | Ga0501043_0019813 | 3300049579 | Bacteria | 5282 |
| 1010 | Ga0501043_0141415 | 3300049579 | Bacteria | 1884 |
| 1011 | Ga0501046_0076410 | 3300049580 | Bacteria | 2594 |
| 1012 | Ga0501047_0019888 | 3300049581 | Bacteria | 6444 |
| 1013 | Ga0501047_0022348 | 3300049581 | Bacteria | 6075 |
| 1014 | Ga0501047_0030921 | 3300049581 | Bacteria | 5162 |
| 1015 | Ga0501047_0090599 | 3300049581 | Bacteria | 2935 |
| 1016 | Ga0501047_0192663 | 3300049581 | Bacteria | 1901 |
| 1017 | Ga0501047_0266501 | 3300049581 | Bacteria | 1560 |
| 1018 | Ga0501048_0116600 | 3300049582 | Bacteria | 1887 |
| 1019 | Ga0501048_0206530 | 3300049582 | Bacteria | 1393 |
| 1020 | Ga0501048_0248442 | 3300049582 | Bacteria | 1263 |
| 1021 | Ga0501067_0029026 | 3300049583 | Bacteria | 3066 |
| 1022 | Ga0501069_0018653 | 3300049585 | Bacteria | 3746 |
| 1023 | Ga0501069_0064447 | 3300049585 | Bacteria | 2048 |
| 1024 | Ga0501070_0000929 | 3300049586 | Bacteria | 26412 |
| 1025 | Ga0501070_0025114 | 3300049586 | Bacteria | 4995 |
| 1026 | Ga0501070_0047935 | 3300049586 | Bacteria | 3550 |
| 1027 | Ga0501070_0062238 | 3300049586 | Bacteria | 3092 |
| 1028 | Ga0501070_0152763 | 3300049586 | Bacteria | 1904 |
| 1029 | Ga0501070_0167154 | 3300049586 | Bacteria | 1812 |
| 1030 | Ga0501071_0065654 | 3300049587 | Bacteria | 2635 |
| 1031 | Ga0501071_0253519 | 3300049587 | Bacteria | 1328 |
| 1032 | Ga0501071_0347921 | 3300049587 | Bacteria | 1128 |
| 1033 | Ga0501072_0032679 | 3300049588 | Bacteria | 4075 |
| 1034 | Ga0501072_0038088 | 3300049588 | Bacteria | 3774 |
| 1035 | Ga0501072_0335628 | 3300049588 | Bacteria | 1201 |
| 1036 | Ga0501073_0007407 | 3300049589 | Bacteria | 8156 |
| 1037 | Ga0501073_0065786 | 3300049589 | Bacteria | 2527 |
| 1038 | Ga0501074_0090568 | 3300049590 | Bacteria | 2190 |
| 1039 | Ga0501074_0171499 | 3300049590 | Bacteria | 1548 |
| 1040 | Ga0501076_0029006 | 3300049592 | Bacteria | 4301 |
| 1041 | Ga0501076_0179356 | 3300049592 | Bacteria | 1727 |
| 1042 | Ga0501076_0280202 | 3300049592 | Bacteria | 1366 |
| 1043 | Ga0501080_0028616 | 3300049742 | Bacteria | 5186 |
| 1044 | Ga0501080_0098556 | 3300049742 | Bacteria | 2713 |
| 1045 | Ga0501080_0149856 | 3300049742 | Bacteria | 2156 |
| 1046 | Ga0501080_0217610 | 3300049742 | Bacteria | 1749 |
| 1047 | Ga0501080_0468059 | 3300049742 | Bacteria | 1128 |
| 1048 | Ga0501081_0030358 | 3300049743 | Bacteria | 3659 |
| 1049 | Ga0501083_0113235 | 3300049744 | Bacteria | 1782 |
| 1050 | Ga0501083_0186995 | 3300049744 | Bacteria | 1352 |
| 1051 | Ga0501035_0011391 | 3300049822 | Bacteria | 8243 |
| 1052 | Ga0501035_0039179 | 3300049822 | Bacteria | 4289 |
| 1053 | Ga0501035_0059429 | 3300049822 | Bacteria | 3404 |
| 1054 | Ga0501035_0060617 | 3300049822 | Bacteria | 3368 |
| 1055 | Ga0501035_0071320 | 3300049822 | Bacteria | 3076 |
| 1056 | Ga0501035_0111490 | 3300049822 | Bacteria | 2397 |
| 1057 | Ga0501044_0020829 | 3300049823 | Bacteria | 6999 |
| 1058 | Ga0501044_0023302 | 3300049823 | Bacteria | 6586 |
| 1059 | Ga0501044_0202853 | 3300049823 | Bacteria | 1941 |
| 1060 | Ga0501044_0232670 | 3300049823 | Bacteria | 1789 |
| 1061 | Ga0501044_0328200 | 3300049823 | Bacteria | 1453 |
| 1062 | Ga0501044_0506713 | 3300049823 | Bacteria | 1108 |
| 1063 | Ga0501044_0557423 | 3300049823 | Bacteria | 1042 |
| 1064 | nmdc:mga03n38_57442_c1 | 3300050490 | Bacteria | 1759 |
| 1065 | nmdc:mga03n38_95617_c1 | 3300050490 | Bacteria | 1423 |
| 1066 | nmdc:mga0yw44_189281_c1 | 3300050492 | Bacteria | 1357 |
| 1067 | nmdc:mga0yw44_279559_c1 | 3300050492 | Bacteria | 1115 |
| 1068 | nmdc:mga0k408_27170_c1 | 3300050493 | Bacteria | 3249 |
| 1069 | nmdc:mga06z11_28840_c1 | 3300050494 | Bacteria | 2667 |
| 1070 | nmdc:mga06z11_30793_c1 | 3300050494 | Bacteria | 2600 |
| 1071 | nmdc:mga06z11_32988_c1 | 3300050494 | Bacteria | 2529 |
| 1072 | nmdc:mga04h51_14127_c1 | 3300050495 | Bacteria | 2275 |
| 1073 | nmdc:mga07m45_194979_c1 | 3300050496 | Bacteria | 1178 |
| 1074 | nmdc:mga07m45_44118_c1 | 3300050496 | Bacteria | 2501 |
| 1075 | nmdc:mga07m45_47599_c1 | 3300050496 | Bacteria | 2411 |
| 1076 | nmdc:mga05p37_129131_c1 | 3300050507 | Bacteria | 3102 |
| 1077 | nmdc:mga05p37_34216_c1 | 3300050507 | Bacteria | 6223 |
| 1078 | nmdc:mga05p37_354_c1 | 3300050507 | Bacteria | 49188 |
| 1079 | nmdc:mga09592_1311_c1 | 3300050508 | Bacteria | 19973 |
| 1080 | nmdc:mga0qj67_167658_c1 | 3300050509 | Bacteria | 1783 |
| 1081 | nmdc:mga0qj67_1940_c1 | 3300050509 | Bacteria | 14712 |
| 1082 | nmdc:mga0qj67_452_c1 | 3300050509 | Bacteria | 28045 |
| 1083 | nmdc:mga06r32_147_c1 | 3300050510 | Bacteria | 53171 |
| 1084 | nmdc:mga06r32_166113_c1 | 3300050510 | Bacteria | 1578 |
| 1085 | nmdc:mga08y16_1264_c1 | 3300050511 | Bacteria | 25114 |
| 1086 | nmdc:mga08y16_463250_c1 | 3300050511 | Bacteria | 1291 |
| 1087 | nmdc:mga08y16_706_c1 | 3300050511 | Bacteria | 31784 |
| 1088 | nmdc:mga0n895_126_c1 | 3300050512 | Bacteria | 45284 |
| 1089 | nmdc:mga0n895_203244_c1 | 3300050512 | Bacteria | 2012 |
| 1090 | nmdc:mga0n895_3658_c1 | 3300050512 | Bacteria | 12435 |
| 1091 | nmdc:mga0n895_73852_c1 | 3300050512 | Bacteria | 3386 |
| 1092 | nmdc:mga0rr50_110564_c1 | 3300050513 | Bacteria | 2174 |
| 1093 | nmdc:mga0rr50_39348_c1 | 3300050513 | Bacteria | 3429 |
| 1094 | nmdc:mga0rr50_58565_c1 | 3300050513 | Bacteria | 2888 |
| 1095 | nmdc:mga08x19_21_c1 | 3300050514 | Bacteria | 302369 |
| 1096 | nmdc:mga08x19_34989_c1 | 3300050514 | Bacteria | 3177 |
| 1097 | nmdc:mga0a205_197_c1 | 3300050515 | Bacteria | 22634 |
| 1098 | nmdc:mga0a205_35258_c1 | 3300050515 | Bacteria | 4804 |
| 1099 | Ga0495601_0000068 | 3300053077 | Bacteria | 56524 |
| 1100 | Ga0495601_0008114 | 3300053077 | Bacteria | 6191 |
| 1101 | Ga0495601_0009067 | 3300053077 | Bacteria | 5875 |
| 1102 | Ga0495601_0023631 | 3300053077 | Bacteria | 3778 |
| 1103 | Ga0495601_0042090 | 3300053077 | Unclassified | 2864 |
| 1104 | Ga0495601_0050293 | 3300053077 | Bacteria | 2628 |
| 1105 | Ga0495601_0066779 | 3300053077 | Bacteria | 2290 |
| 1106 | Ga0495612_0001544 | 3300053078 | Bacteria | 9486 |
| 1107 | Ga0495612_0002142 | 3300053078 | Bacteria | 8121 |
| 1108 | Ga0495612_0014034 | 3300053078 | Bacteria | 3226 |
| 1109 | Ga0495612_0020815 | 3300053078 | Bacteria | 2629 |
| 1110 | Ga0495612_0103951 | 3300053078 | Unclassified | 1211 |
| 1111 | Ga0500610_0084049 | 3300053079 | Bacteria | 1658 |
| 1112 | Ga0495595_0001152 | 3300053084 | Bacteria | 10236 |
| 1113 | Ga0495595_0001627 | 3300053084 | Bacteria | 8780 |
| 1114 | Ga0495595_0029994 | 3300053084 | Bacteria | 2437 |
| 1115 | Ga0495595_0057613 | 3300053084 | Bacteria | 1812 |
| 1116 | Ga0495595_0125911 | 3300053084 | Bacteria | 1250 |
| 1117 | Ga0495619_0000136 | 3300053085 | Bacteria | 54722 |
| 1118 | Ga0495619_0000154 | 3300053085 | Bacteria | 50900 |
| 1119 | Ga0495619_0001079 | 3300053085 | Bacteria | 17901 |
| 1120 | Ga0495619_0010153 | 3300053085 | Bacteria | 5931 |
| 1121 | Ga0495619_0016781 | 3300053085 | Bacteria | 4636 |
| 1122 | Ga0495619_0022065 | 3300053085 | Bacteria | 4069 |
| 1123 | Ga0495619_0130927 | 3300053085 | Bacteria | 1724 |
| 1124 | Ga0500643_000833 | 3300053087 | Bacteria | 19793 |
| 1125 | Ga0500644_0000982 | 3300053088 | Bacteria | 8881 |
| 1126 | Ga0500651_0008832 | 3300053093 | Bacteria | 5957 |
| 1127 | Ga0500566_0038988 | 3300053094 | Bacteria | 2748 |
| 1128 | Ga0500641_0015946 | 3300053096 | Bacteria | 2794 |
| 1129 | Ga0500650_0030316 | 3300053098 | Bacteria | 2453 |
| 1130 | Ga0500569_066558 | 3300053109 | Bacteria | 1125 |
| 1131 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1132 | Ga0500608_128682 | 3300053122 | Bacteria | 1138 |
| 1133 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1134 | Ga0500616_0010066 | 3300053153 | Bacteria | 5682 |
| 1135 | Ga0500616_0013446 | 3300053153 | Bacteria | 4751 |
| 1136 | Ga0500622_0036280 | 3300053156 | Bacteria | 2577 |
| 1137 | Ga0500636_0045638 | 3300053177 | Bacteria | 2584 |
| 1138 | Ga0500645_000549 | 3300053730 | Bacteria | 24816 |
| 1139 | Ga0501084_0066272 | 3300054114 | Bacteria | 3021 |
| 1140 | Ga0501084_0320043 | 3300054114 | Bacteria | 1310 |
| 1141 | Ga0501082_0054918 | 3300060353 | Bacteria | 3433 |
| 1142 | Ga0501082_0102444 | 3300060353 | Bacteria | 2476 |
| 1143 | Ga0530510_0056915 | 3300061734 | Bacteria | 2825 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006038 | Ga0075365_10247944 | Ga0075365_102479441 | 219 |
| 2 | 3300025926 | Ga0207659_10047489 | Ga0207659_100474892 | 221 |
| 3 | 3300039447 | Ga0436361_0129874 | Ga0436361_0129874_209_1042 | 242 |
| 4 | 3300049588 | Ga0501072_0038088 | Ga0501072_0038088_2565_3413 | 245 |
| 5 | 3300049590 | Ga0501074_0171499 | Ga0501074_0171499_577_1425 | 245 |
| 6 | 3300005545 | Ga0070695_100237271 | Ga0070695_1002372712 | 248 |
| 7 | 3300005983 | Ga0081540_1001662 | Ga0081540_10016627 | 248 |
| 8 | 3300005983 | Ga0081540_1012674 | Ga0081540_10126742 | 248 |
| 9 | 3300035171 | Ga0373946_0018220 | Ga0373946_0018220_361_1218 | 252 |
| 10 | 3300046680 | Ga0495646_0186248 | Ga0495646_0186248_288_1052 | 254 |
| 11 | 3300005327 | Ga0070658_10344368 | Ga0070658_103443682 | 257 |
| 12 | 3300005329 | Ga0070683_100173151 | Ga0070683_1001731512 | 257 |
| 13 | 3300005336 | Ga0070680_100049833 | Ga0070680_1000498332 | 257 |
| 14 | 3300005366 | Ga0070659_100323349 | Ga0070659_1003233492 | 257 |
| 15 | 3300005458 | Ga0070681_10125790 | Ga0070681_101257903 | 257 |
| 16 | 3300005535 | Ga0070684_100178374 | Ga0070684_1001783742 | 257 |
| 17 | 3300013104 | Ga0157370_10194757 | Ga0157370_101947572 | 257 |
| 18 | 3300013104 | Ga0157370_10198962 | Ga0157370_101989622 | 257 |
| 19 | 3300013105 | Ga0157369_10001827 | Ga0157369_1000182716 | 257 |
| 20 | 3300025912 | Ga0207707_10073592 | Ga0207707_100735923 | 257 |
| 21 | 3300025932 | Ga0207690_10237055 | Ga0207690_102370552 | 257 |
| 22 | 3300035111 | Ga0373923_0054218 | Ga0373923_0054218_739_1563 | 258 |
| 23 | 3300035118 | Ga0373954_0063059 | Ga0373954_0063059_69_893 | 258 |
| 24 | 3300035119 | Ga0373956_0036600 | Ga0373956_0036600_840_1664 | 258 |
| 25 | 3300035120 | Ga0373957_0010202 | Ga0373957_0010202_1684_2508 | 258 |
| 26 | 3300035172 | Ga0373955_0006095 | Ga0373955_0006095_2180_3004 | 258 |
| 27 | 3300035410 | Ga0373924_0037005 | Ga0373924_0037005_866_1690 | 258 |
| 28 | 3300046454 | Ga0495592_0175787 | Ga0495592_0175787_360_1184 | 258 |
| 29 | 3300046462 | Ga0495651_0189868 | Ga0495651_0189868_103_927 | 258 |
| 30 | 3300046511 | Ga0495608_0104192 | Ga0495608_0104192_740_1564 | 258 |
| 31 | 3300046516 | Ga0495628_0117214 | Ga0495628_0117214_438_1262 | 258 |
| 32 | 3300046533 | Ga0495640_0300195 | Ga0495640_0300195_119_943 | 258 |
| 33 | 3300046536 | Ga0495587_0132359 | Ga0495587_0132359_358_1182 | 258 |
| 34 | 3300046543 | Ga0495645_0313573 | Ga0495645_0313573_134_958 | 258 |
| 35 | 3300046559 | Ga0495667_0078098 | Ga0495667_0078098_1306_2130 | 258 |
| 36 | 3300046675 | Ga0495657_0091600 | Ga0495657_0091600_764_1588 | 258 |
| 37 | 3300046678 | Ga0495599_0196856 | Ga0495599_0196856_334_1158 | 258 |
| 38 | 3300046679 | Ga0495623_0183606 | Ga0495623_0183606_137_961 | 258 |
| 39 | 3300047317 | Ga0495604_0392857 | Ga0495604_0392857_52_876 | 258 |
| 40 | 3300047322 | Ga0495680_0117477 | Ga0495680_0117477_903_1727 | 258 |
| 41 | 3300047444 | Ga0495675_0272805 | Ga0495675_0272805_134_958 | 258 |
| 42 | 3300047471 | Ga0495684_0124339 | Ga0495684_0124339_434_1258 | 258 |
| 43 | 3300048088 | Ga0495602_0091580 | Ga0495602_0091580_366_1190 | 258 |
| 44 | 3300053077 | Ga0495601_0023631 | Ga0495601_0023631_2076_2900 | 258 |
| 45 | 3300053084 | Ga0495595_0057613 | Ga0495595_0057613_763_1587 | 258 |
| 46 | 3300039437 | Ga0436365_0360126 | Ga0436365_0360126_3294_4121 | 259 |
| 47 | 3300009094 | Ga0111539_10168910 | Ga0111539_101689104 | 260 |
| 48 | 3300035725 | Ga0373947_0247239 | Ga0373947_0247239_67_897 | 260 |
| 49 | 3300005341 | Ga0070691_10088293 | Ga0070691_100882932 | 261 |
| 50 | 3300005937 | Ga0081455_10000153 | Ga0081455_1000015335 | 261 |
| 51 | 3300006914 | Ga0075436_100021761 | Ga0075436_1000217614 | 261 |
| 52 | 3300007076 | Ga0075435_100119913 | Ga0075435_1001199132 | 261 |
| 53 | 3300031241 | Ga0265325_10005389 | Ga0265325_100053896 | 261 |
| 54 | 3300031595 | Ga0265313_10000057 | Ga0265313_1000005779 | 261 |
| 55 | 3300050513 | nmdc:mga0rr50_39348_c1 | nmdc:mga0rr50_39348_c1_167_994 | 261 |
| 56 | 3300050514 | nmdc:mga08x19_21_c1 | nmdc:mga08x19_21_c1_129923_130750 | 261 |
| 57 | 3300006844 | Ga0075428_100435492 | Ga0075428_1004354922 | 262 |
| 58 | 3300005435 | Ga0070714_100035280 | Ga0070714_1000352802 | 263 |
| 59 | 3300005616 | Ga0068852_100085751 | Ga0068852_1000857512 | 263 |
| 60 | 3300006353 | Ga0075370_10038169 | Ga0075370_100381694 | 263 |
| 61 | 3300007076 | Ga0075435_100093336 | Ga0075435_1000933362 | 263 |
| 62 | 3300025949 | Ga0207667_10035215 | Ga0207667_100352151 | 263 |
| 63 | 3300026142 | Ga0207698_10260534 | Ga0207698_102605342 | 263 |
| 64 | 3300049571 | Ga0501034_0090780 | Ga0501034_0090780_451_1278 | 263 |
| 65 | 3300049742 | Ga0501080_0217610 | Ga0501080_0217610_228_1055 | 263 |
| 66 | 3300050496 | nmdc:mga07m45_194979_c1 | nmdc:mga07m45_194979_c1_233_1063 | 263 |
| 67 | 3300005439 | Ga0070711_100138772 | Ga0070711_1001387721 | 264 |
| 68 | 3300006028 | Ga0070717_10349038 | Ga0070717_103490382 | 264 |
| 69 | 3300003659 | JGI25404J52841_10000207 | JGI25404J52841_100002074 | 265 |
| 70 | 3300005329 | Ga0070683_100088017 | Ga0070683_1000880172 | 265 |
| 71 | 3300005435 | Ga0070714_100138726 | Ga0070714_1001387262 | 265 |
| 72 | 3300005437 | Ga0070710_10044111 | Ga0070710_100441112 | 265 |
| 73 | 3300005439 | Ga0070711_100090065 | Ga0070711_1000900653 | 265 |
| 74 | 3300005458 | Ga0070681_10074981 | Ga0070681_100749813 | 265 |
| 75 | 3300005530 | Ga0070679_100117245 | Ga0070679_1001172451 | 265 |
| 76 | 3300005535 | Ga0070684_100359223 | Ga0070684_1003592231 | 265 |
| 77 | 3300005983 | Ga0081540_1000008 | Ga0081540_100000848 | 265 |
| 78 | 3300009093 | Ga0105240_10296212 | Ga0105240_102962122 | 265 |
| 79 | 3300013105 | Ga0157369_10242552 | Ga0157369_102425522 | 265 |
| 80 | 3300013307 | Ga0157372_10123167 | Ga0157372_101231672 | 265 |
| 81 | 3300025898 | Ga0207692_10105306 | Ga0207692_101053062 | 265 |
| 82 | 3300025915 | Ga0207693_10000975 | Ga0207693_100009754 | 265 |
| 83 | 3300025916 | Ga0207663_10159114 | Ga0207663_101591142 | 265 |
| 84 | 3300025929 | Ga0207664_10184284 | Ga0207664_101842842 | 265 |
| 85 | 3300039453 | Ga0436362_0884639 | Ga0436362_0884639_1297_2121 | 265 |
| 86 | 3300049569 | Ga0501032_0028639 | Ga0501032_0028639_2599_3432 | 265 |
| 87 | 3300049571 | Ga0501034_0060914 | Ga0501034_0060914_2897_3730 | 265 |
| 88 | 3300049574 | Ga0501038_0012226 | Ga0501038_0012226_5723_6556 | 265 |
| 89 | 3300049581 | Ga0501047_0030921 | Ga0501047_0030921_2997_3830 | 265 |
| 90 | 3300049589 | Ga0501073_0007407 | Ga0501073_0007407_1298_2131 | 265 |
| 91 | 3300049744 | Ga0501083_0113235 | Ga0501083_0113235_181_1014 | 265 |
| 92 | 3300060353 | Ga0501082_0054918 | Ga0501082_0054918_1058_1891 | 265 |
| 93 | iso_pu_bacteria | 8054563764 | 8054568422 | 265 |
| 94 | 3300005434 | Ga0070709_10221187 | Ga0070709_102211872 | 266 |
| 95 | 3300025915 | Ga0207693_10006027 | Ga0207693_100060277 | 266 |
| 96 | 3300028800 | Ga0265338_10006566 | Ga0265338_100065666 | 267 |
| 97 | 3300031249 | Ga0265339_10000071 | Ga0265339_1000007183 | 267 |
| 98 | 3300031595 | Ga0265313_10000415 | Ga0265313_1000041544 | 267 |
| 99 | 3300046454 | Ga0495592_0261722 | Ga0495592_0261722_283_1113 | 267 |
| 100 | 3300046462 | Ga0495651_0073846 | Ga0495651_0073846_1235_2065 | 267 |
| 101 | 3300046516 | Ga0495628_0122395 | Ga0495628_0122395_572_1402 | 267 |
| 102 | 3300046533 | Ga0495640_0254059 | Ga0495640_0254059_68_898 | 267 |
| 103 | 3300046809 | Ga0495600_0144992 | Ga0495600_0144992_17_847 | 267 |
| 104 | 3300047317 | Ga0495604_0064909 | Ga0495604_0064909_1693_2523 | 267 |
| 105 | 3300047319 | Ga0495674_0032652 | Ga0495674_0032652_58_888 | 267 |
| 106 | 3300053077 | Ga0495601_0009067 | Ga0495601_0009067_4026_4856 | 267 |
| 107 | 3300053078 | Ga0495612_0103951 | Ga0495612_0103951_80_910 | 267 |
| 108 | 3300053084 | Ga0495595_0029994 | Ga0495595_0029994_1330_2160 | 267 |
| 109 | 3300053085 | Ga0495619_0000136 | Ga0495619_0000136_41589_42419 | 267 |
| 110 | 3300006195 | Ga0075366_10185370 | Ga0075366_101853702 | 268 |
| 111 | 3300050493 | nmdc:mga0k408_27170_c1 | nmdc:mga0k408_27170_c1_1856_2686 | 268 |
| 112 | 3300006048 | Ga0075363_100115199 | Ga0075363_1001151992 | 269 |
| 113 | 3300050490 | nmdc:mga03n38_95617_c1 | nmdc:mga03n38_95617_c1_91_942 | 269 |
| 114 | 3300005434 | Ga0070709_10029823 | Ga0070709_100298232 | 270 |
| 115 | 3300005436 | Ga0070713_100001555 | Ga0070713_10000155513 | 270 |
| 116 | 3300005437 | Ga0070710_10025993 | Ga0070710_100259932 | 270 |
| 117 | 3300025898 | Ga0207692_10036390 | Ga0207692_100363903 | 270 |
| 118 | 3300025906 | Ga0207699_10129922 | Ga0207699_101299222 | 270 |
| 119 | 3300025916 | Ga0207663_10151500 | Ga0207663_101515002 | 270 |
| 120 | 3300025928 | Ga0207700_10024792 | Ga0207700_100247922 | 270 |
| 121 | 3300025939 | Ga0207665_10093222 | Ga0207665_100932223 | 270 |
| 122 | 3300035083 | Ga0373926_0099066 | Ga0373926_0099066_190_1014 | 270 |
| 123 | 3300035695 | Ga0373927_0102664 | Ga0373927_0102664_72_896 | 270 |
| 124 | 3300036401 | Ga0373937_0048237 | Ga0373937_0048237_2329_3153 | 270 |
| 125 | 3300037068 | Ga0373925_0038910 | Ga0373925_0038910_595_1419 | 270 |
| 126 | 3300046689 | Ga0495613_0326249 | Ga0495613_0326249_147_971 | 270 |
| 127 | 3300048913 | Ga0496110_0074280 | Ga0496110_0074280_360_1172 | 270 |
| 128 | 3300048915 | Ga0496112_0593394 | Ga0496112_0593394_34_870 | 270 |
| 129 | 3300050490 | nmdc:mga03n38_57442_c1 | nmdc:mga03n38_57442_c1_338_1156 | 270 |
| 130 | 3300050494 | nmdc:mga06z11_30793_c1 | nmdc:mga06z11_30793_c1_1602_2420 | 270 |
| 131 | 3300050495 | nmdc:mga04h51_14127_c1 | nmdc:mga04h51_14127_c1_1026_1844 | 270 |
| 132 | 3300005365 | Ga0070688_100050563 | Ga0070688_1000505633 | 271 |
| 133 | 3300005434 | Ga0070709_10205339 | Ga0070709_102053392 | 271 |
| 134 | 3300005435 | Ga0070714_100015432 | Ga0070714_1000154324 | 271 |
| 135 | 3300005436 | Ga0070713_100066169 | Ga0070713_1000661692 | 271 |
| 136 | 3300005439 | Ga0070711_100024053 | Ga0070711_1000240532 | 271 |
| 137 | 3300005614 | Ga0068856_100127057 | Ga0068856_1001270572 | 271 |
| 138 | 3300005937 | Ga0081455_10002775 | Ga0081455_100027757 | 271 |
| 139 | 3300006038 | Ga0075365_10234229 | Ga0075365_102342291 | 271 |
| 140 | 3300006173 | Ga0070716_100015557 | Ga0070716_1000155571 | 271 |
| 141 | 3300006175 | Ga0070712_100054314 | Ga0070712_1000543142 | 271 |
| 142 | 3300025906 | Ga0207699_10041260 | Ga0207699_100412603 | 271 |
| 143 | 3300025913 | Ga0207695_10509378 | Ga0207695_105093782 | 271 |
| 144 | 3300025915 | Ga0207693_10005875 | Ga0207693_100058755 | 271 |
| 145 | 3300025916 | Ga0207663_10132999 | Ga0207663_101329992 | 271 |
| 146 | 3300035117 | Ga0373953_0038456 | Ga0373953_0038456_724_1551 | 271 |
| 147 | 3300035118 | Ga0373954_0014077 | Ga0373954_0014077_1749_2576 | 271 |
| 148 | 3300035120 | Ga0373957_0004989 | Ga0373957_0004989_456_1283 | 271 |
| 149 | 3300035410 | Ga0373924_0053076 | Ga0373924_0053076_727_1554 | 271 |
| 150 | 3300035692 | Ga0373935_0060269 | Ga0373935_0060269_308_1135 | 271 |
| 151 | 3300035724 | Ga0373933_0002026 | Ga0373933_0002026_3572_4399 | 271 |
| 152 | 3300036401 | Ga0373937_0022992 | Ga0373937_0022992_4295_5122 | 271 |
| 153 | 3300046463 | Ga0495653_0122163 | Ga0495653_0122163_163_990 | 271 |
| 154 | 3300046511 | Ga0495608_0015397 | Ga0495608_0015397_1185_2012 | 271 |
| 155 | 3300046529 | Ga0495652_0049073 | Ga0495652_0049073_1582_2409 | 271 |
| 156 | 3300046536 | Ga0495587_0014249 | Ga0495587_0014249_2649_3476 | 271 |
| 157 | 3300046543 | Ga0495645_0000310 | Ga0495645_0000310_1968_2795 | 271 |
| 158 | 3300046675 | Ga0495657_0018260 | Ga0495657_0018260_1621_2448 | 271 |
| 159 | 3300046678 | Ga0495599_0088825 | Ga0495599_0088825_311_1138 | 271 |
| 160 | 3300046679 | Ga0495623_0047692 | Ga0495623_0047692_1615_2442 | 271 |
| 161 | 3300046680 | Ga0495646_0005824 | Ga0495646_0005824_3634_4461 | 271 |
| 162 | 3300046681 | Ga0495647_0057262 | Ga0495647_0057262_513_1340 | 271 |
| 163 | 3300047317 | Ga0495604_0026322 | Ga0495604_0026322_338_1165 | 271 |
| 164 | 3300047319 | Ga0495674_0101085 | Ga0495674_0101085_1407_2234 | 271 |
| 165 | 3300047322 | Ga0495680_0103218 | Ga0495680_0103218_875_1702 | 271 |
| 166 | 3300047444 | Ga0495675_0025771 | Ga0495675_0025771_1025_1852 | 271 |
| 167 | 3300047471 | Ga0495684_0115883 | Ga0495684_0115883_95_922 | 271 |
| 168 | 3300048088 | Ga0495602_0035918 | Ga0495602_0035918_2157_2984 | 271 |
| 169 | 3300053077 | Ga0495601_0008114 | Ga0495601_0008114_1468_2295 | 271 |
| 170 | 3300053078 | Ga0495612_0002142 | Ga0495612_0002142_4659_5486 | 271 |
| 171 | 3300039453 | Ga0436362_0145276 | Ga0436362_0145276_200_1033 | 272 |
| 172 | iso_pu_bacteria | 2513237087 | 2513591808 | 272 |
| 173 | iso_pu_bacteria | 2643221547 | 2643756796 | 272 |
| 174 | iso_pu_bacteria | 2643221733 | 2644727631 | 272 |
| 175 | iso_pu_bacteria | 2643221734 | 2644733454 | 272 |
| 176 | iso_pu_bacteria | 2818991467 | 2819717405 | 272 |
| 177 | iso_pu_bacteria | 2841760612 | 2841763021 | 272 |
| 178 | iso_pu_bacteria | 2844104063 | 2844109109 | 272 |
| 179 | iso_pu_bacteria | 2851246043 | 2851251216 | 272 |
| 180 | iso_pu_bacteria | 2917699015 | 2917701039 | 272 |
| 181 | 3300006178 | Ga0075367_10003172 | Ga0075367_100031722 | 273 |
| 182 | 3300050494 | nmdc:mga06z11_28840_c1 | nmdc:mga06z11_28840_c1_1062_1904 | 273 |
| 183 | 3300050496 | nmdc:mga07m45_44118_c1 | nmdc:mga07m45_44118_c1_1063_1905 | 273 |
| 184 | iso_pu_bacteria | 2643221736 | 2644744676 | 273 |
| 185 | iso_pu_bacteria | 2919450847 | 2919454297 | 273 |
| 186 | iso_pu_bacteria | 8001845381 | 8001848233 | 273 |
| 187 | iso_pu_bacteria | 8057529695 | 8057534968 | 273 |
| 188 | 3300005439 | Ga0070711_100058358 | Ga0070711_1000583581 | 274 |
| 189 | 3300039437 | Ga0436365_1470399 | Ga0436365_1470399_797_1624 | 274 |
| 190 | 3300039438 | Ga0436360_0147686 | Ga0436360_0147686_34_924 | 274 |
| 191 | 3300039450 | Ga0436363_1165521 | Ga0436363_1165521_39_866 | 274 |
| 192 | 3300005290 | Ga0065712_10116506 | Ga0065712_101165061 | 275 |
| 193 | 3300005327 | Ga0070658_10146191 | Ga0070658_101461912 | 275 |
| 194 | 3300005353 | Ga0070669_100073632 | Ga0070669_1000736323 | 275 |
| 195 | 3300005439 | Ga0070711_100041441 | Ga0070711_1000414414 | 275 |
| 196 | 3300005545 | Ga0070695_100018163 | Ga0070695_1000181634 | 275 |
| 197 | 3300005981 | Ga0081538_10047178 | Ga0081538_100471781 | 275 |
| 198 | 3300006038 | Ga0075365_10004253 | Ga0075365_100042535 | 275 |
| 199 | 3300006048 | Ga0075363_100010796 | Ga0075363_1000107962 | 275 |
| 200 | 3300006178 | Ga0075367_10045316 | Ga0075367_100453163 | 275 |
| 201 | 3300006846 | Ga0075430_100300780 | Ga0075430_1003007802 | 275 |
| 202 | 3300006847 | Ga0075431_100189975 | Ga0075431_1001899752 | 275 |
| 203 | 3300013102 | Ga0157371_10183656 | Ga0157371_101836562 | 275 |
| 204 | 3300021384 | Ga0213876_10017304 | Ga0213876_100173045 | 275 |
| 205 | 3300025898 | Ga0207692_10127427 | Ga0207692_101274272 | 275 |
| 206 | 3300025915 | Ga0207693_10003947 | Ga0207693_100039474 | 275 |
| 207 | 3300025923 | Ga0207681_10301757 | Ga0207681_103017572 | 275 |
| 208 | 3300025928 | Ga0207700_10174358 | Ga0207700_101743582 | 275 |
| 209 | 3300025937 | Ga0207669_10349661 | Ga0207669_103496612 | 275 |
| 210 | 3300025939 | Ga0207665_10098860 | Ga0207665_100988602 | 275 |
| 211 | 3300028800 | Ga0265338_10269689 | Ga0265338_102696892 | 275 |
| 212 | 3300031241 | Ga0265325_10013324 | Ga0265325_100133242 | 275 |
| 213 | 3300031249 | Ga0265339_10096653 | Ga0265339_100966532 | 275 |
| 214 | 3300031595 | Ga0265313_10039367 | Ga0265313_100393672 | 275 |
| 215 | 3300032002 | Ga0307416_100276325 | Ga0307416_1002763251 | 275 |
| 216 | 3300032133 | Ga0316583_10000158 | Ga0316583_100001584 | 275 |
| 217 | 3300035724 | Ga0373933_0077918 | Ga0373933_0077918_908_1735 | 275 |
| 218 | 3300036401 | Ga0373937_0680185 | Ga0373937_0680185_55_882 | 275 |
| 219 | 3300037312 | Ga0395899_0021560 | Ga0395899_0021560_3919_4746 | 275 |
| 220 | 3300037312 | Ga0395899_0023051 | Ga0395899_0023051_3528_4355 | 275 |
| 221 | 3300037418 | Ga0395900_0075230 | Ga0395900_0075230_170_997 | 275 |
| 222 | 3300037418 | Ga0395900_0080585 | Ga0395900_0080585_721_1548 | 275 |
| 223 | 3300037466 | Ga0395898_0004062 | Ga0395898_0004062_9869_10696 | 275 |
| 224 | 3300037466 | Ga0395898_0198304 | Ga0395898_0198304_283_1110 | 275 |
| 225 | 3300037466 | Ga0395898_0274050 | Ga0395898_0274050_232_1059 | 275 |
| 226 | 3300038443 | Ga0395901_0005167 | Ga0395901_0005167_10968_11795 | 275 |
| 227 | 3300038443 | Ga0395901_0412868 | Ga0395901_0412868_508_1335 | 275 |
| 228 | 3300039437 | Ga0436365_0014752 | Ga0436365_0014752_17282_18118 | 275 |
| 229 | 3300044694 | Ga0466963_0276756 | Ga0466963_0276756_262_1089 | 275 |
| 230 | 3300045049 | Ga0466959_0150081 | Ga0466959_0150081_185_1012 | 275 |
| 231 | 3300045836 | Ga0466958_0162141 | Ga0466958_0162141_186_1013 | 275 |
| 232 | 3300045976 | Ga0466967_0461870 | Ga0466967_0461870_306_1133 | 275 |
| 233 | 3300046522 | Ga0495643_0098844 | Ga0495643_0098844_611_1441 | 275 |
| 234 | 3300049571 | Ga0501034_0000032 | Ga0501034_0000032_79603_80430 | 275 |
| 235 | 3300049571 | Ga0501034_0387995 | Ga0501034_0387995_318_1145 | 275 |
| 236 | 3300049572 | Ga0501036_0133412 | Ga0501036_0133412_785_1612 | 275 |
| 237 | 3300049574 | Ga0501038_0440615 | Ga0501038_0440615_154_990 | 275 |
| 238 | 3300049577 | Ga0501041_0296987 | Ga0501041_0296987_111_938 | 275 |
| 239 | 3300049578 | Ga0501042_0420237 | Ga0501042_0420237_38_868 | 275 |
| 240 | 3300049581 | Ga0501047_0022348 | Ga0501047_0022348_4486_5322 | 275 |
| 241 | 3300049581 | Ga0501047_0266501 | Ga0501047_0266501_650_1480 | 275 |
| 242 | 3300049585 | Ga0501069_0018653 | Ga0501069_0018653_807_1637 | 275 |
| 243 | 3300049585 | Ga0501069_0064447 | Ga0501069_0064447_835_1665 | 275 |
| 244 | 3300049586 | Ga0501070_0000929 | Ga0501070_0000929_9855_10685 | 275 |
| 245 | 3300049586 | Ga0501070_0047935 | Ga0501070_0047935_385_1215 | 275 |
| 246 | 3300049586 | Ga0501070_0062238 | Ga0501070_0062238_1513_2340 | 275 |
| 247 | 3300049592 | Ga0501076_0179356 | Ga0501076_0179356_858_1685 | 275 |
| 248 | 3300049742 | Ga0501080_0098556 | Ga0501080_0098556_1460_2290 | 275 |
| 249 | 3300049744 | Ga0501083_0186995 | Ga0501083_0186995_304_1131 | 275 |
| 250 | 3300049822 | Ga0501035_0011391 | Ga0501035_0011391_2704_3534 | 275 |
| 251 | 3300049822 | Ga0501035_0071320 | Ga0501035_0071320_1551_2387 | 275 |
| 252 | 3300049823 | Ga0501044_0023302 | Ga0501044_0023302_775_1611 | 275 |
| 253 | 3300049823 | Ga0501044_0202853 | Ga0501044_0202853_1070_1897 | 275 |
| 254 | 3300049823 | Ga0501044_0506713 | Ga0501044_0506713_173_1000 | 275 |
| 255 | 3300050507 | nmdc:mga05p37_129131_c1 | nmdc:mga05p37_129131_c1_192_1019 | 275 |
| 256 | 3300050509 | nmdc:mga0qj67_167658_c1 | nmdc:mga0qj67_167658_c1_463_1293 | 275 |
| 257 | 3300050510 | nmdc:mga06r32_166113_c1 | nmdc:mga06r32_166113_c1_341_1171 | 275 |
| 258 | 3300053077 | Ga0495601_0066779 | Ga0495601_0066779_996_1823 | 275 |
| 259 | 3300053084 | Ga0495595_0125911 | Ga0495595_0125911_215_1042 | 275 |
| 260 | 3300053085 | Ga0495619_0130927 | Ga0495619_0130927_383_1210 | 275 |
| 261 | 3300053153 | Ga0500616_0013446 | Ga0500616_0013446_926_1762 | 275 |
| 262 | 2209111006 | 2214767425 | 2213785229 | 276 |
| 263 | 3300000041 | ARcpr5oldR_c000015 | ARcpr5oldR_00001513 | 276 |
| 264 | 3300000042 | ARSoilYngRDRAFT_c00006 | ARSoilYngRDRAFT_000064 | 276 |
| 265 | 3300000043 | ARcpr5yngRDRAFT_c000041 | ARcpr5yngRDRAFT_0000414 | 276 |
| 266 | 3300000044 | ARSoilOldRDRAFT_c000020 | ARSoilOldRDRAFT_00002033 | 276 |
| 267 | 3300000045 | ARCol0oldRDRAFT_c00041 | ARCol0oldRDRAFT_000414 | 276 |
| 268 | 3300000652 | ARCol0yngRDRAFT_1000465 | ARCol0yngRDRAFT_10004652 | 276 |
| 269 | 3300001977 | JGI24746J21847_1001428 | JGI24746J21847_10014284 | 276 |
| 270 | 3300001978 | JGI24747J21853_1002861 | JGI24747J21853_10028612 | 276 |
| 271 | 3300001989 | JGI24739J22299_10000344 | JGI24739J22299_100003448 | 276 |
| 272 | 3300001990 | JGI24737J22298_10000203 | JGI24737J22298_100002038 | 276 |
| 273 | 3300001990 | JGI24737J22298_10023970 | JGI24737J22298_100239702 | 276 |
| 274 | 3300002070 | JGI24750J21931_1000159 | JGI24750J21931_10001598 | 276 |
| 275 | 3300002073 | JGI24745J21846_1000003 | JGI24745J21846_10000034 | 276 |
| 276 | 3300002074 | JGI24748J21848_1000190 | JGI24748J21848_10001908 | 276 |
| 277 | 3300002075 | JGI24738J21930_10000042 | JGI24738J21930_1000004217 | 276 |
| 278 | 3300002076 | JGI24749J21850_1000350 | JGI24749J21850_10003502 | 276 |
| 279 | 3300002126 | JGI24035J26624_1000010 | JGI24035J26624_10000102 | 276 |
| 280 | 3300002244 | JGI24742J22300_10000016 | JGI24742J22300_1000001621 | 276 |
| 281 | 3300002987 | JGI25159J45721_1004563 | JGI25159J45721_10045635 | 276 |
| 282 | 3300003187 | JGI25151J46595_10000040 | JGI25151J46595_10000040108 | 276 |
| 283 | 3300003771 | Ga0055526_1000351 | Ga0055526_10003515 | 276 |
| 284 | 3300003771 | Ga0055526_1001693 | Ga0055526_100169314 | 276 |
| 285 | 3300003771 | Ga0055526_1003504 | Ga0055526_10035045 | 276 |
| 286 | 3300003775 | Ga0055524_1000023 | Ga0055524_1000023133 | 276 |
| 287 | 3300003911 | JGI25405J52794_10003103 | JGI25405J52794_100031033 | 276 |
| 288 | 3300005262 | Ga0065165_1000218 | Ga0065165_100021866 | 276 |
| 289 | 3300005276 | Ga0065717_1002525 | Ga0065717_10025252 | 276 |
| 290 | 3300005277 | Ga0065716_1002178 | Ga0065716_10021782 | 276 |
| 291 | 3300005289 | Ga0065704_10073457 | Ga0065704_100734575 | 276 |
| 292 | 3300005290 | Ga0065712_10002616 | Ga0065712_100026161 | 276 |
| 293 | 3300005290 | Ga0065712_10068673 | Ga0065712_100686732 | 276 |
| 294 | 3300005290 | Ga0065712_10119855 | Ga0065712_101198552 | 276 |
| 295 | 3300005293 | Ga0065715_10001423 | Ga0065715_1000142313 | 276 |
| 296 | 3300005293 | Ga0065715_10088987 | Ga0065715_1008898718 | 276 |
| 297 | 3300005293 | Ga0065715_10200234 | Ga0065715_102002342 | 276 |
| 298 | 3300005295 | Ga0065707_10107116 | Ga0065707_101071162 | 276 |
| 299 | 3300005328 | Ga0070676_10000784 | Ga0070676_1000078410 | 276 |
| 300 | 3300005328 | Ga0070676_10016846 | Ga0070676_100168464 | 276 |
| 301 | 3300005329 | Ga0070683_100000114 | Ga0070683_10000011414 | 276 |
| 302 | 3300005329 | Ga0070683_100232230 | Ga0070683_1002322302 | 276 |
| 303 | 3300005329 | Ga0070683_100335950 | Ga0070683_1003359501 | 276 |
| 304 | 3300005330 | Ga0070690_100000064 | Ga0070690_10000006431 | 276 |
| 305 | 3300005330 | Ga0070690_100015359 | Ga0070690_1000153592 | 276 |
| 306 | 3300005330 | Ga0070690_100056719 | Ga0070690_1000567192 | 276 |
| 307 | 3300005331 | Ga0070670_100002373 | Ga0070670_10000237310 | 276 |
| 308 | 3300005331 | Ga0070670_100005338 | Ga0070670_1000053386 | 276 |
| 309 | 3300005331 | Ga0070670_100054895 | Ga0070670_1000548954 | 276 |
| 310 | 3300005331 | Ga0070670_100509442 | Ga0070670_1005094421 | 276 |
| 311 | 3300005331 | Ga0070670_100524850 | Ga0070670_1005248501 | 276 |
| 312 | 3300005333 | Ga0070677_10000193 | Ga0070677_1000019320 | 276 |
| 313 | 3300005334 | Ga0068869_100000020 | Ga0068869_1000000206 | 276 |
| 314 | 3300005335 | Ga0070666_10005751 | Ga0070666_100057518 | 276 |
| 315 | 3300005336 | Ga0070680_100000242 | Ga0070680_10000024225 | 276 |
| 316 | 3300005336 | Ga0070680_100059770 | Ga0070680_1000597703 | 276 |
| 317 | 3300005336 | Ga0070680_100192106 | Ga0070680_1001921062 | 276 |
| 318 | 3300005336 | Ga0070680_100362109 | Ga0070680_1003621091 | 276 |
| 319 | 3300005337 | Ga0070682_100000224 | Ga0070682_10000022427 | 276 |
| 320 | 3300005337 | Ga0070682_100016367 | Ga0070682_1000163673 | 276 |
| 321 | 3300005337 | Ga0070682_100075915 | Ga0070682_1000759152 | 276 |
| 322 | 3300005337 | Ga0070682_100318486 | Ga0070682_1003184861 | 276 |
| 323 | 3300005338 | Ga0068868_100003038 | Ga0068868_10000303814 | 276 |
| 324 | 3300005338 | Ga0068868_100005421 | Ga0068868_1000054217 | 276 |
| 325 | 3300005338 | Ga0068868_100327527 | Ga0068868_1003275272 | 276 |
| 326 | 3300005339 | Ga0070660_100000123 | Ga0070660_10000012310 | 276 |
| 327 | 3300005339 | Ga0070660_100075002 | Ga0070660_1000750023 | 276 |
| 328 | 3300005339 | Ga0070660_100480214 | Ga0070660_1004802142 | 276 |
| 329 | 3300005340 | Ga0070689_100000685 | Ga0070689_10000068513 | 276 |
| 330 | 3300005340 | Ga0070689_100010928 | Ga0070689_1000109282 | 276 |
| 331 | 3300005341 | Ga0070691_10001254 | Ga0070691_100012545 | 276 |
| 332 | 3300005343 | Ga0070687_100000351 | Ga0070687_1000003518 | 276 |
| 333 | 3300005343 | Ga0070687_100016686 | Ga0070687_1000166862 | 276 |
| 334 | 3300005344 | Ga0070661_100000039 | Ga0070661_1000000399 | 276 |
| 335 | 3300005344 | Ga0070661_100144629 | Ga0070661_1001446292 | 276 |
| 336 | 3300005345 | Ga0070692_10062423 | Ga0070692_100624232 | 276 |
| 337 | 3300005347 | Ga0070668_100003586 | Ga0070668_10000358611 | 276 |
| 338 | 3300005347 | Ga0070668_100128113 | Ga0070668_1001281132 | 276 |
| 339 | 3300005353 | Ga0070669_100000176 | Ga0070669_10000017617 | 276 |
| 340 | 3300005353 | Ga0070669_100204124 | Ga0070669_1002041242 | 276 |
| 341 | 3300005354 | Ga0070675_100000259 | Ga0070675_10000025931 | 276 |
| 342 | 3300005354 | Ga0070675_100254869 | Ga0070675_1002548692 | 276 |
| 343 | 3300005355 | Ga0070671_100005757 | Ga0070671_1000057578 | 276 |
| 344 | 3300005356 | Ga0070674_100000099 | Ga0070674_10000009910 | 276 |
| 345 | 3300005356 | Ga0070674_100018430 | Ga0070674_1000184304 | 276 |
| 346 | 3300005356 | Ga0070674_100193057 | Ga0070674_1001930572 | 276 |
| 347 | 3300005364 | Ga0070673_100018362 | Ga0070673_1000183623 | 276 |
| 348 | 3300005364 | Ga0070673_100359816 | Ga0070673_1003598161 | 276 |
| 349 | 3300005365 | Ga0070688_100000329 | Ga0070688_10000032919 | 276 |
| 350 | 3300005365 | Ga0070688_100207204 | Ga0070688_1002072042 | 276 |
| 351 | 3300005365 | Ga0070688_100368481 | Ga0070688_1003684811 | 276 |
| 352 | 3300005366 | Ga0070659_100005453 | Ga0070659_1000054535 | 276 |
| 353 | 3300005366 | Ga0070659_100094545 | Ga0070659_1000945452 | 276 |
| 354 | 3300005367 | Ga0070667_100001075 | Ga0070667_10000107519 | 276 |
| 355 | 3300005367 | Ga0070667_100021496 | Ga0070667_1000214965 | 276 |
| 356 | 3300005367 | Ga0070667_100267163 | Ga0070667_1002671632 | 276 |
| 357 | 3300005434 | Ga0070709_10002443 | Ga0070709_100024435 | 276 |
| 358 | 3300005435 | Ga0070714_100015694 | Ga0070714_1000156942 | 276 |
| 359 | 3300005435 | Ga0070714_100043358 | Ga0070714_1000433583 | 276 |
| 360 | 3300005435 | Ga0070714_100311042 | Ga0070714_1003110422 | 276 |
| 361 | 3300005435 | Ga0070714_100543000 | Ga0070714_1005430002 | 276 |
| 362 | 3300005436 | Ga0070713_100000654 | Ga0070713_10000065415 | 276 |
| 363 | 3300005436 | Ga0070713_100014148 | Ga0070713_1000141482 | 276 |
| 364 | 3300005436 | Ga0070713_100060404 | Ga0070713_1000604041 | 276 |
| 365 | 3300005437 | Ga0070710_10000619 | Ga0070710_1000061911 | 276 |
| 366 | 3300005437 | Ga0070710_10003937 | Ga0070710_100039376 | 276 |
| 367 | 3300005438 | Ga0070701_10000025 | Ga0070701_1000002512 | 276 |
| 368 | 3300005439 | Ga0070711_100010734 | Ga0070711_1000107343 | 276 |
| 369 | 3300005439 | Ga0070711_100073806 | Ga0070711_1000738062 | 276 |
| 370 | 3300005440 | Ga0070705_100037650 | Ga0070705_1000376502 | 276 |
| 371 | 3300005440 | Ga0070705_100130307 | Ga0070705_1001303072 | 276 |
| 372 | 3300005441 | Ga0070700_100002215 | Ga0070700_1000022158 | 276 |
| 373 | 3300005444 | Ga0070694_100006957 | Ga0070694_1000069578 | 276 |
| 374 | 3300005445 | Ga0070708_100023192 | Ga0070708_1000231922 | 276 |
| 375 | 3300005455 | Ga0070663_100000064 | Ga0070663_10000006429 | 276 |
| 376 | 3300005455 | Ga0070663_100014208 | Ga0070663_1000142082 | 276 |
| 377 | 3300005455 | Ga0070663_100060234 | Ga0070663_1000602344 | 276 |
| 378 | 3300005456 | Ga0070678_100001526 | Ga0070678_10000152612 | 276 |
| 379 | 3300005456 | Ga0070678_100043310 | Ga0070678_1000433104 | 276 |
| 380 | 3300005456 | Ga0070678_100043991 | Ga0070678_1000439913 | 276 |
| 381 | 3300005457 | Ga0070662_100023064 | Ga0070662_1000230644 | 276 |
| 382 | 3300005457 | Ga0070662_100025880 | Ga0070662_1000258805 | 276 |
| 383 | 3300005457 | Ga0070662_100051625 | Ga0070662_1000516253 | 276 |
| 384 | 3300005457 | Ga0070662_100141585 | Ga0070662_1001415853 | 276 |
| 385 | 3300005457 | Ga0070662_100271400 | Ga0070662_1002714001 | 276 |
| 386 | 3300005457 | Ga0070662_100448009 | Ga0070662_1004480091 | 276 |
| 387 | 3300005458 | Ga0070681_10000435 | Ga0070681_1000043514 | 276 |
| 388 | 3300005458 | Ga0070681_10032023 | Ga0070681_100320233 | 276 |
| 389 | 3300005458 | Ga0070681_10051421 | Ga0070681_100514214 | 276 |
| 390 | 3300005458 | Ga0070681_10063320 | Ga0070681_100633203 | 276 |
| 391 | 3300005459 | Ga0068867_100002108 | Ga0068867_1000021082 | 276 |
| 392 | 3300005459 | Ga0068867_100025717 | Ga0068867_1000257175 | 276 |
| 393 | 3300005466 | Ga0070685_10003445 | Ga0070685_100034457 | 276 |
| 394 | 3300005466 | Ga0070685_10012156 | Ga0070685_100121565 | 276 |
| 395 | 3300005507 | Ga0074259_10047191 | Ga0074259_100471912 | 276 |
| 396 | 3300005518 | Ga0070699_100361940 | Ga0070699_1003619402 | 276 |
| 397 | 3300005530 | Ga0070679_100002876 | Ga0070679_1000028768 | 276 |
| 398 | 3300005535 | Ga0070684_100001610 | Ga0070684_10000161011 | 276 |
| 399 | 3300005535 | Ga0070684_100142642 | Ga0070684_1001426422 | 276 |
| 400 | 3300005535 | Ga0070684_100207569 | Ga0070684_1002075692 | 276 |
| 401 | 3300005539 | Ga0068853_100005553 | Ga0068853_1000055535 | 276 |
| 402 | 3300005539 | Ga0068853_100323476 | Ga0068853_1003234761 | 276 |
| 403 | 3300005543 | Ga0070672_100000011 | Ga0070672_10000001141 | 276 |
| 404 | 3300005543 | Ga0070672_100129130 | Ga0070672_1001291303 | 276 |
| 405 | 3300005543 | Ga0070672_100263855 | Ga0070672_1002638552 | 276 |
| 406 | 3300005543 | Ga0070672_100304859 | Ga0070672_1003048592 | 276 |
| 407 | 3300005544 | Ga0070686_100000076 | Ga0070686_10000007634 | 276 |
| 408 | 3300005544 | Ga0070686_100002194 | Ga0070686_1000021946 | 276 |
| 409 | 3300005544 | Ga0070686_100067747 | Ga0070686_1000677472 | 276 |
| 410 | 3300005544 | Ga0070686_100115683 | Ga0070686_1001156832 | 276 |
| 411 | 3300005545 | Ga0070695_100003381 | Ga0070695_1000033815 | 276 |
| 412 | 3300005545 | Ga0070695_100025754 | Ga0070695_1000257544 | 276 |
| 413 | 3300005546 | Ga0070696_100038461 | Ga0070696_1000384614 | 276 |
| 414 | 3300005547 | Ga0070693_100000122 | Ga0070693_10000012228 | 276 |
| 415 | 3300005547 | Ga0070693_100074358 | Ga0070693_1000743582 | 276 |
| 416 | 3300005548 | Ga0070665_100034452 | Ga0070665_1000344524 | 276 |
| 417 | 3300005549 | Ga0070704_100002018 | Ga0070704_1000020187 | 276 |
| 418 | 3300005549 | Ga0070704_100008020 | Ga0070704_1000080202 | 276 |
| 419 | 3300005549 | Ga0070704_100017468 | Ga0070704_1000174685 | 276 |
| 420 | 3300005549 | Ga0070704_100051139 | Ga0070704_1000511392 | 276 |
| 421 | 3300005549 | Ga0070704_100105130 | Ga0070704_1001051304 | 276 |
| 422 | 3300005563 | Ga0068855_100035734 | Ga0068855_1000357344 | 276 |
| 423 | 3300005563 | Ga0068855_100246086 | Ga0068855_1002460861 | 276 |
| 424 | 3300005564 | Ga0070664_100000112 | Ga0070664_10000011220 | 276 |
| 425 | 3300005564 | Ga0070664_100227925 | Ga0070664_1002279252 | 276 |
| 426 | 3300005564 | Ga0070664_100320227 | Ga0070664_1003202271 | 276 |
| 427 | 3300005564 | Ga0070664_100483617 | Ga0070664_1004836172 | 276 |
| 428 | 3300005577 | Ga0068857_100000023 | Ga0068857_10000002352 | 276 |
| 429 | 3300005578 | Ga0068854_100004158 | Ga0068854_1000041585 | 276 |
| 430 | 3300005614 | Ga0068856_100000099 | Ga0068856_10000009918 | 276 |
| 431 | 3300005614 | Ga0068856_100169702 | Ga0068856_1001697023 | 276 |
| 432 | 3300005614 | Ga0068856_100907814 | Ga0068856_1009078141 | 276 |
| 433 | 3300005615 | Ga0070702_100000005 | Ga0070702_10000000558 | 276 |
| 434 | 3300005615 | Ga0070702_100021306 | Ga0070702_1000213064 | 276 |
| 435 | 3300005616 | Ga0068852_100004502 | Ga0068852_1000045028 | 276 |
| 436 | 3300005616 | Ga0068852_100262158 | Ga0068852_1002621581 | 276 |
| 437 | 3300005616 | Ga0068852_100283878 | Ga0068852_1002838782 | 276 |
| 438 | 3300005617 | Ga0068859_100000503 | Ga0068859_10000050318 | 276 |
| 439 | 3300005617 | Ga0068859_100039458 | Ga0068859_1000394586 | 276 |
| 440 | 3300005617 | Ga0068859_100040577 | Ga0068859_1000405775 | 276 |
| 441 | 3300005617 | Ga0068859_100611665 | Ga0068859_1006116651 | 276 |
| 442 | 3300005618 | Ga0068864_100000112 | Ga0068864_10000011252 | 276 |
| 443 | 3300005618 | Ga0068864_100018108 | Ga0068864_1000181083 | 276 |
| 444 | 3300005618 | Ga0068864_100308582 | Ga0068864_1003085822 | 276 |
| 445 | 3300005618 | Ga0068864_100574723 | Ga0068864_1005747231 | 276 |
| 446 | 3300005718 | Ga0068866_10000977 | Ga0068866_100009773 | 276 |
| 447 | 3300005718 | Ga0068866_10008375 | Ga0068866_100083751 | 276 |
| 448 | 3300005718 | Ga0068866_10106410 | Ga0068866_101064102 | 276 |
| 449 | 3300005719 | Ga0068861_100002096 | Ga0068861_1000020964 | 276 |
| 450 | 3300005719 | Ga0068861_100118714 | Ga0068861_1001187143 | 276 |
| 451 | 3300005834 | Ga0068851_10097376 | Ga0068851_100973761 | 276 |
| 452 | 3300005840 | Ga0068870_10000021 | Ga0068870_1000002113 | 276 |
| 453 | 3300005840 | Ga0068870_10087663 | Ga0068870_100876631 | 276 |
| 454 | 3300005841 | Ga0068863_100000227 | Ga0068863_10000022736 | 276 |
| 455 | 3300005841 | Ga0068863_100076196 | Ga0068863_1000761964 | 276 |
| 456 | 3300005842 | Ga0068858_100120781 | Ga0068858_1001207811 | 276 |
| 457 | 3300005842 | Ga0068858_100353397 | Ga0068858_1003533972 | 276 |
| 458 | 3300005842 | Ga0068858_100495126 | Ga0068858_1004951262 | 276 |
| 459 | 3300005843 | Ga0068860_100000511 | Ga0068860_1000005119 | 276 |
| 460 | 3300005843 | Ga0068860_100201784 | Ga0068860_1002017842 | 276 |
| 461 | 3300005843 | Ga0068860_100345907 | Ga0068860_1003459072 | 276 |
| 462 | 3300005843 | Ga0068860_100577693 | Ga0068860_1005776932 | 276 |
| 463 | 3300005844 | Ga0068862_100001866 | Ga0068862_1000018665 | 276 |
| 464 | 3300005844 | Ga0068862_100340316 | Ga0068862_1003403161 | 276 |
| 465 | 3300005844 | Ga0068862_100437335 | Ga0068862_1004373351 | 276 |
| 466 | 3300005937 | Ga0081455_10192128 | Ga0081455_101921282 | 276 |
| 467 | 3300005983 | Ga0081540_1052135 | Ga0081540_10521352 | 276 |
| 468 | 3300005985 | Ga0081539_10000423 | Ga0081539_1000042376 | 276 |
| 469 | 3300006038 | Ga0075365_10054906 | Ga0075365_100549062 | 276 |
| 470 | 3300006038 | Ga0075365_10230580 | Ga0075365_102305802 | 276 |
| 471 | 3300006058 | Ga0075432_10004763 | Ga0075432_100047632 | 276 |
| 472 | 3300006163 | Ga0070715_10012842 | Ga0070715_100128424 | 276 |
| 473 | 3300006163 | Ga0070715_10071977 | Ga0070715_100719772 | 276 |
| 474 | 3300006173 | Ga0070716_100054784 | Ga0070716_1000547842 | 276 |
| 475 | 3300006175 | Ga0070712_100205026 | Ga0070712_1002050262 | 276 |
| 476 | 3300006178 | Ga0075367_10003813 | Ga0075367_100038131 | 276 |
| 477 | 3300006178 | Ga0075367_10052558 | Ga0075367_100525582 | 276 |
| 478 | 3300006237 | Ga0097621_100000013 | Ga0097621_100000013116 | 276 |
| 479 | 3300006237 | Ga0097621_100001495 | Ga0097621_1000014958 | 276 |
| 480 | 3300006237 | Ga0097621_100038999 | Ga0097621_1000389994 | 276 |
| 481 | 3300006353 | Ga0075370_10036683 | Ga0075370_100366833 | 276 |
| 482 | 3300006358 | Ga0068871_100000064 | Ga0068871_10000006435 | 276 |
| 483 | 3300006358 | Ga0068871_100023154 | Ga0068871_1000231546 | 276 |
| 484 | 3300006358 | Ga0068871_100035623 | Ga0068871_1000356233 | 276 |
| 485 | 3300006844 | Ga0075428_100067278 | Ga0075428_1000672782 | 276 |
| 486 | 3300006846 | Ga0075430_100000646 | Ga0075430_1000006467 | 276 |
| 487 | 3300006846 | Ga0075430_100040915 | Ga0075430_1000409152 | 276 |
| 488 | 3300006847 | Ga0075431_100096301 | Ga0075431_1000963012 | 276 |
| 489 | 3300006852 | Ga0075433_10003920 | Ga0075433_100039202 | 276 |
| 490 | 3300006852 | Ga0075433_10209676 | Ga0075433_102096762 | 276 |
| 491 | 3300006852 | Ga0075433_10245366 | Ga0075433_102453662 | 276 |
| 492 | 3300006871 | Ga0075434_100000109 | Ga0075434_1000001098 | 276 |
| 493 | 3300006871 | Ga0075434_100043968 | Ga0075434_1000439685 | 276 |
| 494 | 3300006871 | Ga0075434_100068843 | Ga0075434_1000688434 | 276 |
| 495 | 3300006871 | Ga0075434_100095466 | Ga0075434_1000954664 | 276 |
| 496 | 3300006880 | Ga0075429_100041545 | Ga0075429_1000415454 | 276 |
| 497 | 3300006881 | Ga0068865_100000088 | Ga0068865_10000008825 | 276 |
| 498 | 3300006881 | Ga0068865_100010435 | Ga0068865_1000104356 | 276 |
| 499 | 3300006881 | Ga0068865_100097144 | Ga0068865_1000971444 | 276 |
| 500 | 3300006881 | Ga0068865_100337805 | Ga0068865_1003378051 | 276 |
| 501 | 3300006914 | Ga0075436_100162541 | Ga0075436_1001625412 | 276 |
| 502 | 3300006914 | Ga0075436_100206844 | Ga0075436_1002068442 | 276 |
| 503 | 3300006931 | Ga0097620_100000503 | Ga0097620_10000050318 | 276 |
| 504 | 3300006931 | Ga0097620_100039461 | Ga0097620_1000394616 | 276 |
| 505 | 3300006931 | Ga0097620_100040574 | Ga0097620_1000405742 | 276 |
| 506 | 3300006931 | Ga0097620_100611664 | Ga0097620_1006116641 | 276 |
| 507 | 3300007076 | Ga0075435_100072374 | Ga0075435_1000723743 | 276 |
| 508 | 3300009011 | Ga0105251_10010716 | Ga0105251_100107164 | 276 |
| 509 | 3300009093 | Ga0105240_10017252 | Ga0105240_100172523 | 276 |
| 510 | 3300009094 | Ga0111539_10000196 | Ga0111539_100001962 | 276 |
| 511 | 3300009094 | Ga0111539_10000376 | Ga0111539_100003764 | 276 |
| 512 | 3300009094 | Ga0111539_10001836 | Ga0111539_100018365 | 276 |
| 513 | 3300009094 | Ga0111539_10413268 | Ga0111539_104132683 | 276 |
| 514 | 3300009098 | Ga0105245_10001381 | Ga0105245_1000138118 | 276 |
| 515 | 3300009098 | Ga0105245_10150658 | Ga0105245_101506582 | 276 |
| 516 | 3300009098 | Ga0105245_10182194 | Ga0105245_101821942 | 276 |
| 517 | 3300009101 | Ga0105247_10010673 | Ga0105247_100106737 | 276 |
| 518 | 3300009101 | Ga0105247_10057028 | Ga0105247_100570282 | 276 |
| 519 | 3300009147 | Ga0114129_10029360 | Ga0114129_100293608 | 276 |
| 520 | 3300009147 | Ga0114129_10157162 | Ga0114129_101571622 | 276 |
| 521 | 3300009147 | Ga0114129_10179567 | Ga0114129_101795672 | 276 |
| 522 | 3300009148 | Ga0105243_10002817 | Ga0105243_100028176 | 276 |
| 523 | 3300009148 | Ga0105243_10200057 | Ga0105243_102000572 | 276 |
| 524 | 3300009174 | Ga0105241_10007352 | Ga0105241_100073525 | 276 |
| 525 | 3300009174 | Ga0105241_10007728 | Ga0105241_100077286 | 276 |
| 526 | 3300009174 | Ga0105241_10049693 | Ga0105241_100496934 | 276 |
| 527 | 3300009176 | Ga0105242_10009592 | Ga0105242_100095924 | 276 |
| 528 | 3300009176 | Ga0105242_10046720 | Ga0105242_100467204 | 276 |
| 529 | 3300009177 | Ga0105248_10001979 | Ga0105248_1000197915 | 276 |
| 530 | 3300009177 | Ga0105248_10048562 | Ga0105248_100485623 | 276 |
| 531 | 3300009177 | Ga0105248_10170960 | Ga0105248_101709602 | 276 |
| 532 | 3300009177 | Ga0105248_10261581 | Ga0105248_102615812 | 276 |
| 533 | 3300009177 | Ga0105248_10303982 | Ga0105248_103039822 | 276 |
| 534 | 3300009545 | Ga0105237_10014351 | Ga0105237_100143516 | 276 |
| 535 | 3300009545 | Ga0105237_10281731 | Ga0105237_102817311 | 276 |
| 536 | 3300009545 | Ga0105237_10366520 | Ga0105237_103665202 | 276 |
| 537 | 3300009545 | Ga0105237_10394327 | Ga0105237_103943272 | 276 |
| 538 | 3300009545 | Ga0105237_10559544 | Ga0105237_105595442 | 276 |
| 539 | 3300009551 | Ga0105238_10018663 | Ga0105238_100186632 | 276 |
| 540 | 3300009551 | Ga0105238_10078408 | Ga0105238_100784084 | 276 |
| 541 | 3300009551 | Ga0105238_10082426 | Ga0105238_100824262 | 276 |
| 542 | 3300009551 | Ga0105238_10731992 | Ga0105238_107319921 | 276 |
| 543 | 3300009553 | Ga0105249_10002341 | Ga0105249_100023415 | 276 |
| 544 | 3300009553 | Ga0105249_10002423 | Ga0105249_100024236 | 276 |
| 545 | 3300009553 | Ga0105249_10168013 | Ga0105249_101680132 | 276 |
| 546 | 3300010375 | Ga0105239_10009150 | Ga0105239_100091506 | 276 |
| 547 | 3300010375 | Ga0105239_10097931 | Ga0105239_100979313 | 276 |
| 548 | 3300010375 | Ga0105239_10173160 | Ga0105239_101731602 | 276 |
| 549 | 3300011119 | Ga0105246_10000016 | Ga0105246_1000001628 | 276 |
| 550 | 3300011119 | Ga0105246_10029004 | Ga0105246_100290042 | 276 |
| 551 | 3300011119 | Ga0105246_10059942 | Ga0105246_100599423 | 276 |
| 552 | 3300011119 | Ga0105246_10060818 | Ga0105246_100608183 | 276 |
| 553 | 3300011119 | Ga0105246_10243873 | Ga0105246_102438732 | 276 |
| 554 | 3300012513 | Ga0157326_1007973 | Ga0157326_10079732 | 276 |
| 555 | 3300013102 | Ga0157371_10073102 | Ga0157371_100731023 | 276 |
| 556 | 3300013102 | Ga0157371_10098120 | Ga0157371_100981202 | 276 |
| 557 | 3300013250 | Ga0171462_1045 | Ga0171462_104534 | 276 |
| 558 | 3300013296 | Ga0157374_10000092 | Ga0157374_1000009232 | 276 |
| 559 | 3300013296 | Ga0157374_10064745 | Ga0157374_100647455 | 276 |
| 560 | 3300013296 | Ga0157374_10163775 | Ga0157374_101637753 | 276 |
| 561 | 3300013297 | Ga0157378_10023667 | Ga0157378_100236674 | 276 |
| 562 | 3300013297 | Ga0157378_10094379 | Ga0157378_100943792 | 276 |
| 563 | 3300013306 | Ga0163162_10010092 | Ga0163162_100100923 | 276 |
| 564 | 3300013306 | Ga0163162_10014928 | Ga0163162_100149286 | 276 |
| 565 | 3300013306 | Ga0163162_10652125 | Ga0163162_106521252 | 276 |
| 566 | 3300013307 | Ga0157372_10019004 | Ga0157372_100190046 | 276 |
| 567 | 3300013307 | Ga0157372_10766573 | Ga0157372_107665731 | 276 |
| 568 | 3300013308 | Ga0157375_10000124 | Ga0157375_100001246 | 276 |
| 569 | 3300013308 | Ga0157375_10018849 | Ga0157375_100188493 | 276 |
| 570 | 3300013308 | Ga0157375_10343210 | Ga0157375_103432101 | 276 |
| 571 | 3300014325 | Ga0163163_10001343 | Ga0163163_100013432 | 276 |
| 572 | 3300014325 | Ga0163163_10016562 | Ga0163163_100165624 | 276 |
| 573 | 3300014325 | Ga0163163_10119365 | Ga0163163_101193652 | 276 |
| 574 | 3300014325 | Ga0163163_10213341 | Ga0163163_102133413 | 276 |
| 575 | 3300014326 | Ga0157380_10001027 | Ga0157380_100010275 | 276 |
| 576 | 3300014326 | Ga0157380_10291143 | Ga0157380_102911432 | 276 |
| 577 | 3300014326 | Ga0157380_10777937 | Ga0157380_107779371 | 276 |
| 578 | 3300014745 | Ga0157377_10000121 | Ga0157377_1000012128 | 276 |
| 579 | 3300014968 | Ga0157379_10000321 | Ga0157379_1000032124 | 276 |
| 580 | 3300014968 | Ga0157379_10030133 | Ga0157379_100301332 | 276 |
| 581 | 3300014968 | Ga0157379_10277886 | Ga0157379_102778862 | 276 |
| 582 | 3300014969 | Ga0157376_10000034 | Ga0157376_1000003471 | 276 |
| 583 | 3300014969 | Ga0157376_10205183 | Ga0157376_102051833 | 276 |
| 584 | 3300017792 | Ga0163161_10000801 | Ga0163161_1000080114 | 276 |
| 585 | 3300017792 | Ga0163161_10012127 | Ga0163161_100121274 | 276 |
| 586 | 3300017792 | Ga0163161_10299547 | Ga0163161_102995471 | 276 |
| 587 | 3300024225 | Ga0224572_1006700 | Ga0224572_10067003 | 276 |
| 588 | 3300025271 | Ga0207666_1000004 | Ga0207666_100000417 | 276 |
| 589 | 3300025273 | Ga0209673_1024132 | Ga0209673_10241323 | 276 |
| 590 | 3300025284 | Ga0209130_1000212 | Ga0209130_100021264 | 276 |
| 591 | 3300025290 | Ga0207673_1000537 | Ga0207673_10005373 | 276 |
| 592 | 3300025291 | Ga0209675_1012821 | Ga0209675_10128212 | 276 |
| 593 | 3300025292 | Ga0209676_1021497 | Ga0209676_10214974 | 276 |
| 594 | 3300025294 | Ga0209025_1000016 | Ga0209025_1000016443 | 276 |
| 595 | 3300025294 | Ga0209025_1001538 | Ga0209025_100153836 | 276 |
| 596 | 3300025294 | Ga0209025_1026823 | Ga0209025_10268232 | 276 |
| 597 | 3300025294 | Ga0209025_1028362 | Ga0209025_10283622 | 276 |
| 598 | 3300025294 | Ga0209025_1066093 | Ga0209025_10660931 | 276 |
| 599 | 3300025295 | Ga0209564_1000075 | Ga0209564_100007551 | 276 |
| 600 | 3300025295 | Ga0209564_1000076 | Ga0209564_100007684 | 276 |
| 601 | 3300025299 | Ga0209256_1000083 | Ga0209256_100008384 | 276 |
| 602 | 3300025299 | Ga0209256_1002896 | Ga0209256_10028964 | 276 |
| 603 | 3300025302 | Ga0207426_1006805 | Ga0207426_10068054 | 276 |
| 604 | 3300025315 | Ga0207697_10001888 | Ga0207697_100018887 | 276 |
| 605 | 3300025315 | Ga0207697_10016615 | Ga0207697_100166153 | 276 |
| 606 | 3300025321 | Ga0207656_10052113 | Ga0207656_100521132 | 276 |
| 607 | 3300025885 | Ga0207653_10016325 | Ga0207653_100163252 | 276 |
| 608 | 3300025893 | Ga0207682_10000016 | Ga0207682_1000001617 | 276 |
| 609 | 3300025893 | Ga0207682_10001712 | Ga0207682_100017125 | 276 |
| 610 | 3300025898 | Ga0207692_10025783 | Ga0207692_100257834 | 276 |
| 611 | 3300025899 | Ga0207642_10000454 | Ga0207642_100004547 | 276 |
| 612 | 3300025900 | Ga0207710_10000475 | Ga0207710_100004752 | 276 |
| 613 | 3300025900 | Ga0207710_10006786 | Ga0207710_100067862 | 276 |
| 614 | 3300025901 | Ga0207688_10000038 | Ga0207688_1000003828 | 276 |
| 615 | 3300025903 | Ga0207680_10026076 | Ga0207680_100260763 | 276 |
| 616 | 3300025903 | Ga0207680_10098159 | Ga0207680_100981593 | 276 |
| 617 | 3300025903 | Ga0207680_10426422 | Ga0207680_104264221 | 276 |
| 618 | 3300025904 | Ga0207647_10012357 | Ga0207647_100123572 | 276 |
| 619 | 3300025904 | Ga0207647_10128683 | Ga0207647_101286832 | 276 |
| 620 | 3300025905 | Ga0207685_10006686 | Ga0207685_100066864 | 276 |
| 621 | 3300025906 | Ga0207699_10001265 | Ga0207699_100012657 | 276 |
| 622 | 3300025906 | Ga0207699_10016301 | Ga0207699_100163014 | 276 |
| 623 | 3300025907 | Ga0207645_10000138 | Ga0207645_100001387 | 276 |
| 624 | 3300025907 | Ga0207645_10015193 | Ga0207645_100151935 | 276 |
| 625 | 3300025907 | Ga0207645_10063855 | Ga0207645_100638552 | 276 |
| 626 | 3300025908 | Ga0207643_10000075 | Ga0207643_1000007556 | 276 |
| 627 | 3300025911 | Ga0207654_10000985 | Ga0207654_1000098511 | 276 |
| 628 | 3300025912 | Ga0207707_10000809 | Ga0207707_100008092 | 276 |
| 629 | 3300025912 | Ga0207707_10047322 | Ga0207707_100473224 | 276 |
| 630 | 3300025912 | Ga0207707_10211104 | Ga0207707_102111043 | 276 |
| 631 | 3300025912 | Ga0207707_10241502 | Ga0207707_102415021 | 276 |
| 632 | 3300025913 | Ga0207695_10069458 | Ga0207695_100694583 | 276 |
| 633 | 3300025914 | Ga0207671_10004109 | Ga0207671_1000410912 | 276 |
| 634 | 3300025914 | Ga0207671_10254704 | Ga0207671_102547042 | 276 |
| 635 | 3300025915 | Ga0207693_10012124 | Ga0207693_100121247 | 276 |
| 636 | 3300025915 | Ga0207693_10026173 | Ga0207693_100261735 | 276 |
| 637 | 3300025915 | Ga0207693_10036273 | Ga0207693_100362733 | 276 |
| 638 | 3300025916 | Ga0207663_10035307 | Ga0207663_100353072 | 276 |
| 639 | 3300025916 | Ga0207663_10177367 | Ga0207663_101773672 | 276 |
| 640 | 3300025916 | Ga0207663_10199742 | Ga0207663_101997422 | 276 |
| 641 | 3300025917 | Ga0207660_10000023 | Ga0207660_1000002329 | 276 |
| 642 | 3300025917 | Ga0207660_10040536 | Ga0207660_100405362 | 276 |
| 643 | 3300025917 | Ga0207660_10132052 | Ga0207660_101320522 | 276 |
| 644 | 3300025917 | Ga0207660_10300450 | Ga0207660_103004502 | 276 |
| 645 | 3300025918 | Ga0207662_10001542 | Ga0207662_100015426 | 276 |
| 646 | 3300025919 | Ga0207657_10007478 | Ga0207657_100074787 | 276 |
| 647 | 3300025919 | Ga0207657_10088330 | Ga0207657_100883303 | 276 |
| 648 | 3300025919 | Ga0207657_10104542 | Ga0207657_101045423 | 276 |
| 649 | 3300025919 | Ga0207657_10309910 | Ga0207657_103099101 | 276 |
| 650 | 3300025920 | Ga0207649_10000122 | Ga0207649_1000012219 | 276 |
| 651 | 3300025920 | Ga0207649_10388455 | Ga0207649_103884551 | 276 |
| 652 | 3300025921 | Ga0207652_10001146 | Ga0207652_1000114618 | 276 |
| 653 | 3300025921 | Ga0207652_10145121 | Ga0207652_101451212 | 276 |
| 654 | 3300025921 | Ga0207652_10396905 | Ga0207652_103969052 | 276 |
| 655 | 3300025921 | Ga0207652_10412109 | Ga0207652_104121092 | 276 |
| 656 | 3300025923 | Ga0207681_10000240 | Ga0207681_1000024039 | 276 |
| 657 | 3300025923 | Ga0207681_10043511 | Ga0207681_100435114 | 276 |
| 658 | 3300025923 | Ga0207681_10216487 | Ga0207681_102164872 | 276 |
| 659 | 3300025923 | Ga0207681_10224220 | Ga0207681_102242202 | 276 |
| 660 | 3300025924 | Ga0207694_10020818 | Ga0207694_100208182 | 276 |
| 661 | 3300025924 | Ga0207694_10078340 | Ga0207694_100783402 | 276 |
| 662 | 3300025925 | Ga0207650_10005524 | Ga0207650_100055246 | 276 |
| 663 | 3300025925 | Ga0207650_10124270 | Ga0207650_101242701 | 276 |
| 664 | 3300025925 | Ga0207650_10161700 | Ga0207650_101617002 | 276 |
| 665 | 3300025925 | Ga0207650_10450762 | Ga0207650_104507621 | 276 |
| 666 | 3300025926 | Ga0207659_10000017 | Ga0207659_1000001769 | 276 |
| 667 | 3300025926 | Ga0207659_10071667 | Ga0207659_100716672 | 276 |
| 668 | 3300025927 | Ga0207687_10000077 | Ga0207687_1000007727 | 276 |
| 669 | 3300025927 | Ga0207687_10017126 | Ga0207687_100171264 | 276 |
| 670 | 3300025927 | Ga0207687_10100894 | Ga0207687_101008943 | 276 |
| 671 | 3300025927 | Ga0207687_10354477 | Ga0207687_103544771 | 276 |
| 672 | 3300025928 | Ga0207700_10004665 | Ga0207700_100046658 | 276 |
| 673 | 3300025928 | Ga0207700_10106898 | Ga0207700_101068981 | 276 |
| 674 | 3300025929 | Ga0207664_10095566 | Ga0207664_100955662 | 276 |
| 675 | 3300025931 | Ga0207644_10001298 | Ga0207644_1000129810 | 276 |
| 676 | 3300025931 | Ga0207644_10004246 | Ga0207644_100042463 | 276 |
| 677 | 3300025931 | Ga0207644_10009440 | Ga0207644_100094405 | 276 |
| 678 | 3300025931 | Ga0207644_10102780 | Ga0207644_101027802 | 276 |
| 679 | 3300025931 | Ga0207644_10113593 | Ga0207644_101135931 | 276 |
| 680 | 3300025931 | Ga0207644_10200522 | Ga0207644_102005222 | 276 |
| 681 | 3300025932 | Ga0207690_10003164 | Ga0207690_100031645 | 276 |
| 682 | 3300025933 | Ga0207706_10004420 | Ga0207706_100044206 | 276 |
| 683 | 3300025933 | Ga0207706_10021501 | Ga0207706_100215012 | 276 |
| 684 | 3300025933 | Ga0207706_10047907 | Ga0207706_100479074 | 276 |
| 685 | 3300025933 | Ga0207706_10165096 | Ga0207706_101650962 | 276 |
| 686 | 3300025933 | Ga0207706_10202177 | Ga0207706_102021773 | 276 |
| 687 | 3300025934 | Ga0207686_10000294 | Ga0207686_1000029415 | 276 |
| 688 | 3300025934 | Ga0207686_10021024 | Ga0207686_100210242 | 276 |
| 689 | 3300025934 | Ga0207686_10100217 | Ga0207686_101002172 | 276 |
| 690 | 3300025935 | Ga0207709_10000126 | Ga0207709_1000012614 | 276 |
| 691 | 3300025936 | Ga0207670_10000086 | Ga0207670_100000866 | 276 |
| 692 | 3300025936 | Ga0207670_10010357 | Ga0207670_100103572 | 276 |
| 693 | 3300025936 | Ga0207670_10022750 | Ga0207670_100227501 | 276 |
| 694 | 3300025936 | Ga0207670_10073621 | Ga0207670_100736212 | 276 |
| 695 | 3300025936 | Ga0207670_10102713 | Ga0207670_101027132 | 276 |
| 696 | 3300025937 | Ga0207669_10000188 | Ga0207669_1000018815 | 276 |
| 697 | 3300025937 | Ga0207669_10022673 | Ga0207669_100226734 | 276 |
| 698 | 3300025937 | Ga0207669_10090912 | Ga0207669_100909123 | 276 |
| 699 | 3300025937 | Ga0207669_10255555 | Ga0207669_102555551 | 276 |
| 700 | 3300025938 | Ga0207704_10002897 | Ga0207704_100028976 | 276 |
| 701 | 3300025938 | Ga0207704_10024840 | Ga0207704_100248404 | 276 |
| 702 | 3300025939 | Ga0207665_10001963 | Ga0207665_1000196312 | 276 |
| 703 | 3300025939 | Ga0207665_10378181 | Ga0207665_103781812 | 276 |
| 704 | 3300025940 | Ga0207691_10000526 | Ga0207691_100005267 | 276 |
| 705 | 3300025940 | Ga0207691_10147463 | Ga0207691_101474632 | 276 |
| 706 | 3300025940 | Ga0207691_10513282 | Ga0207691_105132822 | 276 |
| 707 | 3300025941 | Ga0207711_10007634 | Ga0207711_100076348 | 276 |
| 708 | 3300025941 | Ga0207711_10018226 | Ga0207711_100182264 | 276 |
| 709 | 3300025941 | Ga0207711_10094081 | Ga0207711_100940814 | 276 |
| 710 | 3300025941 | Ga0207711_10297674 | Ga0207711_102976742 | 276 |
| 711 | 3300025941 | Ga0207711_10490964 | Ga0207711_104909641 | 276 |
| 712 | 3300025942 | Ga0207689_10000140 | Ga0207689_1000014033 | 276 |
| 713 | 3300025942 | Ga0207689_10025320 | Ga0207689_100253204 | 276 |
| 714 | 3300025942 | Ga0207689_10157363 | Ga0207689_101573633 | 276 |
| 715 | 3300025944 | Ga0207661_10000074 | Ga0207661_1000007413 | 276 |
| 716 | 3300025944 | Ga0207661_10157080 | Ga0207661_101570802 | 276 |
| 717 | 3300025945 | Ga0207679_10000031 | Ga0207679_10000031110 | 276 |
| 718 | 3300025945 | Ga0207679_10287255 | Ga0207679_102872552 | 276 |
| 719 | 3300025949 | Ga0207667_10033121 | Ga0207667_100331212 | 276 |
| 720 | 3300025960 | Ga0207651_10001805 | Ga0207651_100018058 | 276 |
| 721 | 3300025960 | Ga0207651_10054533 | Ga0207651_100545332 | 276 |
| 722 | 3300025961 | Ga0207712_10000279 | Ga0207712_100002796 | 276 |
| 723 | 3300025961 | Ga0207712_10004811 | Ga0207712_100048114 | 276 |
| 724 | 3300025972 | Ga0207668_10613158 | Ga0207668_106131581 | 276 |
| 725 | 3300025981 | Ga0207640_10000105 | Ga0207640_1000010515 | 276 |
| 726 | 3300025981 | Ga0207640_10000216 | Ga0207640_1000021615 | 276 |
| 727 | 3300025986 | Ga0207658_10001907 | Ga0207658_1000190710 | 276 |
| 728 | 3300025986 | Ga0207658_10042886 | Ga0207658_100428864 | 276 |
| 729 | 3300025986 | Ga0207658_10110243 | Ga0207658_101102431 | 276 |
| 730 | 3300025986 | Ga0207658_10281385 | Ga0207658_102813851 | 276 |
| 731 | 3300025986 | Ga0207658_10400945 | Ga0207658_104009451 | 276 |
| 732 | 3300026023 | Ga0207677_10007306 | Ga0207677_100073064 | 276 |
| 733 | 3300026023 | Ga0207677_10023683 | Ga0207677_100236835 | 276 |
| 734 | 3300026023 | Ga0207677_10573746 | Ga0207677_105737461 | 276 |
| 735 | 3300026035 | Ga0207703_10000418 | Ga0207703_1000041825 | 276 |
| 736 | 3300026035 | Ga0207703_10152080 | Ga0207703_101520802 | 276 |
| 737 | 3300026035 | Ga0207703_10343520 | Ga0207703_103435201 | 276 |
| 738 | 3300026041 | Ga0207639_10000599 | Ga0207639_100005992 | 276 |
| 739 | 3300026041 | Ga0207639_10121380 | Ga0207639_101213804 | 276 |
| 740 | 3300026041 | Ga0207639_10228155 | Ga0207639_102281552 | 276 |
| 741 | 3300026067 | Ga0207678_10003953 | Ga0207678_1000395311 | 276 |
| 742 | 3300026067 | Ga0207678_10022090 | Ga0207678_100220906 | 276 |
| 743 | 3300026075 | Ga0207708_10010311 | Ga0207708_100103116 | 276 |
| 744 | 3300026075 | Ga0207708_10449315 | Ga0207708_104493152 | 276 |
| 745 | 3300026078 | Ga0207702_10000753 | Ga0207702_1000075319 | 276 |
| 746 | 3300026078 | Ga0207702_10146394 | Ga0207702_101463943 | 276 |
| 747 | 3300026088 | Ga0207641_10001634 | Ga0207641_100016349 | 276 |
| 748 | 3300026088 | Ga0207641_10019340 | Ga0207641_100193404 | 276 |
| 749 | 3300026089 | Ga0207648_10006918 | Ga0207648_100069187 | 276 |
| 750 | 3300026089 | Ga0207648_10053413 | Ga0207648_100534134 | 276 |
| 751 | 3300026089 | Ga0207648_10106853 | Ga0207648_101068532 | 276 |
| 752 | 3300026095 | Ga0207676_10000133 | Ga0207676_1000013343 | 276 |
| 753 | 3300026095 | Ga0207676_10087401 | Ga0207676_100874012 | 276 |
| 754 | 3300026095 | Ga0207676_10089435 | Ga0207676_100894352 | 276 |
| 755 | 3300026116 | Ga0207674_10001514 | Ga0207674_100015146 | 276 |
| 756 | 3300026116 | Ga0207674_10030742 | Ga0207674_100307426 | 276 |
| 757 | 3300026118 | Ga0207675_100000570 | Ga0207675_10000057025 | 276 |
| 758 | 3300026118 | Ga0207675_100185284 | Ga0207675_1001852842 | 276 |
| 759 | 3300026121 | Ga0207683_10000004 | Ga0207683_1000000496 | 276 |
| 760 | 3300026121 | Ga0207683_10011279 | Ga0207683_100112792 | 276 |
| 761 | 3300026121 | Ga0207683_10020739 | Ga0207683_100207396 | 276 |
| 762 | 3300026121 | Ga0207683_10043398 | Ga0207683_100433984 | 276 |
| 763 | 3300026121 | Ga0207683_10505246 | Ga0207683_105052462 | 276 |
| 764 | 3300026142 | Ga0207698_10007207 | Ga0207698_100072073 | 276 |
| 765 | 3300026142 | Ga0207698_10304142 | Ga0207698_103041422 | 276 |
| 766 | 3300027617 | Ga0210002_1000183 | Ga0210002_10001836 | 276 |
| 767 | 3300027682 | Ga0209971_1003472 | Ga0209971_10034724 | 276 |
| 768 | 3300027695 | Ga0209966_1001288 | Ga0209966_10012882 | 276 |
| 769 | 3300027695 | Ga0209966_1030379 | Ga0209966_10303791 | 276 |
| 770 | 3300027717 | Ga0209998_10001130 | Ga0209998_100011306 | 276 |
| 771 | 3300027717 | Ga0209998_10001412 | Ga0209998_100014124 | 276 |
| 772 | 3300027717 | Ga0209998_10002862 | Ga0209998_100028624 | 276 |
| 773 | 3300027866 | Ga0209813_10015791 | Ga0209813_100157912 | 276 |
| 774 | 3300027876 | Ga0209974_10002488 | Ga0209974_100024882 | 276 |
| 775 | 3300027876 | Ga0209974_10038892 | Ga0209974_100388922 | 276 |
| 776 | 3300027907 | Ga0207428_10000218 | Ga0207428_1000021827 | 276 |
| 777 | 3300027907 | Ga0207428_10000250 | Ga0207428_100002502 | 276 |
| 778 | 3300027907 | Ga0207428_10000777 | Ga0207428_100007774 | 276 |
| 779 | 3300028023 | Ga0265357_1003621 | Ga0265357_10036212 | 276 |
| 780 | 3300028379 | Ga0268266_10013746 | Ga0268266_100137467 | 276 |
| 781 | 3300028379 | Ga0268266_10037440 | Ga0268266_100374404 | 276 |
| 782 | 3300028380 | Ga0268265_10000194 | Ga0268265_1000019435 | 276 |
| 783 | 3300028380 | Ga0268265_10063302 | Ga0268265_100633021 | 276 |
| 784 | 3300028380 | Ga0268265_10121161 | Ga0268265_101211613 | 276 |
| 785 | 3300028381 | Ga0268264_10000393 | Ga0268264_1000039328 | 276 |
| 786 | 3300028381 | Ga0268264_10206938 | Ga0268264_102069382 | 276 |
| 787 | 3300028381 | Ga0268264_10375726 | Ga0268264_103757262 | 276 |
| 788 | 3300028556 | Ga0265337_1003879 | Ga0265337_10038797 | 276 |
| 789 | 3300028800 | Ga0265338_10269461 | Ga0265338_102694612 | 276 |
| 790 | 3300031241 | Ga0265325_10000039 | Ga0265325_1000003979 | 276 |
| 791 | 3300031241 | Ga0265325_10006452 | Ga0265325_100064523 | 276 |
| 792 | 3300031241 | Ga0265325_10089525 | Ga0265325_100895252 | 276 |
| 793 | 3300031249 | Ga0265339_10011771 | Ga0265339_100117715 | 276 |
| 794 | 3300031344 | Ga0265316_10060342 | Ga0265316_100603422 | 276 |
| 795 | 3300031344 | Ga0265316_10106018 | Ga0265316_101060182 | 276 |
| 796 | 3300031344 | Ga0265316_10119851 | Ga0265316_101198512 | 276 |
| 797 | 3300031595 | Ga0265313_10001341 | Ga0265313_100013414 | 276 |
| 798 | 3300031595 | Ga0265313_10001740 | Ga0265313_100017408 | 276 |
| 799 | 3300031711 | Ga0265314_10003150 | Ga0265314_1000315016 | 276 |
| 800 | 3300031711 | Ga0265314_10024673 | Ga0265314_100246734 | 276 |
| 801 | 3300031712 | Ga0265342_10010642 | Ga0265342_100106426 | 276 |
| 802 | 3300031731 | Ga0307405_10008563 | Ga0307405_100085635 | 276 |
| 803 | 3300031995 | Ga0307409_100381988 | Ga0307409_1003819882 | 276 |
| 804 | 3300032002 | Ga0307416_100216204 | Ga0307416_1002162042 | 276 |
| 805 | 3300034816 | Ga0373930_0001167 | Ga0373930_0001167_1851_2681 | 276 |
| 806 | 3300034816 | Ga0373930_0015641 | Ga0373930_0015641_68_898 | 276 |
| 807 | 3300034817 | Ga0373948_0000190 | Ga0373948_0000190_1649_2479 | 276 |
| 808 | 3300034817 | Ga0373948_0007388 | Ga0373948_0007388_691_1521 | 276 |
| 809 | 3300034818 | Ga0373950_0000342 | Ga0373950_0000342_3133_3963 | 276 |
| 810 | 3300034818 | Ga0373950_0003250 | Ga0373950_0003250_1352_2185 | 276 |
| 811 | 3300034819 | Ga0373958_0000055 | Ga0373958_0000055_5488_6318 | 276 |
| 812 | 3300034819 | Ga0373958_0002208 | Ga0373958_0002208_1100_1933 | 276 |
| 813 | 3300034820 | Ga0373959_0005211 | Ga0373959_0005211_214_1044 | 276 |
| 814 | 3300034957 | Ga0373938_0003013 | Ga0373938_0003013_963_1793 | 276 |
| 815 | 3300034957 | Ga0373938_0004580 | Ga0373938_0004580_1010_1840 | 276 |
| 816 | 3300034957 | Ga0373938_0027998 | Ga0373938_0027998_157_990 | 276 |
| 817 | 3300035083 | Ga0373926_0049144 | Ga0373926_0049144_498_1421 | 276 |
| 818 | 3300035084 | Ga0373928_0000361 | Ga0373928_0000361_2637_3467 | 276 |
| 819 | 3300035084 | Ga0373928_0003934 | Ga0373928_0003934_1134_1967 | 276 |
| 820 | 3300035084 | Ga0373928_0037247 | Ga0373928_0037247_82_915 | 276 |
| 821 | 3300035085 | Ga0373929_0000927 | Ga0373929_0000927_1239_2069 | 276 |
| 822 | 3300035085 | Ga0373929_0005221 | Ga0373929_0005221_1172_2002 | 276 |
| 823 | 3300035088 | Ga0373940_0000594 | Ga0373940_0000594_3502_4332 | 276 |
| 824 | 3300035088 | Ga0373940_0019435 | Ga0373940_0019435_638_1468 | 276 |
| 825 | 3300035088 | Ga0373940_0027313 | Ga0373940_0027313_306_1136 | 276 |
| 826 | 3300035089 | Ga0373944_0026503 | Ga0373944_0026503_330_1163 | 276 |
| 827 | 3300035090 | Ga0373949_0000308 | Ga0373949_0000308_12563_13393 | 276 |
| 828 | 3300035090 | Ga0373949_0001125 | Ga0373949_0001125_5176_6006 | 276 |
| 829 | 3300035090 | Ga0373949_0003075 | Ga0373949_0003075_2168_3001 | 276 |
| 830 | 3300035091 | Ga0373951_0000393 | Ga0373951_0000393_5745_6575 | 276 |
| 831 | 3300035091 | Ga0373951_0005644 | Ga0373951_0005644_34_867 | 276 |
| 832 | 3300035092 | Ga0373952_0000208 | Ga0373952_0000208_7252_8082 | 276 |
| 833 | 3300035092 | Ga0373952_0003614 | Ga0373952_0003614_1502_2332 | 276 |
| 834 | 3300035111 | Ga0373923_0040203 | Ga0373923_0040203_559_1392 | 276 |
| 835 | 3300035111 | Ga0373923_0067162 | Ga0373923_0067162_545_1375 | 276 |
| 836 | 3300035112 | Ga0373932_0000031 | Ga0373932_0000031_17485_18315 | 276 |
| 837 | 3300035112 | Ga0373932_0001291 | Ga0373932_0001291_1105_1935 | 276 |
| 838 | 3300035112 | Ga0373932_0002778 | Ga0373932_0002778_1650_2483 | 276 |
| 839 | 3300035113 | Ga0373936_0041267 | Ga0373936_0041267_598_1431 | 276 |
| 840 | 3300035114 | Ga0373939_0000083 | Ga0373939_0000083_6747_7577 | 276 |
| 841 | 3300035114 | Ga0373939_0002536 | Ga0373939_0002536_2017_2847 | 276 |
| 842 | 3300035114 | Ga0373939_0006676 | Ga0373939_0006676_537_1367 | 276 |
| 843 | 3300035115 | Ga0373941_0000540 | Ga0373941_0000540_5094_5924 | 276 |
| 844 | 3300035115 | Ga0373941_0003276 | Ga0373941_0003276_130_960 | 276 |
| 845 | 3300035115 | Ga0373941_0006891 | Ga0373941_0006891_1392_2225 | 276 |
| 846 | 3300035117 | Ga0373953_0087433 | Ga0373953_0087433_383_1213 | 276 |
| 847 | 3300035118 | Ga0373954_0002212 | Ga0373954_0002212_5562_6392 | 276 |
| 848 | 3300035118 | Ga0373954_0017610 | Ga0373954_0017610_292_1215 | 276 |
| 849 | 3300035120 | Ga0373957_0004504 | Ga0373957_0004504_2865_3695 | 276 |
| 850 | 3300035120 | Ga0373957_0051454 | Ga0373957_0051454_179_1009 | 276 |
| 851 | 3300035121 | Ga0373960_0000088 | Ga0373960_0000088_11505_12335 | 276 |
| 852 | 3300035121 | Ga0373960_0016046 | Ga0373960_0016046_216_1046 | 276 |
| 853 | 3300035121 | Ga0373960_0020821 | Ga0373960_0020821_211_1044 | 276 |
| 854 | 3300035170 | Ga0373943_0036171 | Ga0373943_0036171_1358_2188 | 276 |
| 855 | 3300035170 | Ga0373943_0169942 | Ga0373943_0169942_232_1158 | 276 |
| 856 | 3300035171 | Ga0373946_0015402 | Ga0373946_0015402_1906_2829 | 276 |
| 857 | 3300035171 | Ga0373946_0017067 | Ga0373946_0017067_1410_2240 | 276 |
| 858 | 3300035171 | Ga0373946_0181357 | Ga0373946_0181357_101_931 | 276 |
| 859 | 3300035172 | Ga0373955_0005908 | Ga0373955_0005908_1159_1989 | 276 |
| 860 | 3300035172 | Ga0373955_0229157 | Ga0373955_0229157_208_1038 | 276 |
| 861 | 3300035207 | Ga0373942_0001977 | Ga0373942_0001977_409_1239 | 276 |
| 862 | 3300035207 | Ga0373942_0005072 | Ga0373942_0005072_592_1422 | 276 |
| 863 | 3300035207 | Ga0373942_0015853 | Ga0373942_0015853_130_960 | 276 |
| 864 | 3300035241 | Ga0373961_0000539 | Ga0373961_0000539_6955_7785 | 276 |
| 865 | 3300035241 | Ga0373961_0021041 | Ga0373961_0021041_608_1438 | 276 |
| 866 | 3300035242 | Ga0373962_0000715 | Ga0373962_0000715_958_1788 | 276 |
| 867 | 3300035242 | Ga0373962_0001826 | Ga0373962_0001826_2253_3083 | 276 |
| 868 | 3300035410 | Ga0373924_0060690 | Ga0373924_0060690_421_1254 | 276 |
| 869 | 3300035691 | Ga0373931_0000034 | Ga0373931_0000034_60738_61568 | 276 |
| 870 | 3300035691 | Ga0373931_0001752 | Ga0373931_0001752_2805_3635 | 276 |
| 871 | 3300035691 | Ga0373931_0002007 | Ga0373931_0002007_6038_6871 | 276 |
| 872 | 3300035691 | Ga0373931_0029793 | Ga0373931_0029793_1803_2636 | 276 |
| 873 | 3300035692 | Ga0373935_0036652 | Ga0373935_0036652_802_1725 | 276 |
| 874 | 3300035695 | Ga0373927_0027484 | Ga0373927_0027484_446_1279 | 276 |
| 875 | 3300035695 | Ga0373927_0062736 | Ga0373927_0062736_999_1829 | 276 |
| 876 | 3300035695 | Ga0373927_0090003 | Ga0373927_0090003_1049_1879 | 276 |
| 877 | 3300035724 | Ga0373933_0005149 | Ga0373933_0005149_76_906 | 276 |
| 878 | 3300035724 | Ga0373933_0014886 | Ga0373933_0014886_1869_2699 | 276 |
| 879 | 3300035724 | Ga0373933_0123954 | Ga0373933_0123954_453_1283 | 276 |
| 880 | 3300035725 | Ga0373947_0022290 | Ga0373947_0022290_2235_3068 | 276 |
| 881 | 3300035725 | Ga0373947_0022926 | Ga0373947_0022926_1888_2721 | 276 |
| 882 | 3300036401 | Ga0373937_0218789 | Ga0373937_0218789_239_1162 | 276 |
| 883 | 3300036401 | Ga0373937_0283598 | Ga0373937_0283598_641_1471 | 276 |
| 884 | 3300037068 | Ga0373925_0008801 | Ga0373925_0008801_2381_3214 | 276 |
| 885 | 3300037068 | Ga0373925_0085861 | Ga0373925_0085861_600_1523 | 276 |
| 886 | 3300037068 | Ga0373925_0183584 | Ga0373925_0183584_592_1422 | 276 |
| 887 | 3300037068 | Ga0373925_0318438 | Ga0373925_0318438_183_1013 | 276 |
| 888 | 3300039437 | Ga0436365_1671729 | Ga0436365_1671729_1164_1994 | 276 |
| 889 | 3300042001 | Ga0439441_010949 | Ga0439441_010949_309_1139 | 276 |
| 890 | 3300042461 | Ga0439460_0028728 | Ga0439460_0028728_189_1019 | 276 |
| 891 | 3300045051 | Ga0451576_0012930 | Ga0451576_0012930_7398_8228 | 276 |
| 892 | 3300046452 | Ga0495617_009118 | Ga0495617_009118_1243_2166 | 276 |
| 893 | 3300046454 | Ga0495592_0003774 | Ga0495592_0003774_4742_5572 | 276 |
| 894 | 3300046454 | Ga0495592_0009503 | Ga0495592_0009503_1508_2338 | 276 |
| 895 | 3300046455 | Ga0495603_0164686 | Ga0495603_0164686_83_913 | 276 |
| 896 | 3300046459 | Ga0495629_0000690 | Ga0495629_0000690_5720_6553 | 276 |
| 897 | 3300046459 | Ga0495629_0004882 | Ga0495629_0004882_6556_7479 | 276 |
| 898 | 3300046459 | Ga0495629_0041679 | Ga0495629_0041679_1278_2108 | 276 |
| 899 | 3300046461 | Ga0495641_0059768 | Ga0495641_0059768_872_1705 | 276 |
| 900 | 3300046462 | Ga0495651_0014052 | Ga0495651_0014052_3780_4610 | 276 |
| 901 | 3300046462 | Ga0495651_0018759 | Ga0495651_0018759_2249_3172 | 276 |
| 902 | 3300046463 | Ga0495653_0004104 | Ga0495653_0004104_2611_3441 | 276 |
| 903 | 3300046463 | Ga0495653_0011137 | Ga0495653_0011137_1756_2589 | 276 |
| 904 | 3300046463 | Ga0495653_0108867 | Ga0495653_0108867_713_1543 | 276 |
| 905 | 3300046472 | Ga0495580_0016533 | Ga0495580_0016533_1412_2245 | 276 |
| 906 | 3300046473 | Ga0495582_0027132 | Ga0495582_0027132_1295_2128 | 276 |
| 907 | 3300046473 | Ga0495582_0046935 | Ga0495582_0046935_1501_2334 | 276 |
| 908 | 3300046474 | Ga0495605_0022132 | Ga0495605_0022132_514_1344 | 276 |
| 909 | 3300046475 | Ga0495639_0029813 | Ga0495639_0029813_318_1241 | 276 |
| 910 | 3300046475 | Ga0495639_0041470 | Ga0495639_0041470_1015_1845 | 276 |
| 911 | 3300046477 | Ga0495664_0000935 | Ga0495664_0000935_13234_14064 | 276 |
| 912 | 3300046477 | Ga0495664_0032161 | Ga0495664_0032161_1619_2452 | 276 |
| 913 | 3300046491 | Ga0495584_0028985 | Ga0495584_0028985_949_1872 | 276 |
| 914 | 3300046492 | Ga0495585_0001893 | Ga0495585_0001893_6740_7663 | 276 |
| 915 | 3300046499 | Ga0495594_0081117 | Ga0495594_0081117_26_952 | 276 |
| 916 | 3300046501 | Ga0495607_0019327 | Ga0495607_0019327_2722_3555 | 276 |
| 917 | 3300046511 | Ga0495608_0014494 | Ga0495608_0014494_4239_5069 | 276 |
| 918 | 3300046511 | Ga0495608_0017107 | Ga0495608_0017107_3115_4038 | 276 |
| 919 | 3300046512 | Ga0495610_0022484 | Ga0495610_0022484_284_1117 | 276 |
| 920 | 3300046514 | Ga0495618_0003011 | Ga0495618_0003011_7428_8258 | 276 |
| 921 | 3300046514 | Ga0495618_0005170 | Ga0495618_0005170_4384_5307 | 276 |
| 922 | 3300046516 | Ga0495628_0005583 | Ga0495628_0005583_5435_6265 | 276 |
| 923 | 3300046517 | Ga0495630_0008623 | Ga0495630_0008623_6467_7300 | 276 |
| 924 | 3300046517 | Ga0495630_0135201 | Ga0495630_0135201_556_1386 | 276 |
| 925 | 3300046522 | Ga0495643_0129308 | Ga0495643_0129308_375_1208 | 276 |
| 926 | 3300046523 | Ga0495644_0000609 | Ga0495644_0000609_1890_2723 | 276 |
| 927 | 3300046529 | Ga0495652_0020631 | Ga0495652_0020631_529_1452 | 276 |
| 928 | 3300046529 | Ga0495652_0201207 | Ga0495652_0201207_267_1097 | 276 |
| 929 | 3300046531 | Ga0495665_0089355 | Ga0495665_0089355_534_1457 | 276 |
| 930 | 3300046533 | Ga0495640_0019188 | Ga0495640_0019188_1069_1899 | 276 |
| 931 | 3300046535 | Ga0495586_0031215 | Ga0495586_0031215_1263_2093 | 276 |
| 932 | 3300046536 | Ga0495587_0001842 | Ga0495587_0001842_6964_7794 | 276 |
| 933 | 3300046536 | Ga0495587_0040716 | Ga0495587_0040716_321_1154 | 276 |
| 934 | 3300046538 | Ga0495609_0114552 | Ga0495609_0114552_36_866 | 276 |
| 935 | 3300046543 | Ga0495645_0008466 | Ga0495645_0008466_4332_5162 | 276 |
| 936 | 3300046557 | Ga0495622_0013890 | Ga0495622_0013890_358_1281 | 276 |
| 937 | 3300046559 | Ga0495667_0000946 | Ga0495667_0000946_13375_14205 | 276 |
| 938 | 3300046559 | Ga0495667_0020778 | Ga0495667_0020778_1795_2625 | 276 |
| 939 | 3300046615 | Ga0495656_0000135 | Ga0495656_0000135_23637_24560 | 276 |
| 940 | 3300046642 | Ga0495634_0007276 | Ga0495634_0007276_7170_8000 | 276 |
| 941 | 3300046642 | Ga0495634_0007973 | Ga0495634_0007973_227_1150 | 276 |
| 942 | 3300046648 | Ga0495611_0089413 | Ga0495611_0089413_338_1261 | 276 |
| 943 | 3300046663 | Ga0495635_0002226 | Ga0495635_0002226_8069_8992 | 276 |
| 944 | 3300046663 | Ga0495635_0010100 | Ga0495635_0010100_1533_2363 | 276 |
| 945 | 3300046664 | Ga0495659_0001106 | Ga0495659_0001106_6966_7889 | 276 |
| 946 | 3300046665 | Ga0495661_0057261 | Ga0495661_0057261_406_1329 | 276 |
| 947 | 3300046674 | Ga0495588_0024336 | Ga0495588_0024336_605_1528 | 276 |
| 948 | 3300046675 | Ga0495657_0009702 | Ga0495657_0009702_5924_6754 | 276 |
| 949 | 3300046678 | Ga0495599_0014755 | Ga0495599_0014755_3157_3987 | 276 |
| 950 | 3300046678 | Ga0495599_0082279 | Ga0495599_0082279_556_1479 | 276 |
| 951 | 3300046678 | Ga0495599_0118069 | Ga0495599_0118069_206_1036 | 276 |
| 952 | 3300046680 | Ga0495646_0000846 | Ga0495646_0000846_13842_14672 | 276 |
| 953 | 3300046681 | Ga0495647_0017444 | Ga0495647_0017444_1690_2523 | 276 |
| 954 | 3300046683 | Ga0495658_0003137 | Ga0495658_0003137_1952_2785 | 276 |
| 955 | 3300046683 | Ga0495658_0007569 | Ga0495658_0007569_4532_5365 | 276 |
| 956 | 3300046684 | Ga0495669_0026128 | Ga0495669_0026128_1215_2045 | 276 |
| 957 | 3300046689 | Ga0495613_0061433 | Ga0495613_0061433_1901_2734 | 276 |
| 958 | 3300046689 | Ga0495613_0077855 | Ga0495613_0077855_916_1746 | 276 |
| 959 | 3300046690 | Ga0495624_0009424 | Ga0495624_0009424_1460_2293 | 276 |
| 960 | 3300046690 | Ga0495624_0095007 | Ga0495624_0095007_513_1343 | 276 |
| 961 | 3300046691 | Ga0495670_0000427 | Ga0495670_0000427_2437_3270 | 276 |
| 962 | 3300046691 | Ga0495670_0137512 | Ga0495670_0137512_67_900 | 276 |
| 963 | 3300046809 | Ga0495600_0000371 | Ga0495600_0000371_15223_16056 | 276 |
| 964 | 3300046809 | Ga0495600_0002986 | Ga0495600_0002986_456_1286 | 276 |
| 965 | 3300047315 | Ga0495581_0073208 | Ga0495581_0073208_622_1455 | 276 |
| 966 | 3300047317 | Ga0495604_0008735 | Ga0495604_0008735_4826_5656 | 276 |
| 967 | 3300047317 | Ga0495604_0018786 | Ga0495604_0018786_2093_3016 | 276 |
| 968 | 3300047319 | Ga0495674_0009124 | Ga0495674_0009124_685_1515 | 276 |
| 969 | 3300047319 | Ga0495674_0079445 | Ga0495674_0079445_1287_2117 | 276 |
| 970 | 3300047320 | Ga0495672_0122671 | Ga0495672_0122671_208_1041 | 276 |
| 971 | 3300047321 | Ga0495676_0041026 | Ga0495676_0041026_1522_2355 | 276 |
| 972 | 3300047322 | Ga0495680_0002891 | Ga0495680_0002891_16409_17242 | 276 |
| 973 | 3300047322 | Ga0495680_0004911 | Ga0495680_0004911_7154_7984 | 276 |
| 974 | 3300047322 | Ga0495680_0052511 | Ga0495680_0052511_155_985 | 276 |
| 975 | 3300047444 | Ga0495675_0003232 | Ga0495675_0003232_5999_6829 | 276 |
| 976 | 3300047447 | Ga0495685_011033 | Ga0495685_011033_1124_1954 | 276 |
| 977 | 3300047471 | Ga0495684_0001459 | Ga0495684_0001459_13551_14474 | 276 |
| 978 | 3300047471 | Ga0495684_0097058 | Ga0495684_0097058_597_1427 | 276 |
| 979 | 3300047471 | Ga0495684_0166725 | Ga0495684_0166725_510_1340 | 276 |
| 980 | 3300047673 | Ga0495593_0005084 | Ga0495593_0005084_2700_3533 | 276 |
| 981 | 3300047673 | Ga0495593_0017427 | Ga0495593_0017427_1115_1948 | 276 |
| 982 | 3300047673 | Ga0495593_0045359 | Ga0495593_0045359_1271_2101 | 276 |
| 983 | 3300048088 | Ga0495602_0059119 | Ga0495602_0059119_2476_3306 | 276 |
| 984 | 3300048089 | Ga0495614_0013485 | Ga0495614_0013485_1713_2636 | 276 |
| 985 | 3300048903 | Ga0496100_0000050 | Ga0496100_0000050_35936_36766 | 276 |
| 986 | 3300048903 | Ga0496100_0077112 | Ga0496100_0077112_1321_2151 | 276 |
| 987 | 3300048904 | Ga0496101_0000121 | Ga0496101_0000121_23491_24321 | 276 |
| 988 | 3300048904 | Ga0496101_0000736 | Ga0496101_0000736_13209_14039 | 276 |
| 989 | 3300048905 | Ga0496102_0003252 | Ga0496102_0003252_10821_11651 | 276 |
| 990 | 3300048905 | Ga0496102_0085354 | Ga0496102_0085354_592_1422 | 276 |
| 991 | 3300048905 | Ga0496102_0088060 | Ga0496102_0088060_386_1219 | 276 |
| 992 | 3300048905 | Ga0496102_0117195 | Ga0496102_0117195_534_1364 | 276 |
| 993 | 3300048905 | Ga0496102_0327404 | Ga0496102_0327404_254_1084 | 276 |
| 994 | 3300048905 | Ga0496102_0409953 | Ga0496102_0409953_32_862 | 276 |
| 995 | 3300048905 | Ga0496102_0466921 | Ga0496102_0466921_254_1087 | 276 |
| 996 | 3300048906 | Ga0496103_0000175 | Ga0496103_0000175_27619_28449 | 276 |
| 997 | 3300048906 | Ga0496103_0115582 | Ga0496103_0115582_478_1311 | 276 |
| 998 | 3300048907 | Ga0496104_0000454 | Ga0496104_0000454_28144_28974 | 276 |
| 999 | 3300048907 | Ga0496104_0107071 | Ga0496104_0107071_619_1449 | 276 |
| 1000 | 3300048907 | Ga0496104_0128575 | Ga0496104_0128575_305_1135 | 276 |
| 1001 | 3300048907 | Ga0496104_0143317 | Ga0496104_0143317_63_893 | 276 |
| 1002 | 3300048908 | Ga0496105_0027592 | Ga0496105_0027592_2148_2978 | 276 |
| 1003 | 3300048908 | Ga0496105_0072615 | Ga0496105_0072615_921_1751 | 276 |
| 1004 | 3300048908 | Ga0496105_0121105 | Ga0496105_0121105_475_1308 | 276 |
| 1005 | 3300048909 | Ga0496106_0000133 | Ga0496106_0000133_48743_49573 | 276 |
| 1006 | 3300048909 | Ga0496106_0014768 | Ga0496106_0014768_4447_5277 | 276 |
| 1007 | 3300048909 | Ga0496106_0024517 | Ga0496106_0024517_1276_2106 | 276 |
| 1008 | 3300048909 | Ga0496106_0025595 | Ga0496106_0025595_1399_2232 | 276 |
| 1009 | 3300048910 | Ga0496107_0000237 | Ga0496107_0000237_609_1439 | 276 |
| 1010 | 3300048910 | Ga0496107_0018351 | Ga0496107_0018351_1279_2109 | 276 |
| 1011 | 3300048910 | Ga0496107_0046462 | Ga0496107_0046462_411_1241 | 276 |
| 1012 | 3300048910 | Ga0496107_0106139 | Ga0496107_0106139_879_1712 | 276 |
| 1013 | 3300048911 | Ga0496108_0017335 | Ga0496108_0017335_575_1405 | 276 |
| 1014 | 3300048911 | Ga0496108_0036931 | Ga0496108_0036931_2532_3362 | 276 |
| 1015 | 3300048911 | Ga0496108_0124282 | Ga0496108_0124282_32_865 | 276 |
| 1016 | 3300048911 | Ga0496108_0164751 | Ga0496108_0164751_850_1683 | 276 |
| 1017 | 3300048912 | Ga0496109_0007388 | Ga0496109_0007388_7301_8131 | 276 |
| 1018 | 3300048912 | Ga0496109_0026973 | Ga0496109_0026973_4260_5090 | 276 |
| 1019 | 3300048912 | Ga0496109_0431687 | Ga0496109_0431687_62_892 | 276 |
| 1020 | 3300048913 | Ga0496110_0009875 | Ga0496110_0009875_3960_4790 | 276 |
| 1021 | 3300048913 | Ga0496110_0103921 | Ga0496110_0103921_82_915 | 276 |
| 1022 | 3300048914 | Ga0496111_0066222 | Ga0496111_0066222_234_1064 | 276 |
| 1023 | 3300048914 | Ga0496111_0160042 | Ga0496111_0160042_431_1261 | 276 |
| 1024 | 3300048915 | Ga0496112_0229477 | Ga0496112_0229477_884_1714 | 276 |
| 1025 | 3300048915 | Ga0496112_0247188 | Ga0496112_0247188_320_1150 | 276 |
| 1026 | 3300048916 | Ga0496113_0190121 | Ga0496113_0190121_351_1184 | 276 |
| 1027 | 3300048916 | Ga0496113_0227683 | Ga0496113_0227683_38_868 | 276 |
| 1028 | 3300048916 | Ga0496113_0265922 | Ga0496113_0265922_255_1085 | 276 |
| 1029 | 3300048917 | Ga0496114_0002721 | Ga0496114_0002721_399_1229 | 276 |
| 1030 | 3300048917 | Ga0496114_0012692 | Ga0496114_0012692_1516_2346 | 276 |
| 1031 | 3300048917 | Ga0496114_0032154 | Ga0496114_0032154_1998_2831 | 276 |
| 1032 | 3300048918 | Ga0496115_0066203 | Ga0496115_0066203_63_893 | 276 |
| 1033 | 3300048918 | Ga0496115_0081829 | Ga0496115_0081829_613_1443 | 276 |
| 1034 | 3300048918 | Ga0496115_0084764 | Ga0496115_0084764_1714_2547 | 276 |
| 1035 | 3300048918 | Ga0496115_0129112 | Ga0496115_0129112_209_1039 | 276 |
| 1036 | 3300048918 | Ga0496115_0212058 | Ga0496115_0212058_469_1299 | 276 |
| 1037 | 3300048920 | Ga0496117_0036056 | Ga0496117_0036056_1120_1953 | 276 |
| 1038 | 3300048920 | Ga0496117_0052793 | Ga0496117_0052793_556_1389 | 276 |
| 1039 | 3300048921 | Ga0496118_0134551 | Ga0496118_0134551_117_950 | 276 |
| 1040 | 3300048922 | Ga0496119_0188403 | Ga0496119_0188403_11_844 | 276 |
| 1041 | 3300048925 | Ga0496122_0022949 | Ga0496122_0022949_1072_1905 | 276 |
| 1042 | 3300048925 | Ga0496122_0081079 | Ga0496122_0081079_1264_2097 | 276 |
| 1043 | 3300049568 | Ga0501031_0086553 | Ga0501031_0086553_419_1249 | 276 |
| 1044 | 3300049569 | Ga0501032_0090434 | Ga0501032_0090434_756_1586 | 276 |
| 1045 | 3300049569 | Ga0501032_0126405 | Ga0501032_0126405_687_1517 | 276 |
| 1046 | 3300049569 | Ga0501032_0150846 | Ga0501032_0150846_90_920 | 276 |
| 1047 | 3300049569 | Ga0501032_0194621 | Ga0501032_0194621_272_1102 | 276 |
| 1048 | 3300049570 | Ga0501033_0014695 | Ga0501033_0014695_4709_5539 | 276 |
| 1049 | 3300049570 | Ga0501033_0022119 | Ga0501033_0022119_3929_4759 | 276 |
| 1050 | 3300049570 | Ga0501033_0054068 | Ga0501033_0054068_815_1645 | 276 |
| 1051 | 3300049571 | Ga0501034_0042726 | Ga0501034_0042726_2890_3720 | 276 |
| 1052 | 3300049571 | Ga0501034_0060549 | Ga0501034_0060549_2229_3059 | 276 |
| 1053 | 3300049571 | Ga0501034_0151914 | Ga0501034_0151914_645_1478 | 276 |
| 1054 | 3300049571 | Ga0501034_0167393 | Ga0501034_0167393_921_1751 | 276 |
| 1055 | 3300049571 | Ga0501034_0264152 | Ga0501034_0264152_705_1535 | 276 |
| 1056 | 3300049571 | Ga0501034_0468769 | Ga0501034_0468769_315_1145 | 276 |
| 1057 | 3300049572 | Ga0501036_0003133 | Ga0501036_0003133_1494_2324 | 276 |
| 1058 | 3300049572 | Ga0501036_0026699 | Ga0501036_0026699_792_1622 | 276 |
| 1059 | 3300049572 | Ga0501036_0059934 | Ga0501036_0059934_834_1664 | 276 |
| 1060 | 3300049572 | Ga0501036_0503699 | Ga0501036_0503699_105_935 | 276 |
| 1061 | 3300049573 | Ga0501037_0014087 | Ga0501037_0014087_3911_4744 | 276 |
| 1062 | 3300049573 | Ga0501037_0034335 | Ga0501037_0034335_2268_3098 | 276 |
| 1063 | 3300049573 | Ga0501037_0074977 | Ga0501037_0074977_962_1792 | 276 |
| 1064 | 3300049574 | Ga0501038_0025621 | Ga0501038_0025621_687_1517 | 276 |
| 1065 | 3300049574 | Ga0501038_0064795 | Ga0501038_0064795_2106_2936 | 276 |
| 1066 | 3300049574 | Ga0501038_0090496 | Ga0501038_0090496_727_1557 | 276 |
| 1067 | 3300049574 | Ga0501038_0125562 | Ga0501038_0125562_13_843 | 276 |
| 1068 | 3300049578 | Ga0501042_0315851 | Ga0501042_0315851_172_1002 | 276 |
| 1069 | 3300049579 | Ga0501043_0002174 | Ga0501043_0002174_14680_15510 | 276 |
| 1070 | 3300049579 | Ga0501043_0019813 | Ga0501043_0019813_3671_4501 | 276 |
| 1071 | 3300049579 | Ga0501043_0141415 | Ga0501043_0141415_868_1698 | 276 |
| 1072 | 3300049580 | Ga0501046_0076410 | Ga0501046_0076410_592_1422 | 276 |
| 1073 | 3300049581 | Ga0501047_0019888 | Ga0501047_0019888_2119_2949 | 276 |
| 1074 | 3300049581 | Ga0501047_0090599 | Ga0501047_0090599_636_1466 | 276 |
| 1075 | 3300049581 | Ga0501047_0192663 | Ga0501047_0192663_1017_1847 | 276 |
| 1076 | 3300049582 | Ga0501048_0116600 | Ga0501048_0116600_1026_1856 | 276 |
| 1077 | 3300049582 | Ga0501048_0206530 | Ga0501048_0206530_323_1246 | 276 |
| 1078 | 3300049582 | Ga0501048_0248442 | Ga0501048_0248442_373_1203 | 276 |
| 1079 | 3300049583 | Ga0501067_0029026 | Ga0501067_0029026_1678_2508 | 276 |
| 1080 | 3300049586 | Ga0501070_0025114 | Ga0501070_0025114_3927_4757 | 276 |
| 1081 | 3300049586 | Ga0501070_0152763 | Ga0501070_0152763_765_1595 | 276 |
| 1082 | 3300049586 | Ga0501070_0167154 | Ga0501070_0167154_939_1769 | 276 |
| 1083 | 3300049587 | Ga0501071_0065654 | Ga0501071_0065654_101_934 | 276 |
| 1084 | 3300049587 | Ga0501071_0253519 | Ga0501071_0253519_81_911 | 276 |
| 1085 | 3300049587 | Ga0501071_0347921 | Ga0501071_0347921_119_949 | 276 |
| 1086 | 3300049588 | Ga0501072_0032679 | Ga0501072_0032679_1152_1985 | 276 |
| 1087 | 3300049588 | Ga0501072_0335628 | Ga0501072_0335628_311_1144 | 276 |
| 1088 | 3300049589 | Ga0501073_0065786 | Ga0501073_0065786_436_1266 | 276 |
| 1089 | 3300049590 | Ga0501074_0090568 | Ga0501074_0090568_381_1211 | 276 |
| 1090 | 3300049592 | Ga0501076_0029006 | Ga0501076_0029006_422_1252 | 276 |
| 1091 | 3300049592 | Ga0501076_0280202 | Ga0501076_0280202_407_1240 | 276 |
| 1092 | 3300049742 | Ga0501080_0028616 | Ga0501080_0028616_744_1574 | 276 |
| 1093 | 3300049742 | Ga0501080_0149856 | Ga0501080_0149856_923_1753 | 276 |
| 1094 | 3300049742 | Ga0501080_0468059 | Ga0501080_0468059_138_968 | 276 |
| 1095 | 3300049743 | Ga0501081_0030358 | Ga0501081_0030358_1528_2358 | 276 |
| 1096 | 3300049822 | Ga0501035_0039179 | Ga0501035_0039179_1682_2512 | 276 |
| 1097 | 3300049822 | Ga0501035_0059429 | Ga0501035_0059429_1468_2298 | 276 |
| 1098 | 3300049822 | Ga0501035_0060617 | Ga0501035_0060617_555_1385 | 276 |
| 1099 | 3300049822 | Ga0501035_0111490 | Ga0501035_0111490_1048_1878 | 276 |
| 1100 | 3300049823 | Ga0501044_0020829 | Ga0501044_0020829_5931_6761 | 276 |
| 1101 | 3300049823 | Ga0501044_0232670 | Ga0501044_0232670_547_1377 | 276 |
| 1102 | 3300049823 | Ga0501044_0328200 | Ga0501044_0328200_581_1411 | 276 |
| 1103 | 3300049823 | Ga0501044_0557423 | Ga0501044_0557423_44_874 | 276 |
| 1104 | 3300050492 | nmdc:mga0yw44_189281_c1 | nmdc:mga0yw44_189281_c1_500_1336 | 276 |
| 1105 | 3300050492 | nmdc:mga0yw44_279559_c1 | nmdc:mga0yw44_279559_c1_142_990 | 276 |
| 1106 | 3300050494 | nmdc:mga06z11_32988_c1 | nmdc:mga06z11_32988_c1_1020_1850 | 276 |
| 1107 | 3300050496 | nmdc:mga07m45_47599_c1 | nmdc:mga07m45_47599_c1_930_1760 | 276 |
| 1108 | 3300050507 | nmdc:mga05p37_34216_c1 | nmdc:mga05p37_34216_c1_4319_5152 | 276 |
| 1109 | 3300050507 | nmdc:mga05p37_354_c1 | nmdc:mga05p37_354_c1_47354_48187 | 276 |
| 1110 | 3300050508 | nmdc:mga09592_1311_c1 | nmdc:mga09592_1311_c1_5773_6606 | 276 |
| 1111 | 3300050509 | nmdc:mga0qj67_1940_c1 | nmdc:mga0qj67_1940_c1_712_1545 | 276 |
| 1112 | 3300050509 | nmdc:mga0qj67_452_c1 | nmdc:mga0qj67_452_c1_23276_24109 | 276 |
| 1113 | 3300050510 | nmdc:mga06r32_147_c1 | nmdc:mga06r32_147_c1_1020_1853 | 276 |
| 1114 | 3300050511 | nmdc:mga08y16_1264_c1 | nmdc:mga08y16_1264_c1_584_1417 | 276 |
| 1115 | 3300050511 | nmdc:mga08y16_463250_c1 | nmdc:mga08y16_463250_c1_51_881 | 276 |
| 1116 | 3300050511 | nmdc:mga08y16_706_c1 | nmdc:mga08y16_706_c1_23883_24713 | 276 |
| 1117 | 3300050512 | nmdc:mga0n895_126_c1 | nmdc:mga0n895_126_c1_38998_39828 | 276 |
| 1118 | 3300050512 | nmdc:mga0n895_203244_c1 | nmdc:mga0n895_203244_c1_521_1354 | 276 |
| 1119 | 3300050512 | nmdc:mga0n895_3658_c1 | nmdc:mga0n895_3658_c1_9533_10366 | 276 |
| 1120 | 3300050512 | nmdc:mga0n895_73852_c1 | nmdc:mga0n895_73852_c1_1798_2628 | 276 |
| 1121 | 3300050513 | nmdc:mga0rr50_110564_c1 | nmdc:mga0rr50_110564_c1_1160_1993 | 276 |
| 1122 | 3300050513 | nmdc:mga0rr50_58565_c1 | nmdc:mga0rr50_58565_c1_1245_2078 | 276 |
| 1123 | 3300050514 | nmdc:mga08x19_34989_c1 | nmdc:mga08x19_34989_c1_520_1353 | 276 |
| 1124 | 3300050515 | nmdc:mga0a205_197_c1 | nmdc:mga0a205_197_c1_8473_9303 | 276 |
| 1125 | 3300050515 | nmdc:mga0a205_35258_c1 | nmdc:mga0a205_35258_c1_2036_2869 | 276 |
| 1126 | 3300053077 | Ga0495601_0000068 | Ga0495601_0000068_45652_46482 | 276 |
| 1127 | 3300053077 | Ga0495601_0042090 | Ga0495601_0042090_675_1505 | 276 |
| 1128 | 3300053077 | Ga0495601_0050293 | Ga0495601_0050293_63_893 | 276 |
| 1129 | 3300053078 | Ga0495612_0001544 | Ga0495612_0001544_4750_5580 | 276 |
| 1130 | 3300053078 | Ga0495612_0014034 | Ga0495612_0014034_103_933 | 276 |
| 1131 | 3300053078 | Ga0495612_0020815 | Ga0495612_0020815_784_1707 | 276 |
| 1132 | 3300053079 | Ga0500610_0084049 | Ga0500610_0084049_330_1163 | 276 |
| 1133 | 3300053084 | Ga0495595_0001152 | Ga0495595_0001152_5488_6318 | 276 |
| 1134 | 3300053084 | Ga0495595_0001627 | Ga0495595_0001627_6155_6985 | 276 |
| 1135 | 3300053085 | Ga0495619_0000154 | Ga0495619_0000154_6339_7169 | 276 |
| 1136 | 3300053085 | Ga0495619_0001079 | Ga0495619_0001079_1565_2398 | 276 |
| 1137 | 3300053085 | Ga0495619_0010153 | Ga0495619_0010153_263_1093 | 276 |
| 1138 | 3300053085 | Ga0495619_0016781 | Ga0495619_0016781_2460_3290 | 276 |
| 1139 | 3300053085 | Ga0495619_0022065 | Ga0495619_0022065_3219_4052 | 276 |
| 1140 | 3300053087 | Ga0500643_000833 | Ga0500643_000833_13659_14489 | 276 |
| 1141 | 3300053088 | Ga0500644_0000982 | Ga0500644_0000982_1032_1862 | 276 |
| 1142 | 3300053093 | Ga0500651_0008832 | Ga0500651_0008832_4674_5504 | 276 |
| 1143 | 3300053094 | Ga0500566_0038988 | Ga0500566_0038988_614_1444 | 276 |
| 1144 | 3300053096 | Ga0500641_0015946 | Ga0500641_0015946_402_1235 | 276 |
| 1145 | 3300053098 | Ga0500650_0030316 | Ga0500650_0030316_1397_2227 | 276 |
| 1146 | 3300053109 | Ga0500569_066558 | Ga0500569_066558_160_993 | 276 |
| 1147 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_554005_554835 | 276 |
| 1148 | 3300053122 | Ga0500608_128682 | Ga0500608_128682_68_901 | 276 |
| 1149 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_620355_621185 | 276 |
| 1150 | 3300053153 | Ga0500616_0010066 | Ga0500616_0010066_4633_5466 | 276 |
| 1151 | 3300053156 | Ga0500622_0036280 | Ga0500622_0036280_406_1239 | 276 |
| 1152 | 3300053177 | Ga0500636_0045638 | Ga0500636_0045638_579_1412 | 276 |
| 1153 | 3300053730 | Ga0500645_000549 | Ga0500645_000549_7974_8804 | 276 |
| 1154 | 3300054114 | Ga0501084_0066272 | Ga0501084_0066272_327_1157 | 276 |
| 1155 | 3300054114 | Ga0501084_0320043 | Ga0501084_0320043_122_952 | 276 |
| 1156 | 3300060353 | Ga0501082_0102444 | Ga0501082_0102444_985_1815 | 276 |
| 1157 | 3300061734 | Ga0530510_0056915 | Ga0530510_0056915_168_1001 | 276 |
| 1158 | iso_pu_bacteria | 2851182111 | 2851182304 | 276 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6fmt-assembly1.cif.gz_A | imisx-ep of hg-baca soaking sad | 0.5922 | 13 | 276 |
| 6fmt-assembly1.cif.gz_A | imisx-ep of hg-baca soaking sad | 0.5865 | 13 | 276 |
| 6cb2-assembly1.cif.gz_A | crystal structure of escherichia coli uppp | 0.5507 | 17 | 276 |
| 6cb2-assembly1.cif.gz_A | crystal structure of escherichia coli uppp | 0.5321 | 17 | 276 |
| 4lds-assembly1.cif.gz_B | the inward-facing structure of the glucose transporter from staphylococcus epidermidis | 0.3586 | 17 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0XLR0_202_437_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4527 | 48 | 249 | 1.20.1250.20 |
| af_Q54E67_237_417_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4459 | 58 | 274 | 1.20.1250.20 |
| af_Q54E67_237_417_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.427 | 58 | 274 | 1.20.1250.20 |
| af_A0A1D6FKK2_52_340_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4055 | 12 | 271 | 1.20.1250.20 |
| af_O07730_221_402_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4012 | 59 | 274 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A800M742-F1-model_v4 | Probable membrane transporter protein | 0.9738 | 11 | 274 |
GO:0005886
|
| AF-A0A2U1V8W1-F1-model_v4 | Probable membrane transporter protein | 0.9707 | 10 | 274 |
GO:0005886
|
| AF-A0A2W5BL51-F1-model_v4 | deleted | 0.9706 | 5 | 221 |
|
| AF-A0A7U3E1W1-F1-model_v4 | deleted | 0.9698 | 1 | 274 |
|
| AF-A0A3D2W4T4-F1-model_v4 | Probable membrane transporter protein | 0.9683 | 9 | 206 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar