F490968

General Info

Members Datasets Scaffolds Average Seq Length
1158 472 1143 276

Family's Representative Sequence

Representative Sequence 3300025294|Ga0209025_1066093|Ga0209025_10660931
Length 311
Sequence MHCTQALTALARPALPWHAKYRRGCAPFVTDKVFMFSAISPGELAFLAASLIVAGAITGILAGLFGVGGGAVIVPILYEIFRIIGVPEEVRMPLCVGTSLAIIIPTSIRSFNAHRAKGLVDLSILKIWAVPVVLGVLAGSYIARFAPPDLFKIIFVLVAVLSALRLLFAADKWKFGEDLPGKPVMVGYGGLIGVLSALMGIGGGQLSSLFMTFYGRPIHQAIATSSGLGVLISIPGALGFIYAGWPKMDLLPPLSLGYVSFIGFLLFIPTSIWMAPVGARMAHRLSKRKLEVVFGIFLLTVAGRFIWSLLA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
4 2643221733 Bosea sp. Root381 Isolate Unclassified
5 2643221734 Bosea sp. Root670 Isolate Unclassified
6 2643221736 Bosea sp. Root483D1 Isolate Unclassified
7 2818991467 Bosea vestrisii 3192 Isolate Unclassified
8 2841760612 Bosea sp. Tri-49 Isolate Nodule
9 2844104063 Bosea sp. Tri-39 Isolate Nodule
10 2851182111 Bosea sp. Tri-44 Isolate Nodule
11 2851246043 Bosea sp. Tri-54 Isolate Nodule
12 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
13 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
14 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
15 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
16 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
17 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
18 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
19 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
20 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
21 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
25 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
26 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
27 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
28 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
29 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
30 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
31 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
39 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
58 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
71 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
72 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
73 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
74 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
75 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
76 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
77 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
78 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
86 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
87 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
94 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
95 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
104 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
105 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
106 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
107 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
108 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
113 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
114 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
115 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
116 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
117 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
118 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
119 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
120 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
121 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
122 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
123 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
124 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
125 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
126 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
127 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
128 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
132 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
133 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
134 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
135 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
136 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
137 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
138 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
139 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
141 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
145 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
146 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
148 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
149 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
150 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
151 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
152 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
153 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
156 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
157 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
158 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
159 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
160 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
172 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
173 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
174 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
178 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
254 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
256 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
257 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
261 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
262 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
263 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
264 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
265 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
266 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
267 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
268 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
269 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
270 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
271 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
272 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
273 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
274 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
275 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
276 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
277 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
278 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
279 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
280 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
281 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
282 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
283 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
284 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
285 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
286 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
288 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
289 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
290 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
291 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
292 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
293 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
294 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
295 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
296 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
297 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
298 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
299 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
300 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
301 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
302 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
303 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
304 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
305 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
306 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
307 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
308 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
309 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
310 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
311 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
312 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
313 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
314 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
315 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
316 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
317 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
318 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
319 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
320 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
321 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
322 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
323 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
324 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
325 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
326 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
329 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
330 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
331 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
332 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
333 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
334 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
335 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
336 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
337 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
338 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
339 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
340 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
341 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
342 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
343 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
344 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
345 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
346 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
347 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
348 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
349 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
350 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
351 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
352 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
353 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
354 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
355 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
356 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
357 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
358 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
359 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
360 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
361 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
362 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
363 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
364 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
365 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
366 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
367 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
368 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
369 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
370 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
371 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
372 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
373 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
374 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
375 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
376 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
377 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
378 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
379 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
380 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
381 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
382 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
383 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
384 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
385 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
386 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
387 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
388 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
389 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
390 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
391 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
392 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
393 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
394 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
395 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
396 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
397 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
398 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
399 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
400 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
401 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
402 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
403 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
404 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
405 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
406 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
407 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
408 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
422 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
423 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
424 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
425 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
426 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
427 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
428 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
429 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
430 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
431 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
432 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
434 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
435 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
436 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
437 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
438 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
439 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
440 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
441 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
442 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
443 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
444 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
445 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
446 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
447 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
448 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
449 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
450 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
451 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
452 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
453 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
454 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
455 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
456 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
457 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
458 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
459 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
460 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
461 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
462 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
463 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
464 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
465 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
466 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
467 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
468 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
469 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
470 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
471 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
472 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.53
Nodule 0.52
Rhizoplane 4.66
Rhizosphere 87.65
Stem 0
Stem Tuber 0
Unclassified 1.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214767425 2209111006 Bacteria 2786
2 ARcpr5oldR_c000015 3300000041 Bacteria 37040
3 ARSoilYngRDRAFT_c00006 3300000042 Bacteria 34836
4 ARcpr5yngRDRAFT_c000041 3300000043 Bacteria 20456
5 ARSoilOldRDRAFT_c000020 3300000044 Bacteria 36475
6 ARCol0oldRDRAFT_c00041 3300000045 Bacteria 9974
7 ARCol0yngRDRAFT_1000465 3300000652 Bacteria 4874
8 JGI24746J21847_1001428 3300001977 Bacteria 3802
9 JGI24747J21853_1002861 3300001978 Unclassified 1451
10 JGI24739J22299_10000344 3300001989 Bacteria 15875
11 JGI24737J22298_10000203 3300001990 Bacteria 19319
12 JGI24737J22298_10023970 3300001990 Bacteria 1933
13 JGI24750J21931_1000159 3300002070 Bacteria 11336
14 JGI24745J21846_1000003 3300002073 Bacteria 15974
15 JGI24748J21848_1000190 3300002074 Bacteria 7872
16 JGI24738J21930_10000042 3300002075 Bacteria 24954
17 JGI24749J21850_1000350 3300002076 Bacteria 6870
18 JGI24035J26624_1000010 3300002126 Bacteria 13491
19 JGI24742J22300_10000016 3300002244 Bacteria 26706
20 JGI25159J45721_1004563 3300002987 Bacteria 4563
21 JGI25151J46595_10000040 3300003187 Bacteria 176750
22 JGI25404J52841_10000207 3300003659 Bacteria 7108
23 Ga0055526_1000351 3300003771 Bacteria 37413
24 Ga0055526_1001693 3300003771 Bacteria 15409
25 Ga0055526_1003504 3300003771 Bacteria 9924
26 Ga0055524_1000023 3300003775 Bacteria 221408
27 JGI25405J52794_10003103 3300003911 Bacteria 2892
28 Ga0065165_1000218 3300005262 Bacteria 100161
29 Ga0065717_1002525 3300005276 Bacteria 1865
30 Ga0065716_1002178 3300005277 Bacteria 2134
31 Ga0065704_10073457 3300005289 Bacteria 7145
32 Ga0065712_10002616 3300005290 Bacteria 7662
33 Ga0065712_10068673 3300005290 Bacteria 9438
34 Ga0065712_10116506 3300005290 Bacteria 1735
35 Ga0065712_10119855 3300005290 Bacteria 1682
36 Ga0065715_10001423 3300005293 Bacteria 13648
37 Ga0065715_10088987 3300005293 Bacteria 18087
38 Ga0065715_10200234 3300005293 Unclassified 1365
39 Ga0065707_10107116 3300005295 Bacteria 2568
40 Ga0070658_10146191 3300005327 Bacteria 1977
41 Ga0070658_10344368 3300005327 Bacteria 1275
42 Ga0070676_10000784 3300005328 Bacteria 15682
43 Ga0070676_10016846 3300005328 Bacteria 4040
44 Ga0070683_100000114 3300005329 Bacteria 52980
45 Ga0070683_100088017 3300005329 Bacteria 2913
46 Ga0070683_100173151 3300005329 Bacteria 2049
47 Ga0070683_100232230 3300005329 Bacteria 1754
48 Ga0070683_100335950 3300005329 Unclassified 1438
49 Ga0070690_100000064 3300005330 Bacteria 53027
50 Ga0070690_100015359 3300005330 Plasmid 4566
51 Ga0070690_100056719 3300005330 Bacteria 2512
52 Ga0070670_100002373 3300005331 Bacteria 15518
53 Ga0070670_100005338 3300005331 Bacteria 10835
54 Ga0070670_100054895 3300005331 Bacteria 3420
55 Ga0070670_100509442 3300005331 Bacteria 1071
56 Ga0070670_100524850 3300005331 Unclassified 1055
57 Ga0070677_10000193 3300005333 Bacteria 20923
58 Ga0068869_100000020 3300005334 Bacteria 66561
59 Ga0070666_10005751 3300005335 Bacteria 7616
60 Ga0070680_100000242 3300005336 Bacteria 36144
61 Ga0070680_100049833 3300005336 Bacteria 3415
62 Ga0070680_100059770 3300005336 Bacteria 3119
63 Ga0070680_100192106 3300005336 Bacteria 1720
64 Ga0070680_100362109 3300005336 Bacteria 1234
65 Ga0070682_100000224 3300005337 Bacteria 41040
66 Ga0070682_100016367 3300005337 Bacteria 4310
67 Ga0070682_100075915 3300005337 Unclassified 2162
68 Ga0070682_100318486 3300005337 Bacteria 1148
69 Ga0068868_100003038 3300005338 Bacteria 11683
70 Ga0068868_100005421 3300005338 Bacteria 8962
71 Ga0068868_100327527 3300005338 Bacteria 1306
72 Ga0070660_100000123 3300005339 Bacteria 48796
73 Ga0070660_100075002 3300005339 Bacteria 2647
74 Ga0070660_100480214 3300005339 Unclassified 1033
75 Ga0070689_100000685 3300005340 Bacteria 20556
76 Ga0070689_100010928 3300005340 Bacteria 6487
77 Ga0070691_10001254 3300005341 Bacteria 10708
78 Ga0070691_10088293 3300005341 Bacteria 1526
79 Ga0070687_100000351 3300005343 Bacteria 15646
80 Ga0070687_100016686 3300005343 Bacteria 3358
81 Ga0070661_100000039 3300005344 Bacteria 102990
82 Ga0070661_100144629 3300005344 Bacteria 1794
83 Ga0070692_10062423 3300005345 Bacteria 1966
84 Ga0070668_100003586 3300005347 Bacteria 11452
85 Ga0070668_100128113 3300005347 Unclassified 2035
86 Ga0070669_100000176 3300005353 Bacteria 55540
87 Ga0070669_100073632 3300005353 Bacteria 2531
88 Ga0070669_100204124 3300005353 Bacteria 1557
89 Ga0070675_100000259 3300005354 Bacteria 34661
90 Ga0070675_100254869 3300005354 Bacteria 1536
91 Ga0070671_100005757 3300005355 Bacteria 9872
92 Ga0070674_100000099 3300005356 Bacteria 40231
93 Ga0070674_100018430 3300005356 Bacteria 4414
94 Ga0070674_100193057 3300005356 Bacteria 1568
95 Ga0070673_100018362 3300005364 Bacteria 4993
96 Ga0070673_100359816 3300005364 Bacteria 1293
97 Ga0070688_100000329 3300005365 Bacteria 24316
98 Ga0070688_100050563 3300005365 Bacteria 2590
99 Ga0070688_100207204 3300005365 Bacteria 1375
100 Ga0070688_100368481 3300005365 Bacteria 1056
101 Ga0070659_100005453 3300005366 Bacteria 9138
102 Ga0070659_100094545 3300005366 Bacteria 2400
103 Ga0070659_100323349 3300005366 Bacteria 1290
104 Ga0070667_100001075 3300005367 Bacteria 24994
105 Ga0070667_100021496 3300005367 Bacteria 5356
106 Ga0070667_100267163 3300005367 Bacteria 1533
107 Ga0070709_10002443 3300005434 Bacteria 10067
108 Ga0070709_10029823 3300005434 Bacteria 3267
109 Ga0070709_10205339 3300005434 Bacteria 1398
110 Ga0070709_10221187 3300005434 Bacteria 1350
111 Ga0070714_100015432 3300005435 Bacteria 6147
112 Ga0070714_100015694 3300005435 Bacteria 6098
113 Ga0070714_100035280 3300005435 Bacteria 4191
114 Ga0070714_100043358 3300005435 Bacteria 3804
115 Ga0070714_100138726 3300005435 Bacteria 2180
116 Ga0070714_100311042 3300005435 Bacteria 1471
117 Ga0070714_100543000 3300005435 Bacteria 1112
118 Ga0070713_100000654 3300005436 Bacteria 22167
119 Ga0070713_100001555 3300005436 Bacteria 14678
120 Ga0070713_100014148 3300005436 Bacteria 5912
121 Ga0070713_100060404 3300005436 Bacteria 3168
122 Ga0070713_100066169 3300005436 Bacteria 3038
123 Ga0070710_10000619 3300005437 Bacteria 16925
124 Ga0070710_10003937 3300005437 Bacteria 7037
125 Ga0070710_10025993 3300005437 Bacteria 3106
126 Ga0070710_10044111 3300005437 Bacteria 2473
127 Ga0070701_10000025 3300005438 Bacteria 38966
128 Ga0070711_100010734 3300005439 Bacteria 5677
129 Ga0070711_100024053 3300005439 Bacteria 3969
130 Ga0070711_100041441 3300005439 Bacteria 3110
131 Ga0070711_100058358 3300005439 Bacteria 2676
132 Ga0070711_100073806 3300005439 Bacteria 2412
133 Ga0070711_100090065 3300005439 Bacteria 2208
134 Ga0070711_100138772 3300005439 Bacteria 1820
135 Ga0070705_100037650 3300005440 Bacteria 2730
136 Ga0070705_100130307 3300005440 Bacteria 1639
137 Ga0070700_100002215 3300005441 Bacteria 9887
138 Ga0070694_100006957 3300005444 Bacteria 6869
139 Ga0070708_100023192 3300005445 Bacteria 5274
140 Ga0070663_100000064 3300005455 Bacteria 45232
141 Ga0070663_100014208 3300005455 Bacteria 5105
142 Ga0070663_100060234 3300005455 Bacteria 2730
143 Ga0070678_100001526 3300005456 Bacteria 12364
144 Ga0070678_100043310 3300005456 Bacteria 3205
145 Ga0070678_100043991 3300005456 Bacteria 3185
146 Ga0070662_100023064 3300005457 Bacteria 4271
147 Ga0070662_100025880 3300005457 Bacteria 4057
148 Ga0070662_100051625 3300005457 Bacteria 2970
149 Ga0070662_100141585 3300005457 Bacteria 1864
150 Ga0070662_100271400 3300005457 Bacteria 1370
151 Ga0070662_100448009 3300005457 Bacteria 1071
152 Ga0070681_10000435 3300005458 Bacteria 33975
153 Ga0070681_10032023 3300005458 Bacteria 5278
154 Ga0070681_10051421 3300005458 Bacteria 4110
155 Ga0070681_10063320 3300005458 Bacteria 3670
156 Ga0070681_10074981 3300005458 Bacteria 3343
157 Ga0070681_10125790 3300005458 Bacteria 2496
158 Ga0068867_100002108 3300005459 Bacteria 13947
159 Ga0068867_100025717 3300005459 Bacteria 4225
160 Ga0070685_10003445 3300005466 Bacteria 8045
161 Ga0070685_10012156 3300005466 Bacteria 4516
162 Ga0074259_10047191 3300005507 Bacteria 1695
163 Ga0070699_100361940 3300005518 Bacteria 1308
164 Ga0070679_100002876 3300005530 Bacteria 15657
165 Ga0070679_100117245 3300005530 Bacteria 2647
166 Ga0070684_100001610 3300005535 Bacteria 16308
167 Ga0070684_100142642 3300005535 Bacteria 2167
168 Ga0070684_100178374 3300005535 Bacteria 1931
169 Ga0070684_100207569 3300005535 Bacteria 1785
170 Ga0070684_100359223 3300005535 Bacteria 1340
171 Ga0068853_100005553 3300005539 Bacteria 9895
172 Ga0068853_100323476 3300005539 Bacteria 1430
173 Ga0070672_100000011 3300005543 Bacteria 80761
174 Ga0070672_100129130 3300005543 Bacteria 2076
175 Ga0070672_100263855 3300005543 Bacteria 1453
176 Ga0070672_100304859 3300005543 Bacteria 1351
177 Ga0070686_100000076 3300005544 Bacteria 71207
178 Ga0070686_100002194 3300005544 Bacteria 10784
179 Ga0070686_100067747 3300005544 Bacteria 2327
180 Ga0070686_100115683 3300005544 Bacteria 1834
181 Ga0070695_100003381 3300005545 Bacteria 9327
182 Ga0070695_100018163 3300005545 Bacteria 4269
183 Ga0070695_100025754 3300005545 Bacteria 3634
184 Ga0070695_100237271 3300005545 Bacteria 1321
185 Ga0070696_100038461 3300005546 Bacteria 3302
186 Ga0070693_100000122 3300005547 Bacteria 34819
187 Ga0070693_100074358 3300005547 Bacteria 2010
188 Ga0070665_100034452 3300005548 Bacteria 5092
189 Ga0070704_100002018 3300005549 Bacteria 11242
190 Ga0070704_100008020 3300005549 Bacteria 6307
191 Ga0070704_100017468 3300005549 Bacteria 4562
192 Ga0070704_100051139 3300005549 Bacteria 2908
193 Ga0070704_100105130 3300005549 Bacteria 2137
194 Ga0068855_100035734 3300005563 Bacteria 5918
195 Ga0068855_100246086 3300005563 Bacteria 1996
196 Ga0070664_100000112 3300005564 Bacteria 53506
197 Ga0070664_100227925 3300005564 Bacteria 1669
198 Ga0070664_100320227 3300005564 Unclassified 1405
199 Ga0070664_100483617 3300005564 Bacteria 1139
200 Ga0068857_100000023 3300005577 Bacteria 86999
201 Ga0068854_100004158 3300005578 Bacteria 9099
202 Ga0068856_100000099 3300005614 Bacteria 83061
203 Ga0068856_100127057 3300005614 Unclassified 2553
204 Ga0068856_100169702 3300005614 Unclassified 2194
205 Ga0068856_100907814 3300005614 Unclassified 900
206 Ga0070702_100000005 3300005615 Bacteria 70200
207 Ga0070702_100021306 3300005615 Plasmid 3408
208 Ga0068852_100004502 3300005616 Bacteria 9856
209 Ga0068852_100085751 3300005616 Bacteria 2806
210 Ga0068852_100262158 3300005616 Bacteria 1660
211 Ga0068852_100283878 3300005616 Bacteria 1597
212 Ga0068859_100000503 3300005617 Bacteria 38475
213 Ga0068859_100039458 3300005617 Plasmid 4736
214 Ga0068859_100040577 3300005617 Bacteria 4671
215 Ga0068859_100611665 3300005617 Bacteria 1182
216 Ga0068864_100000112 3300005618 Bacteria 79688
217 Ga0068864_100018108 3300005618 Bacteria 5878
218 Ga0068864_100308582 3300005618 Bacteria 1483
219 Ga0068864_100574723 3300005618 Unclassified 1091
220 Ga0068866_10000977 3300005718 Bacteria 12586
221 Ga0068866_10008375 3300005718 Bacteria 4356
222 Ga0068866_10106410 3300005718 Bacteria 1557
223 Ga0068861_100002096 3300005719 Bacteria 12937
224 Ga0068861_100118714 3300005719 Bacteria 2131
225 Ga0068851_10097376 3300005834 Bacteria 1557
226 Ga0068870_10000021 3300005840 Bacteria 56319
227 Ga0068870_10087663 3300005840 Bacteria 1733
228 Ga0068863_100000227 3300005841 Bacteria 59675
229 Ga0068863_100076196 3300005841 Unclassified 3173
230 Ga0068858_100120781 3300005842 Unclassified 2450
231 Ga0068858_100353397 3300005842 Bacteria 1408
232 Ga0068858_100495126 3300005842 Bacteria 1180
233 Ga0068860_100000511 3300005843 Bacteria 47927
234 Ga0068860_100201784 3300005843 Bacteria 1927
235 Ga0068860_100345907 3300005843 Bacteria 1463
236 Ga0068860_100577693 3300005843 Bacteria 1128
237 Ga0068862_100001866 3300005844 Bacteria 19089
238 Ga0068862_100340316 3300005844 Bacteria 1389
239 Ga0068862_100437335 3300005844 Bacteria 1230
240 Ga0081455_10000153 3300005937 Bacteria 83186
241 Ga0081455_10002775 3300005937 Bacteria 20627
242 Ga0081455_10192128 3300005937 Bacteria 1536
243 Ga0081538_10047178 3300005981 Bacteria 2645
244 Ga0081540_1000008 3300005983 Bacteria 203702
245 Ga0081540_1001662 3300005983 Bacteria 18923
246 Ga0081540_1012674 3300005983 Bacteria 5531
247 Ga0081540_1052135 3300005983 Bacteria 2017
248 Ga0081539_10000423 3300005985 Bacteria 89970
249 Ga0070717_10349038 3300006028 Bacteria 1323
250 Ga0075365_10004253 3300006038 Bacteria 7549
251 Ga0075365_10054906 3300006038 Bacteria 2643
252 Ga0075365_10230580 3300006038 Bacteria 1300
253 Ga0075365_10234229 3300006038 Bacteria 1289
254 Ga0075365_10247944 3300006038 Bacteria 1251
255 Ga0075363_100010796 3300006048 Bacteria 4354
256 Ga0075363_100115199 3300006048 Bacteria 1496
257 Ga0075432_10004763 3300006058 Bacteria 4618
258 Ga0070715_10012842 3300006163 Unclassified 3060
259 Ga0070715_10071977 3300006163 Bacteria 1547
260 Ga0070716_100015557 3300006173 Bacteria 3912
261 Ga0070716_100054784 3300006173 Unclassified 2279
262 Ga0070712_100054314 3300006175 Unclassified 2800
263 Ga0070712_100205026 3300006175 Bacteria 1552
264 Ga0075367_10003172 3300006178 Bacteria 7754
265 Ga0075367_10003813 3300006178 Bacteria 7267
266 Ga0075367_10045316 3300006178 Bacteria 2581
267 Ga0075367_10052558 3300006178 Bacteria 2412
268 Ga0075366_10185370 3300006195 Bacteria 1264
269 Ga0097621_100000013 3300006237 Bacteria 103062
270 Ga0097621_100001495 3300006237 Bacteria 16032
271 Ga0097621_100038999 3300006237 Bacteria 3814
272 Ga0075370_10036683 3300006353 Bacteria 2754
273 Ga0075370_10038169 3300006353 Bacteria 2703
274 Ga0068871_100000064 3300006358 Bacteria 58283
275 Ga0068871_100023154 3300006358 Bacteria 4799
276 Ga0068871_100035623 3300006358 Bacteria 3956
277 Ga0075428_100067278 3300006844 Bacteria 3922
278 Ga0075428_100435492 3300006844 Bacteria 1405
279 Ga0075430_100000646 3300006846 Bacteria 26596
280 Ga0075430_100040915 3300006846 Bacteria 3922
281 Ga0075430_100300780 3300006846 Bacteria 1327
282 Ga0075431_100096301 3300006847 Bacteria 3055
283 Ga0075431_100189975 3300006847 Bacteria 2105
284 Ga0075433_10003920 3300006852 Bacteria 11526
285 Ga0075433_10209676 3300006852 Bacteria 1732
286 Ga0075433_10245366 3300006852 Unclassified 1590
287 Ga0075434_100000109 3300006871 Bacteria 46918
288 Ga0075434_100043968 3300006871 Bacteria 4431
289 Ga0075434_100068843 3300006871 Bacteria 3527
290 Ga0075434_100095466 3300006871 Bacteria 2979
291 Ga0075429_100041545 3300006880 Bacteria 4005
292 Ga0068865_100000088 3300006881 Bacteria 48315
293 Ga0068865_100010435 3300006881 Bacteria 5782
294 Ga0068865_100097144 3300006881 Bacteria 2149
295 Ga0068865_100337805 3300006881 Bacteria 1216
296 Ga0075436_100021761 3300006914 Bacteria 4401
297 Ga0075436_100162541 3300006914 Bacteria 1574
298 Ga0075436_100206844 3300006914 Bacteria 1391
299 Ga0097620_100000503 3300006931 Bacteria 38475
300 Ga0097620_100039461 3300006931 Plasmid 4736
301 Ga0097620_100040574 3300006931 Bacteria 4671
302 Ga0097620_100611664 3300006931 Bacteria 1182
303 Ga0075435_100072374 3300007076 Bacteria 2816
304 Ga0075435_100093336 3300007076 Bacteria 2487
305 Ga0075435_100119913 3300007076 Bacteria 2194
306 Ga0105251_10010716 3300009011 Bacteria 5288
307 Ga0105240_10017252 3300009093 Bacteria 9739
308 Ga0105240_10296212 3300009093 Bacteria 1852
309 Ga0111539_10000196 3300009094 Bacteria 70998
310 Ga0111539_10000376 3300009094 Bacteria 55320
311 Ga0111539_10001836 3300009094 Bacteria 28237
312 Ga0111539_10168910 3300009094 Bacteria 2556
313 Ga0111539_10413268 3300009094 Bacteria 1571
314 Ga0105245_10001381 3300009098 Bacteria 21973
315 Ga0105245_10150658 3300009098 Bacteria 2199
316 Ga0105245_10182194 3300009098 Unclassified 2007
317 Ga0105247_10010673 3300009101 Bacteria 5546
318 Ga0105247_10057028 3300009101 Bacteria 2414
319 Ga0114129_10029360 3300009147 Bacteria 7790
320 Ga0114129_10157162 3300009147 Bacteria 3108
321 Ga0114129_10179567 3300009147 Bacteria 2882
322 Ga0105243_10002817 3300009148 Bacteria 14441
323 Ga0105243_10200057 3300009148 Bacteria 1751
324 Ga0105241_10007352 3300009174 Bacteria 8100
325 Ga0105241_10007728 3300009174 Bacteria 7903
326 Ga0105241_10049693 3300009174 Bacteria 3195
327 Ga0105242_10009592 3300009176 Bacteria 7420
328 Ga0105242_10046720 3300009176 Unclassified 3513
329 Ga0105248_10001979 3300009177 Bacteria 22762
330 Ga0105248_10048562 3300009177 Bacteria 4761
331 Ga0105248_10170960 3300009177 Bacteria 2449
332 Ga0105248_10261581 3300009177 Unclassified 1948
333 Ga0105248_10303982 3300009177 Bacteria 1796
334 Ga0105237_10014351 3300009545 Bacteria 8289
335 Ga0105237_10281731 3300009545 Bacteria 1665
336 Ga0105237_10366520 3300009545 Bacteria 1445
337 Ga0105237_10394327 3300009545 Bacteria 1389
338 Ga0105237_10559544 3300009545 Bacteria 1150
339 Ga0105238_10018663 3300009551 Bacteria 7063
340 Ga0105238_10078408 3300009551 Bacteria 3293
341 Ga0105238_10082426 3300009551 Bacteria 3206
342 Ga0105238_10731992 3300009551 Unclassified 1002
343 Ga0105249_10002341 3300009553 Bacteria 16462
344 Ga0105249_10002423 3300009553 Bacteria 16185
345 Ga0105249_10168013 3300009553 Bacteria 2125
346 Ga0105239_10009150 3300010375 Bacteria 11204
347 Ga0105239_10097931 3300010375 Bacteria 3242
348 Ga0105239_10173160 3300010375 Bacteria 2414
349 Ga0105246_10000016 3300011119 Bacteria 65781
350 Ga0105246_10029004 3300011119 Bacteria 3639
351 Ga0105246_10059942 3300011119 Unclassified 2643
352 Ga0105246_10060818 3300011119 Bacteria 2626
353 Ga0105246_10243873 3300011119 Bacteria 1422
354 Ga0157326_1007973 3300012513 Bacteria 1149
355 Ga0157371_10073102 3300013102 Unclassified 2428
356 Ga0157371_10098120 3300013102 Bacteria 2077
357 Ga0157371_10183656 3300013102 Bacteria 1496
358 Ga0157370_10194757 3300013104 Bacteria 1881
359 Ga0157370_10198962 3300013104 Bacteria 1859
360 Ga0157369_10001827 3300013105 Bacteria 25725
361 Ga0157369_10242552 3300013105 Bacteria 1882
362 Ga0171462_1045 3300013250 Bacteria 50984
363 Ga0157374_10000092 3300013296 Bacteria 85738
364 Ga0157374_10064745 3300013296 Bacteria 3432
365 Ga0157374_10163775 3300013296 Bacteria 2167
366 Ga0157378_10023667 3300013297 Bacteria 5402
367 Ga0157378_10094379 3300013297 Unclassified 2724
368 Ga0163162_10010092 3300013306 Bacteria 9182
369 Ga0163162_10014928 3300013306 Bacteria 7586
370 Ga0163162_10652125 3300013306 Bacteria 1176
371 Ga0157372_10019004 3300013307 Bacteria 7396
372 Ga0157372_10123167 3300013307 Bacteria 2980
373 Ga0157372_10766573 3300013307 Unclassified 1122
374 Ga0157375_10000124 3300013308 Bacteria 76003
375 Ga0157375_10018849 3300013308 Bacteria 6264
376 Ga0157375_10343210 3300013308 Bacteria 1659
377 Ga0163163_10001343 3300014325 Bacteria 20762
378 Ga0163163_10016562 3300014325 Bacteria 6855
379 Ga0163163_10119365 3300014325 Bacteria 2670
380 Ga0163163_10213341 3300014325 Bacteria 1979
381 Ga0157380_10001027 3300014326 Bacteria 17807
382 Ga0157380_10291143 3300014326 Bacteria 1499
383 Ga0157380_10777937 3300014326 Bacteria 972
384 Ga0157377_10000121 3300014745 Bacteria 51192
385 Ga0157379_10000321 3300014968 Bacteria 38296
386 Ga0157379_10030133 3300014968 Bacteria 4827
387 Ga0157379_10277886 3300014968 Bacteria 1524
388 Ga0157376_10000034 3300014969 Bacteria 161526
389 Ga0157376_10205183 3300014969 Bacteria 1816
390 Ga0163161_10000801 3300017792 Bacteria 24605
391 Ga0163161_10012127 3300017792 Bacteria 5979
392 Ga0163161_10299547 3300017792 Bacteria 1266
393 Ga0213876_10017304 3300021384 Bacteria 3805
394 Ga0224572_1006700 3300024225 Bacteria 2089
395 Ga0207666_1000004 3300025271 Bacteria 56747
396 Ga0209673_1024132 3300025273 Bacteria 2051
397 Ga0209130_1000212 3300025284 Bacteria 76696
398 Ga0207673_1000537 3300025290 Bacteria 4047
399 Ga0209675_1012821 3300025291 Bacteria 2672
400 Ga0209676_1021497 3300025292 Bacteria 2165
401 Ga0209025_1000016 3300025294 Bacteria 770739
402 Ga0209025_1001538 3300025294 Bacteria 29419
403 Ga0209025_1026823 3300025294 Bacteria 2877
404 Ga0209025_1028362 3300025294 Bacteria 2746
405 Ga0209025_1066093 3300025294 Bacteria 1316
406 Ga0209564_1000075 3300025295 Bacteria 285760
407 Ga0209564_1000076 3300025295 Bacteria 283602
408 Ga0209256_1000083 3300025299 Bacteria 221460
409 Ga0209256_1002896 3300025299 Bacteria 13002
410 Ga0207426_1006805 3300025302 Bacteria 4890
411 Ga0207697_10001888 3300025315 Bacteria 11200
412 Ga0207697_10016615 3300025315 Bacteria 3031
413 Ga0207656_10052113 3300025321 Bacteria 1771
414 Ga0207653_10016325 3300025885 Bacteria 2332
415 Ga0207682_10000016 3300025893 Bacteria 78971
416 Ga0207682_10001712 3300025893 Bacteria 10043
417 Ga0207692_10025783 3300025898 Unclassified 2751
418 Ga0207692_10036390 3300025898 Bacteria 2400
419 Ga0207692_10105306 3300025898 Bacteria 1556
420 Ga0207692_10127427 3300025898 Bacteria 1433
421 Ga0207642_10000454 3300025899 Bacteria 12480
422 Ga0207710_10000475 3300025900 Bacteria 25581
423 Ga0207710_10006786 3300025900 Bacteria 4876
424 Ga0207688_10000038 3300025901 Bacteria 45000
425 Ga0207680_10026076 3300025903 Bacteria 3234
426 Ga0207680_10098159 3300025903 Bacteria 1877
427 Ga0207680_10426422 3300025903 Bacteria 940
428 Ga0207647_10012357 3300025904 Bacteria 5944
429 Ga0207647_10128683 3300025904 Unclassified 1489
430 Ga0207685_10006686 3300025905 Plasmid 3161
431 Ga0207699_10001265 3300025906 Bacteria 12020
432 Ga0207699_10016301 3300025906 Bacteria 3884
433 Ga0207699_10041260 3300025906 Unclassified 2664
434 Ga0207699_10129922 3300025906 Bacteria 1642
435 Ga0207645_10000138 3300025907 Bacteria 55917
436 Ga0207645_10015193 3300025907 Bacteria 5126
437 Ga0207645_10063855 3300025907 Bacteria 2353
438 Ga0207643_10000075 3300025908 Bacteria 64981
439 Ga0207654_10000985 3300025911 Bacteria 15621
440 Ga0207707_10000809 3300025912 Bacteria 30640
441 Ga0207707_10047322 3300025912 Bacteria 3745
442 Ga0207707_10073592 3300025912 Bacteria 2979
443 Ga0207707_10211104 3300025912 Bacteria 1691
444 Ga0207707_10241502 3300025912 Bacteria 1570
445 Ga0207695_10069458 3300025913 Bacteria 3604
446 Ga0207695_10509378 3300025913 Bacteria 1085
447 Ga0207671_10004109 3300025914 Bacteria 14077
448 Ga0207671_10254704 3300025914 Bacteria 1380
449 Ga0207693_10000975 3300025915 Bacteria 25758
450 Ga0207693_10003947 3300025915 Bacteria 12607
451 Ga0207693_10005875 3300025915 Bacteria 10184
452 Ga0207693_10006027 3300025915 Bacteria 10049
453 Ga0207693_10012124 3300025915 Bacteria 6967
454 Ga0207693_10026173 3300025915 Bacteria 4619
455 Ga0207693_10036273 3300025915 Bacteria 3886
456 Ga0207663_10035307 3300025916 Bacteria 2998
457 Ga0207663_10132999 3300025916 Bacteria 1722
458 Ga0207663_10151500 3300025916 Bacteria 1627
459 Ga0207663_10159114 3300025916 Bacteria 1592
460 Ga0207663_10177367 3300025916 Bacteria 1519
461 Ga0207663_10199742 3300025916 Unclassified 1442
462 Ga0207660_10000023 3300025917 Bacteria 71712
463 Ga0207660_10040536 3300025917 Bacteria 3261
464 Ga0207660_10132052 3300025917 Bacteria 1902
465 Ga0207660_10300450 3300025917 Bacteria 1278
466 Ga0207662_10001542 3300025918 Bacteria 11239
467 Ga0207657_10007478 3300025919 Bacteria 11195
468 Ga0207657_10088330 3300025919 Bacteria 2591
469 Ga0207657_10104542 3300025919 Bacteria 2345
470 Ga0207657_10309910 3300025919 Bacteria 1250
471 Ga0207649_10000122 3300025920 Bacteria 65841
472 Ga0207649_10388455 3300025920 Bacteria 1042
473 Ga0207652_10001146 3300025921 Bacteria 23846
474 Ga0207652_10145121 3300025921 Bacteria 2123
475 Ga0207652_10396905 3300025921 Archaea 1245
476 Ga0207652_10412109 3300025921 Bacteria 1219
477 Ga0207681_10000240 3300025923 Bacteria 42226
478 Ga0207681_10043511 3300025923 Bacteria 3006
479 Ga0207681_10216487 3300025923 Bacteria 1479
480 Ga0207681_10224220 3300025923 Bacteria 1456
481 Ga0207681_10301757 3300025923 Unclassified 1267
482 Ga0207694_10020818 3300025924 Bacteria 4965
483 Ga0207694_10078340 3300025924 Bacteria 2590
484 Ga0207650_10005524 3300025925 Bacteria 8625
485 Ga0207650_10124270 3300025925 Bacteria 2012
486 Ga0207650_10161700 3300025925 Bacteria 1774
487 Ga0207650_10450762 3300025925 Bacteria 1071
488 Ga0207659_10000017 3300025926 Bacteria 159908
489 Ga0207659_10047489 3300025926 Plasmid 3037
490 Ga0207659_10071667 3300025926 Bacteria 2531
491 Ga0207687_10000077 3300025927 Bacteria 71218
492 Ga0207687_10017126 3300025927 Plasmid 4764
493 Ga0207687_10100894 3300025927 Bacteria 2124
494 Ga0207687_10354477 3300025927 Bacteria 1196
495 Ga0207700_10004665 3300025928 Bacteria 8119
496 Ga0207700_10024792 3300025928 Bacteria 4156
497 Ga0207700_10106898 3300025928 Bacteria 2244
498 Ga0207700_10174358 3300025928 Bacteria 1796
499 Ga0207664_10095566 3300025929 Unclassified 2445
500 Ga0207664_10184284 3300025929 Bacteria 1794
501 Ga0207644_10001298 3300025931 Bacteria 16078
502 Ga0207644_10004246 3300025931 Bacteria 9300
503 Ga0207644_10009440 3300025931 Bacteria 6406
504 Ga0207644_10102780 3300025931 Bacteria 2150
505 Ga0207644_10113593 3300025931 Bacteria 2051
506 Ga0207644_10200522 3300025931 Bacteria 1574
507 Ga0207690_10003164 3300025932 Bacteria 9891
508 Ga0207690_10237055 3300025932 Bacteria 1403
509 Ga0207706_10004420 3300025933 Bacteria 13211
510 Ga0207706_10021501 3300025933 Bacteria 5794
511 Ga0207706_10047907 3300025933 Bacteria 3780
512 Ga0207706_10165096 3300025933 Bacteria 1946
513 Ga0207706_10202177 3300025933 Bacteria 1742
514 Ga0207686_10000294 3300025934 Bacteria 36711
515 Ga0207686_10021024 3300025934 Bacteria 3738
516 Ga0207686_10100217 3300025934 Bacteria 1932
517 Ga0207709_10000126 3300025935 Bacteria 114049
518 Ga0207670_10000086 3300025936 Bacteria 63570
519 Ga0207670_10010357 3300025936 Bacteria 5365
520 Ga0207670_10022750 3300025936 Bacteria 3890
521 Ga0207670_10073621 3300025936 Bacteria 2369
522 Ga0207670_10102713 3300025936 Unclassified 2044
523 Ga0207669_10000188 3300025937 Bacteria 28047
524 Ga0207669_10022673 3300025937 Unclassified 3340
525 Ga0207669_10090912 3300025937 Bacteria 1986
526 Ga0207669_10255555 3300025937 Bacteria 1307
527 Ga0207669_10349661 3300025937 Unclassified 1141
528 Ga0207704_10002897 3300025938 Bacteria 7760
529 Ga0207704_10024840 3300025938 Bacteria 3259
530 Ga0207665_10001963 3300025939 Bacteria 13843
531 Ga0207665_10093222 3300025939 Bacteria 2091
532 Ga0207665_10098860 3300025939 Bacteria 2034
533 Ga0207665_10378181 3300025939 Unclassified 1074
534 Ga0207691_10000526 3300025940 Bacteria 38205
535 Ga0207691_10147463 3300025940 Bacteria 2070
536 Ga0207691_10513282 3300025940 Bacteria 1017
537 Ga0207711_10007634 3300025941 Bacteria 9044
538 Ga0207711_10018226 3300025941 Bacteria 5836
539 Ga0207711_10094081 3300025941 Bacteria 2640
540 Ga0207711_10297674 3300025941 Bacteria 1488
541 Ga0207711_10490964 3300025941 Bacteria 1144
542 Ga0207689_10000140 3300025942 Bacteria 62258
543 Ga0207689_10025320 3300025942 Bacteria 4972
544 Ga0207689_10157363 3300025942 Bacteria 1873
545 Ga0207661_10000074 3300025944 Bacteria 68047
546 Ga0207661_10157080 3300025944 Bacteria 1971
547 Ga0207679_10000031 3300025945 Bacteria 165962
548 Ga0207679_10287255 3300025945 Bacteria 1413
549 Ga0207667_10033121 3300025949 Bacteria 5559
550 Ga0207667_10035215 3300025949 Bacteria 5371
551 Ga0207651_10001805 3300025960 Bacteria 9959
552 Ga0207651_10054533 3300025960 Bacteria 2740
553 Ga0207712_10000279 3300025961 Bacteria 48635
554 Ga0207712_10004811 3300025961 Bacteria 8532
555 Ga0207668_10613158 3300025972 Bacteria 949
556 Ga0207640_10000105 3300025981 Bacteria 64812
557 Ga0207640_10000216 3300025981 Bacteria 40557
558 Ga0207658_10001907 3300025986 Bacteria 15607
559 Ga0207658_10042886 3300025986 Unclassified 3285
560 Ga0207658_10110243 3300025986 Unclassified 2174
561 Ga0207658_10281385 3300025986 Bacteria 1426
562 Ga0207658_10400945 3300025986 Bacteria 1206
563 Ga0207677_10007306 3300026023 Bacteria 6101
564 Ga0207677_10023683 3300026023 Plasmid 3798
565 Ga0207677_10573746 3300026023 Unclassified 986
566 Ga0207703_10000418 3300026035 Bacteria 45072
567 Ga0207703_10152080 3300026035 Bacteria 2019
568 Ga0207703_10343520 3300026035 Bacteria 1372
569 Ga0207639_10000599 3300026041 Bacteria 24821
570 Ga0207639_10121380 3300026041 Unclassified 2148
571 Ga0207639_10228155 3300026041 Bacteria 1612
572 Ga0207678_10003953 3300026067 Bacteria 13331
573 Ga0207678_10022090 3300026067 Bacteria 5575
574 Ga0207708_10010311 3300026075 Bacteria 6939
575 Ga0207708_10449315 3300026075 Bacteria 1073
576 Ga0207702_10000753 3300026078 Bacteria 34590
577 Ga0207702_10146394 3300026078 Unclassified 2144
578 Ga0207641_10001634 3300026088 Bacteria 21851
579 Ga0207641_10019340 3300026088 Bacteria 5589
580 Ga0207648_10006918 3300026089 Bacteria 11239
581 Ga0207648_10053413 3300026089 Bacteria 3532
582 Ga0207648_10106853 3300026089 Bacteria 2456
583 Ga0207676_10000133 3300026095 Bacteria 65766
584 Ga0207676_10087401 3300026095 Bacteria 2549
585 Ga0207676_10089435 3300026095 Bacteria 2523
586 Ga0207674_10001514 3300026116 Bacteria 29977
587 Ga0207674_10030742 3300026116 Bacteria 5644
588 Ga0207675_100000570 3300026118 Bacteria 36090
589 Ga0207675_100185284 3300026118 Bacteria 1995
590 Ga0207683_10000004 3300026121 Bacteria 188086
591 Ga0207683_10011279 3300026121 Bacteria 7619
592 Ga0207683_10020739 3300026121 Bacteria 5622
593 Ga0207683_10043398 3300026121 Bacteria 3930
594 Ga0207683_10505246 3300026121 Bacteria 1117
595 Ga0207698_10007207 3300026142 Bacteria 6968
596 Ga0207698_10260534 3300026142 Bacteria 1593
597 Ga0207698_10304142 3300026142 Bacteria 1486
598 Ga0210002_1000183 3300027617 Bacteria 9003
599 Ga0209971_1003472 3300027682 Bacteria 3736
600 Ga0209966_1001288 3300027695 Bacteria 4443
601 Ga0209966_1030379 3300027695 Bacteria 1092
602 Ga0209998_10001130 3300027717 Bacteria 6609
603 Ga0209998_10001412 3300027717 Bacteria 5820
604 Ga0209998_10002862 3300027717 Bacteria 3872
605 Ga0209813_10015791 3300027866 Bacteria 2052
606 Ga0209974_10002488 3300027876 Bacteria 6667
607 Ga0209974_10038892 3300027876 Bacteria 1582
608 Ga0207428_10000218 3300027907 Bacteria 79728
609 Ga0207428_10000250 3300027907 Bacteria 73217
610 Ga0207428_10000777 3300027907 Bacteria 36251
611 Ga0265357_1003621 3300028023 Bacteria 1348
612 Ga0268266_10013746 3300028379 Bacteria 6970
613 Ga0268266_10037440 3300028379 Bacteria 4133
614 Ga0268265_10000194 3300028380 Bacteria 70928
615 Ga0268265_10063302 3300028380 Bacteria 2845
616 Ga0268265_10121161 3300028380 Unclassified 2155
617 Ga0268264_10000393 3300028381 Bacteria 63015
618 Ga0268264_10206938 3300028381 Bacteria 1799
619 Ga0268264_10375726 3300028381 Bacteria 1360
620 Ga0265337_1003879 3300028556 Bacteria 6343
621 Ga0265338_10006566 3300028800 Bacteria 14761
622 Ga0265338_10269461 3300028800 Bacteria 1248
623 Ga0265338_10269689 3300028800 Bacteria 1247
624 Ga0265325_10000039 3300031241 Bacteria 93014
625 Ga0265325_10005389 3300031241 Bacteria 7903
626 Ga0265325_10006452 3300031241 Bacteria 7111
627 Ga0265325_10013324 3300031241 Bacteria 4684
628 Ga0265325_10089525 3300031241 Bacteria 1519
629 Ga0265339_10000071 3300031249 Bacteria 88416
630 Ga0265339_10011771 3300031249 Bacteria 5368
631 Ga0265339_10096653 3300031249 Bacteria 1541
632 Ga0265316_10060342 3300031344 Bacteria 2948
633 Ga0265316_10106018 3300031344 Bacteria 2132
634 Ga0265316_10119851 3300031344 Bacteria 1988
635 Ga0265313_10000057 3300031595 Bacteria 108544
636 Ga0265313_10000415 3300031595 Bacteria 45805
637 Ga0265313_10001341 3300031595 Bacteria 23197
638 Ga0265313_10001740 3300031595 Bacteria 20008
639 Ga0265313_10039367 3300031595 Bacteria 2345
640 Ga0265314_10003150 3300031711 Bacteria 16185
641 Ga0265314_10024673 3300031711 Bacteria 4553
642 Ga0265342_10010642 3300031712 Bacteria 6361
643 Ga0307405_10008563 3300031731 Bacteria 5196
644 Ga0307409_100381988 3300031995 Bacteria 1339
645 Ga0307416_100216204 3300032002 Bacteria 1833
646 Ga0307416_100276325 3300032002 Bacteria 1653
647 Ga0316583_10000158 3300032133 Bacteria 16588
648 Ga0373930_0001167 3300034816 Bacteria 3842
649 Ga0373930_0015641 3300034816 Bacteria 1426
650 Ga0373948_0000190 3300034817 Bacteria 7039
651 Ga0373948_0007388 3300034817 Bacteria 1847
652 Ga0373950_0000342 3300034818 Bacteria 5805
653 Ga0373950_0003250 3300034818 Bacteria 2307
654 Ga0373958_0000055 3300034819 Bacteria 11096
655 Ga0373958_0002208 3300034819 Bacteria 2705
656 Ga0373959_0005211 3300034820 Bacteria 2128
657 Ga0373938_0003013 3300034957 Bacteria 2732
658 Ga0373938_0004580 3300034957 Bacteria 2318
659 Ga0373938_0027998 3300034957 Bacteria 1189
660 Ga0373926_0049144 3300035083 Bacteria 1518
661 Ga0373926_0099066 3300035083 Bacteria 1089
662 Ga0373928_0000361 3300035084 Bacteria 9079
663 Ga0373928_0003934 3300035084 Bacteria 2834
664 Ga0373928_0037247 3300035084 Unclassified 1103
665 Ga0373929_0000927 3300035085 Bacteria 5708
666 Ga0373929_0005221 3300035085 Bacteria 2335
667 Ga0373940_0000594 3300035088 Bacteria 5745
668 Ga0373940_0019435 3300035088 Unclassified 1716
669 Ga0373940_0027313 3300035088 Unclassified 1499
670 Ga0373944_0026503 3300035089 Bacteria 1712
671 Ga0373949_0000308 3300035090 Bacteria 17544
672 Ga0373949_0001125 3300035090 Bacteria 8093
673 Ga0373949_0003075 3300035090 Bacteria 4081
674 Ga0373951_0000393 3300035091 Bacteria 12972
675 Ga0373951_0005644 3300035091 Bacteria 2897
676 Ga0373952_0000208 3300035092 Bacteria 9305
677 Ga0373952_0003614 3300035092 Bacteria 2789
678 Ga0373923_0040203 3300035111 Unclassified 1923
679 Ga0373923_0054218 3300035111 Bacteria 1687
680 Ga0373923_0067162 3300035111 Bacteria 1533
681 Ga0373932_0000031 3300035112 Bacteria 38730
682 Ga0373932_0001291 3300035112 Bacteria 7088
683 Ga0373932_0002778 3300035112 Bacteria 4345
684 Ga0373936_0041267 3300035113 Bacteria 1851
685 Ga0373939_0000083 3300035114 Bacteria 30438
686 Ga0373939_0002536 3300035114 Bacteria 4293
687 Ga0373939_0006676 3300035114 Bacteria 2786
688 Ga0373941_0000540 3300035115 Bacteria 7532
689 Ga0373941_0003276 3300035115 Bacteria 3654
690 Ga0373941_0006891 3300035115 Bacteria 2759
691 Ga0373953_0038456 3300035117 Bacteria 1892
692 Ga0373953_0087433 3300035117 Unclassified 1301
693 Ga0373954_0002212 3300035118 Bacteria 8084
694 Ga0373954_0014077 3300035118 Bacteria 3566
695 Ga0373954_0017610 3300035118 Bacteria 3210
696 Ga0373954_0063059 3300035118 Bacteria 1751
697 Ga0373956_0036600 3300035119 Bacteria 2166
698 Ga0373957_0004504 3300035120 Bacteria 4241
699 Ga0373957_0004989 3300035120 Bacteria 4090
700 Ga0373957_0010202 3300035120 Bacteria 3098
701 Ga0373957_0051454 3300035120 Unclassified 1576
702 Ga0373960_0000088 3300035121 Bacteria 13897
703 Ga0373960_0016046 3300035121 Bacteria 1921
704 Ga0373960_0020821 3300035121 Bacteria 1738
705 Ga0373943_0036171 3300035170 Bacteria 2364
706 Ga0373943_0169942 3300035170 Bacteria 1192
707 Ga0373946_0015402 3300035171 Bacteria 2899
708 Ga0373946_0017067 3300035171 Bacteria 2773
709 Ga0373946_0018220 3300035171 Bacteria 2694
710 Ga0373946_0181357 3300035171 Unclassified 999
711 Ga0373955_0005908 3300035172 Bacteria 5537
712 Ga0373955_0006095 3300035172 Bacteria 5476
713 Ga0373955_0229157 3300035172 Bacteria 1111
714 Ga0373942_0001977 3300035207 Bacteria 5119
715 Ga0373942_0005072 3300035207 Bacteria 3054
716 Ga0373942_0015853 3300035207 Bacteria 1842
717 Ga0373961_0000539 3300035241 Bacteria 14412
718 Ga0373961_0021041 3300035241 Bacteria 1731
719 Ga0373962_0000715 3300035242 Bacteria 7504
720 Ga0373962_0001826 3300035242 Bacteria 5069
721 Ga0373924_0037005 3300035410 Bacteria 1985
722 Ga0373924_0053076 3300035410 Bacteria 1683
723 Ga0373924_0060690 3300035410 Bacteria 1581
724 Ga0373931_0000034 3300035691 Bacteria 86665
725 Ga0373931_0001752 3300035691 Bacteria 9420
726 Ga0373931_0002007 3300035691 Bacteria 8956
727 Ga0373931_0029793 3300035691 Unclassified 2805
728 Ga0373935_0036652 3300035692 Bacteria 3067
729 Ga0373935_0060269 3300035692 Bacteria 2427
730 Ga0373927_0027484 3300035695 Bacteria 3714
731 Ga0373927_0062736 3300035695 Bacteria 2403
732 Ga0373927_0090003 3300035695 Bacteria 1993
733 Ga0373927_0102664 3300035695 Bacteria 1860
734 Ga0373933_0002026 3300035724 Bacteria 11656
735 Ga0373933_0005149 3300035724 Bacteria 7132
736 Ga0373933_0014886 3300035724 Bacteria 4330
737 Ga0373933_0077918 3300035724 Bacteria 2027
738 Ga0373933_0123954 3300035724 Bacteria 1620
739 Ga0373947_0022290 3300035725 Bacteria 3671
740 Ga0373947_0022926 3300035725 Plasmid 3626
741 Ga0373947_0247239 3300035725 Bacteria 1178
742 Ga0373937_0022992 3300036401 Bacteria 5606
743 Ga0373937_0048237 3300036401 Bacteria 3898
744 Ga0373937_0218789 3300036401 Bacteria 1792
745 Ga0373937_0283598 3300036401 Bacteria 1564
746 Ga0373937_0680185 3300036401 Bacteria 975
747 Ga0373925_0008801 3300037068 Bacteria 7350
748 Ga0373925_0038910 3300037068 Bacteria 3518
749 Ga0373925_0085861 3300037068 Bacteria 2399
750 Ga0373925_0183584 3300037068 Bacteria 1657
751 Ga0373925_0318438 3300037068 Bacteria 1258
752 Ga0395899_0021560 3300037312 Bacteria 4886
753 Ga0395899_0023051 3300037312 Bacteria 4718
754 Ga0395900_0075230 3300037418 Bacteria 3471
755 Ga0395900_0080585 3300037418 Bacteria 3345
756 Ga0395898_0004062 3300037466 Bacteria 16073
757 Ga0395898_0198304 3300037466 Bacteria 1917
758 Ga0395898_0274050 3300037466 Bacteria 1609
759 Ga0395901_0005167 3300038443 Bacteria 13174
760 Ga0395901_0412868 3300038443 Bacteria 1385
761 Ga0436365_0014752 3300039437 Bacteria 19903
762 Ga0436365_0360126 3300039437 Bacteria 4261
763 Ga0436365_1470399 3300039437 Bacteria 2288
764 Ga0436365_1671729 3300039437 Bacteria 6475
765 Ga0436360_0147686 3300039438 Bacteria 984
766 Ga0436361_0129874 3300039447 Bacteria 1093
767 Ga0436363_1165521 3300039450 Unclassified 1313
768 Ga0436362_0145276 3300039453 Bacteria 1240
769 Ga0436362_0884639 3300039453 Bacteria 3007
770 Ga0439441_010949 3300042001 Bacteria 1532
771 Ga0439460_0028728 3300042461 Bacteria 1571
772 Ga0466963_0276756 3300044694 Bacteria 1179
773 Ga0466959_0150081 3300045049 Bacteria 1643
774 Ga0451576_0012930 3300045051 Bacteria 9352
775 Ga0466958_0162141 3300045836 Bacteria 1413
776 Ga0466967_0461870 3300045976 Bacteria 1242
777 Ga0495617_009118 3300046452 Bacteria 3413
778 Ga0495592_0003774 3300046454 Bacteria 10932
779 Ga0495592_0009503 3300046454 Bacteria 7314
780 Ga0495592_0175787 3300046454 Bacteria 1462
781 Ga0495592_0261722 3300046454 Unclassified 1139
782 Ga0495603_0164686 3300046455 Bacteria 1285
783 Ga0495629_0000690 3300046459 Bacteria 27325
784 Ga0495629_0004882 3300046459 Bacteria 10064
785 Ga0495629_0041679 3300046459 Bacteria 3229
786 Ga0495641_0059768 3300046461 Bacteria 1722
787 Ga0495651_0014052 3300046462 Bacteria 6193
788 Ga0495651_0018759 3300046462 Bacteria 5359
789 Ga0495651_0073846 3300046462 Unclassified 2588
790 Ga0495651_0189868 3300046462 Bacteria 1447
791 Ga0495653_0004104 3300046463 Bacteria 11776
792 Ga0495653_0011137 3300046463 Bacteria 7355
793 Ga0495653_0108867 3300046463 Unclassified 1995
794 Ga0495653_0122163 3300046463 Bacteria 1854
795 Ga0495580_0016533 3300046472 Bacteria 5533
796 Ga0495582_0027132 3300046473 Unclassified 3138
797 Ga0495582_0046935 3300046473 Bacteria 2378
798 Ga0495605_0022132 3300046474 Bacteria 3361
799 Ga0495639_0029813 3300046475 Bacteria 2422
800 Ga0495639_0041470 3300046475 Bacteria 2073
801 Ga0495664_0000935 3300046477 Bacteria 15082
802 Ga0495664_0032161 3300046477 Bacteria 3077
803 Ga0495584_0028985 3300046491 Bacteria 2806
804 Ga0495585_0001893 3300046492 Bacteria 15772
805 Ga0495594_0081117 3300046499 Bacteria 1811
806 Ga0495607_0019327 3300046501 Unclassified 4329
807 Ga0495608_0014494 3300046511 Bacteria 5467
808 Ga0495608_0015397 3300046511 Bacteria 5304
809 Ga0495608_0017107 3300046511 Bacteria 5019
810 Ga0495608_0104192 3300046511 Bacteria 1827
811 Ga0495610_0022484 3300046512 Bacteria 3449
812 Ga0495618_0003011 3300046514 Bacteria 10648
813 Ga0495618_0005170 3300046514 Bacteria 7973
814 Ga0495628_0005583 3300046516 Bacteria 11013
815 Ga0495628_0117214 3300046516 Bacteria 2045
816 Ga0495628_0122395 3300046516 Unclassified 1995
817 Ga0495630_0008623 3300046517 Bacteria 7317
818 Ga0495630_0135201 3300046517 Bacteria 1873
819 Ga0495643_0098844 3300046522 Bacteria 1498
820 Ga0495643_0129308 3300046522 Bacteria 1269
821 Ga0495644_0000609 3300046523 Bacteria 15027
822 Ga0495652_0020631 3300046529 Bacteria 5857
823 Ga0495652_0049073 3300046529 Unclassified 3615
824 Ga0495652_0201207 3300046529 Bacteria 1511
825 Ga0495665_0089355 3300046531 Bacteria 1618
826 Ga0495640_0019188 3300046533 Bacteria 5051
827 Ga0495640_0254059 3300046533 Unclassified 1100
828 Ga0495640_0300195 3300046533 Bacteria 997
829 Ga0495586_0031215 3300046535 Bacteria 2852
830 Ga0495587_0001842 3300046536 Bacteria 14138
831 Ga0495587_0014249 3300046536 Bacteria 4990
832 Ga0495587_0040716 3300046536 Bacteria 2775
833 Ga0495587_0132359 3300046536 Bacteria 1425
834 Ga0495609_0114552 3300046538 Unclassified 1162
835 Ga0495645_0000310 3300046543 Bacteria 35179
836 Ga0495645_0008466 3300046543 Bacteria 7183
837 Ga0495645_0313573 3300046543 Bacteria 1021
838 Ga0495622_0013890 3300046557 Bacteria 3736
839 Ga0495667_0000946 3300046559 Bacteria 18764
840 Ga0495667_0020778 3300046559 Bacteria 4430
841 Ga0495667_0078098 3300046559 Bacteria 2152
842 Ga0495656_0000135 3300046615 Bacteria 27441
843 Ga0495634_0007276 3300046642 Bacteria 8339
844 Ga0495634_0007973 3300046642 Bacteria 7898
845 Ga0495611_0089413 3300046648 Bacteria 1422
846 Ga0495635_0002226 3300046663 Bacteria 13172
847 Ga0495635_0010100 3300046663 Bacteria 6601
848 Ga0495659_0001106 3300046664 Bacteria 9384
849 Ga0495661_0057261 3300046665 Bacteria 2328
850 Ga0495588_0024336 3300046674 Bacteria 3007
851 Ga0495657_0009702 3300046675 Bacteria 7279
852 Ga0495657_0018260 3300046675 Bacteria 5080
853 Ga0495657_0091600 3300046675 Bacteria 1949
854 Ga0495599_0014755 3300046678 Bacteria 4837
855 Ga0495599_0082279 3300046678 Bacteria 2011
856 Ga0495599_0088825 3300046678 Bacteria 1929
857 Ga0495599_0118069 3300046678 Bacteria 1649
858 Ga0495599_0196856 3300046678 Bacteria 1239
859 Ga0495623_0047692 3300046679 Unclassified 2719
860 Ga0495623_0183606 3300046679 Bacteria 1213
861 Ga0495646_0000846 3300046680 Bacteria 17305
862 Ga0495646_0005824 3300046680 Bacteria 7814
863 Ga0495646_0186248 3300046680 Bacteria 1137
864 Ga0495647_0017444 3300046681 Bacteria 2540
865 Ga0495647_0057262 3300046681 Bacteria 1530
866 Ga0495658_0003137 3300046683 Bacteria 8241
867 Ga0495658_0007569 3300046683 Bacteria 5382
868 Ga0495669_0026128 3300046684 Bacteria 2551
869 Ga0495613_0061433 3300046689 Bacteria 2751
870 Ga0495613_0077855 3300046689 Bacteria 2412
871 Ga0495613_0326249 3300046689 Bacteria 1059
872 Ga0495624_0009424 3300046690 Bacteria 6763
873 Ga0495624_0095007 3300046690 Bacteria 1837
874 Ga0495670_0000427 3300046691 Bacteria 20176
875 Ga0495670_0137512 3300046691 Bacteria 1276
876 Ga0495600_0000371 3300046809 Bacteria 23444
877 Ga0495600_0002986 3300046809 Bacteria 9878
878 Ga0495600_0144992 3300046809 Unclassified 1539
879 Ga0495581_0073208 3300047315 Bacteria 1982
880 Ga0495604_0008735 3300047317 Bacteria 8007
881 Ga0495604_0018786 3300047317 Bacteria 5535
882 Ga0495604_0026322 3300047317 Bacteria 4631
883 Ga0495604_0064909 3300047317 Bacteria 2781
884 Ga0495604_0392857 3300047317 Bacteria 914
885 Ga0495674_0009124 3300047319 Bacteria 9424
886 Ga0495674_0032652 3300047319 Bacteria 4720
887 Ga0495674_0079445 3300047319 Bacteria 2817
888 Ga0495674_0101085 3300047319 Unclassified 2453
889 Ga0495672_0122671 3300047320 Bacteria 1379
890 Ga0495676_0041026 3300047321 Bacteria 3814
891 Ga0495680_0002891 3300047322 Bacteria 17259
892 Ga0495680_0004911 3300047322 Bacteria 12666
893 Ga0495680_0052511 3300047322 Bacteria 3177
894 Ga0495680_0103218 3300047322 Bacteria 2122
895 Ga0495680_0117477 3300047322 Bacteria 1966
896 Ga0495675_0003232 3300047444 Bacteria 9803
897 Ga0495675_0025771 3300047444 Unclassified 3747
898 Ga0495675_0272805 3300047444 Bacteria 1010
899 Ga0495685_011033 3300047447 Bacteria 3040
900 Ga0495684_0001459 3300047471 Bacteria 18933
901 Ga0495684_0097058 3300047471 Bacteria 2230
902 Ga0495684_0115883 3300047471 Bacteria 2020
903 Ga0495684_0124339 3300047471 Bacteria 1941
904 Ga0495684_0166725 3300047471 Bacteria 1640
905 Ga0495593_0005084 3300047673 Bacteria 7780
906 Ga0495593_0017427 3300047673 Bacteria 4043
907 Ga0495593_0045359 3300047673 Bacteria 2346
908 Ga0495602_0035918 3300048088 Bacteria 4617
909 Ga0495602_0059119 3300048088 Bacteria 3349
910 Ga0495602_0091580 3300048088 Bacteria 2521
911 Ga0495614_0013485 3300048089 Bacteria 3585
912 Ga0496100_0000050 3300048903 Bacteria 75449
913 Ga0496100_0077112 3300048903 Bacteria 2240
914 Ga0496101_0000121 3300048904 Bacteria 76264
915 Ga0496101_0000736 3300048904 Bacteria 19494
916 Ga0496102_0003252 3300048905 Bacteria 13782
917 Ga0496102_0085354 3300048905 Bacteria 2914
918 Ga0496102_0088060 3300048905 Bacteria 2869
919 Ga0496102_0117195 3300048905 Bacteria 2485
920 Ga0496102_0327404 3300048905 Bacteria 1443
921 Ga0496102_0409953 3300048905 Unclassified 1273
922 Ga0496102_0466921 3300048905 Unclassified 1183
923 Ga0496103_0000175 3300048906 Bacteria 65716
924 Ga0496103_0115582 3300048906 Bacteria 1706
925 Ga0496104_0000454 3300048907 Bacteria 35421
926 Ga0496104_0107071 3300048907 Bacteria 2679
927 Ga0496104_0128575 3300048907 Bacteria 2433
928 Ga0496104_0143317 3300048907 Bacteria 2295
929 Ga0496105_0027592 3300048908 Bacteria 4640
930 Ga0496105_0072615 3300048908 Bacteria 2843
931 Ga0496105_0121105 3300048908 Bacteria 2157
932 Ga0496106_0000133 3300048909 Bacteria 55926
933 Ga0496106_0014768 3300048909 Bacteria 5774
934 Ga0496106_0024517 3300048909 Bacteria 4485
935 Ga0496106_0025595 3300048909 Unclassified 4392
936 Ga0496107_0000237 3300048910 Bacteria 29056
937 Ga0496107_0018351 3300048910 Bacteria 4926
938 Ga0496107_0046462 3300048910 Bacteria 3125
939 Ga0496107_0106139 3300048910 Unclassified 2062
940 Ga0496108_0017335 3300048911 Bacteria 5890
941 Ga0496108_0036931 3300048911 Bacteria 4067
942 Ga0496108_0124282 3300048911 Unclassified 2214
943 Ga0496108_0164751 3300048911 Bacteria 1916
944 Ga0496109_0007388 3300048912 Bacteria 9301
945 Ga0496109_0026973 3300048912 Bacteria 5124
946 Ga0496109_0431687 3300048912 Bacteria 1244
947 Ga0496110_0009875 3300048913 Bacteria 7735
948 Ga0496110_0074280 3300048913 Bacteria 3019
949 Ga0496110_0103921 3300048913 Plasmid 2548
950 Ga0496111_0066222 3300048914 Bacteria 2623
951 Ga0496111_0160042 3300048914 Unclassified 1671
952 Ga0496112_0229477 3300048915 Bacteria 1811
953 Ga0496112_0247188 3300048915 Unclassified 1735
954 Ga0496112_0593394 3300048915 Bacteria 1040
955 Ga0496113_0190121 3300048916 Bacteria 1629
956 Ga0496113_0227683 3300048916 Bacteria 1486
957 Ga0496113_0265922 3300048916 Bacteria 1370
958 Ga0496114_0002721 3300048917 Bacteria 13500
959 Ga0496114_0012692 3300048917 Bacteria 6748
960 Ga0496114_0032154 3300048917 Bacteria 4317
961 Ga0496115_0066203 3300048918 Bacteria 2919
962 Ga0496115_0081829 3300048918 Bacteria 2630
963 Ga0496115_0084764 3300048918 Bacteria 2584
964 Ga0496115_0129112 3300048918 Bacteria 2083
965 Ga0496115_0212058 3300048918 Unclassified 1599
966 Ga0496117_0036056 3300048920 Bacteria 3705
967 Ga0496117_0052793 3300048920 Bacteria 2861
968 Ga0496118_0134551 3300048921 Bacteria 1580
969 Ga0496119_0188403 3300048922 Bacteria 1077
970 Ga0496122_0022949 3300048925 Bacteria 5523
971 Ga0496122_0081079 3300048925 Bacteria 2260
972 Ga0501031_0086553 3300049568 Bacteria 2043
973 Ga0501032_0028639 3300049569 Bacteria 3827
974 Ga0501032_0090434 3300049569 Bacteria 2031
975 Ga0501032_0126405 3300049569 Bacteria 1689
976 Ga0501032_0150846 3300049569 Bacteria 1528
977 Ga0501032_0194621 3300049569 Bacteria 1324
978 Ga0501033_0014695 3300049570 Bacteria 5942
979 Ga0501033_0022119 3300049570 Bacteria 4797
980 Ga0501033_0054068 3300049570 Bacteria 2971
981 Ga0501034_0000032 3300049571 Bacteria 243763
982 Ga0501034_0042726 3300049571 Bacteria 4588
983 Ga0501034_0060549 3300049571 Bacteria 3802
984 Ga0501034_0060914 3300049571 Bacteria 3791
985 Ga0501034_0090780 3300049571 Bacteria 3052
986 Ga0501034_0151914 3300049571 Bacteria 2291
987 Ga0501034_0167393 3300049571 Bacteria 2166
988 Ga0501034_0264152 3300049571 Bacteria 1663
989 Ga0501034_0387995 3300049571 Bacteria 1321
990 Ga0501034_0468769 3300049571 Bacteria 1175
991 Ga0501036_0003133 3300049572 Bacteria 13193
992 Ga0501036_0026699 3300049572 Bacteria 4878
993 Ga0501036_0059934 3300049572 Bacteria 3225
994 Ga0501036_0133412 3300049572 Bacteria 2096
995 Ga0501036_0503699 3300049572 Bacteria 1007
996 Ga0501037_0014087 3300049573 Bacteria 5890
997 Ga0501037_0034335 3300049573 Bacteria 3742
998 Ga0501037_0074977 3300049573 Bacteria 2457
999 Ga0501038_0012226 3300049574 Bacteria 7839
1000 Ga0501038_0025621 3300049574 Bacteria 5255
1001 Ga0501038_0064795 3300049574 Bacteria 3115
1002 Ga0501038_0090496 3300049574 Bacteria 2564
1003 Ga0501038_0125562 3300049574 Bacteria 2112
1004 Ga0501038_0440615 3300049574 Bacteria 1003
1005 Ga0501041_0296987 3300049577 Bacteria 1018
1006 Ga0501042_0315851 3300049578 Bacteria 1129
1007 Ga0501042_0420237 3300049578 Bacteria 969
1008 Ga0501043_0002174 3300049579 Bacteria 16722
1009 Ga0501043_0019813 3300049579 Bacteria 5282
1010 Ga0501043_0141415 3300049579 Bacteria 1884
1011 Ga0501046_0076410 3300049580 Bacteria 2594
1012 Ga0501047_0019888 3300049581 Bacteria 6444
1013 Ga0501047_0022348 3300049581 Bacteria 6075
1014 Ga0501047_0030921 3300049581 Bacteria 5162
1015 Ga0501047_0090599 3300049581 Bacteria 2935
1016 Ga0501047_0192663 3300049581 Bacteria 1901
1017 Ga0501047_0266501 3300049581 Bacteria 1560
1018 Ga0501048_0116600 3300049582 Bacteria 1887
1019 Ga0501048_0206530 3300049582 Bacteria 1393
1020 Ga0501048_0248442 3300049582 Bacteria 1263
1021 Ga0501067_0029026 3300049583 Bacteria 3066
1022 Ga0501069_0018653 3300049585 Bacteria 3746
1023 Ga0501069_0064447 3300049585 Bacteria 2048
1024 Ga0501070_0000929 3300049586 Bacteria 26412
1025 Ga0501070_0025114 3300049586 Bacteria 4995
1026 Ga0501070_0047935 3300049586 Bacteria 3550
1027 Ga0501070_0062238 3300049586 Bacteria 3092
1028 Ga0501070_0152763 3300049586 Bacteria 1904
1029 Ga0501070_0167154 3300049586 Bacteria 1812
1030 Ga0501071_0065654 3300049587 Bacteria 2635
1031 Ga0501071_0253519 3300049587 Bacteria 1328
1032 Ga0501071_0347921 3300049587 Bacteria 1128
1033 Ga0501072_0032679 3300049588 Bacteria 4075
1034 Ga0501072_0038088 3300049588 Bacteria 3774
1035 Ga0501072_0335628 3300049588 Bacteria 1201
1036 Ga0501073_0007407 3300049589 Bacteria 8156
1037 Ga0501073_0065786 3300049589 Bacteria 2527
1038 Ga0501074_0090568 3300049590 Bacteria 2190
1039 Ga0501074_0171499 3300049590 Bacteria 1548
1040 Ga0501076_0029006 3300049592 Bacteria 4301
1041 Ga0501076_0179356 3300049592 Bacteria 1727
1042 Ga0501076_0280202 3300049592 Bacteria 1366
1043 Ga0501080_0028616 3300049742 Bacteria 5186
1044 Ga0501080_0098556 3300049742 Bacteria 2713
1045 Ga0501080_0149856 3300049742 Bacteria 2156
1046 Ga0501080_0217610 3300049742 Bacteria 1749
1047 Ga0501080_0468059 3300049742 Bacteria 1128
1048 Ga0501081_0030358 3300049743 Bacteria 3659
1049 Ga0501083_0113235 3300049744 Bacteria 1782
1050 Ga0501083_0186995 3300049744 Bacteria 1352
1051 Ga0501035_0011391 3300049822 Bacteria 8243
1052 Ga0501035_0039179 3300049822 Bacteria 4289
1053 Ga0501035_0059429 3300049822 Bacteria 3404
1054 Ga0501035_0060617 3300049822 Bacteria 3368
1055 Ga0501035_0071320 3300049822 Bacteria 3076
1056 Ga0501035_0111490 3300049822 Bacteria 2397
1057 Ga0501044_0020829 3300049823 Bacteria 6999
1058 Ga0501044_0023302 3300049823 Bacteria 6586
1059 Ga0501044_0202853 3300049823 Bacteria 1941
1060 Ga0501044_0232670 3300049823 Bacteria 1789
1061 Ga0501044_0328200 3300049823 Bacteria 1453
1062 Ga0501044_0506713 3300049823 Bacteria 1108
1063 Ga0501044_0557423 3300049823 Bacteria 1042
1064 nmdc:mga03n38_57442_c1 3300050490 Bacteria 1759
1065 nmdc:mga03n38_95617_c1 3300050490 Bacteria 1423
1066 nmdc:mga0yw44_189281_c1 3300050492 Bacteria 1357
1067 nmdc:mga0yw44_279559_c1 3300050492 Bacteria 1115
1068 nmdc:mga0k408_27170_c1 3300050493 Bacteria 3249
1069 nmdc:mga06z11_28840_c1 3300050494 Bacteria 2667
1070 nmdc:mga06z11_30793_c1 3300050494 Bacteria 2600
1071 nmdc:mga06z11_32988_c1 3300050494 Bacteria 2529
1072 nmdc:mga04h51_14127_c1 3300050495 Bacteria 2275
1073 nmdc:mga07m45_194979_c1 3300050496 Bacteria 1178
1074 nmdc:mga07m45_44118_c1 3300050496 Bacteria 2501
1075 nmdc:mga07m45_47599_c1 3300050496 Bacteria 2411
1076 nmdc:mga05p37_129131_c1 3300050507 Bacteria 3102
1077 nmdc:mga05p37_34216_c1 3300050507 Bacteria 6223
1078 nmdc:mga05p37_354_c1 3300050507 Bacteria 49188
1079 nmdc:mga09592_1311_c1 3300050508 Bacteria 19973
1080 nmdc:mga0qj67_167658_c1 3300050509 Bacteria 1783
1081 nmdc:mga0qj67_1940_c1 3300050509 Bacteria 14712
1082 nmdc:mga0qj67_452_c1 3300050509 Bacteria 28045
1083 nmdc:mga06r32_147_c1 3300050510 Bacteria 53171
1084 nmdc:mga06r32_166113_c1 3300050510 Bacteria 1578
1085 nmdc:mga08y16_1264_c1 3300050511 Bacteria 25114
1086 nmdc:mga08y16_463250_c1 3300050511 Bacteria 1291
1087 nmdc:mga08y16_706_c1 3300050511 Bacteria 31784
1088 nmdc:mga0n895_126_c1 3300050512 Bacteria 45284
1089 nmdc:mga0n895_203244_c1 3300050512 Bacteria 2012
1090 nmdc:mga0n895_3658_c1 3300050512 Bacteria 12435
1091 nmdc:mga0n895_73852_c1 3300050512 Bacteria 3386
1092 nmdc:mga0rr50_110564_c1 3300050513 Bacteria 2174
1093 nmdc:mga0rr50_39348_c1 3300050513 Bacteria 3429
1094 nmdc:mga0rr50_58565_c1 3300050513 Bacteria 2888
1095 nmdc:mga08x19_21_c1 3300050514 Bacteria 302369
1096 nmdc:mga08x19_34989_c1 3300050514 Bacteria 3177
1097 nmdc:mga0a205_197_c1 3300050515 Bacteria 22634
1098 nmdc:mga0a205_35258_c1 3300050515 Bacteria 4804
1099 Ga0495601_0000068 3300053077 Bacteria 56524
1100 Ga0495601_0008114 3300053077 Bacteria 6191
1101 Ga0495601_0009067 3300053077 Bacteria 5875
1102 Ga0495601_0023631 3300053077 Bacteria 3778
1103 Ga0495601_0042090 3300053077 Unclassified 2864
1104 Ga0495601_0050293 3300053077 Bacteria 2628
1105 Ga0495601_0066779 3300053077 Bacteria 2290
1106 Ga0495612_0001544 3300053078 Bacteria 9486
1107 Ga0495612_0002142 3300053078 Bacteria 8121
1108 Ga0495612_0014034 3300053078 Bacteria 3226
1109 Ga0495612_0020815 3300053078 Bacteria 2629
1110 Ga0495612_0103951 3300053078 Unclassified 1211
1111 Ga0500610_0084049 3300053079 Bacteria 1658
1112 Ga0495595_0001152 3300053084 Bacteria 10236
1113 Ga0495595_0001627 3300053084 Bacteria 8780
1114 Ga0495595_0029994 3300053084 Bacteria 2437
1115 Ga0495595_0057613 3300053084 Bacteria 1812
1116 Ga0495595_0125911 3300053084 Bacteria 1250
1117 Ga0495619_0000136 3300053085 Bacteria 54722
1118 Ga0495619_0000154 3300053085 Bacteria 50900
1119 Ga0495619_0001079 3300053085 Bacteria 17901
1120 Ga0495619_0010153 3300053085 Bacteria 5931
1121 Ga0495619_0016781 3300053085 Bacteria 4636
1122 Ga0495619_0022065 3300053085 Bacteria 4069
1123 Ga0495619_0130927 3300053085 Bacteria 1724
1124 Ga0500643_000833 3300053087 Bacteria 19793
1125 Ga0500644_0000982 3300053088 Bacteria 8881
1126 Ga0500651_0008832 3300053093 Bacteria 5957
1127 Ga0500566_0038988 3300053094 Bacteria 2748
1128 Ga0500641_0015946 3300053096 Bacteria 2794
1129 Ga0500650_0030316 3300053098 Bacteria 2453
1130 Ga0500569_066558 3300053109 Bacteria 1125
1131 Ga0500595_000002 3300053119 Bacteria 1074388
1132 Ga0500608_128682 3300053122 Bacteria 1138
1133 Ga0500616_0000002 3300053153 Bacteria 1611257
1134 Ga0500616_0010066 3300053153 Bacteria 5682
1135 Ga0500616_0013446 3300053153 Bacteria 4751
1136 Ga0500622_0036280 3300053156 Bacteria 2577
1137 Ga0500636_0045638 3300053177 Bacteria 2584
1138 Ga0500645_000549 3300053730 Bacteria 24816
1139 Ga0501084_0066272 3300054114 Bacteria 3021
1140 Ga0501084_0320043 3300054114 Bacteria 1310
1141 Ga0501082_0054918 3300060353 Bacteria 3433
1142 Ga0501082_0102444 3300060353 Bacteria 2476
1143 Ga0530510_0056915 3300061734 Bacteria 2825

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10247944 Ga0075365_102479441 219
2 3300025926 Ga0207659_10047489 Ga0207659_100474892 221
3 3300039447 Ga0436361_0129874 Ga0436361_0129874_209_1042 242
4 3300049588 Ga0501072_0038088 Ga0501072_0038088_2565_3413 245
5 3300049590 Ga0501074_0171499 Ga0501074_0171499_577_1425 245
6 3300005545 Ga0070695_100237271 Ga0070695_1002372712 248
7 3300005983 Ga0081540_1001662 Ga0081540_10016627 248
8 3300005983 Ga0081540_1012674 Ga0081540_10126742 248
9 3300035171 Ga0373946_0018220 Ga0373946_0018220_361_1218 252
10 3300046680 Ga0495646_0186248 Ga0495646_0186248_288_1052 254
11 3300005327 Ga0070658_10344368 Ga0070658_103443682 257
12 3300005329 Ga0070683_100173151 Ga0070683_1001731512 257
13 3300005336 Ga0070680_100049833 Ga0070680_1000498332 257
14 3300005366 Ga0070659_100323349 Ga0070659_1003233492 257
15 3300005458 Ga0070681_10125790 Ga0070681_101257903 257
16 3300005535 Ga0070684_100178374 Ga0070684_1001783742 257
17 3300013104 Ga0157370_10194757 Ga0157370_101947572 257
18 3300013104 Ga0157370_10198962 Ga0157370_101989622 257
19 3300013105 Ga0157369_10001827 Ga0157369_1000182716 257
20 3300025912 Ga0207707_10073592 Ga0207707_100735923 257
21 3300025932 Ga0207690_10237055 Ga0207690_102370552 257
22 3300035111 Ga0373923_0054218 Ga0373923_0054218_739_1563 258
23 3300035118 Ga0373954_0063059 Ga0373954_0063059_69_893 258
24 3300035119 Ga0373956_0036600 Ga0373956_0036600_840_1664 258
25 3300035120 Ga0373957_0010202 Ga0373957_0010202_1684_2508 258
26 3300035172 Ga0373955_0006095 Ga0373955_0006095_2180_3004 258
27 3300035410 Ga0373924_0037005 Ga0373924_0037005_866_1690 258
28 3300046454 Ga0495592_0175787 Ga0495592_0175787_360_1184 258
29 3300046462 Ga0495651_0189868 Ga0495651_0189868_103_927 258
30 3300046511 Ga0495608_0104192 Ga0495608_0104192_740_1564 258
31 3300046516 Ga0495628_0117214 Ga0495628_0117214_438_1262 258
32 3300046533 Ga0495640_0300195 Ga0495640_0300195_119_943 258
33 3300046536 Ga0495587_0132359 Ga0495587_0132359_358_1182 258
34 3300046543 Ga0495645_0313573 Ga0495645_0313573_134_958 258
35 3300046559 Ga0495667_0078098 Ga0495667_0078098_1306_2130 258
36 3300046675 Ga0495657_0091600 Ga0495657_0091600_764_1588 258
37 3300046678 Ga0495599_0196856 Ga0495599_0196856_334_1158 258
38 3300046679 Ga0495623_0183606 Ga0495623_0183606_137_961 258
39 3300047317 Ga0495604_0392857 Ga0495604_0392857_52_876 258
40 3300047322 Ga0495680_0117477 Ga0495680_0117477_903_1727 258
41 3300047444 Ga0495675_0272805 Ga0495675_0272805_134_958 258
42 3300047471 Ga0495684_0124339 Ga0495684_0124339_434_1258 258
43 3300048088 Ga0495602_0091580 Ga0495602_0091580_366_1190 258
44 3300053077 Ga0495601_0023631 Ga0495601_0023631_2076_2900 258
45 3300053084 Ga0495595_0057613 Ga0495595_0057613_763_1587 258
46 3300039437 Ga0436365_0360126 Ga0436365_0360126_3294_4121 259
47 3300009094 Ga0111539_10168910 Ga0111539_101689104 260
48 3300035725 Ga0373947_0247239 Ga0373947_0247239_67_897 260
49 3300005341 Ga0070691_10088293 Ga0070691_100882932 261
50 3300005937 Ga0081455_10000153 Ga0081455_1000015335 261
51 3300006914 Ga0075436_100021761 Ga0075436_1000217614 261
52 3300007076 Ga0075435_100119913 Ga0075435_1001199132 261
53 3300031241 Ga0265325_10005389 Ga0265325_100053896 261
54 3300031595 Ga0265313_10000057 Ga0265313_1000005779 261
55 3300050513 nmdc:mga0rr50_39348_c1 nmdc:mga0rr50_39348_c1_167_994 261
56 3300050514 nmdc:mga08x19_21_c1 nmdc:mga08x19_21_c1_129923_130750 261
57 3300006844 Ga0075428_100435492 Ga0075428_1004354922 262
58 3300005435 Ga0070714_100035280 Ga0070714_1000352802 263
59 3300005616 Ga0068852_100085751 Ga0068852_1000857512 263
60 3300006353 Ga0075370_10038169 Ga0075370_100381694 263
61 3300007076 Ga0075435_100093336 Ga0075435_1000933362 263
62 3300025949 Ga0207667_10035215 Ga0207667_100352151 263
63 3300026142 Ga0207698_10260534 Ga0207698_102605342 263
64 3300049571 Ga0501034_0090780 Ga0501034_0090780_451_1278 263
65 3300049742 Ga0501080_0217610 Ga0501080_0217610_228_1055 263
66 3300050496 nmdc:mga07m45_194979_c1 nmdc:mga07m45_194979_c1_233_1063 263
67 3300005439 Ga0070711_100138772 Ga0070711_1001387721 264
68 3300006028 Ga0070717_10349038 Ga0070717_103490382 264
69 3300003659 JGI25404J52841_10000207 JGI25404J52841_100002074 265
70 3300005329 Ga0070683_100088017 Ga0070683_1000880172 265
71 3300005435 Ga0070714_100138726 Ga0070714_1001387262 265
72 3300005437 Ga0070710_10044111 Ga0070710_100441112 265
73 3300005439 Ga0070711_100090065 Ga0070711_1000900653 265
74 3300005458 Ga0070681_10074981 Ga0070681_100749813 265
75 3300005530 Ga0070679_100117245 Ga0070679_1001172451 265
76 3300005535 Ga0070684_100359223 Ga0070684_1003592231 265
77 3300005983 Ga0081540_1000008 Ga0081540_100000848 265
78 3300009093 Ga0105240_10296212 Ga0105240_102962122 265
79 3300013105 Ga0157369_10242552 Ga0157369_102425522 265
80 3300013307 Ga0157372_10123167 Ga0157372_101231672 265
81 3300025898 Ga0207692_10105306 Ga0207692_101053062 265
82 3300025915 Ga0207693_10000975 Ga0207693_100009754 265
83 3300025916 Ga0207663_10159114 Ga0207663_101591142 265
84 3300025929 Ga0207664_10184284 Ga0207664_101842842 265
85 3300039453 Ga0436362_0884639 Ga0436362_0884639_1297_2121 265
86 3300049569 Ga0501032_0028639 Ga0501032_0028639_2599_3432 265
87 3300049571 Ga0501034_0060914 Ga0501034_0060914_2897_3730 265
88 3300049574 Ga0501038_0012226 Ga0501038_0012226_5723_6556 265
89 3300049581 Ga0501047_0030921 Ga0501047_0030921_2997_3830 265
90 3300049589 Ga0501073_0007407 Ga0501073_0007407_1298_2131 265
91 3300049744 Ga0501083_0113235 Ga0501083_0113235_181_1014 265
92 3300060353 Ga0501082_0054918 Ga0501082_0054918_1058_1891 265
93 iso_pu_bacteria 8054563764 8054568422 265
94 3300005434 Ga0070709_10221187 Ga0070709_102211872 266
95 3300025915 Ga0207693_10006027 Ga0207693_100060277 266
96 3300028800 Ga0265338_10006566 Ga0265338_100065666 267
97 3300031249 Ga0265339_10000071 Ga0265339_1000007183 267
98 3300031595 Ga0265313_10000415 Ga0265313_1000041544 267
99 3300046454 Ga0495592_0261722 Ga0495592_0261722_283_1113 267
100 3300046462 Ga0495651_0073846 Ga0495651_0073846_1235_2065 267
101 3300046516 Ga0495628_0122395 Ga0495628_0122395_572_1402 267
102 3300046533 Ga0495640_0254059 Ga0495640_0254059_68_898 267
103 3300046809 Ga0495600_0144992 Ga0495600_0144992_17_847 267
104 3300047317 Ga0495604_0064909 Ga0495604_0064909_1693_2523 267
105 3300047319 Ga0495674_0032652 Ga0495674_0032652_58_888 267
106 3300053077 Ga0495601_0009067 Ga0495601_0009067_4026_4856 267
107 3300053078 Ga0495612_0103951 Ga0495612_0103951_80_910 267
108 3300053084 Ga0495595_0029994 Ga0495595_0029994_1330_2160 267
109 3300053085 Ga0495619_0000136 Ga0495619_0000136_41589_42419 267
110 3300006195 Ga0075366_10185370 Ga0075366_101853702 268
111 3300050493 nmdc:mga0k408_27170_c1 nmdc:mga0k408_27170_c1_1856_2686 268
112 3300006048 Ga0075363_100115199 Ga0075363_1001151992 269
113 3300050490 nmdc:mga03n38_95617_c1 nmdc:mga03n38_95617_c1_91_942 269
114 3300005434 Ga0070709_10029823 Ga0070709_100298232 270
115 3300005436 Ga0070713_100001555 Ga0070713_10000155513 270
116 3300005437 Ga0070710_10025993 Ga0070710_100259932 270
117 3300025898 Ga0207692_10036390 Ga0207692_100363903 270
118 3300025906 Ga0207699_10129922 Ga0207699_101299222 270
119 3300025916 Ga0207663_10151500 Ga0207663_101515002 270
120 3300025928 Ga0207700_10024792 Ga0207700_100247922 270
121 3300025939 Ga0207665_10093222 Ga0207665_100932223 270
122 3300035083 Ga0373926_0099066 Ga0373926_0099066_190_1014 270
123 3300035695 Ga0373927_0102664 Ga0373927_0102664_72_896 270
124 3300036401 Ga0373937_0048237 Ga0373937_0048237_2329_3153 270
125 3300037068 Ga0373925_0038910 Ga0373925_0038910_595_1419 270
126 3300046689 Ga0495613_0326249 Ga0495613_0326249_147_971 270
127 3300048913 Ga0496110_0074280 Ga0496110_0074280_360_1172 270
128 3300048915 Ga0496112_0593394 Ga0496112_0593394_34_870 270
129 3300050490 nmdc:mga03n38_57442_c1 nmdc:mga03n38_57442_c1_338_1156 270
130 3300050494 nmdc:mga06z11_30793_c1 nmdc:mga06z11_30793_c1_1602_2420 270
131 3300050495 nmdc:mga04h51_14127_c1 nmdc:mga04h51_14127_c1_1026_1844 270
132 3300005365 Ga0070688_100050563 Ga0070688_1000505633 271
133 3300005434 Ga0070709_10205339 Ga0070709_102053392 271
134 3300005435 Ga0070714_100015432 Ga0070714_1000154324 271
135 3300005436 Ga0070713_100066169 Ga0070713_1000661692 271
136 3300005439 Ga0070711_100024053 Ga0070711_1000240532 271
137 3300005614 Ga0068856_100127057 Ga0068856_1001270572 271
138 3300005937 Ga0081455_10002775 Ga0081455_100027757 271
139 3300006038 Ga0075365_10234229 Ga0075365_102342291 271
140 3300006173 Ga0070716_100015557 Ga0070716_1000155571 271
141 3300006175 Ga0070712_100054314 Ga0070712_1000543142 271
142 3300025906 Ga0207699_10041260 Ga0207699_100412603 271
143 3300025913 Ga0207695_10509378 Ga0207695_105093782 271
144 3300025915 Ga0207693_10005875 Ga0207693_100058755 271
145 3300025916 Ga0207663_10132999 Ga0207663_101329992 271
146 3300035117 Ga0373953_0038456 Ga0373953_0038456_724_1551 271
147 3300035118 Ga0373954_0014077 Ga0373954_0014077_1749_2576 271
148 3300035120 Ga0373957_0004989 Ga0373957_0004989_456_1283 271
149 3300035410 Ga0373924_0053076 Ga0373924_0053076_727_1554 271
150 3300035692 Ga0373935_0060269 Ga0373935_0060269_308_1135 271
151 3300035724 Ga0373933_0002026 Ga0373933_0002026_3572_4399 271
152 3300036401 Ga0373937_0022992 Ga0373937_0022992_4295_5122 271
153 3300046463 Ga0495653_0122163 Ga0495653_0122163_163_990 271
154 3300046511 Ga0495608_0015397 Ga0495608_0015397_1185_2012 271
155 3300046529 Ga0495652_0049073 Ga0495652_0049073_1582_2409 271
156 3300046536 Ga0495587_0014249 Ga0495587_0014249_2649_3476 271
157 3300046543 Ga0495645_0000310 Ga0495645_0000310_1968_2795 271
158 3300046675 Ga0495657_0018260 Ga0495657_0018260_1621_2448 271
159 3300046678 Ga0495599_0088825 Ga0495599_0088825_311_1138 271
160 3300046679 Ga0495623_0047692 Ga0495623_0047692_1615_2442 271
161 3300046680 Ga0495646_0005824 Ga0495646_0005824_3634_4461 271
162 3300046681 Ga0495647_0057262 Ga0495647_0057262_513_1340 271
163 3300047317 Ga0495604_0026322 Ga0495604_0026322_338_1165 271
164 3300047319 Ga0495674_0101085 Ga0495674_0101085_1407_2234 271
165 3300047322 Ga0495680_0103218 Ga0495680_0103218_875_1702 271
166 3300047444 Ga0495675_0025771 Ga0495675_0025771_1025_1852 271
167 3300047471 Ga0495684_0115883 Ga0495684_0115883_95_922 271
168 3300048088 Ga0495602_0035918 Ga0495602_0035918_2157_2984 271
169 3300053077 Ga0495601_0008114 Ga0495601_0008114_1468_2295 271
170 3300053078 Ga0495612_0002142 Ga0495612_0002142_4659_5486 271
171 3300039453 Ga0436362_0145276 Ga0436362_0145276_200_1033 272
172 iso_pu_bacteria 2513237087 2513591808 272
173 iso_pu_bacteria 2643221547 2643756796 272
174 iso_pu_bacteria 2643221733 2644727631 272
175 iso_pu_bacteria 2643221734 2644733454 272
176 iso_pu_bacteria 2818991467 2819717405 272
177 iso_pu_bacteria 2841760612 2841763021 272
178 iso_pu_bacteria 2844104063 2844109109 272
179 iso_pu_bacteria 2851246043 2851251216 272
180 iso_pu_bacteria 2917699015 2917701039 272
181 3300006178 Ga0075367_10003172 Ga0075367_100031722 273
182 3300050494 nmdc:mga06z11_28840_c1 nmdc:mga06z11_28840_c1_1062_1904 273
183 3300050496 nmdc:mga07m45_44118_c1 nmdc:mga07m45_44118_c1_1063_1905 273
184 iso_pu_bacteria 2643221736 2644744676 273
185 iso_pu_bacteria 2919450847 2919454297 273
186 iso_pu_bacteria 8001845381 8001848233 273
187 iso_pu_bacteria 8057529695 8057534968 273
188 3300005439 Ga0070711_100058358 Ga0070711_1000583581 274
189 3300039437 Ga0436365_1470399 Ga0436365_1470399_797_1624 274
190 3300039438 Ga0436360_0147686 Ga0436360_0147686_34_924 274
191 3300039450 Ga0436363_1165521 Ga0436363_1165521_39_866 274
192 3300005290 Ga0065712_10116506 Ga0065712_101165061 275
193 3300005327 Ga0070658_10146191 Ga0070658_101461912 275
194 3300005353 Ga0070669_100073632 Ga0070669_1000736323 275
195 3300005439 Ga0070711_100041441 Ga0070711_1000414414 275
196 3300005545 Ga0070695_100018163 Ga0070695_1000181634 275
197 3300005981 Ga0081538_10047178 Ga0081538_100471781 275
198 3300006038 Ga0075365_10004253 Ga0075365_100042535 275
199 3300006048 Ga0075363_100010796 Ga0075363_1000107962 275
200 3300006178 Ga0075367_10045316 Ga0075367_100453163 275
201 3300006846 Ga0075430_100300780 Ga0075430_1003007802 275
202 3300006847 Ga0075431_100189975 Ga0075431_1001899752 275
203 3300013102 Ga0157371_10183656 Ga0157371_101836562 275
204 3300021384 Ga0213876_10017304 Ga0213876_100173045 275
205 3300025898 Ga0207692_10127427 Ga0207692_101274272 275
206 3300025915 Ga0207693_10003947 Ga0207693_100039474 275
207 3300025923 Ga0207681_10301757 Ga0207681_103017572 275
208 3300025928 Ga0207700_10174358 Ga0207700_101743582 275
209 3300025937 Ga0207669_10349661 Ga0207669_103496612 275
210 3300025939 Ga0207665_10098860 Ga0207665_100988602 275
211 3300028800 Ga0265338_10269689 Ga0265338_102696892 275
212 3300031241 Ga0265325_10013324 Ga0265325_100133242 275
213 3300031249 Ga0265339_10096653 Ga0265339_100966532 275
214 3300031595 Ga0265313_10039367 Ga0265313_100393672 275
215 3300032002 Ga0307416_100276325 Ga0307416_1002763251 275
216 3300032133 Ga0316583_10000158 Ga0316583_100001584 275
217 3300035724 Ga0373933_0077918 Ga0373933_0077918_908_1735 275
218 3300036401 Ga0373937_0680185 Ga0373937_0680185_55_882 275
219 3300037312 Ga0395899_0021560 Ga0395899_0021560_3919_4746 275
220 3300037312 Ga0395899_0023051 Ga0395899_0023051_3528_4355 275
221 3300037418 Ga0395900_0075230 Ga0395900_0075230_170_997 275
222 3300037418 Ga0395900_0080585 Ga0395900_0080585_721_1548 275
223 3300037466 Ga0395898_0004062 Ga0395898_0004062_9869_10696 275
224 3300037466 Ga0395898_0198304 Ga0395898_0198304_283_1110 275
225 3300037466 Ga0395898_0274050 Ga0395898_0274050_232_1059 275
226 3300038443 Ga0395901_0005167 Ga0395901_0005167_10968_11795 275
227 3300038443 Ga0395901_0412868 Ga0395901_0412868_508_1335 275
228 3300039437 Ga0436365_0014752 Ga0436365_0014752_17282_18118 275
229 3300044694 Ga0466963_0276756 Ga0466963_0276756_262_1089 275
230 3300045049 Ga0466959_0150081 Ga0466959_0150081_185_1012 275
231 3300045836 Ga0466958_0162141 Ga0466958_0162141_186_1013 275
232 3300045976 Ga0466967_0461870 Ga0466967_0461870_306_1133 275
233 3300046522 Ga0495643_0098844 Ga0495643_0098844_611_1441 275
234 3300049571 Ga0501034_0000032 Ga0501034_0000032_79603_80430 275
235 3300049571 Ga0501034_0387995 Ga0501034_0387995_318_1145 275
236 3300049572 Ga0501036_0133412 Ga0501036_0133412_785_1612 275
237 3300049574 Ga0501038_0440615 Ga0501038_0440615_154_990 275
238 3300049577 Ga0501041_0296987 Ga0501041_0296987_111_938 275
239 3300049578 Ga0501042_0420237 Ga0501042_0420237_38_868 275
240 3300049581 Ga0501047_0022348 Ga0501047_0022348_4486_5322 275
241 3300049581 Ga0501047_0266501 Ga0501047_0266501_650_1480 275
242 3300049585 Ga0501069_0018653 Ga0501069_0018653_807_1637 275
243 3300049585 Ga0501069_0064447 Ga0501069_0064447_835_1665 275
244 3300049586 Ga0501070_0000929 Ga0501070_0000929_9855_10685 275
245 3300049586 Ga0501070_0047935 Ga0501070_0047935_385_1215 275
246 3300049586 Ga0501070_0062238 Ga0501070_0062238_1513_2340 275
247 3300049592 Ga0501076_0179356 Ga0501076_0179356_858_1685 275
248 3300049742 Ga0501080_0098556 Ga0501080_0098556_1460_2290 275
249 3300049744 Ga0501083_0186995 Ga0501083_0186995_304_1131 275
250 3300049822 Ga0501035_0011391 Ga0501035_0011391_2704_3534 275
251 3300049822 Ga0501035_0071320 Ga0501035_0071320_1551_2387 275
252 3300049823 Ga0501044_0023302 Ga0501044_0023302_775_1611 275
253 3300049823 Ga0501044_0202853 Ga0501044_0202853_1070_1897 275
254 3300049823 Ga0501044_0506713 Ga0501044_0506713_173_1000 275
255 3300050507 nmdc:mga05p37_129131_c1 nmdc:mga05p37_129131_c1_192_1019 275
256 3300050509 nmdc:mga0qj67_167658_c1 nmdc:mga0qj67_167658_c1_463_1293 275
257 3300050510 nmdc:mga06r32_166113_c1 nmdc:mga06r32_166113_c1_341_1171 275
258 3300053077 Ga0495601_0066779 Ga0495601_0066779_996_1823 275
259 3300053084 Ga0495595_0125911 Ga0495595_0125911_215_1042 275
260 3300053085 Ga0495619_0130927 Ga0495619_0130927_383_1210 275
261 3300053153 Ga0500616_0013446 Ga0500616_0013446_926_1762 275
262 2209111006 2214767425 2213785229 276
263 3300000041 ARcpr5oldR_c000015 ARcpr5oldR_00001513 276
264 3300000042 ARSoilYngRDRAFT_c00006 ARSoilYngRDRAFT_000064 276
265 3300000043 ARcpr5yngRDRAFT_c000041 ARcpr5yngRDRAFT_0000414 276
266 3300000044 ARSoilOldRDRAFT_c000020 ARSoilOldRDRAFT_00002033 276
267 3300000045 ARCol0oldRDRAFT_c00041 ARCol0oldRDRAFT_000414 276
268 3300000652 ARCol0yngRDRAFT_1000465 ARCol0yngRDRAFT_10004652 276
269 3300001977 JGI24746J21847_1001428 JGI24746J21847_10014284 276
270 3300001978 JGI24747J21853_1002861 JGI24747J21853_10028612 276
271 3300001989 JGI24739J22299_10000344 JGI24739J22299_100003448 276
272 3300001990 JGI24737J22298_10000203 JGI24737J22298_100002038 276
273 3300001990 JGI24737J22298_10023970 JGI24737J22298_100239702 276
274 3300002070 JGI24750J21931_1000159 JGI24750J21931_10001598 276
275 3300002073 JGI24745J21846_1000003 JGI24745J21846_10000034 276
276 3300002074 JGI24748J21848_1000190 JGI24748J21848_10001908 276
277 3300002075 JGI24738J21930_10000042 JGI24738J21930_1000004217 276
278 3300002076 JGI24749J21850_1000350 JGI24749J21850_10003502 276
279 3300002126 JGI24035J26624_1000010 JGI24035J26624_10000102 276
280 3300002244 JGI24742J22300_10000016 JGI24742J22300_1000001621 276
281 3300002987 JGI25159J45721_1004563 JGI25159J45721_10045635 276
282 3300003187 JGI25151J46595_10000040 JGI25151J46595_10000040108 276
283 3300003771 Ga0055526_1000351 Ga0055526_10003515 276
284 3300003771 Ga0055526_1001693 Ga0055526_100169314 276
285 3300003771 Ga0055526_1003504 Ga0055526_10035045 276
286 3300003775 Ga0055524_1000023 Ga0055524_1000023133 276
287 3300003911 JGI25405J52794_10003103 JGI25405J52794_100031033 276
288 3300005262 Ga0065165_1000218 Ga0065165_100021866 276
289 3300005276 Ga0065717_1002525 Ga0065717_10025252 276
290 3300005277 Ga0065716_1002178 Ga0065716_10021782 276
291 3300005289 Ga0065704_10073457 Ga0065704_100734575 276
292 3300005290 Ga0065712_10002616 Ga0065712_100026161 276
293 3300005290 Ga0065712_10068673 Ga0065712_100686732 276
294 3300005290 Ga0065712_10119855 Ga0065712_101198552 276
295 3300005293 Ga0065715_10001423 Ga0065715_1000142313 276
296 3300005293 Ga0065715_10088987 Ga0065715_1008898718 276
297 3300005293 Ga0065715_10200234 Ga0065715_102002342 276
298 3300005295 Ga0065707_10107116 Ga0065707_101071162 276
299 3300005328 Ga0070676_10000784 Ga0070676_1000078410 276
300 3300005328 Ga0070676_10016846 Ga0070676_100168464 276
301 3300005329 Ga0070683_100000114 Ga0070683_10000011414 276
302 3300005329 Ga0070683_100232230 Ga0070683_1002322302 276
303 3300005329 Ga0070683_100335950 Ga0070683_1003359501 276
304 3300005330 Ga0070690_100000064 Ga0070690_10000006431 276
305 3300005330 Ga0070690_100015359 Ga0070690_1000153592 276
306 3300005330 Ga0070690_100056719 Ga0070690_1000567192 276
307 3300005331 Ga0070670_100002373 Ga0070670_10000237310 276
308 3300005331 Ga0070670_100005338 Ga0070670_1000053386 276
309 3300005331 Ga0070670_100054895 Ga0070670_1000548954 276
310 3300005331 Ga0070670_100509442 Ga0070670_1005094421 276
311 3300005331 Ga0070670_100524850 Ga0070670_1005248501 276
312 3300005333 Ga0070677_10000193 Ga0070677_1000019320 276
313 3300005334 Ga0068869_100000020 Ga0068869_1000000206 276
314 3300005335 Ga0070666_10005751 Ga0070666_100057518 276
315 3300005336 Ga0070680_100000242 Ga0070680_10000024225 276
316 3300005336 Ga0070680_100059770 Ga0070680_1000597703 276
317 3300005336 Ga0070680_100192106 Ga0070680_1001921062 276
318 3300005336 Ga0070680_100362109 Ga0070680_1003621091 276
319 3300005337 Ga0070682_100000224 Ga0070682_10000022427 276
320 3300005337 Ga0070682_100016367 Ga0070682_1000163673 276
321 3300005337 Ga0070682_100075915 Ga0070682_1000759152 276
322 3300005337 Ga0070682_100318486 Ga0070682_1003184861 276
323 3300005338 Ga0068868_100003038 Ga0068868_10000303814 276
324 3300005338 Ga0068868_100005421 Ga0068868_1000054217 276
325 3300005338 Ga0068868_100327527 Ga0068868_1003275272 276
326 3300005339 Ga0070660_100000123 Ga0070660_10000012310 276
327 3300005339 Ga0070660_100075002 Ga0070660_1000750023 276
328 3300005339 Ga0070660_100480214 Ga0070660_1004802142 276
329 3300005340 Ga0070689_100000685 Ga0070689_10000068513 276
330 3300005340 Ga0070689_100010928 Ga0070689_1000109282 276
331 3300005341 Ga0070691_10001254 Ga0070691_100012545 276
332 3300005343 Ga0070687_100000351 Ga0070687_1000003518 276
333 3300005343 Ga0070687_100016686 Ga0070687_1000166862 276
334 3300005344 Ga0070661_100000039 Ga0070661_1000000399 276
335 3300005344 Ga0070661_100144629 Ga0070661_1001446292 276
336 3300005345 Ga0070692_10062423 Ga0070692_100624232 276
337 3300005347 Ga0070668_100003586 Ga0070668_10000358611 276
338 3300005347 Ga0070668_100128113 Ga0070668_1001281132 276
339 3300005353 Ga0070669_100000176 Ga0070669_10000017617 276
340 3300005353 Ga0070669_100204124 Ga0070669_1002041242 276
341 3300005354 Ga0070675_100000259 Ga0070675_10000025931 276
342 3300005354 Ga0070675_100254869 Ga0070675_1002548692 276
343 3300005355 Ga0070671_100005757 Ga0070671_1000057578 276
344 3300005356 Ga0070674_100000099 Ga0070674_10000009910 276
345 3300005356 Ga0070674_100018430 Ga0070674_1000184304 276
346 3300005356 Ga0070674_100193057 Ga0070674_1001930572 276
347 3300005364 Ga0070673_100018362 Ga0070673_1000183623 276
348 3300005364 Ga0070673_100359816 Ga0070673_1003598161 276
349 3300005365 Ga0070688_100000329 Ga0070688_10000032919 276
350 3300005365 Ga0070688_100207204 Ga0070688_1002072042 276
351 3300005365 Ga0070688_100368481 Ga0070688_1003684811 276
352 3300005366 Ga0070659_100005453 Ga0070659_1000054535 276
353 3300005366 Ga0070659_100094545 Ga0070659_1000945452 276
354 3300005367 Ga0070667_100001075 Ga0070667_10000107519 276
355 3300005367 Ga0070667_100021496 Ga0070667_1000214965 276
356 3300005367 Ga0070667_100267163 Ga0070667_1002671632 276
357 3300005434 Ga0070709_10002443 Ga0070709_100024435 276
358 3300005435 Ga0070714_100015694 Ga0070714_1000156942 276
359 3300005435 Ga0070714_100043358 Ga0070714_1000433583 276
360 3300005435 Ga0070714_100311042 Ga0070714_1003110422 276
361 3300005435 Ga0070714_100543000 Ga0070714_1005430002 276
362 3300005436 Ga0070713_100000654 Ga0070713_10000065415 276
363 3300005436 Ga0070713_100014148 Ga0070713_1000141482 276
364 3300005436 Ga0070713_100060404 Ga0070713_1000604041 276
365 3300005437 Ga0070710_10000619 Ga0070710_1000061911 276
366 3300005437 Ga0070710_10003937 Ga0070710_100039376 276
367 3300005438 Ga0070701_10000025 Ga0070701_1000002512 276
368 3300005439 Ga0070711_100010734 Ga0070711_1000107343 276
369 3300005439 Ga0070711_100073806 Ga0070711_1000738062 276
370 3300005440 Ga0070705_100037650 Ga0070705_1000376502 276
371 3300005440 Ga0070705_100130307 Ga0070705_1001303072 276
372 3300005441 Ga0070700_100002215 Ga0070700_1000022158 276
373 3300005444 Ga0070694_100006957 Ga0070694_1000069578 276
374 3300005445 Ga0070708_100023192 Ga0070708_1000231922 276
375 3300005455 Ga0070663_100000064 Ga0070663_10000006429 276
376 3300005455 Ga0070663_100014208 Ga0070663_1000142082 276
377 3300005455 Ga0070663_100060234 Ga0070663_1000602344 276
378 3300005456 Ga0070678_100001526 Ga0070678_10000152612 276
379 3300005456 Ga0070678_100043310 Ga0070678_1000433104 276
380 3300005456 Ga0070678_100043991 Ga0070678_1000439913 276
381 3300005457 Ga0070662_100023064 Ga0070662_1000230644 276
382 3300005457 Ga0070662_100025880 Ga0070662_1000258805 276
383 3300005457 Ga0070662_100051625 Ga0070662_1000516253 276
384 3300005457 Ga0070662_100141585 Ga0070662_1001415853 276
385 3300005457 Ga0070662_100271400 Ga0070662_1002714001 276
386 3300005457 Ga0070662_100448009 Ga0070662_1004480091 276
387 3300005458 Ga0070681_10000435 Ga0070681_1000043514 276
388 3300005458 Ga0070681_10032023 Ga0070681_100320233 276
389 3300005458 Ga0070681_10051421 Ga0070681_100514214 276
390 3300005458 Ga0070681_10063320 Ga0070681_100633203 276
391 3300005459 Ga0068867_100002108 Ga0068867_1000021082 276
392 3300005459 Ga0068867_100025717 Ga0068867_1000257175 276
393 3300005466 Ga0070685_10003445 Ga0070685_100034457 276
394 3300005466 Ga0070685_10012156 Ga0070685_100121565 276
395 3300005507 Ga0074259_10047191 Ga0074259_100471912 276
396 3300005518 Ga0070699_100361940 Ga0070699_1003619402 276
397 3300005530 Ga0070679_100002876 Ga0070679_1000028768 276
398 3300005535 Ga0070684_100001610 Ga0070684_10000161011 276
399 3300005535 Ga0070684_100142642 Ga0070684_1001426422 276
400 3300005535 Ga0070684_100207569 Ga0070684_1002075692 276
401 3300005539 Ga0068853_100005553 Ga0068853_1000055535 276
402 3300005539 Ga0068853_100323476 Ga0068853_1003234761 276
403 3300005543 Ga0070672_100000011 Ga0070672_10000001141 276
404 3300005543 Ga0070672_100129130 Ga0070672_1001291303 276
405 3300005543 Ga0070672_100263855 Ga0070672_1002638552 276
406 3300005543 Ga0070672_100304859 Ga0070672_1003048592 276
407 3300005544 Ga0070686_100000076 Ga0070686_10000007634 276
408 3300005544 Ga0070686_100002194 Ga0070686_1000021946 276
409 3300005544 Ga0070686_100067747 Ga0070686_1000677472 276
410 3300005544 Ga0070686_100115683 Ga0070686_1001156832 276
411 3300005545 Ga0070695_100003381 Ga0070695_1000033815 276
412 3300005545 Ga0070695_100025754 Ga0070695_1000257544 276
413 3300005546 Ga0070696_100038461 Ga0070696_1000384614 276
414 3300005547 Ga0070693_100000122 Ga0070693_10000012228 276
415 3300005547 Ga0070693_100074358 Ga0070693_1000743582 276
416 3300005548 Ga0070665_100034452 Ga0070665_1000344524 276
417 3300005549 Ga0070704_100002018 Ga0070704_1000020187 276
418 3300005549 Ga0070704_100008020 Ga0070704_1000080202 276
419 3300005549 Ga0070704_100017468 Ga0070704_1000174685 276
420 3300005549 Ga0070704_100051139 Ga0070704_1000511392 276
421 3300005549 Ga0070704_100105130 Ga0070704_1001051304 276
422 3300005563 Ga0068855_100035734 Ga0068855_1000357344 276
423 3300005563 Ga0068855_100246086 Ga0068855_1002460861 276
424 3300005564 Ga0070664_100000112 Ga0070664_10000011220 276
425 3300005564 Ga0070664_100227925 Ga0070664_1002279252 276
426 3300005564 Ga0070664_100320227 Ga0070664_1003202271 276
427 3300005564 Ga0070664_100483617 Ga0070664_1004836172 276
428 3300005577 Ga0068857_100000023 Ga0068857_10000002352 276
429 3300005578 Ga0068854_100004158 Ga0068854_1000041585 276
430 3300005614 Ga0068856_100000099 Ga0068856_10000009918 276
431 3300005614 Ga0068856_100169702 Ga0068856_1001697023 276
432 3300005614 Ga0068856_100907814 Ga0068856_1009078141 276
433 3300005615 Ga0070702_100000005 Ga0070702_10000000558 276
434 3300005615 Ga0070702_100021306 Ga0070702_1000213064 276
435 3300005616 Ga0068852_100004502 Ga0068852_1000045028 276
436 3300005616 Ga0068852_100262158 Ga0068852_1002621581 276
437 3300005616 Ga0068852_100283878 Ga0068852_1002838782 276
438 3300005617 Ga0068859_100000503 Ga0068859_10000050318 276
439 3300005617 Ga0068859_100039458 Ga0068859_1000394586 276
440 3300005617 Ga0068859_100040577 Ga0068859_1000405775 276
441 3300005617 Ga0068859_100611665 Ga0068859_1006116651 276
442 3300005618 Ga0068864_100000112 Ga0068864_10000011252 276
443 3300005618 Ga0068864_100018108 Ga0068864_1000181083 276
444 3300005618 Ga0068864_100308582 Ga0068864_1003085822 276
445 3300005618 Ga0068864_100574723 Ga0068864_1005747231 276
446 3300005718 Ga0068866_10000977 Ga0068866_100009773 276
447 3300005718 Ga0068866_10008375 Ga0068866_100083751 276
448 3300005718 Ga0068866_10106410 Ga0068866_101064102 276
449 3300005719 Ga0068861_100002096 Ga0068861_1000020964 276
450 3300005719 Ga0068861_100118714 Ga0068861_1001187143 276
451 3300005834 Ga0068851_10097376 Ga0068851_100973761 276
452 3300005840 Ga0068870_10000021 Ga0068870_1000002113 276
453 3300005840 Ga0068870_10087663 Ga0068870_100876631 276
454 3300005841 Ga0068863_100000227 Ga0068863_10000022736 276
455 3300005841 Ga0068863_100076196 Ga0068863_1000761964 276
456 3300005842 Ga0068858_100120781 Ga0068858_1001207811 276
457 3300005842 Ga0068858_100353397 Ga0068858_1003533972 276
458 3300005842 Ga0068858_100495126 Ga0068858_1004951262 276
459 3300005843 Ga0068860_100000511 Ga0068860_1000005119 276
460 3300005843 Ga0068860_100201784 Ga0068860_1002017842 276
461 3300005843 Ga0068860_100345907 Ga0068860_1003459072 276
462 3300005843 Ga0068860_100577693 Ga0068860_1005776932 276
463 3300005844 Ga0068862_100001866 Ga0068862_1000018665 276
464 3300005844 Ga0068862_100340316 Ga0068862_1003403161 276
465 3300005844 Ga0068862_100437335 Ga0068862_1004373351 276
466 3300005937 Ga0081455_10192128 Ga0081455_101921282 276
467 3300005983 Ga0081540_1052135 Ga0081540_10521352 276
468 3300005985 Ga0081539_10000423 Ga0081539_1000042376 276
469 3300006038 Ga0075365_10054906 Ga0075365_100549062 276
470 3300006038 Ga0075365_10230580 Ga0075365_102305802 276
471 3300006058 Ga0075432_10004763 Ga0075432_100047632 276
472 3300006163 Ga0070715_10012842 Ga0070715_100128424 276
473 3300006163 Ga0070715_10071977 Ga0070715_100719772 276
474 3300006173 Ga0070716_100054784 Ga0070716_1000547842 276
475 3300006175 Ga0070712_100205026 Ga0070712_1002050262 276
476 3300006178 Ga0075367_10003813 Ga0075367_100038131 276
477 3300006178 Ga0075367_10052558 Ga0075367_100525582 276
478 3300006237 Ga0097621_100000013 Ga0097621_100000013116 276
479 3300006237 Ga0097621_100001495 Ga0097621_1000014958 276
480 3300006237 Ga0097621_100038999 Ga0097621_1000389994 276
481 3300006353 Ga0075370_10036683 Ga0075370_100366833 276
482 3300006358 Ga0068871_100000064 Ga0068871_10000006435 276
483 3300006358 Ga0068871_100023154 Ga0068871_1000231546 276
484 3300006358 Ga0068871_100035623 Ga0068871_1000356233 276
485 3300006844 Ga0075428_100067278 Ga0075428_1000672782 276
486 3300006846 Ga0075430_100000646 Ga0075430_1000006467 276
487 3300006846 Ga0075430_100040915 Ga0075430_1000409152 276
488 3300006847 Ga0075431_100096301 Ga0075431_1000963012 276
489 3300006852 Ga0075433_10003920 Ga0075433_100039202 276
490 3300006852 Ga0075433_10209676 Ga0075433_102096762 276
491 3300006852 Ga0075433_10245366 Ga0075433_102453662 276
492 3300006871 Ga0075434_100000109 Ga0075434_1000001098 276
493 3300006871 Ga0075434_100043968 Ga0075434_1000439685 276
494 3300006871 Ga0075434_100068843 Ga0075434_1000688434 276
495 3300006871 Ga0075434_100095466 Ga0075434_1000954664 276
496 3300006880 Ga0075429_100041545 Ga0075429_1000415454 276
497 3300006881 Ga0068865_100000088 Ga0068865_10000008825 276
498 3300006881 Ga0068865_100010435 Ga0068865_1000104356 276
499 3300006881 Ga0068865_100097144 Ga0068865_1000971444 276
500 3300006881 Ga0068865_100337805 Ga0068865_1003378051 276
501 3300006914 Ga0075436_100162541 Ga0075436_1001625412 276
502 3300006914 Ga0075436_100206844 Ga0075436_1002068442 276
503 3300006931 Ga0097620_100000503 Ga0097620_10000050318 276
504 3300006931 Ga0097620_100039461 Ga0097620_1000394616 276
505 3300006931 Ga0097620_100040574 Ga0097620_1000405742 276
506 3300006931 Ga0097620_100611664 Ga0097620_1006116641 276
507 3300007076 Ga0075435_100072374 Ga0075435_1000723743 276
508 3300009011 Ga0105251_10010716 Ga0105251_100107164 276
509 3300009093 Ga0105240_10017252 Ga0105240_100172523 276
510 3300009094 Ga0111539_10000196 Ga0111539_100001962 276
511 3300009094 Ga0111539_10000376 Ga0111539_100003764 276
512 3300009094 Ga0111539_10001836 Ga0111539_100018365 276
513 3300009094 Ga0111539_10413268 Ga0111539_104132683 276
514 3300009098 Ga0105245_10001381 Ga0105245_1000138118 276
515 3300009098 Ga0105245_10150658 Ga0105245_101506582 276
516 3300009098 Ga0105245_10182194 Ga0105245_101821942 276
517 3300009101 Ga0105247_10010673 Ga0105247_100106737 276
518 3300009101 Ga0105247_10057028 Ga0105247_100570282 276
519 3300009147 Ga0114129_10029360 Ga0114129_100293608 276
520 3300009147 Ga0114129_10157162 Ga0114129_101571622 276
521 3300009147 Ga0114129_10179567 Ga0114129_101795672 276
522 3300009148 Ga0105243_10002817 Ga0105243_100028176 276
523 3300009148 Ga0105243_10200057 Ga0105243_102000572 276
524 3300009174 Ga0105241_10007352 Ga0105241_100073525 276
525 3300009174 Ga0105241_10007728 Ga0105241_100077286 276
526 3300009174 Ga0105241_10049693 Ga0105241_100496934 276
527 3300009176 Ga0105242_10009592 Ga0105242_100095924 276
528 3300009176 Ga0105242_10046720 Ga0105242_100467204 276
529 3300009177 Ga0105248_10001979 Ga0105248_1000197915 276
530 3300009177 Ga0105248_10048562 Ga0105248_100485623 276
531 3300009177 Ga0105248_10170960 Ga0105248_101709602 276
532 3300009177 Ga0105248_10261581 Ga0105248_102615812 276
533 3300009177 Ga0105248_10303982 Ga0105248_103039822 276
534 3300009545 Ga0105237_10014351 Ga0105237_100143516 276
535 3300009545 Ga0105237_10281731 Ga0105237_102817311 276
536 3300009545 Ga0105237_10366520 Ga0105237_103665202 276
537 3300009545 Ga0105237_10394327 Ga0105237_103943272 276
538 3300009545 Ga0105237_10559544 Ga0105237_105595442 276
539 3300009551 Ga0105238_10018663 Ga0105238_100186632 276
540 3300009551 Ga0105238_10078408 Ga0105238_100784084 276
541 3300009551 Ga0105238_10082426 Ga0105238_100824262 276
542 3300009551 Ga0105238_10731992 Ga0105238_107319921 276
543 3300009553 Ga0105249_10002341 Ga0105249_100023415 276
544 3300009553 Ga0105249_10002423 Ga0105249_100024236 276
545 3300009553 Ga0105249_10168013 Ga0105249_101680132 276
546 3300010375 Ga0105239_10009150 Ga0105239_100091506 276
547 3300010375 Ga0105239_10097931 Ga0105239_100979313 276
548 3300010375 Ga0105239_10173160 Ga0105239_101731602 276
549 3300011119 Ga0105246_10000016 Ga0105246_1000001628 276
550 3300011119 Ga0105246_10029004 Ga0105246_100290042 276
551 3300011119 Ga0105246_10059942 Ga0105246_100599423 276
552 3300011119 Ga0105246_10060818 Ga0105246_100608183 276
553 3300011119 Ga0105246_10243873 Ga0105246_102438732 276
554 3300012513 Ga0157326_1007973 Ga0157326_10079732 276
555 3300013102 Ga0157371_10073102 Ga0157371_100731023 276
556 3300013102 Ga0157371_10098120 Ga0157371_100981202 276
557 3300013250 Ga0171462_1045 Ga0171462_104534 276
558 3300013296 Ga0157374_10000092 Ga0157374_1000009232 276
559 3300013296 Ga0157374_10064745 Ga0157374_100647455 276
560 3300013296 Ga0157374_10163775 Ga0157374_101637753 276
561 3300013297 Ga0157378_10023667 Ga0157378_100236674 276
562 3300013297 Ga0157378_10094379 Ga0157378_100943792 276
563 3300013306 Ga0163162_10010092 Ga0163162_100100923 276
564 3300013306 Ga0163162_10014928 Ga0163162_100149286 276
565 3300013306 Ga0163162_10652125 Ga0163162_106521252 276
566 3300013307 Ga0157372_10019004 Ga0157372_100190046 276
567 3300013307 Ga0157372_10766573 Ga0157372_107665731 276
568 3300013308 Ga0157375_10000124 Ga0157375_100001246 276
569 3300013308 Ga0157375_10018849 Ga0157375_100188493 276
570 3300013308 Ga0157375_10343210 Ga0157375_103432101 276
571 3300014325 Ga0163163_10001343 Ga0163163_100013432 276
572 3300014325 Ga0163163_10016562 Ga0163163_100165624 276
573 3300014325 Ga0163163_10119365 Ga0163163_101193652 276
574 3300014325 Ga0163163_10213341 Ga0163163_102133413 276
575 3300014326 Ga0157380_10001027 Ga0157380_100010275 276
576 3300014326 Ga0157380_10291143 Ga0157380_102911432 276
577 3300014326 Ga0157380_10777937 Ga0157380_107779371 276
578 3300014745 Ga0157377_10000121 Ga0157377_1000012128 276
579 3300014968 Ga0157379_10000321 Ga0157379_1000032124 276
580 3300014968 Ga0157379_10030133 Ga0157379_100301332 276
581 3300014968 Ga0157379_10277886 Ga0157379_102778862 276
582 3300014969 Ga0157376_10000034 Ga0157376_1000003471 276
583 3300014969 Ga0157376_10205183 Ga0157376_102051833 276
584 3300017792 Ga0163161_10000801 Ga0163161_1000080114 276
585 3300017792 Ga0163161_10012127 Ga0163161_100121274 276
586 3300017792 Ga0163161_10299547 Ga0163161_102995471 276
587 3300024225 Ga0224572_1006700 Ga0224572_10067003 276
588 3300025271 Ga0207666_1000004 Ga0207666_100000417 276
589 3300025273 Ga0209673_1024132 Ga0209673_10241323 276
590 3300025284 Ga0209130_1000212 Ga0209130_100021264 276
591 3300025290 Ga0207673_1000537 Ga0207673_10005373 276
592 3300025291 Ga0209675_1012821 Ga0209675_10128212 276
593 3300025292 Ga0209676_1021497 Ga0209676_10214974 276
594 3300025294 Ga0209025_1000016 Ga0209025_1000016443 276
595 3300025294 Ga0209025_1001538 Ga0209025_100153836 276
596 3300025294 Ga0209025_1026823 Ga0209025_10268232 276
597 3300025294 Ga0209025_1028362 Ga0209025_10283622 276
598 3300025294 Ga0209025_1066093 Ga0209025_10660931 276
599 3300025295 Ga0209564_1000075 Ga0209564_100007551 276
600 3300025295 Ga0209564_1000076 Ga0209564_100007684 276
601 3300025299 Ga0209256_1000083 Ga0209256_100008384 276
602 3300025299 Ga0209256_1002896 Ga0209256_10028964 276
603 3300025302 Ga0207426_1006805 Ga0207426_10068054 276
604 3300025315 Ga0207697_10001888 Ga0207697_100018887 276
605 3300025315 Ga0207697_10016615 Ga0207697_100166153 276
606 3300025321 Ga0207656_10052113 Ga0207656_100521132 276
607 3300025885 Ga0207653_10016325 Ga0207653_100163252 276
608 3300025893 Ga0207682_10000016 Ga0207682_1000001617 276
609 3300025893 Ga0207682_10001712 Ga0207682_100017125 276
610 3300025898 Ga0207692_10025783 Ga0207692_100257834 276
611 3300025899 Ga0207642_10000454 Ga0207642_100004547 276
612 3300025900 Ga0207710_10000475 Ga0207710_100004752 276
613 3300025900 Ga0207710_10006786 Ga0207710_100067862 276
614 3300025901 Ga0207688_10000038 Ga0207688_1000003828 276
615 3300025903 Ga0207680_10026076 Ga0207680_100260763 276
616 3300025903 Ga0207680_10098159 Ga0207680_100981593 276
617 3300025903 Ga0207680_10426422 Ga0207680_104264221 276
618 3300025904 Ga0207647_10012357 Ga0207647_100123572 276
619 3300025904 Ga0207647_10128683 Ga0207647_101286832 276
620 3300025905 Ga0207685_10006686 Ga0207685_100066864 276
621 3300025906 Ga0207699_10001265 Ga0207699_100012657 276
622 3300025906 Ga0207699_10016301 Ga0207699_100163014 276
623 3300025907 Ga0207645_10000138 Ga0207645_100001387 276
624 3300025907 Ga0207645_10015193 Ga0207645_100151935 276
625 3300025907 Ga0207645_10063855 Ga0207645_100638552 276
626 3300025908 Ga0207643_10000075 Ga0207643_1000007556 276
627 3300025911 Ga0207654_10000985 Ga0207654_1000098511 276
628 3300025912 Ga0207707_10000809 Ga0207707_100008092 276
629 3300025912 Ga0207707_10047322 Ga0207707_100473224 276
630 3300025912 Ga0207707_10211104 Ga0207707_102111043 276
631 3300025912 Ga0207707_10241502 Ga0207707_102415021 276
632 3300025913 Ga0207695_10069458 Ga0207695_100694583 276
633 3300025914 Ga0207671_10004109 Ga0207671_1000410912 276
634 3300025914 Ga0207671_10254704 Ga0207671_102547042 276
635 3300025915 Ga0207693_10012124 Ga0207693_100121247 276
636 3300025915 Ga0207693_10026173 Ga0207693_100261735 276
637 3300025915 Ga0207693_10036273 Ga0207693_100362733 276
638 3300025916 Ga0207663_10035307 Ga0207663_100353072 276
639 3300025916 Ga0207663_10177367 Ga0207663_101773672 276
640 3300025916 Ga0207663_10199742 Ga0207663_101997422 276
641 3300025917 Ga0207660_10000023 Ga0207660_1000002329 276
642 3300025917 Ga0207660_10040536 Ga0207660_100405362 276
643 3300025917 Ga0207660_10132052 Ga0207660_101320522 276
644 3300025917 Ga0207660_10300450 Ga0207660_103004502 276
645 3300025918 Ga0207662_10001542 Ga0207662_100015426 276
646 3300025919 Ga0207657_10007478 Ga0207657_100074787 276
647 3300025919 Ga0207657_10088330 Ga0207657_100883303 276
648 3300025919 Ga0207657_10104542 Ga0207657_101045423 276
649 3300025919 Ga0207657_10309910 Ga0207657_103099101 276
650 3300025920 Ga0207649_10000122 Ga0207649_1000012219 276
651 3300025920 Ga0207649_10388455 Ga0207649_103884551 276
652 3300025921 Ga0207652_10001146 Ga0207652_1000114618 276
653 3300025921 Ga0207652_10145121 Ga0207652_101451212 276
654 3300025921 Ga0207652_10396905 Ga0207652_103969052 276
655 3300025921 Ga0207652_10412109 Ga0207652_104121092 276
656 3300025923 Ga0207681_10000240 Ga0207681_1000024039 276
657 3300025923 Ga0207681_10043511 Ga0207681_100435114 276
658 3300025923 Ga0207681_10216487 Ga0207681_102164872 276
659 3300025923 Ga0207681_10224220 Ga0207681_102242202 276
660 3300025924 Ga0207694_10020818 Ga0207694_100208182 276
661 3300025924 Ga0207694_10078340 Ga0207694_100783402 276
662 3300025925 Ga0207650_10005524 Ga0207650_100055246 276
663 3300025925 Ga0207650_10124270 Ga0207650_101242701 276
664 3300025925 Ga0207650_10161700 Ga0207650_101617002 276
665 3300025925 Ga0207650_10450762 Ga0207650_104507621 276
666 3300025926 Ga0207659_10000017 Ga0207659_1000001769 276
667 3300025926 Ga0207659_10071667 Ga0207659_100716672 276
668 3300025927 Ga0207687_10000077 Ga0207687_1000007727 276
669 3300025927 Ga0207687_10017126 Ga0207687_100171264 276
670 3300025927 Ga0207687_10100894 Ga0207687_101008943 276
671 3300025927 Ga0207687_10354477 Ga0207687_103544771 276
672 3300025928 Ga0207700_10004665 Ga0207700_100046658 276
673 3300025928 Ga0207700_10106898 Ga0207700_101068981 276
674 3300025929 Ga0207664_10095566 Ga0207664_100955662 276
675 3300025931 Ga0207644_10001298 Ga0207644_1000129810 276
676 3300025931 Ga0207644_10004246 Ga0207644_100042463 276
677 3300025931 Ga0207644_10009440 Ga0207644_100094405 276
678 3300025931 Ga0207644_10102780 Ga0207644_101027802 276
679 3300025931 Ga0207644_10113593 Ga0207644_101135931 276
680 3300025931 Ga0207644_10200522 Ga0207644_102005222 276
681 3300025932 Ga0207690_10003164 Ga0207690_100031645 276
682 3300025933 Ga0207706_10004420 Ga0207706_100044206 276
683 3300025933 Ga0207706_10021501 Ga0207706_100215012 276
684 3300025933 Ga0207706_10047907 Ga0207706_100479074 276
685 3300025933 Ga0207706_10165096 Ga0207706_101650962 276
686 3300025933 Ga0207706_10202177 Ga0207706_102021773 276
687 3300025934 Ga0207686_10000294 Ga0207686_1000029415 276
688 3300025934 Ga0207686_10021024 Ga0207686_100210242 276
689 3300025934 Ga0207686_10100217 Ga0207686_101002172 276
690 3300025935 Ga0207709_10000126 Ga0207709_1000012614 276
691 3300025936 Ga0207670_10000086 Ga0207670_100000866 276
692 3300025936 Ga0207670_10010357 Ga0207670_100103572 276
693 3300025936 Ga0207670_10022750 Ga0207670_100227501 276
694 3300025936 Ga0207670_10073621 Ga0207670_100736212 276
695 3300025936 Ga0207670_10102713 Ga0207670_101027132 276
696 3300025937 Ga0207669_10000188 Ga0207669_1000018815 276
697 3300025937 Ga0207669_10022673 Ga0207669_100226734 276
698 3300025937 Ga0207669_10090912 Ga0207669_100909123 276
699 3300025937 Ga0207669_10255555 Ga0207669_102555551 276
700 3300025938 Ga0207704_10002897 Ga0207704_100028976 276
701 3300025938 Ga0207704_10024840 Ga0207704_100248404 276
702 3300025939 Ga0207665_10001963 Ga0207665_1000196312 276
703 3300025939 Ga0207665_10378181 Ga0207665_103781812 276
704 3300025940 Ga0207691_10000526 Ga0207691_100005267 276
705 3300025940 Ga0207691_10147463 Ga0207691_101474632 276
706 3300025940 Ga0207691_10513282 Ga0207691_105132822 276
707 3300025941 Ga0207711_10007634 Ga0207711_100076348 276
708 3300025941 Ga0207711_10018226 Ga0207711_100182264 276
709 3300025941 Ga0207711_10094081 Ga0207711_100940814 276
710 3300025941 Ga0207711_10297674 Ga0207711_102976742 276
711 3300025941 Ga0207711_10490964 Ga0207711_104909641 276
712 3300025942 Ga0207689_10000140 Ga0207689_1000014033 276
713 3300025942 Ga0207689_10025320 Ga0207689_100253204 276
714 3300025942 Ga0207689_10157363 Ga0207689_101573633 276
715 3300025944 Ga0207661_10000074 Ga0207661_1000007413 276
716 3300025944 Ga0207661_10157080 Ga0207661_101570802 276
717 3300025945 Ga0207679_10000031 Ga0207679_10000031110 276
718 3300025945 Ga0207679_10287255 Ga0207679_102872552 276
719 3300025949 Ga0207667_10033121 Ga0207667_100331212 276
720 3300025960 Ga0207651_10001805 Ga0207651_100018058 276
721 3300025960 Ga0207651_10054533 Ga0207651_100545332 276
722 3300025961 Ga0207712_10000279 Ga0207712_100002796 276
723 3300025961 Ga0207712_10004811 Ga0207712_100048114 276
724 3300025972 Ga0207668_10613158 Ga0207668_106131581 276
725 3300025981 Ga0207640_10000105 Ga0207640_1000010515 276
726 3300025981 Ga0207640_10000216 Ga0207640_1000021615 276
727 3300025986 Ga0207658_10001907 Ga0207658_1000190710 276
728 3300025986 Ga0207658_10042886 Ga0207658_100428864 276
729 3300025986 Ga0207658_10110243 Ga0207658_101102431 276
730 3300025986 Ga0207658_10281385 Ga0207658_102813851 276
731 3300025986 Ga0207658_10400945 Ga0207658_104009451 276
732 3300026023 Ga0207677_10007306 Ga0207677_100073064 276
733 3300026023 Ga0207677_10023683 Ga0207677_100236835 276
734 3300026023 Ga0207677_10573746 Ga0207677_105737461 276
735 3300026035 Ga0207703_10000418 Ga0207703_1000041825 276
736 3300026035 Ga0207703_10152080 Ga0207703_101520802 276
737 3300026035 Ga0207703_10343520 Ga0207703_103435201 276
738 3300026041 Ga0207639_10000599 Ga0207639_100005992 276
739 3300026041 Ga0207639_10121380 Ga0207639_101213804 276
740 3300026041 Ga0207639_10228155 Ga0207639_102281552 276
741 3300026067 Ga0207678_10003953 Ga0207678_1000395311 276
742 3300026067 Ga0207678_10022090 Ga0207678_100220906 276
743 3300026075 Ga0207708_10010311 Ga0207708_100103116 276
744 3300026075 Ga0207708_10449315 Ga0207708_104493152 276
745 3300026078 Ga0207702_10000753 Ga0207702_1000075319 276
746 3300026078 Ga0207702_10146394 Ga0207702_101463943 276
747 3300026088 Ga0207641_10001634 Ga0207641_100016349 276
748 3300026088 Ga0207641_10019340 Ga0207641_100193404 276
749 3300026089 Ga0207648_10006918 Ga0207648_100069187 276
750 3300026089 Ga0207648_10053413 Ga0207648_100534134 276
751 3300026089 Ga0207648_10106853 Ga0207648_101068532 276
752 3300026095 Ga0207676_10000133 Ga0207676_1000013343 276
753 3300026095 Ga0207676_10087401 Ga0207676_100874012 276
754 3300026095 Ga0207676_10089435 Ga0207676_100894352 276
755 3300026116 Ga0207674_10001514 Ga0207674_100015146 276
756 3300026116 Ga0207674_10030742 Ga0207674_100307426 276
757 3300026118 Ga0207675_100000570 Ga0207675_10000057025 276
758 3300026118 Ga0207675_100185284 Ga0207675_1001852842 276
759 3300026121 Ga0207683_10000004 Ga0207683_1000000496 276
760 3300026121 Ga0207683_10011279 Ga0207683_100112792 276
761 3300026121 Ga0207683_10020739 Ga0207683_100207396 276
762 3300026121 Ga0207683_10043398 Ga0207683_100433984 276
763 3300026121 Ga0207683_10505246 Ga0207683_105052462 276
764 3300026142 Ga0207698_10007207 Ga0207698_100072073 276
765 3300026142 Ga0207698_10304142 Ga0207698_103041422 276
766 3300027617 Ga0210002_1000183 Ga0210002_10001836 276
767 3300027682 Ga0209971_1003472 Ga0209971_10034724 276
768 3300027695 Ga0209966_1001288 Ga0209966_10012882 276
769 3300027695 Ga0209966_1030379 Ga0209966_10303791 276
770 3300027717 Ga0209998_10001130 Ga0209998_100011306 276
771 3300027717 Ga0209998_10001412 Ga0209998_100014124 276
772 3300027717 Ga0209998_10002862 Ga0209998_100028624 276
773 3300027866 Ga0209813_10015791 Ga0209813_100157912 276
774 3300027876 Ga0209974_10002488 Ga0209974_100024882 276
775 3300027876 Ga0209974_10038892 Ga0209974_100388922 276
776 3300027907 Ga0207428_10000218 Ga0207428_1000021827 276
777 3300027907 Ga0207428_10000250 Ga0207428_100002502 276
778 3300027907 Ga0207428_10000777 Ga0207428_100007774 276
779 3300028023 Ga0265357_1003621 Ga0265357_10036212 276
780 3300028379 Ga0268266_10013746 Ga0268266_100137467 276
781 3300028379 Ga0268266_10037440 Ga0268266_100374404 276
782 3300028380 Ga0268265_10000194 Ga0268265_1000019435 276
783 3300028380 Ga0268265_10063302 Ga0268265_100633021 276
784 3300028380 Ga0268265_10121161 Ga0268265_101211613 276
785 3300028381 Ga0268264_10000393 Ga0268264_1000039328 276
786 3300028381 Ga0268264_10206938 Ga0268264_102069382 276
787 3300028381 Ga0268264_10375726 Ga0268264_103757262 276
788 3300028556 Ga0265337_1003879 Ga0265337_10038797 276
789 3300028800 Ga0265338_10269461 Ga0265338_102694612 276
790 3300031241 Ga0265325_10000039 Ga0265325_1000003979 276
791 3300031241 Ga0265325_10006452 Ga0265325_100064523 276
792 3300031241 Ga0265325_10089525 Ga0265325_100895252 276
793 3300031249 Ga0265339_10011771 Ga0265339_100117715 276
794 3300031344 Ga0265316_10060342 Ga0265316_100603422 276
795 3300031344 Ga0265316_10106018 Ga0265316_101060182 276
796 3300031344 Ga0265316_10119851 Ga0265316_101198512 276
797 3300031595 Ga0265313_10001341 Ga0265313_100013414 276
798 3300031595 Ga0265313_10001740 Ga0265313_100017408 276
799 3300031711 Ga0265314_10003150 Ga0265314_1000315016 276
800 3300031711 Ga0265314_10024673 Ga0265314_100246734 276
801 3300031712 Ga0265342_10010642 Ga0265342_100106426 276
802 3300031731 Ga0307405_10008563 Ga0307405_100085635 276
803 3300031995 Ga0307409_100381988 Ga0307409_1003819882 276
804 3300032002 Ga0307416_100216204 Ga0307416_1002162042 276
805 3300034816 Ga0373930_0001167 Ga0373930_0001167_1851_2681 276
806 3300034816 Ga0373930_0015641 Ga0373930_0015641_68_898 276
807 3300034817 Ga0373948_0000190 Ga0373948_0000190_1649_2479 276
808 3300034817 Ga0373948_0007388 Ga0373948_0007388_691_1521 276
809 3300034818 Ga0373950_0000342 Ga0373950_0000342_3133_3963 276
810 3300034818 Ga0373950_0003250 Ga0373950_0003250_1352_2185 276
811 3300034819 Ga0373958_0000055 Ga0373958_0000055_5488_6318 276
812 3300034819 Ga0373958_0002208 Ga0373958_0002208_1100_1933 276
813 3300034820 Ga0373959_0005211 Ga0373959_0005211_214_1044 276
814 3300034957 Ga0373938_0003013 Ga0373938_0003013_963_1793 276
815 3300034957 Ga0373938_0004580 Ga0373938_0004580_1010_1840 276
816 3300034957 Ga0373938_0027998 Ga0373938_0027998_157_990 276
817 3300035083 Ga0373926_0049144 Ga0373926_0049144_498_1421 276
818 3300035084 Ga0373928_0000361 Ga0373928_0000361_2637_3467 276
819 3300035084 Ga0373928_0003934 Ga0373928_0003934_1134_1967 276
820 3300035084 Ga0373928_0037247 Ga0373928_0037247_82_915 276
821 3300035085 Ga0373929_0000927 Ga0373929_0000927_1239_2069 276
822 3300035085 Ga0373929_0005221 Ga0373929_0005221_1172_2002 276
823 3300035088 Ga0373940_0000594 Ga0373940_0000594_3502_4332 276
824 3300035088 Ga0373940_0019435 Ga0373940_0019435_638_1468 276
825 3300035088 Ga0373940_0027313 Ga0373940_0027313_306_1136 276
826 3300035089 Ga0373944_0026503 Ga0373944_0026503_330_1163 276
827 3300035090 Ga0373949_0000308 Ga0373949_0000308_12563_13393 276
828 3300035090 Ga0373949_0001125 Ga0373949_0001125_5176_6006 276
829 3300035090 Ga0373949_0003075 Ga0373949_0003075_2168_3001 276
830 3300035091 Ga0373951_0000393 Ga0373951_0000393_5745_6575 276
831 3300035091 Ga0373951_0005644 Ga0373951_0005644_34_867 276
832 3300035092 Ga0373952_0000208 Ga0373952_0000208_7252_8082 276
833 3300035092 Ga0373952_0003614 Ga0373952_0003614_1502_2332 276
834 3300035111 Ga0373923_0040203 Ga0373923_0040203_559_1392 276
835 3300035111 Ga0373923_0067162 Ga0373923_0067162_545_1375 276
836 3300035112 Ga0373932_0000031 Ga0373932_0000031_17485_18315 276
837 3300035112 Ga0373932_0001291 Ga0373932_0001291_1105_1935 276
838 3300035112 Ga0373932_0002778 Ga0373932_0002778_1650_2483 276
839 3300035113 Ga0373936_0041267 Ga0373936_0041267_598_1431 276
840 3300035114 Ga0373939_0000083 Ga0373939_0000083_6747_7577 276
841 3300035114 Ga0373939_0002536 Ga0373939_0002536_2017_2847 276
842 3300035114 Ga0373939_0006676 Ga0373939_0006676_537_1367 276
843 3300035115 Ga0373941_0000540 Ga0373941_0000540_5094_5924 276
844 3300035115 Ga0373941_0003276 Ga0373941_0003276_130_960 276
845 3300035115 Ga0373941_0006891 Ga0373941_0006891_1392_2225 276
846 3300035117 Ga0373953_0087433 Ga0373953_0087433_383_1213 276
847 3300035118 Ga0373954_0002212 Ga0373954_0002212_5562_6392 276
848 3300035118 Ga0373954_0017610 Ga0373954_0017610_292_1215 276
849 3300035120 Ga0373957_0004504 Ga0373957_0004504_2865_3695 276
850 3300035120 Ga0373957_0051454 Ga0373957_0051454_179_1009 276
851 3300035121 Ga0373960_0000088 Ga0373960_0000088_11505_12335 276
852 3300035121 Ga0373960_0016046 Ga0373960_0016046_216_1046 276
853 3300035121 Ga0373960_0020821 Ga0373960_0020821_211_1044 276
854 3300035170 Ga0373943_0036171 Ga0373943_0036171_1358_2188 276
855 3300035170 Ga0373943_0169942 Ga0373943_0169942_232_1158 276
856 3300035171 Ga0373946_0015402 Ga0373946_0015402_1906_2829 276
857 3300035171 Ga0373946_0017067 Ga0373946_0017067_1410_2240 276
858 3300035171 Ga0373946_0181357 Ga0373946_0181357_101_931 276
859 3300035172 Ga0373955_0005908 Ga0373955_0005908_1159_1989 276
860 3300035172 Ga0373955_0229157 Ga0373955_0229157_208_1038 276
861 3300035207 Ga0373942_0001977 Ga0373942_0001977_409_1239 276
862 3300035207 Ga0373942_0005072 Ga0373942_0005072_592_1422 276
863 3300035207 Ga0373942_0015853 Ga0373942_0015853_130_960 276
864 3300035241 Ga0373961_0000539 Ga0373961_0000539_6955_7785 276
865 3300035241 Ga0373961_0021041 Ga0373961_0021041_608_1438 276
866 3300035242 Ga0373962_0000715 Ga0373962_0000715_958_1788 276
867 3300035242 Ga0373962_0001826 Ga0373962_0001826_2253_3083 276
868 3300035410 Ga0373924_0060690 Ga0373924_0060690_421_1254 276
869 3300035691 Ga0373931_0000034 Ga0373931_0000034_60738_61568 276
870 3300035691 Ga0373931_0001752 Ga0373931_0001752_2805_3635 276
871 3300035691 Ga0373931_0002007 Ga0373931_0002007_6038_6871 276
872 3300035691 Ga0373931_0029793 Ga0373931_0029793_1803_2636 276
873 3300035692 Ga0373935_0036652 Ga0373935_0036652_802_1725 276
874 3300035695 Ga0373927_0027484 Ga0373927_0027484_446_1279 276
875 3300035695 Ga0373927_0062736 Ga0373927_0062736_999_1829 276
876 3300035695 Ga0373927_0090003 Ga0373927_0090003_1049_1879 276
877 3300035724 Ga0373933_0005149 Ga0373933_0005149_76_906 276
878 3300035724 Ga0373933_0014886 Ga0373933_0014886_1869_2699 276
879 3300035724 Ga0373933_0123954 Ga0373933_0123954_453_1283 276
880 3300035725 Ga0373947_0022290 Ga0373947_0022290_2235_3068 276
881 3300035725 Ga0373947_0022926 Ga0373947_0022926_1888_2721 276
882 3300036401 Ga0373937_0218789 Ga0373937_0218789_239_1162 276
883 3300036401 Ga0373937_0283598 Ga0373937_0283598_641_1471 276
884 3300037068 Ga0373925_0008801 Ga0373925_0008801_2381_3214 276
885 3300037068 Ga0373925_0085861 Ga0373925_0085861_600_1523 276
886 3300037068 Ga0373925_0183584 Ga0373925_0183584_592_1422 276
887 3300037068 Ga0373925_0318438 Ga0373925_0318438_183_1013 276
888 3300039437 Ga0436365_1671729 Ga0436365_1671729_1164_1994 276
889 3300042001 Ga0439441_010949 Ga0439441_010949_309_1139 276
890 3300042461 Ga0439460_0028728 Ga0439460_0028728_189_1019 276
891 3300045051 Ga0451576_0012930 Ga0451576_0012930_7398_8228 276
892 3300046452 Ga0495617_009118 Ga0495617_009118_1243_2166 276
893 3300046454 Ga0495592_0003774 Ga0495592_0003774_4742_5572 276
894 3300046454 Ga0495592_0009503 Ga0495592_0009503_1508_2338 276
895 3300046455 Ga0495603_0164686 Ga0495603_0164686_83_913 276
896 3300046459 Ga0495629_0000690 Ga0495629_0000690_5720_6553 276
897 3300046459 Ga0495629_0004882 Ga0495629_0004882_6556_7479 276
898 3300046459 Ga0495629_0041679 Ga0495629_0041679_1278_2108 276
899 3300046461 Ga0495641_0059768 Ga0495641_0059768_872_1705 276
900 3300046462 Ga0495651_0014052 Ga0495651_0014052_3780_4610 276
901 3300046462 Ga0495651_0018759 Ga0495651_0018759_2249_3172 276
902 3300046463 Ga0495653_0004104 Ga0495653_0004104_2611_3441 276
903 3300046463 Ga0495653_0011137 Ga0495653_0011137_1756_2589 276
904 3300046463 Ga0495653_0108867 Ga0495653_0108867_713_1543 276
905 3300046472 Ga0495580_0016533 Ga0495580_0016533_1412_2245 276
906 3300046473 Ga0495582_0027132 Ga0495582_0027132_1295_2128 276
907 3300046473 Ga0495582_0046935 Ga0495582_0046935_1501_2334 276
908 3300046474 Ga0495605_0022132 Ga0495605_0022132_514_1344 276
909 3300046475 Ga0495639_0029813 Ga0495639_0029813_318_1241 276
910 3300046475 Ga0495639_0041470 Ga0495639_0041470_1015_1845 276
911 3300046477 Ga0495664_0000935 Ga0495664_0000935_13234_14064 276
912 3300046477 Ga0495664_0032161 Ga0495664_0032161_1619_2452 276
913 3300046491 Ga0495584_0028985 Ga0495584_0028985_949_1872 276
914 3300046492 Ga0495585_0001893 Ga0495585_0001893_6740_7663 276
915 3300046499 Ga0495594_0081117 Ga0495594_0081117_26_952 276
916 3300046501 Ga0495607_0019327 Ga0495607_0019327_2722_3555 276
917 3300046511 Ga0495608_0014494 Ga0495608_0014494_4239_5069 276
918 3300046511 Ga0495608_0017107 Ga0495608_0017107_3115_4038 276
919 3300046512 Ga0495610_0022484 Ga0495610_0022484_284_1117 276
920 3300046514 Ga0495618_0003011 Ga0495618_0003011_7428_8258 276
921 3300046514 Ga0495618_0005170 Ga0495618_0005170_4384_5307 276
922 3300046516 Ga0495628_0005583 Ga0495628_0005583_5435_6265 276
923 3300046517 Ga0495630_0008623 Ga0495630_0008623_6467_7300 276
924 3300046517 Ga0495630_0135201 Ga0495630_0135201_556_1386 276
925 3300046522 Ga0495643_0129308 Ga0495643_0129308_375_1208 276
926 3300046523 Ga0495644_0000609 Ga0495644_0000609_1890_2723 276
927 3300046529 Ga0495652_0020631 Ga0495652_0020631_529_1452 276
928 3300046529 Ga0495652_0201207 Ga0495652_0201207_267_1097 276
929 3300046531 Ga0495665_0089355 Ga0495665_0089355_534_1457 276
930 3300046533 Ga0495640_0019188 Ga0495640_0019188_1069_1899 276
931 3300046535 Ga0495586_0031215 Ga0495586_0031215_1263_2093 276
932 3300046536 Ga0495587_0001842 Ga0495587_0001842_6964_7794 276
933 3300046536 Ga0495587_0040716 Ga0495587_0040716_321_1154 276
934 3300046538 Ga0495609_0114552 Ga0495609_0114552_36_866 276
935 3300046543 Ga0495645_0008466 Ga0495645_0008466_4332_5162 276
936 3300046557 Ga0495622_0013890 Ga0495622_0013890_358_1281 276
937 3300046559 Ga0495667_0000946 Ga0495667_0000946_13375_14205 276
938 3300046559 Ga0495667_0020778 Ga0495667_0020778_1795_2625 276
939 3300046615 Ga0495656_0000135 Ga0495656_0000135_23637_24560 276
940 3300046642 Ga0495634_0007276 Ga0495634_0007276_7170_8000 276
941 3300046642 Ga0495634_0007973 Ga0495634_0007973_227_1150 276
942 3300046648 Ga0495611_0089413 Ga0495611_0089413_338_1261 276
943 3300046663 Ga0495635_0002226 Ga0495635_0002226_8069_8992 276
944 3300046663 Ga0495635_0010100 Ga0495635_0010100_1533_2363 276
945 3300046664 Ga0495659_0001106 Ga0495659_0001106_6966_7889 276
946 3300046665 Ga0495661_0057261 Ga0495661_0057261_406_1329 276
947 3300046674 Ga0495588_0024336 Ga0495588_0024336_605_1528 276
948 3300046675 Ga0495657_0009702 Ga0495657_0009702_5924_6754 276
949 3300046678 Ga0495599_0014755 Ga0495599_0014755_3157_3987 276
950 3300046678 Ga0495599_0082279 Ga0495599_0082279_556_1479 276
951 3300046678 Ga0495599_0118069 Ga0495599_0118069_206_1036 276
952 3300046680 Ga0495646_0000846 Ga0495646_0000846_13842_14672 276
953 3300046681 Ga0495647_0017444 Ga0495647_0017444_1690_2523 276
954 3300046683 Ga0495658_0003137 Ga0495658_0003137_1952_2785 276
955 3300046683 Ga0495658_0007569 Ga0495658_0007569_4532_5365 276
956 3300046684 Ga0495669_0026128 Ga0495669_0026128_1215_2045 276
957 3300046689 Ga0495613_0061433 Ga0495613_0061433_1901_2734 276
958 3300046689 Ga0495613_0077855 Ga0495613_0077855_916_1746 276
959 3300046690 Ga0495624_0009424 Ga0495624_0009424_1460_2293 276
960 3300046690 Ga0495624_0095007 Ga0495624_0095007_513_1343 276
961 3300046691 Ga0495670_0000427 Ga0495670_0000427_2437_3270 276
962 3300046691 Ga0495670_0137512 Ga0495670_0137512_67_900 276
963 3300046809 Ga0495600_0000371 Ga0495600_0000371_15223_16056 276
964 3300046809 Ga0495600_0002986 Ga0495600_0002986_456_1286 276
965 3300047315 Ga0495581_0073208 Ga0495581_0073208_622_1455 276
966 3300047317 Ga0495604_0008735 Ga0495604_0008735_4826_5656 276
967 3300047317 Ga0495604_0018786 Ga0495604_0018786_2093_3016 276
968 3300047319 Ga0495674_0009124 Ga0495674_0009124_685_1515 276
969 3300047319 Ga0495674_0079445 Ga0495674_0079445_1287_2117 276
970 3300047320 Ga0495672_0122671 Ga0495672_0122671_208_1041 276
971 3300047321 Ga0495676_0041026 Ga0495676_0041026_1522_2355 276
972 3300047322 Ga0495680_0002891 Ga0495680_0002891_16409_17242 276
973 3300047322 Ga0495680_0004911 Ga0495680_0004911_7154_7984 276
974 3300047322 Ga0495680_0052511 Ga0495680_0052511_155_985 276
975 3300047444 Ga0495675_0003232 Ga0495675_0003232_5999_6829 276
976 3300047447 Ga0495685_011033 Ga0495685_011033_1124_1954 276
977 3300047471 Ga0495684_0001459 Ga0495684_0001459_13551_14474 276
978 3300047471 Ga0495684_0097058 Ga0495684_0097058_597_1427 276
979 3300047471 Ga0495684_0166725 Ga0495684_0166725_510_1340 276
980 3300047673 Ga0495593_0005084 Ga0495593_0005084_2700_3533 276
981 3300047673 Ga0495593_0017427 Ga0495593_0017427_1115_1948 276
982 3300047673 Ga0495593_0045359 Ga0495593_0045359_1271_2101 276
983 3300048088 Ga0495602_0059119 Ga0495602_0059119_2476_3306 276
984 3300048089 Ga0495614_0013485 Ga0495614_0013485_1713_2636 276
985 3300048903 Ga0496100_0000050 Ga0496100_0000050_35936_36766 276
986 3300048903 Ga0496100_0077112 Ga0496100_0077112_1321_2151 276
987 3300048904 Ga0496101_0000121 Ga0496101_0000121_23491_24321 276
988 3300048904 Ga0496101_0000736 Ga0496101_0000736_13209_14039 276
989 3300048905 Ga0496102_0003252 Ga0496102_0003252_10821_11651 276
990 3300048905 Ga0496102_0085354 Ga0496102_0085354_592_1422 276
991 3300048905 Ga0496102_0088060 Ga0496102_0088060_386_1219 276
992 3300048905 Ga0496102_0117195 Ga0496102_0117195_534_1364 276
993 3300048905 Ga0496102_0327404 Ga0496102_0327404_254_1084 276
994 3300048905 Ga0496102_0409953 Ga0496102_0409953_32_862 276
995 3300048905 Ga0496102_0466921 Ga0496102_0466921_254_1087 276
996 3300048906 Ga0496103_0000175 Ga0496103_0000175_27619_28449 276
997 3300048906 Ga0496103_0115582 Ga0496103_0115582_478_1311 276
998 3300048907 Ga0496104_0000454 Ga0496104_0000454_28144_28974 276
999 3300048907 Ga0496104_0107071 Ga0496104_0107071_619_1449 276
1000 3300048907 Ga0496104_0128575 Ga0496104_0128575_305_1135 276
1001 3300048907 Ga0496104_0143317 Ga0496104_0143317_63_893 276
1002 3300048908 Ga0496105_0027592 Ga0496105_0027592_2148_2978 276
1003 3300048908 Ga0496105_0072615 Ga0496105_0072615_921_1751 276
1004 3300048908 Ga0496105_0121105 Ga0496105_0121105_475_1308 276
1005 3300048909 Ga0496106_0000133 Ga0496106_0000133_48743_49573 276
1006 3300048909 Ga0496106_0014768 Ga0496106_0014768_4447_5277 276
1007 3300048909 Ga0496106_0024517 Ga0496106_0024517_1276_2106 276
1008 3300048909 Ga0496106_0025595 Ga0496106_0025595_1399_2232 276
1009 3300048910 Ga0496107_0000237 Ga0496107_0000237_609_1439 276
1010 3300048910 Ga0496107_0018351 Ga0496107_0018351_1279_2109 276
1011 3300048910 Ga0496107_0046462 Ga0496107_0046462_411_1241 276
1012 3300048910 Ga0496107_0106139 Ga0496107_0106139_879_1712 276
1013 3300048911 Ga0496108_0017335 Ga0496108_0017335_575_1405 276
1014 3300048911 Ga0496108_0036931 Ga0496108_0036931_2532_3362 276
1015 3300048911 Ga0496108_0124282 Ga0496108_0124282_32_865 276
1016 3300048911 Ga0496108_0164751 Ga0496108_0164751_850_1683 276
1017 3300048912 Ga0496109_0007388 Ga0496109_0007388_7301_8131 276
1018 3300048912 Ga0496109_0026973 Ga0496109_0026973_4260_5090 276
1019 3300048912 Ga0496109_0431687 Ga0496109_0431687_62_892 276
1020 3300048913 Ga0496110_0009875 Ga0496110_0009875_3960_4790 276
1021 3300048913 Ga0496110_0103921 Ga0496110_0103921_82_915 276
1022 3300048914 Ga0496111_0066222 Ga0496111_0066222_234_1064 276
1023 3300048914 Ga0496111_0160042 Ga0496111_0160042_431_1261 276
1024 3300048915 Ga0496112_0229477 Ga0496112_0229477_884_1714 276
1025 3300048915 Ga0496112_0247188 Ga0496112_0247188_320_1150 276
1026 3300048916 Ga0496113_0190121 Ga0496113_0190121_351_1184 276
1027 3300048916 Ga0496113_0227683 Ga0496113_0227683_38_868 276
1028 3300048916 Ga0496113_0265922 Ga0496113_0265922_255_1085 276
1029 3300048917 Ga0496114_0002721 Ga0496114_0002721_399_1229 276
1030 3300048917 Ga0496114_0012692 Ga0496114_0012692_1516_2346 276
1031 3300048917 Ga0496114_0032154 Ga0496114_0032154_1998_2831 276
1032 3300048918 Ga0496115_0066203 Ga0496115_0066203_63_893 276
1033 3300048918 Ga0496115_0081829 Ga0496115_0081829_613_1443 276
1034 3300048918 Ga0496115_0084764 Ga0496115_0084764_1714_2547 276
1035 3300048918 Ga0496115_0129112 Ga0496115_0129112_209_1039 276
1036 3300048918 Ga0496115_0212058 Ga0496115_0212058_469_1299 276
1037 3300048920 Ga0496117_0036056 Ga0496117_0036056_1120_1953 276
1038 3300048920 Ga0496117_0052793 Ga0496117_0052793_556_1389 276
1039 3300048921 Ga0496118_0134551 Ga0496118_0134551_117_950 276
1040 3300048922 Ga0496119_0188403 Ga0496119_0188403_11_844 276
1041 3300048925 Ga0496122_0022949 Ga0496122_0022949_1072_1905 276
1042 3300048925 Ga0496122_0081079 Ga0496122_0081079_1264_2097 276
1043 3300049568 Ga0501031_0086553 Ga0501031_0086553_419_1249 276
1044 3300049569 Ga0501032_0090434 Ga0501032_0090434_756_1586 276
1045 3300049569 Ga0501032_0126405 Ga0501032_0126405_687_1517 276
1046 3300049569 Ga0501032_0150846 Ga0501032_0150846_90_920 276
1047 3300049569 Ga0501032_0194621 Ga0501032_0194621_272_1102 276
1048 3300049570 Ga0501033_0014695 Ga0501033_0014695_4709_5539 276
1049 3300049570 Ga0501033_0022119 Ga0501033_0022119_3929_4759 276
1050 3300049570 Ga0501033_0054068 Ga0501033_0054068_815_1645 276
1051 3300049571 Ga0501034_0042726 Ga0501034_0042726_2890_3720 276
1052 3300049571 Ga0501034_0060549 Ga0501034_0060549_2229_3059 276
1053 3300049571 Ga0501034_0151914 Ga0501034_0151914_645_1478 276
1054 3300049571 Ga0501034_0167393 Ga0501034_0167393_921_1751 276
1055 3300049571 Ga0501034_0264152 Ga0501034_0264152_705_1535 276
1056 3300049571 Ga0501034_0468769 Ga0501034_0468769_315_1145 276
1057 3300049572 Ga0501036_0003133 Ga0501036_0003133_1494_2324 276
1058 3300049572 Ga0501036_0026699 Ga0501036_0026699_792_1622 276
1059 3300049572 Ga0501036_0059934 Ga0501036_0059934_834_1664 276
1060 3300049572 Ga0501036_0503699 Ga0501036_0503699_105_935 276
1061 3300049573 Ga0501037_0014087 Ga0501037_0014087_3911_4744 276
1062 3300049573 Ga0501037_0034335 Ga0501037_0034335_2268_3098 276
1063 3300049573 Ga0501037_0074977 Ga0501037_0074977_962_1792 276
1064 3300049574 Ga0501038_0025621 Ga0501038_0025621_687_1517 276
1065 3300049574 Ga0501038_0064795 Ga0501038_0064795_2106_2936 276
1066 3300049574 Ga0501038_0090496 Ga0501038_0090496_727_1557 276
1067 3300049574 Ga0501038_0125562 Ga0501038_0125562_13_843 276
1068 3300049578 Ga0501042_0315851 Ga0501042_0315851_172_1002 276
1069 3300049579 Ga0501043_0002174 Ga0501043_0002174_14680_15510 276
1070 3300049579 Ga0501043_0019813 Ga0501043_0019813_3671_4501 276
1071 3300049579 Ga0501043_0141415 Ga0501043_0141415_868_1698 276
1072 3300049580 Ga0501046_0076410 Ga0501046_0076410_592_1422 276
1073 3300049581 Ga0501047_0019888 Ga0501047_0019888_2119_2949 276
1074 3300049581 Ga0501047_0090599 Ga0501047_0090599_636_1466 276
1075 3300049581 Ga0501047_0192663 Ga0501047_0192663_1017_1847 276
1076 3300049582 Ga0501048_0116600 Ga0501048_0116600_1026_1856 276
1077 3300049582 Ga0501048_0206530 Ga0501048_0206530_323_1246 276
1078 3300049582 Ga0501048_0248442 Ga0501048_0248442_373_1203 276
1079 3300049583 Ga0501067_0029026 Ga0501067_0029026_1678_2508 276
1080 3300049586 Ga0501070_0025114 Ga0501070_0025114_3927_4757 276
1081 3300049586 Ga0501070_0152763 Ga0501070_0152763_765_1595 276
1082 3300049586 Ga0501070_0167154 Ga0501070_0167154_939_1769 276
1083 3300049587 Ga0501071_0065654 Ga0501071_0065654_101_934 276
1084 3300049587 Ga0501071_0253519 Ga0501071_0253519_81_911 276
1085 3300049587 Ga0501071_0347921 Ga0501071_0347921_119_949 276
1086 3300049588 Ga0501072_0032679 Ga0501072_0032679_1152_1985 276
1087 3300049588 Ga0501072_0335628 Ga0501072_0335628_311_1144 276
1088 3300049589 Ga0501073_0065786 Ga0501073_0065786_436_1266 276
1089 3300049590 Ga0501074_0090568 Ga0501074_0090568_381_1211 276
1090 3300049592 Ga0501076_0029006 Ga0501076_0029006_422_1252 276
1091 3300049592 Ga0501076_0280202 Ga0501076_0280202_407_1240 276
1092 3300049742 Ga0501080_0028616 Ga0501080_0028616_744_1574 276
1093 3300049742 Ga0501080_0149856 Ga0501080_0149856_923_1753 276
1094 3300049742 Ga0501080_0468059 Ga0501080_0468059_138_968 276
1095 3300049743 Ga0501081_0030358 Ga0501081_0030358_1528_2358 276
1096 3300049822 Ga0501035_0039179 Ga0501035_0039179_1682_2512 276
1097 3300049822 Ga0501035_0059429 Ga0501035_0059429_1468_2298 276
1098 3300049822 Ga0501035_0060617 Ga0501035_0060617_555_1385 276
1099 3300049822 Ga0501035_0111490 Ga0501035_0111490_1048_1878 276
1100 3300049823 Ga0501044_0020829 Ga0501044_0020829_5931_6761 276
1101 3300049823 Ga0501044_0232670 Ga0501044_0232670_547_1377 276
1102 3300049823 Ga0501044_0328200 Ga0501044_0328200_581_1411 276
1103 3300049823 Ga0501044_0557423 Ga0501044_0557423_44_874 276
1104 3300050492 nmdc:mga0yw44_189281_c1 nmdc:mga0yw44_189281_c1_500_1336 276
1105 3300050492 nmdc:mga0yw44_279559_c1 nmdc:mga0yw44_279559_c1_142_990 276
1106 3300050494 nmdc:mga06z11_32988_c1 nmdc:mga06z11_32988_c1_1020_1850 276
1107 3300050496 nmdc:mga07m45_47599_c1 nmdc:mga07m45_47599_c1_930_1760 276
1108 3300050507 nmdc:mga05p37_34216_c1 nmdc:mga05p37_34216_c1_4319_5152 276
1109 3300050507 nmdc:mga05p37_354_c1 nmdc:mga05p37_354_c1_47354_48187 276
1110 3300050508 nmdc:mga09592_1311_c1 nmdc:mga09592_1311_c1_5773_6606 276
1111 3300050509 nmdc:mga0qj67_1940_c1 nmdc:mga0qj67_1940_c1_712_1545 276
1112 3300050509 nmdc:mga0qj67_452_c1 nmdc:mga0qj67_452_c1_23276_24109 276
1113 3300050510 nmdc:mga06r32_147_c1 nmdc:mga06r32_147_c1_1020_1853 276
1114 3300050511 nmdc:mga08y16_1264_c1 nmdc:mga08y16_1264_c1_584_1417 276
1115 3300050511 nmdc:mga08y16_463250_c1 nmdc:mga08y16_463250_c1_51_881 276
1116 3300050511 nmdc:mga08y16_706_c1 nmdc:mga08y16_706_c1_23883_24713 276
1117 3300050512 nmdc:mga0n895_126_c1 nmdc:mga0n895_126_c1_38998_39828 276
1118 3300050512 nmdc:mga0n895_203244_c1 nmdc:mga0n895_203244_c1_521_1354 276
1119 3300050512 nmdc:mga0n895_3658_c1 nmdc:mga0n895_3658_c1_9533_10366 276
1120 3300050512 nmdc:mga0n895_73852_c1 nmdc:mga0n895_73852_c1_1798_2628 276
1121 3300050513 nmdc:mga0rr50_110564_c1 nmdc:mga0rr50_110564_c1_1160_1993 276
1122 3300050513 nmdc:mga0rr50_58565_c1 nmdc:mga0rr50_58565_c1_1245_2078 276
1123 3300050514 nmdc:mga08x19_34989_c1 nmdc:mga08x19_34989_c1_520_1353 276
1124 3300050515 nmdc:mga0a205_197_c1 nmdc:mga0a205_197_c1_8473_9303 276
1125 3300050515 nmdc:mga0a205_35258_c1 nmdc:mga0a205_35258_c1_2036_2869 276
1126 3300053077 Ga0495601_0000068 Ga0495601_0000068_45652_46482 276
1127 3300053077 Ga0495601_0042090 Ga0495601_0042090_675_1505 276
1128 3300053077 Ga0495601_0050293 Ga0495601_0050293_63_893 276
1129 3300053078 Ga0495612_0001544 Ga0495612_0001544_4750_5580 276
1130 3300053078 Ga0495612_0014034 Ga0495612_0014034_103_933 276
1131 3300053078 Ga0495612_0020815 Ga0495612_0020815_784_1707 276
1132 3300053079 Ga0500610_0084049 Ga0500610_0084049_330_1163 276
1133 3300053084 Ga0495595_0001152 Ga0495595_0001152_5488_6318 276
1134 3300053084 Ga0495595_0001627 Ga0495595_0001627_6155_6985 276
1135 3300053085 Ga0495619_0000154 Ga0495619_0000154_6339_7169 276
1136 3300053085 Ga0495619_0001079 Ga0495619_0001079_1565_2398 276
1137 3300053085 Ga0495619_0010153 Ga0495619_0010153_263_1093 276
1138 3300053085 Ga0495619_0016781 Ga0495619_0016781_2460_3290 276
1139 3300053085 Ga0495619_0022065 Ga0495619_0022065_3219_4052 276
1140 3300053087 Ga0500643_000833 Ga0500643_000833_13659_14489 276
1141 3300053088 Ga0500644_0000982 Ga0500644_0000982_1032_1862 276
1142 3300053093 Ga0500651_0008832 Ga0500651_0008832_4674_5504 276
1143 3300053094 Ga0500566_0038988 Ga0500566_0038988_614_1444 276
1144 3300053096 Ga0500641_0015946 Ga0500641_0015946_402_1235 276
1145 3300053098 Ga0500650_0030316 Ga0500650_0030316_1397_2227 276
1146 3300053109 Ga0500569_066558 Ga0500569_066558_160_993 276
1147 3300053119 Ga0500595_000002 Ga0500595_000002_554005_554835 276
1148 3300053122 Ga0500608_128682 Ga0500608_128682_68_901 276
1149 3300053153 Ga0500616_0000002 Ga0500616_0000002_620355_621185 276
1150 3300053153 Ga0500616_0010066 Ga0500616_0010066_4633_5466 276
1151 3300053156 Ga0500622_0036280 Ga0500622_0036280_406_1239 276
1152 3300053177 Ga0500636_0045638 Ga0500636_0045638_579_1412 276
1153 3300053730 Ga0500645_000549 Ga0500645_000549_7974_8804 276
1154 3300054114 Ga0501084_0066272 Ga0501084_0066272_327_1157 276
1155 3300054114 Ga0501084_0320043 Ga0501084_0320043_122_952 276
1156 3300060353 Ga0501082_0102444 Ga0501082_0102444_985_1815 276
1157 3300061734 Ga0530510_0056915 Ga0530510_0056915_168_1001 276
1158 iso_pu_bacteria 2851182111 2851182304 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

51

305

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5922 13 276
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5865 13 276
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5507 17 276
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5321 17 276
4lds-assembly1.cif.gz_B the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.3586 17 268
ID Description Score Start End Superfamily
af_A0A0P0XLR0_202_437_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4527 48 249 1.20.1250.20
af_Q54E67_237_417_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4459 58 274 1.20.1250.20
af_Q54E67_237_417_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.427 58 274 1.20.1250.20
af_A0A1D6FKK2_52_340_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4055 12 271 1.20.1250.20
af_O07730_221_402_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4012 59 274 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A800M742-F1-model_v4 Probable membrane transporter protein 0.9738 11 274 GO:0005886
AF-A0A2U1V8W1-F1-model_v4 Probable membrane transporter protein 0.9707 10 274 GO:0005886
AF-A0A2W5BL51-F1-model_v4 deleted 0.9706 5 221
AF-A0A7U3E1W1-F1-model_v4 deleted 0.9698 1 274
AF-A0A3D2W4T4-F1-model_v4 Probable membrane transporter protein 0.9683 9 206 GO:0005886

Feature Viewer

pLDDT pTM Quality
88.81 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map