F490962
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1157 | 788 | 765 | 288 |
Family's Representative Sequence
| Representative Sequence | 3300046674|Ga0495588_0065733|Ga0495588_0065733_538_1530 |
| Length | 330 |
| Sequence | VRAVVTAADVRLFLKKTKAAGLLPSRWGGCLYRHQREGVEMATQNTRVLARWMMAPSVGLLLIWMIVPLAMTLWFSFQNYNLLNPGNVSFAGLFNYQYFYSDPAFFQSIWNTLLIVCGVLFITVIGGIAIALMLDQPMWGQGLVRILVISPFFVMPPVAALVWKNMIMHPQYGVFADISRFFGLQPVDWFGQYPLFSIIIIVAWQWLPFATLILLTALQSLDGEQKEAAEMDGAGFVNRFIYLTVPHLARSITVVILIQTIFLLGVYAEILVTTNGGPGYASTNLPFLIYRTALLGYDVGGASAGGIIAVILANIVAFFLMRAVGKNLDK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 6 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 7 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 8 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 9 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 10 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 11 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 12 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 17 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 18 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 24 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 25 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 26 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 27 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 28 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 29 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 30 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 31 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 32 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 33 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 34 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 35 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 36 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 37 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 38 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 39 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 40 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 41 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 42 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 43 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 44 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 45 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 46 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 47 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 48 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 49 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 50 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 51 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 52 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 53 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 54 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 55 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 56 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 57 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 58 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 59 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 60 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 61 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 62 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 63 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 64 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 65 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 66 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 67 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 68 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 69 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 70 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 71 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 72 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 73 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 74 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 75 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 76 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 77 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 78 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 79 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 80 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 81 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 82 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 83 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 84 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 85 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 86 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 87 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 88 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 89 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 90 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 91 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 92 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 93 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 94 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 95 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 96 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 97 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 98 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 99 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 100 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 101 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 102 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 103 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 104 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 105 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 106 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 107 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 108 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 109 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 110 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 111 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 112 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 113 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 114 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 115 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 116 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 117 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 118 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 119 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 120 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 121 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 122 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 123 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 124 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 125 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 126 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 127 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 128 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 129 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 130 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 131 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 132 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 133 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 134 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 135 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 136 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 137 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 138 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 139 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 140 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 141 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 142 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 143 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 144 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 145 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 146 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 147 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 148 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 149 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 150 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 151 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 152 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 153 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 154 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 155 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 156 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 157 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 158 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 159 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 160 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 161 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 162 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 163 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 164 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 165 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 166 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 167 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 168 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 169 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 170 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 171 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 172 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 173 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 174 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 175 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 176 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 177 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 178 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 179 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 180 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 181 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 182 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 183 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 184 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 185 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 186 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 187 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 188 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 189 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 190 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 191 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 192 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 193 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 194 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 195 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 196 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 197 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 198 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 199 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 200 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 201 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 202 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 203 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 204 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 205 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 206 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 207 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 208 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 209 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 210 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 211 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 212 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 213 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 214 | 2922368715 | |||
| 215 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 216 | 2922425934 | |||
| 217 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 218 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 219 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 220 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 221 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 222 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 223 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 224 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 225 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 226 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 227 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 228 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 229 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 230 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 231 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 232 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 233 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 234 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 235 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 236 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 237 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 238 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 239 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 240 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 241 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 242 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 243 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 244 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 245 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 246 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 247 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 248 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 249 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 250 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 251 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 252 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 253 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 254 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 255 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 256 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 257 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 258 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 259 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 260 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 261 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 262 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 263 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 264 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 265 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 266 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 267 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 268 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 269 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 270 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 271 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 272 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 273 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 274 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 275 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 276 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 277 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 278 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 279 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 280 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 281 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 282 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 283 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 284 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 285 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 286 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 287 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 288 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 289 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 290 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 291 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 292 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 293 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 294 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 295 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 296 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 297 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 298 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 299 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 300 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 301 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 302 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 303 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 304 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 305 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 306 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 307 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 308 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 309 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 310 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 311 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 312 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 313 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 314 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 315 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 316 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 317 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 318 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 319 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 320 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 321 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 322 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 323 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 324 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 325 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 326 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 327 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 328 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 329 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 330 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 331 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 332 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 333 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 334 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 335 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 336 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 337 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 338 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 339 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 340 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 341 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 342 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 343 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 344 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 345 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 346 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 347 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 348 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 349 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 350 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 351 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 352 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 353 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 354 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 355 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 356 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 357 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 358 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 359 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 360 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 361 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 362 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 363 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 364 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 365 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 366 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 367 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 368 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 369 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 370 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 371 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 372 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 373 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 374 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 375 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 376 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 377 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 378 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 379 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 380 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 381 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 382 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 383 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 384 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 385 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 386 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 387 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 388 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 389 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 390 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 391 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 392 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 393 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 394 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 395 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 396 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 397 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 399 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 400 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 401 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 402 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 403 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 404 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 405 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 406 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 407 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 409 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 410 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 411 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 412 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 413 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 414 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 415 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 416 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 417 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 418 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 419 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 420 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 421 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 422 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 423 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 424 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 425 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 426 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 427 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 428 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 429 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 430 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 431 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 432 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 433 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 434 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 435 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 436 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 437 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 438 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 439 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 440 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 441 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 442 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 443 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 444 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 445 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 446 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 447 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 448 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 449 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 450 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 451 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 452 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 453 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 454 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 455 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 456 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 457 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 458 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 485 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 486 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 488 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 489 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 490 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 491 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 493 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 494 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 495 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 496 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 497 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 498 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 499 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 500 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 501 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 502 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 503 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 504 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 505 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 506 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 507 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 508 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 509 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 510 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 511 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 512 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 513 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 514 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 515 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 516 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 517 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 518 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 519 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 520 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 521 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 522 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 523 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 524 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 525 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 526 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 527 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 528 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 529 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 530 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 531 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 532 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 533 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 534 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 535 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 536 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 537 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 538 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 539 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 540 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 541 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 542 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 543 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 544 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 545 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 546 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 547 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 548 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 595 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 596 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 597 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 598 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 599 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 600 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 601 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 602 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 603 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 604 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 605 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 606 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 607 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 608 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 609 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 610 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 611 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 612 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 613 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 614 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 615 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 616 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 617 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 618 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 619 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 621 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 622 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 623 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 624 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 625 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 626 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 627 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 628 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 629 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 630 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 631 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 632 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 633 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 634 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 635 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 636 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 637 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 638 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 639 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 640 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 641 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 642 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 643 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 644 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 645 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 646 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 647 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 648 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 649 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 650 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 651 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 652 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 653 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 654 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 655 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 656 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 657 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 658 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 659 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 662 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 663 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 664 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 665 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 666 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 667 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 668 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 669 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 670 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 671 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 672 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 673 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 674 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 675 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 676 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 677 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 678 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 679 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 680 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 681 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 682 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 683 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 684 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 685 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 686 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 687 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 688 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 689 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 690 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 691 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 692 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 693 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 694 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 695 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 696 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 697 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 698 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 699 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 700 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 701 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 702 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 703 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 704 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 705 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 706 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 707 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 708 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 709 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 710 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 711 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 712 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 713 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 714 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 715 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 716 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 717 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 718 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 719 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 720 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 721 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 722 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 723 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 724 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 725 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 726 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 727 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 728 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 729 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 730 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 731 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 732 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 733 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 734 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 735 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 736 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 737 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 738 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 739 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 740 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 741 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 742 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 743 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 744 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 745 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 746 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 747 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 748 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 749 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 750 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 751 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 752 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 753 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 754 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 755 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 756 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 757 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 758 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 759 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 760 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 761 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 762 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 763 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 764 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 765 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 766 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 767 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 768 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 769 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 770 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 771 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 772 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 773 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 774 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 775 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 776 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 777 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 778 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 779 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 780 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 781 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 782 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 783 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 784 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 785 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 786 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 787 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 788 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 58.44 |
| Metatranscriptomes | 7.88 |
| Isolates | 33.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.43 |
| Bulb | 0 |
| Endosphere | 13.22 |
| Nodule | 22.47 |
| Rhizoplane | 2.94 |
| Rhizosphere | 44.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001029 | 3300001979 | Bacteria | 12506 |
| 2 | JGI25155J39150_1000012 | 3300002704 | Bacteria | 199435 |
| 3 | JGI25156J39149_1000049 | 3300002705 | Bacteria | 91988 |
| 4 | JGI25162J39368_1000001 | 3300002737 | Bacteria | 740113 |
| 5 | JGI25162J39368_1000146 | 3300002737 | Bacteria | 76858 |
| 6 | JGI25162J39368_1000409 | 3300002737 | Bacteria | 35106 |
| 7 | JGI25154J39366_1000033 | 3300002738 | Bacteria | 184379 |
| 8 | JGI25157J39369_1000055 | 3300002741 | Bacteria | 107875 |
| 9 | JGI25163J39215_1004290 | 3300002771 | Bacteria | 1021 |
| 10 | JGI25159J45721_1000304 | 3300002987 | Bacteria | 23104 |
| 11 | JGI25151J46595_10003057 | 3300003187 | Bacteria | 9463 |
| 12 | JGI25406J46586_10007472 | 3300003203 | Bacteria | 4986 |
| 13 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 14 | JGI25165J46597_1000078 | 3300003214 | Bacteria | 179320 |
| 15 | JGI25165J46597_1000451 | 3300003214 | Bacteria | 41309 |
| 16 | JGI25165J46597_1000751 | 3300003214 | Bacteria | 24993 |
| 17 | JGI25165J46597_1001719 | 3300003214 | Bacteria | 9753 |
| 18 | JGI25153J46596_10001118 | 3300003215 | Bacteria | 16267 |
| 19 | JGI25153J46596_10009829 | 3300003215 | Bacteria | 4391 |
| 20 | JGI25153J46596_10025010 | 3300003215 | Bacteria | 2142 |
| 21 | JGI25153J46596_10025075 | 3300003215 | Bacteria | 2138 |
| 22 | rootL2_10015244 | 3300003322 | Bacteria | 2097 |
| 23 | JGI25160J50197_1000006 | 3300003354 | Bacteria | 316247 |
| 24 | JGI25160J50197_1001199 | 3300003354 | Bacteria | 13171 |
| 25 | JGI25160J50197_1011660 | 3300003354 | Bacteria | 3098 |
| 26 | JGI25161J50226_1000004 | 3300003374 | Bacteria | 316212 |
| 27 | Ga0006562J51391_1019963 | 3300003578 | Bacteria | 2966 |
| 28 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 29 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 30 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 31 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 32 | Ga0055525_1005814 | 3300003759 | Bacteria | 1045 |
| 33 | Ga0055536_1004899 | 3300003781 | Bacteria | 6680 |
| 34 | Ga0055530_10015159 | 3300003791 | Bacteria | 2533 |
| 35 | Ga0055540_1007821 | 3300003792 | Bacteria | 3958 |
| 36 | Ga0055531_10000916 | 3300003794 | Bacteria | 23920 |
| 37 | Ga0055531_10009357 | 3300003794 | Bacteria | 5015 |
| 38 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 39 | Ga0058692_1007093 | 3300003856 | Bacteria | 3006 |
| 40 | Ga0058692_1011868 | 3300003856 | Bacteria | 2088 |
| 41 | Ga0055543_1000002 | 3300004625 | Bacteria | 390020 |
| 42 | Ga0065165_1000217 | 3300005262 | Bacteria | 100170 |
| 43 | Ga0065165_1001104 | 3300005262 | Bacteria | 32057 |
| 44 | Ga0065165_1001488 | 3300005262 | Bacteria | 24882 |
| 45 | Ga0065165_1004881 | 3300005262 | Bacteria | 7928 |
| 46 | Ga0065165_1006238 | 3300005262 | Bacteria | 6340 |
| 47 | Ga0065704_10008449 | 3300005289 | Bacteria | 2339 |
| 48 | Ga0070676_10369822 | 3300005328 | Bacteria | 990 |
| 49 | Ga0068869_100212736 | 3300005334 | Bacteria | 1529 |
| 50 | Ga0070666_10104128 | 3300005335 | Bacteria | 1958 |
| 51 | Ga0070682_100279022 | 3300005337 | Bacteria | 1217 |
| 52 | Ga0070661_100428735 | 3300005344 | Bacteria | 1049 |
| 53 | Ga0070668_100016767 | 3300005347 | Bacteria | 5477 |
| 54 | Ga0070668_100018004 | 3300005347 | Bacteria | 5300 |
| 55 | Ga0070668_100023836 | 3300005347 | Bacteria | 4633 |
| 56 | Ga0070669_100010381 | 3300005353 | Bacteria | 6614 |
| 57 | Ga0070671_100028427 | 3300005355 | Bacteria | 4604 |
| 58 | Ga0070667_100077871 | 3300005367 | Bacteria | 2832 |
| 59 | Ga0070713_100154692 | 3300005436 | Bacteria | 2043 |
| 60 | Ga0070700_100021063 | 3300005441 | Bacteria | 3787 |
| 61 | Ga0070708_100234024 | 3300005445 | Bacteria | 1724 |
| 62 | Ga0070663_100393871 | 3300005455 | Bacteria | 1131 |
| 63 | Ga0070663_100471256 | 3300005455 | Bacteria | 1038 |
| 64 | Ga0070678_100238558 | 3300005456 | Bacteria | 1519 |
| 65 | Ga0070662_100207970 | 3300005457 | Bacteria | 1556 |
| 66 | Ga0070707_100007996 | 3300005468 | Bacteria | 9825 |
| 67 | Ga0068853_100050817 | 3300005539 | Bacteria | 3566 |
| 68 | Ga0070695_100000980 | 3300005545 | Bacteria | 15536 |
| 69 | Ga0070665_100000349 | 3300005548 | Bacteria | 69493 |
| 70 | Ga0070665_100019496 | 3300005548 | Bacteria | 6809 |
| 71 | Ga0070665_100044835 | 3300005548 | Bacteria | 4439 |
| 72 | Ga0070665_100048095 | 3300005548 | Bacteria | 4283 |
| 73 | Ga0070665_100123692 | 3300005548 | Bacteria | 2589 |
| 74 | Ga0070665_100173854 | 3300005548 | Bacteria | 2154 |
| 75 | Ga0070665_100551781 | 3300005548 | Bacteria | 1164 |
| 76 | Ga0070664_100650538 | 3300005564 | Bacteria | 980 |
| 77 | Ga0068854_100290135 | 3300005578 | Bacteria | 1320 |
| 78 | Ga0068856_100049312 | 3300005614 | Bacteria | 4150 |
| 79 | Ga0068856_100191144 | 3300005614 | Bacteria | 2061 |
| 80 | Ga0068856_100287343 | 3300005614 | Bacteria | 1661 |
| 81 | Ga0068852_100478184 | 3300005616 | Bacteria | 1237 |
| 82 | Ga0068859_100279564 | 3300005617 | Bacteria | 1762 |
| 83 | Ga0068861_100068365 | 3300005719 | Bacteria | 2745 |
| 84 | Ga0068863_100370493 | 3300005841 | Bacteria | 1397 |
| 85 | Ga0068860_100387746 | 3300005843 | Bacteria | 1380 |
| 86 | Ga0081455_10053582 | 3300005937 | Bacteria | 3445 |
| 87 | Ga0081540_1027415 | 3300005983 | Bacteria | 3228 |
| 88 | Ga0081540_1053799 | 3300005983 | Bacteria | 1971 |
| 89 | Ga0081540_1069025 | 3300005983 | Bacteria | 1644 |
| 90 | Ga0081539_10001859 | 3300005985 | Bacteria | 33250 |
| 91 | Ga0075365_10024820 | 3300006038 | Bacteria | 3788 |
| 92 | Ga0075365_10104769 | 3300006038 | Bacteria | 1940 |
| 93 | Ga0075363_100006188 | 3300006048 | Bacteria | 5410 |
| 94 | Ga0075363_100015847 | 3300006048 | Bacteria | 3712 |
| 95 | Ga0075364_10000074 | 3300006051 | Bacteria | 38784 |
| 96 | Ga0075364_10038218 | 3300006051 | Bacteria | 3109 |
| 97 | Ga0075364_10079924 | 3300006051 | Bacteria | 2161 |
| 98 | Ga0075364_10086516 | 3300006051 | Bacteria | 2077 |
| 99 | Ga0070715_10027017 | 3300006163 | Bacteria | 2289 |
| 100 | Ga0075362_10002799 | 3300006177 | Bacteria | 5947 |
| 101 | Ga0075362_10020346 | 3300006177 | Bacteria | 2772 |
| 102 | Ga0075367_10013641 | 3300006178 | Bacteria | 4376 |
| 103 | Ga0075367_10065836 | 3300006178 | Bacteria | 2171 |
| 104 | Ga0075367_10080727 | 3300006178 | Bacteria | 1967 |
| 105 | Ga0075369_10009090 | 3300006186 | Bacteria | 3848 |
| 106 | Ga0075370_10006154 | 3300006353 | Bacteria | 6019 |
| 107 | Ga0075370_10034156 | 3300006353 | Bacteria | 2851 |
| 108 | Ga0075428_100013125 | 3300006844 | Bacteria | 9215 |
| 109 | Ga0075434_100006769 | 3300006871 | Bacteria | 10534 |
| 110 | Ga0075434_100102094 | 3300006871 | Bacteria | 2875 |
| 111 | Ga0097620_100279579 | 3300006931 | Bacteria | 1762 |
| 112 | Ga0099825_1024201 | 3300006941 | Bacteria | 3593 |
| 113 | Ga0099824_1006678 | 3300006942 | Bacteria | 15704 |
| 114 | Ga0099822_1043467 | 3300006943 | Bacteria | 2281 |
| 115 | Ga0079104_1000563 | 3300006946 | Bacteria | 37845 |
| 116 | Ga0099826_10000045 | 3300006948 | Bacteria | 75912 |
| 117 | Ga0099826_10007422 | 3300006948 | Bacteria | 8096 |
| 118 | Ga0105244_10038235 | 3300009036 | Bacteria | 2503 |
| 119 | Ga0105244_10156677 | 3300009036 | Bacteria | 1089 |
| 120 | Ga0105240_10000019 | 3300009093 | Bacteria | 406211 |
| 121 | Ga0105240_10216082 | 3300009093 | Bacteria | 2237 |
| 122 | Ga0105240_10271139 | 3300009093 | Bacteria | 1954 |
| 123 | Ga0105245_10202801 | 3300009098 | Bacteria | 1905 |
| 124 | Ga0105247_10133439 | 3300009101 | Bacteria | 1620 |
| 125 | Ga0105247_10166301 | 3300009101 | Bacteria | 1464 |
| 126 | Ga0114129_10012990 | 3300009147 | Bacteria | 11857 |
| 127 | Ga0105243_10068288 | 3300009148 | Bacteria | 2864 |
| 128 | Ga0105243_10070952 | 3300009148 | Bacteria | 2815 |
| 129 | Ga0105243_10073163 | 3300009148 | Bacteria | 2776 |
| 130 | Ga0105241_10068288 | 3300009174 | Bacteria | 2754 |
| 131 | Ga0105242_10354023 | 3300009176 | Bacteria | 1357 |
| 132 | Ga0105242_10743290 | 3300009176 | Bacteria | 965 |
| 133 | Ga0105248_10087965 | 3300009177 | Bacteria | 3497 |
| 134 | Ga0105237_10002910 | 3300009545 | Bacteria | 20751 |
| 135 | Ga0105237_10027706 | 3300009545 | Bacteria | 5777 |
| 136 | Ga0105237_10076852 | 3300009545 | Bacteria | 3329 |
| 137 | Ga0105237_10239726 | 3300009545 | Bacteria | 1815 |
| 138 | Ga0105237_10332327 | 3300009545 | Bacteria | 1524 |
| 139 | Ga0105237_10430298 | 3300009545 | Bacteria | 1325 |
| 140 | Ga0105238_10053821 | 3300009551 | Bacteria | 4044 |
| 141 | Ga0105249_10014920 | 3300009553 | Bacteria | 6873 |
| 142 | Ga0105239_10006284 | 3300010375 | Bacteria | 13818 |
| 143 | Ga0105239_10038814 | 3300010375 | Bacteria | 5217 |
| 144 | Ga0105239_10042362 | 3300010375 | Bacteria | 4989 |
| 145 | Ga0105239_10045034 | 3300010375 | Bacteria | 4836 |
| 146 | Ga0105239_10271542 | 3300010375 | Bacteria | 1907 |
| 147 | Ga0105239_10347186 | 3300010375 | Bacteria | 1675 |
| 148 | Ga0105239_10583899 | 3300010375 | Bacteria | 1274 |
| 149 | Ga0105246_10012435 | 3300011119 | Bacteria | 5312 |
| 150 | Ga0105246_10031951 | 3300011119 | Bacteria | 3488 |
| 151 | Ga0157373_10019415 | 3300013100 | Bacteria | 4946 |
| 152 | Ga0157371_10000005 | 3300013102 | Bacteria | 416456 |
| 153 | Ga0157371_10088074 | 3300013102 | Bacteria | 2198 |
| 154 | Ga0157370_10005600 | 3300013104 | Bacteria | 14063 |
| 155 | Ga0157369_10216291 | 3300013105 | Bacteria | 2007 |
| 156 | Ga0157369_10301305 | 3300013105 | Bacteria | 1667 |
| 157 | Ga0157369_10448858 | 3300013105 | Bacteria | 1335 |
| 158 | Ga0157369_10564260 | 3300013105 | Bacteria | 1176 |
| 159 | Ga0157374_10099050 | 3300013296 | Bacteria | 2792 |
| 160 | Ga0163162_10304059 | 3300013306 | Bacteria | 1727 |
| 161 | Ga0182008_10128144 | 3300014497 | Bacteria | 1264 |
| 162 | Ga0157379_10230010 | 3300014968 | Bacteria | 1680 |
| 163 | Ga0157376_10529186 | 3300014969 | Bacteria | 1163 |
| 164 | Ga0182006_1009455 | 3300015261 | Bacteria | 4367 |
| 165 | Ga0182007_10001799 | 3300015262 | Bacteria | 11183 |
| 166 | Ga0182005_1024788 | 3300015265 | Bacteria | 1638 |
| 167 | Ga0182005_1025969 | 3300015265 | Bacteria | 1598 |
| 168 | Ga0214544_1000004 | 3300021320 | Bacteria | 455869 |
| 169 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 170 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 171 | Ga0214543_1000006 | 3300021327 | Bacteria | 443395 |
| 172 | Ga0213874_10005902 | 3300021377 | Bacteria | 2875 |
| 173 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 174 | Ga0209436_115303 | 3300025208 | Bacteria | 1191 |
| 175 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 176 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 177 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 178 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 179 | Ga0209563_102075 | 3300025230 | Bacteria | 4743 |
| 180 | Ga0207427_100300 | 3300025231 | Bacteria | 34562 |
| 181 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 182 | Ga0209437_100078 | 3300025233 | Bacteria | 278088 |
| 183 | Ga0209437_100174 | 3300025233 | Bacteria | 138811 |
| 184 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 185 | Ga0209646_1005577 | 3300025246 | Bacteria | 2180 |
| 186 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 187 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 188 | Ga0209677_100155 | 3300025253 | Bacteria | 62873 |
| 189 | Ga0209677_104509 | 3300025253 | Bacteria | 3986 |
| 190 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 191 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 192 | Ga0209233_1000150 | 3300025261 | Bacteria | 179401 |
| 193 | Ga0209233_1000163 | 3300025261 | Bacteria | 152912 |
| 194 | Ga0209233_1000295 | 3300025261 | Bacteria | 62548 |
| 195 | Ga0209233_1000441 | 3300025261 | Bacteria | 28814 |
| 196 | Ga0209233_1000459 | 3300025261 | Bacteria | 26552 |
| 197 | Ga0209233_1001854 | 3300025261 | Bacteria | 8120 |
| 198 | Ga0209233_1012224 | 3300025261 | Bacteria | 2495 |
| 199 | Ga0209455_1010339 | 3300025272 | Bacteria | 2378 |
| 200 | Ga0209130_1000032 | 3300025284 | Bacteria | 316240 |
| 201 | Ga0209676_1002982 | 3300025292 | Bacteria | 11009 |
| 202 | Ga0209025_1000445 | 3300025294 | Bacteria | 81092 |
| 203 | Ga0209025_1001209 | 3300025294 | Bacteria | 36250 |
| 204 | Ga0209025_1020477 | 3300025294 | Bacteria | 3618 |
| 205 | Ga0209025_1051016 | 3300025294 | Bacteria | 1648 |
| 206 | Ga0209025_1052966 | 3300025294 | Bacteria | 1597 |
| 207 | Ga0209564_1008632 | 3300025295 | Bacteria | 4994 |
| 208 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 209 | Ga0209758_1000105 | 3300025297 | Bacteria | 221415 |
| 210 | Ga0209758_1000345 | 3300025297 | Bacteria | 84958 |
| 211 | Ga0209758_1001280 | 3300025297 | Bacteria | 31015 |
| 212 | Ga0209758_1012480 | 3300025297 | Bacteria | 4753 |
| 213 | Ga0209758_1034315 | 3300025297 | Bacteria | 2021 |
| 214 | Ga0209050_1006042 | 3300025298 | Bacteria | 7329 |
| 215 | Ga0209256_1002090 | 3300025299 | Bacteria | 17511 |
| 216 | Ga0209256_1013546 | 3300025299 | Bacteria | 3016 |
| 217 | Ga0207426_1000077 | 3300025302 | Bacteria | 316246 |
| 218 | Ga0207426_1000400 | 3300025302 | Bacteria | 73493 |
| 219 | Ga0207426_1000402 | 3300025302 | Bacteria | 72738 |
| 220 | Ga0209051_1005198 | 3300025303 | Bacteria | 7700 |
| 221 | Ga0209257_1001089 | 3300025304 | Bacteria | 35523 |
| 222 | Ga0209257_1003767 | 3300025304 | Bacteria | 12521 |
| 223 | Ga0207710_10033009 | 3300025900 | Bacteria | 2269 |
| 224 | Ga0207647_10002713 | 3300025904 | Bacteria | 13371 |
| 225 | Ga0207705_10270945 | 3300025909 | Bacteria | 1298 |
| 226 | Ga0207684_10151077 | 3300025910 | Bacteria | 1998 |
| 227 | Ga0207684_10177313 | 3300025910 | Bacteria | 1837 |
| 228 | Ga0207654_10049356 | 3300025911 | Bacteria | 2413 |
| 229 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 230 | Ga0207695_10000049 | 3300025913 | Bacteria | 406233 |
| 231 | Ga0207695_10001193 | 3300025913 | Bacteria | 44667 |
| 232 | Ga0207671_10000107 | 3300025914 | Bacteria | 128950 |
| 233 | Ga0207671_10001041 | 3300025914 | Bacteria | 33720 |
| 234 | Ga0207671_10073634 | 3300025914 | Bacteria | 2552 |
| 235 | Ga0207646_10057330 | 3300025922 | Bacteria | 3481 |
| 236 | Ga0207681_10018137 | 3300025923 | Bacteria | 4431 |
| 237 | Ga0207694_10033877 | 3300025924 | Bacteria | 3914 |
| 238 | Ga0207687_10089190 | 3300025927 | Bacteria | 2245 |
| 239 | Ga0207700_10098188 | 3300025928 | Bacteria | 2329 |
| 240 | Ga0207644_10049516 | 3300025931 | Bacteria | 3008 |
| 241 | Ga0207690_10123574 | 3300025932 | Bacteria | 1884 |
| 242 | Ga0207706_10139987 | 3300025933 | Bacteria | 2128 |
| 243 | Ga0207709_10090813 | 3300025935 | Bacteria | 1996 |
| 244 | Ga0207709_10120968 | 3300025935 | Bacteria | 1767 |
| 245 | Ga0207670_10277882 | 3300025936 | Bacteria | 1304 |
| 246 | Ga0207711_10043179 | 3300025941 | Bacteria | 3844 |
| 247 | Ga0207712_10035469 | 3300025961 | Bacteria | 3389 |
| 248 | Ga0207668_10057399 | 3300025972 | Bacteria | 2715 |
| 249 | Ga0207668_10081246 | 3300025972 | Bacteria | 2350 |
| 250 | Ga0207668_10096919 | 3300025972 | Bacteria | 2181 |
| 251 | Ga0207640_10088366 | 3300025981 | Bacteria | 2139 |
| 252 | Ga0207678_10088900 | 3300026067 | Bacteria | 2640 |
| 253 | Ga0207678_10263401 | 3300026067 | Bacteria | 1478 |
| 254 | Ga0207708_10017794 | 3300026075 | Bacteria | 5348 |
| 255 | Ga0207702_10166633 | 3300026078 | Bacteria | 2016 |
| 256 | Ga0207675_100303545 | 3300026118 | Bacteria | 1555 |
| 257 | Ga0207698_10150594 | 3300026142 | Bacteria | 2018 |
| 258 | Ga0207698_10275362 | 3300026142 | Bacteria | 1554 |
| 259 | Ga0207698_10562057 | 3300026142 | Bacteria | 1120 |
| 260 | Ga0209281_1000032 | 3300027111 | Bacteria | 401727 |
| 261 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 262 | Ga0209389_1000010 | 3300027296 | Bacteria | 223892 |
| 263 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 264 | Ga0209371_1002352 | 3300027312 | Bacteria | 10747 |
| 265 | Ga0209589_1000002 | 3300027357 | Bacteria | 708598 |
| 266 | Ga0209589_1000016 | 3300027357 | Bacteria | 223788 |
| 267 | Ga0209489_100002 | 3300027361 | Bacteria | 708609 |
| 268 | Ga0209489_100016 | 3300027361 | Bacteria | 223873 |
| 269 | Ga0209489_113333 | 3300027361 | Bacteria | 6704 |
| 270 | Ga0209700_100002 | 3300027363 | Bacteria | 708598 |
| 271 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 272 | Ga0209282_1000210 | 3300027666 | Bacteria | 31123 |
| 273 | Ga0209282_1008160 | 3300027666 | Bacteria | 6594 |
| 274 | Ga0268266_10000092 | 3300028379 | Bacteria | 192109 |
| 275 | Ga0268266_10002356 | 3300028379 | Bacteria | 20435 |
| 276 | Ga0268266_10136273 | 3300028379 | Bacteria | 2199 |
| 277 | Ga0268266_10174646 | 3300028379 | Bacteria | 1952 |
| 278 | Ga0268266_10181379 | 3300028379 | Bacteria | 1917 |
| 279 | Ga0268266_10362274 | 3300028379 | Bacteria | 1364 |
| 280 | Ga0265337_1004861 | 3300028556 | Bacteria | 5485 |
| 281 | Ga0265326_10006349 | 3300028558 | Bacteria | 3682 |
| 282 | Ga0265319_1005704 | 3300028563 | Bacteria | 5907 |
| 283 | Ga0265334_10001643 | 3300028573 | Bacteria | 10718 |
| 284 | Ga0265318_10034833 | 3300028577 | Bacteria | 1938 |
| 285 | Ga0265323_10000803 | 3300028653 | Bacteria | 16860 |
| 286 | Ga0265336_10001030 | 3300028666 | Bacteria | 13681 |
| 287 | Ga0307517_10000875 | 3300028786 | Bacteria | 51286 |
| 288 | Ga0307517_10035058 | 3300028786 | Bacteria | 5692 |
| 289 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 290 | Ga0307515_10005257 | 3300028794 | Bacteria | 26313 |
| 291 | Ga0307515_10011281 | 3300028794 | Bacteria | 16963 |
| 292 | Ga0307515_10079364 | 3300028794 | Bacteria | 4300 |
| 293 | Ga0265338_10000076 | 3300028800 | Bacteria | 180204 |
| 294 | Ga0265324_10002044 | 3300029957 | Bacteria | 10728 |
| 295 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 296 | Ga0268256_1001392 | 3300030500 | Bacteria | 14681 |
| 297 | Ga0307512_10090549 | 3300030522 | Bacteria | 2133 |
| 298 | Ga0265340_10050010 | 3300031247 | Bacteria | 2029 |
| 299 | Ga0307513_10053382 | 3300031456 | Bacteria | 4345 |
| 300 | Ga0307408_100101330 | 3300031548 | Bacteria | 2194 |
| 301 | Ga0265313_10072373 | 3300031595 | Bacteria | 1584 |
| 302 | Ga0307508_10087736 | 3300031616 | Bacteria | 2695 |
| 303 | Ga0307508_10300855 | 3300031616 | Bacteria | 1197 |
| 304 | Ga0307514_10030872 | 3300031649 | Bacteria | 4299 |
| 305 | Ga0265314_10005339 | 3300031711 | Bacteria | 11618 |
| 306 | Ga0265342_10035803 | 3300031712 | Bacteria | 3035 |
| 307 | Ga0307516_10355366 | 3300031730 | Bacteria | 1130 |
| 308 | Ga0307406_10033730 | 3300031901 | Bacteria | 3135 |
| 309 | Ga0307412_10431317 | 3300031911 | Bacteria | 1081 |
| 310 | Ga0307414_10008732 | 3300032004 | Bacteria | 5775 |
| 311 | Ga0307414_10166766 | 3300032004 | Bacteria | 1756 |
| 312 | Ga0307414_10214893 | 3300032004 | Bacteria | 1574 |
| 313 | Ga0307411_10062906 | 3300032005 | Bacteria | 2478 |
| 314 | Ga0307510_10003276 | 3300033180 | Bacteria | 18841 |
| 315 | Ga0307510_10120793 | 3300033180 | Bacteria | 2326 |
| 316 | Ga0307510_10207436 | 3300033180 | Bacteria | 1486 |
| 317 | Ga0315911_1000007 | 3300033442 | Bacteria | 413725 |
| 318 | Ga0395900_0183744 | 3300037418 | Bacteria | 2123 |
| 319 | Ga0395900_0268425 | 3300037418 | Bacteria | 1702 |
| 320 | Ga0395900_0347928 | 3300037418 | Bacteria | 1456 |
| 321 | Ga0395898_0372586 | 3300037466 | Bacteria | 1362 |
| 322 | Ga0395905_0060148 | 3300037471 | Bacteria | 3552 |
| 323 | Ga0395905_0101885 | 3300037471 | Bacteria | 2695 |
| 324 | Ga0395905_0306078 | 3300037471 | Bacteria | 1477 |
| 325 | Ga0395905_0456172 | 3300037471 | Bacteria | 1176 |
| 326 | Ga0395901_0219662 | 3300038443 | Bacteria | 1987 |
| 327 | Ga0395901_0305349 | 3300038443 | Bacteria | 1649 |
| 328 | Ga0395901_0531044 | 3300038443 | Bacteria | 1194 |
| 329 | Ga0395901_0569198 | 3300038443 | Bacteria | 1146 |
| 330 | Ga0400483_146472 | 3300039062 | Bacteria | 8547 |
| 331 | Ga0400483_193432 | 3300039062 | Bacteria | 9134 |
| 332 | Ga0436365_1592281 | 3300039437 | Bacteria | 2915 |
| 333 | Ga0436361_0847892 | 3300039447 | Bacteria | 2203 |
| 334 | Ga0436363_0259999 | 3300039450 | Bacteria | 4253 |
| 335 | Ga0436363_1697570 | 3300039450 | Bacteria | 1316 |
| 336 | Ga0436362_1201805 | 3300039453 | Bacteria | 2123 |
| 337 | Ga0439436_0009638 | 3300041404 | Bacteria | 2960 |
| 338 | Ga0439438_048316 | 3300041405 | Bacteria | 1089 |
| 339 | Ga0439461_0028331 | 3300041410 | Bacteria | 1153 |
| 340 | Ga0439466_0041491 | 3300041411 | Bacteria | 1535 |
| 341 | Ga0439445_0064834 | 3300042004 | Bacteria | 1004 |
| 342 | Ga0439449_0030465 | 3300042007 | Bacteria | 2011 |
| 343 | Ga0450920_008222 | 3300042122 | Bacteria | 1904 |
| 344 | Ga0439434_0033988 | 3300042435 | Bacteria | 1556 |
| 345 | Ga0439459_0016431 | 3300042438 | Bacteria | 1368 |
| 346 | Ga0450918_007484 | 3300042531 | Bacteria | 1930 |
| 347 | Ga0466972_0000223 | 3300044658 | Bacteria | 40015 |
| 348 | Ga0466972_0064291 | 3300044658 | Bacteria | 1756 |
| 349 | Ga0466965_0051073 | 3300044683 | Bacteria | 2051 |
| 350 | Ga0466965_0057454 | 3300044683 | Bacteria | 1939 |
| 351 | Ga0466966_0034491 | 3300044684 | Bacteria | 3271 |
| 352 | Ga0466966_0089095 | 3300044684 | Bacteria | 1917 |
| 353 | Ga0466966_0165812 | 3300044684 | Bacteria | 1344 |
| 354 | Ga0466964_0030074 | 3300044706 | Bacteria | 2148 |
| 355 | Ga0466968_0152879 | 3300044735 | Bacteria | 1061 |
| 356 | Ga0466970_0113606 | 3300044765 | Bacteria | 1480 |
| 357 | Ga0466970_0203836 | 3300044765 | Bacteria | 1101 |
| 358 | Ga0466957_0021800 | 3300044842 | Bacteria | 3776 |
| 359 | Ga0466960_0058915 | 3300044901 | Bacteria | 1877 |
| 360 | Ga0451576_0673963 | 3300045051 | Bacteria | 1087 |
| 361 | Ga0495592_0006028 | 3300046454 | Bacteria | 9014 |
| 362 | Ga0495592_0042076 | 3300046454 | Bacteria | 3422 |
| 363 | Ga0495629_0007893 | 3300046459 | Bacteria | 7829 |
| 364 | Ga0495638_0011564 | 3300046460 | Bacteria | 6081 |
| 365 | Ga0495651_0003476 | 3300046462 | Bacteria | 12075 |
| 366 | Ga0495651_0014212 | 3300046462 | Bacteria | 6153 |
| 367 | Ga0495653_0029927 | 3300046463 | Bacteria | 4339 |
| 368 | Ga0495650_0035367 | 3300046471 | Bacteria | 2200 |
| 369 | Ga0495662_0101687 | 3300046476 | Bacteria | 1406 |
| 370 | Ga0495606_0006924 | 3300046507 | Bacteria | 10312 |
| 371 | Ga0495606_0053038 | 3300046507 | Bacteria | 2633 |
| 372 | Ga0495608_0010132 | 3300046511 | Bacteria | 6573 |
| 373 | Ga0495608_0010325 | 3300046511 | Bacteria | 6517 |
| 374 | Ga0495628_0013956 | 3300046516 | Bacteria | 6746 |
| 375 | Ga0495628_0028035 | 3300046516 | Bacteria | 4580 |
| 376 | Ga0495643_0077064 | 3300046522 | Bacteria | 1742 |
| 377 | Ga0495643_0183023 | 3300046522 | Bacteria | 1017 |
| 378 | Ga0495648_0009261 | 3300046524 | Bacteria | 7654 |
| 379 | Ga0495652_0033972 | 3300046529 | Bacteria | 4447 |
| 380 | Ga0495652_0040135 | 3300046529 | Bacteria | 4045 |
| 381 | Ga0495652_0060027 | 3300046529 | Bacteria | 3215 |
| 382 | Ga0495654_0079440 | 3300046530 | Bacteria | 1541 |
| 383 | Ga0495640_0053526 | 3300046533 | Bacteria | 2767 |
| 384 | Ga0495587_0066043 | 3300046536 | Bacteria | 2111 |
| 385 | Ga0495597_0051636 | 3300046542 | Bacteria | 1812 |
| 386 | Ga0495597_0133895 | 3300046542 | Bacteria | 1026 |
| 387 | Ga0495645_0032890 | 3300046543 | Bacteria | 3783 |
| 388 | Ga0495622_0055998 | 3300046557 | Bacteria | 1828 |
| 389 | Ga0495633_0059342 | 3300046558 | Bacteria | 1794 |
| 390 | Ga0495633_0172630 | 3300046558 | Bacteria | 996 |
| 391 | Ga0495667_0019541 | 3300046559 | Bacteria | 4571 |
| 392 | Ga0495668_0062432 | 3300046616 | Bacteria | 2053 |
| 393 | Ga0495634_0023196 | 3300046642 | Bacteria | 4364 |
| 394 | Ga0495611_0138584 | 3300046648 | Bacteria | 1136 |
| 395 | Ga0495625_0171361 | 3300046660 | Bacteria | 1449 |
| 396 | Ga0495625_0301726 | 3300046660 | Bacteria | 1025 |
| 397 | Ga0495635_0015040 | 3300046663 | Bacteria | 5413 |
| 398 | Ga0495635_0055541 | 3300046663 | Bacteria | 2728 |
| 399 | Ga0495588_0000802 | 3300046674 | Bacteria | 14062 |
| 400 | Ga0495588_0036609 | 3300046674 | Bacteria | 2490 |
| 401 | Ga0495588_0065733 | 3300046674 | Bacteria | 1882 |
| 402 | Ga0495657_0001348 | 3300046675 | Bacteria | 21351 |
| 403 | Ga0495657_0042744 | 3300046675 | Bacteria | 3092 |
| 404 | Ga0495646_0066146 | 3300046680 | Bacteria | 2138 |
| 405 | Ga0495624_0123402 | 3300046690 | Bacteria | 1590 |
| 406 | Ga0495671_0027713 | 3300046692 | Bacteria | 2923 |
| 407 | Ga0495649_0006416 | 3300046694 | Bacteria | 7323 |
| 408 | Ga0495589_0074662 | 3300046794 | Bacteria | 1654 |
| 409 | Ga0495600_0001805 | 3300046809 | Bacteria | 11977 |
| 410 | Ga0495600_0013217 | 3300046809 | Bacteria | 5183 |
| 411 | Ga0495600_0020788 | 3300046809 | Bacteria | 4200 |
| 412 | Ga0495581_0059334 | 3300047315 | Bacteria | 2211 |
| 413 | Ga0495604_0006572 | 3300047317 | Bacteria | 9216 |
| 414 | Ga0495604_0009422 | 3300047317 | Bacteria | 7724 |
| 415 | Ga0495604_0111853 | 3300047317 | Bacteria | 1990 |
| 416 | Ga0495674_0061626 | 3300047319 | Bacteria | 3268 |
| 417 | Ga0495676_0031415 | 3300047321 | Bacteria | 4492 |
| 418 | Ga0495680_0061574 | 3300047322 | Bacteria | 2886 |
| 419 | Ga0495683_0032722 | 3300047323 | Bacteria | 2648 |
| 420 | Ga0495687_007327 | 3300047443 | Bacteria | 6524 |
| 421 | Ga0495675_0013083 | 3300047444 | Bacteria | 5234 |
| 422 | Ga0495681_0000633 | 3300047470 | Bacteria | 26818 |
| 423 | Ga0495684_0036589 | 3300047471 | Bacteria | 3763 |
| 424 | Ga0495686_0127232 | 3300047472 | Bacteria | 1514 |
| 425 | Ga0495686_0221231 | 3300047472 | Bacteria | 1077 |
| 426 | Ga0495602_0017394 | 3300048088 | Bacteria | 7209 |
| 427 | Ga0496100_0080677 | 3300048903 | Bacteria | 2196 |
| 428 | Ga0496101_0242986 | 3300048904 | Bacteria | 1401 |
| 429 | Ga0496102_0026452 | 3300048905 | Bacteria | 5174 |
| 430 | Ga0496102_0198851 | 3300048905 | Bacteria | 1889 |
| 431 | Ga0496102_0241985 | 3300048905 | Bacteria | 1701 |
| 432 | Ga0496102_0421276 | 3300048905 | Bacteria | 1254 |
| 433 | Ga0496103_0011150 | 3300048906 | Bacteria | 5323 |
| 434 | Ga0496103_0313582 | 3300048906 | Bacteria | 1009 |
| 435 | Ga0496104_0023025 | 3300048907 | Bacteria | 5724 |
| 436 | Ga0496104_0094352 | 3300048907 | Bacteria | 2862 |
| 437 | Ga0496105_0030560 | 3300048908 | Bacteria | 4413 |
| 438 | Ga0496105_0376154 | 3300048908 | Bacteria | 1131 |
| 439 | Ga0496106_0123728 | 3300048909 | Bacteria | 2023 |
| 440 | Ga0496106_0554551 | 3300048909 | Bacteria | 922 |
| 441 | Ga0496107_0021362 | 3300048910 | Bacteria | 4575 |
| 442 | Ga0496108_0014576 | 3300048911 | Bacteria | 6417 |
| 443 | Ga0496108_0202889 | 3300048911 | Bacteria | 1721 |
| 444 | Ga0496109_0023600 | 3300048912 | Bacteria | 5460 |
| 445 | Ga0496110_0089212 | 3300048913 | Bacteria | 2756 |
| 446 | Ga0496110_0182006 | 3300048913 | Bacteria | 1908 |
| 447 | Ga0496111_0010417 | 3300048914 | Bacteria | 6238 |
| 448 | Ga0496111_0399674 | 3300048914 | Bacteria | 1015 |
| 449 | Ga0496112_0028981 | 3300048915 | Bacteria | 5350 |
| 450 | Ga0496113_0054041 | 3300048916 | Bacteria | 3005 |
| 451 | Ga0496113_0072547 | 3300048916 | Bacteria | 2620 |
| 452 | Ga0496113_0408218 | 3300048916 | Bacteria | 1091 |
| 453 | Ga0496116_0000135 | 3300048919 | Bacteria | 153165 |
| 454 | Ga0496116_0013446 | 3300048919 | Bacteria | 6598 |
| 455 | Ga0496117_0000030 | 3300048920 | Bacteria | 389141 |
| 456 | Ga0496117_0000036 | 3300048920 | Bacteria | 325635 |
| 457 | Ga0496117_0002215 | 3300048920 | Bacteria | 25150 |
| 458 | Ga0496117_0027761 | 3300048920 | Bacteria | 4399 |
| 459 | Ga0496117_0149213 | 3300048920 | Bacteria | 1386 |
| 460 | Ga0496118_0015167 | 3300048921 | Bacteria | 7155 |
| 461 | Ga0496118_0015347 | 3300048921 | Bacteria | 7096 |
| 462 | Ga0496118_0045413 | 3300048921 | Bacteria | 3430 |
| 463 | Ga0496118_0109917 | 3300048921 | Bacteria | 1833 |
| 464 | Ga0496118_0217436 | 3300048921 | Bacteria | 1115 |
| 465 | Ga0496119_0013167 | 3300048922 | Bacteria | 6617 |
| 466 | Ga0496119_0056490 | 3300048922 | Bacteria | 2378 |
| 467 | Ga0496119_0088051 | 3300048922 | Bacteria | 1771 |
| 468 | Ga0496120_0001375 | 3300048923 | Bacteria | 29703 |
| 469 | Ga0496120_0006733 | 3300048923 | Bacteria | 8733 |
| 470 | Ga0496120_0031758 | 3300048923 | Bacteria | 3193 |
| 471 | Ga0496120_0056525 | 3300048923 | Bacteria | 2214 |
| 472 | Ga0496120_0097036 | 3300048923 | Bacteria | 1564 |
| 473 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 474 | Ga0496121_0000180 | 3300048924 | Bacteria | 141128 |
| 475 | Ga0496121_0090651 | 3300048924 | Bacteria | 2389 |
| 476 | Ga0496121_0114301 | 3300048924 | Bacteria | 2052 |
| 477 | Ga0496121_0157261 | 3300048924 | Bacteria | 1666 |
| 478 | Ga0496121_0263191 | 3300048924 | Bacteria | 1189 |
| 479 | Ga0496121_0263192 | 3300048924 | Bacteria | 1189 |
| 480 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 481 | Ga0496122_0000050 | 3300048925 | Bacteria | 267874 |
| 482 | Ga0496122_0000107 | 3300048925 | Bacteria | 193163 |
| 483 | Ga0496122_0043126 | 3300048925 | Bacteria | 3538 |
| 484 | Ga0496122_0131503 | 3300048925 | Bacteria | 1588 |
| 485 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 486 | Ga0496123_0000023 | 3300048926 | Bacteria | 346894 |
| 487 | Ga0496123_0000063 | 3300048926 | Bacteria | 216072 |
| 488 | Ga0496123_0022678 | 3300048926 | Bacteria | 4830 |
| 489 | Ga0496123_0116701 | 3300048926 | Bacteria | 1511 |
| 490 | Ga0496124_0000239 | 3300048927 | Bacteria | 106633 |
| 491 | Ga0496124_0001743 | 3300048927 | Bacteria | 30475 |
| 492 | Ga0496124_0006693 | 3300048927 | Bacteria | 12475 |
| 493 | Ga0496124_0032989 | 3300048927 | Bacteria | 4563 |
| 494 | Ga0496124_0049059 | 3300048927 | Bacteria | 3603 |
| 495 | Ga0496124_0050788 | 3300048927 | Bacteria | 3531 |
| 496 | Ga0496124_0130593 | 3300048927 | Bacteria | 1996 |
| 497 | Ga0496124_0147380 | 3300048927 | Bacteria | 1851 |
| 498 | Ga0496124_0159222 | 3300048927 | Bacteria | 1762 |
| 499 | Ga0496124_0217407 | 3300048927 | Bacteria | 1440 |
| 500 | Ga0496124_0274835 | 3300048927 | Bacteria | 1231 |
| 501 | Ga0496125_0000200 | 3300048928 | Bacteria | 126369 |
| 502 | Ga0496125_0000306 | 3300048928 | Bacteria | 96360 |
| 503 | Ga0496125_0044724 | 3300048928 | Bacteria | 3738 |
| 504 | Ga0496125_0201461 | 3300048928 | Bacteria | 1302 |
| 505 | Ga0496126_0000129 | 3300048929 | Bacteria | 174059 |
| 506 | Ga0496126_0000188 | 3300048929 | Bacteria | 139625 |
| 507 | Ga0496126_0022621 | 3300048929 | Bacteria | 6110 |
| 508 | Ga0496126_0108299 | 3300048929 | Bacteria | 2423 |
| 509 | Ga0496126_0270131 | 3300048929 | Bacteria | 1411 |
| 510 | Ga0496126_0288362 | 3300048929 | Bacteria | 1358 |
| 511 | Ga0496126_0330264 | 3300048929 | Bacteria | 1251 |
| 512 | Ga0495682_0005057 | 3300049460 | Bacteria | 5538 |
| 513 | Ga0501031_0042424 | 3300049568 | Bacteria | 2969 |
| 514 | Ga0501031_0074864 | 3300049568 | Bacteria | 2204 |
| 515 | Ga0501031_0276600 | 3300049568 | Bacteria | 1089 |
| 516 | Ga0501032_0000004 | 3300049569 | Bacteria | 310855 |
| 517 | Ga0501032_0002753 | 3300049569 | Bacteria | 13683 |
| 518 | Ga0501032_0078299 | 3300049569 | Bacteria | 2201 |
| 519 | Ga0501033_0000016 | 3300049570 | Bacteria | 217458 |
| 520 | Ga0501033_0000438 | 3300049570 | Bacteria | 39916 |
| 521 | Ga0501033_0004986 | 3300049570 | Bacteria | 10556 |
| 522 | Ga0501033_0019437 | 3300049570 | Bacteria | 5137 |
| 523 | Ga0501034_0000011 | 3300049571 | Bacteria | 310855 |
| 524 | Ga0501034_0000712 | 3300049571 | Bacteria | 50543 |
| 525 | Ga0501034_0002438 | 3300049571 | Bacteria | 22442 |
| 526 | Ga0501034_0002517 | 3300049571 | Bacteria | 21984 |
| 527 | Ga0501034_0004793 | 3300049571 | Bacteria | 14958 |
| 528 | Ga0501034_0045426 | 3300049571 | Bacteria | 4438 |
| 529 | Ga0501034_0184508 | 3300049571 | Bacteria | 2050 |
| 530 | Ga0501034_0251611 | 3300049571 | Bacteria | 1711 |
| 531 | Ga0501034_0488861 | 3300049571 | Bacteria | 1145 |
| 532 | Ga0501036_0000001 | 3300049572 | Bacteria | 310855 |
| 533 | Ga0501036_0003294 | 3300049572 | Bacteria | 12883 |
| 534 | Ga0501036_0006995 | 3300049572 | Bacteria | 9182 |
| 535 | Ga0501036_0065241 | 3300049572 | Bacteria | 3082 |
| 536 | Ga0501036_0092384 | 3300049572 | Bacteria | 2556 |
| 537 | Ga0501036_0179313 | 3300049572 | Bacteria | 1784 |
| 538 | Ga0501037_0000006 | 3300049573 | Bacteria | 217461 |
| 539 | Ga0501037_0000722 | 3300049573 | Bacteria | 25036 |
| 540 | Ga0501037_0005086 | 3300049573 | Bacteria | 9569 |
| 541 | Ga0501037_0048495 | 3300049573 | Bacteria | 3111 |
| 542 | Ga0501037_0064525 | 3300049573 | Bacteria | 2669 |
| 543 | Ga0501037_0175549 | 3300049573 | Bacteria | 1522 |
| 544 | Ga0501038_0000003 | 3300049574 | Bacteria | 310855 |
| 545 | Ga0501038_0000047 | 3300049574 | Bacteria | 104311 |
| 546 | Ga0501038_0006213 | 3300049574 | Bacteria | 11049 |
| 547 | Ga0501038_0071935 | 3300049574 | Bacteria | 2932 |
| 548 | Ga0501038_0096508 | 3300049574 | Bacteria | 2467 |
| 549 | Ga0501038_0187849 | 3300049574 | Bacteria | 1664 |
| 550 | Ga0501038_0256190 | 3300049574 | Bacteria | 1384 |
| 551 | Ga0501039_0000004 | 3300049575 | Bacteria | 310855 |
| 552 | Ga0501039_0000038 | 3300049575 | Bacteria | 119484 |
| 553 | Ga0501039_0001298 | 3300049575 | Bacteria | 18251 |
| 554 | Ga0501039_0002554 | 3300049575 | Bacteria | 13579 |
| 555 | Ga0501040_0002512 | 3300049576 | Bacteria | 11813 |
| 556 | Ga0501040_0012498 | 3300049576 | Bacteria | 5563 |
| 557 | Ga0501041_0082274 | 3300049577 | Bacteria | 1983 |
| 558 | Ga0501042_0022636 | 3300049578 | Bacteria | 4390 |
| 559 | Ga0501042_0083948 | 3300049578 | Bacteria | 2283 |
| 560 | Ga0501042_0370607 | 3300049578 | Bacteria | 1036 |
| 561 | Ga0501043_0000131 | 3300049579 | Bacteria | 69743 |
| 562 | Ga0501043_0000155 | 3300049579 | Bacteria | 62570 |
| 563 | Ga0501043_0011433 | 3300049579 | Bacteria | 6949 |
| 564 | Ga0501043_0013677 | 3300049579 | Bacteria | 6352 |
| 565 | Ga0501043_0075709 | 3300049579 | Bacteria | 2643 |
| 566 | Ga0501043_0148232 | 3300049579 | Bacteria | 1836 |
| 567 | Ga0501046_0001714 | 3300049580 | Bacteria | 20920 |
| 568 | Ga0501046_0068786 | 3300049580 | Bacteria | 2756 |
| 569 | Ga0501046_0139899 | 3300049580 | Bacteria | 1832 |
| 570 | Ga0501047_0021199 | 3300049581 | Bacteria | 6240 |
| 571 | Ga0501047_0103798 | 3300049581 | Bacteria | 2723 |
| 572 | Ga0501047_0191688 | 3300049581 | Bacteria | 1907 |
| 573 | Ga0501047_0314333 | 3300049581 | Bacteria | 1407 |
| 574 | Ga0501048_0022766 | 3300049582 | Bacteria | 4581 |
| 575 | Ga0501048_0053324 | 3300049582 | Bacteria | 2876 |
| 576 | Ga0501069_0002311 | 3300049585 | Bacteria | 9623 |
| 577 | Ga0501070_0022569 | 3300049586 | Bacteria | 5271 |
| 578 | Ga0501070_0047177 | 3300049586 | Bacteria | 3581 |
| 579 | Ga0501070_0178399 | 3300049586 | Bacteria | 1748 |
| 580 | Ga0501070_0521760 | 3300049586 | Bacteria | 953 |
| 581 | Ga0501071_0177923 | 3300049587 | Bacteria | 1593 |
| 582 | Ga0501071_0231418 | 3300049587 | Bacteria | 1392 |
| 583 | Ga0501073_0002004 | 3300049589 | Bacteria | 15198 |
| 584 | Ga0501074_0005021 | 3300049590 | Bacteria | 9496 |
| 585 | Ga0501074_0106220 | 3300049590 | Bacteria | 2010 |
| 586 | Ga0501075_0267942 | 3300049591 | Bacteria | 1302 |
| 587 | Ga0501075_0420454 | 3300049591 | Bacteria | 1019 |
| 588 | Ga0501076_0120412 | 3300049592 | Bacteria | 2125 |
| 589 | Ga0501079_0077058 | 3300049741 | Bacteria | 2579 |
| 590 | Ga0501080_0002095 | 3300049742 | Bacteria | 17315 |
| 591 | Ga0501080_0092647 | 3300049742 | Bacteria | 2806 |
| 592 | Ga0501080_0347999 | 3300049742 | Bacteria | 1339 |
| 593 | Ga0501083_0013585 | 3300049744 | Bacteria | 5693 |
| 594 | Ga0501083_0161515 | 3300049744 | Bacteria | 1466 |
| 595 | Ga0501035_0000009 | 3300049822 | Bacteria | 310827 |
| 596 | Ga0501035_0000553 | 3300049822 | Bacteria | 41541 |
| 597 | Ga0501035_0011132 | 3300049822 | Bacteria | 8331 |
| 598 | Ga0501035_0070342 | 3300049822 | Bacteria | 3100 |
| 599 | Ga0501044_0000005 | 3300049823 | Bacteria | 310855 |
| 600 | Ga0501044_0002857 | 3300049823 | Bacteria | 19658 |
| 601 | Ga0501044_0013594 | 3300049823 | Bacteria | 8797 |
| 602 | Ga0501044_0053088 | 3300049823 | Bacteria | 4172 |
| 603 | Ga0501044_0079125 | 3300049823 | Bacteria | 3331 |
| 604 | Ga0501044_0246023 | 3300049823 | Bacteria | 1731 |
| 605 | Ga0501045_0030010 | 3300049824 | Bacteria | 3933 |
| 606 | Ga0501045_0108466 | 3300049824 | Bacteria | 2058 |
| 607 | Ga0501045_0178364 | 3300049824 | Bacteria | 1583 |
| 608 | nmdc:mga03683_1610_c1 | 3300050489 | Bacteria | 6761 |
| 609 | nmdc:mga00v17_32885_c1 | 3300050491 | Bacteria | 3069 |
| 610 | nmdc:mga00v17_68286_c1 | 3300050491 | Bacteria | 2197 |
| 611 | nmdc:mga00v17_78_c1 | 3300050491 | Bacteria | 40508 |
| 612 | nmdc:mga0yw44_5347_c1 | 3300050492 | Bacteria | 6047 |
| 613 | nmdc:mga0yw44_849_c1 | 3300050492 | Bacteria | 1904 |
| 614 | nmdc:mga0k408_44631_c1 | 3300050493 | Bacteria | 2557 |
| 615 | nmdc:mga0k408_5881_c1 | 3300050493 | Bacteria | 6539 |
| 616 | nmdc:mga0k408_96574_c1 | 3300050493 | Bacteria | 1740 |
| 617 | nmdc:mga06z11_163794_c1 | 3300050494 | Bacteria | 1273 |
| 618 | nmdc:mga06z11_4521_c1 | 3300050494 | Bacteria | 5477 |
| 619 | nmdc:mga06z11_89330_c1 | 3300050494 | Bacteria | 1670 |
| 620 | nmdc:mga07m45_352464_c1 | 3300050496 | Bacteria | 855 |
| 621 | nmdc:mga07m45_7487_c1 | 3300050496 | Bacteria | 5580 |
| 622 | nmdc:mga07m45_9056_c1 | 3300050496 | Bacteria | 5143 |
| 623 | nmdc:mga05p37_13489_c1 | 3300050507 | Bacteria | 9792 |
| 624 | nmdc:mga05p37_704927_c1 | 3300050507 | Bacteria | 1120 |
| 625 | nmdc:mga0n895_5560_c1 | 3300050512 | Bacteria | 10552 |
| 626 | nmdc:mga0rr50_99336_c1 | 3300050513 | Bacteria | 2283 |
| 627 | nmdc:mga08x19_122782_c1 | 3300050514 | Bacteria | 1742 |
| 628 | nmdc:mga0sz30_13288_c1 | 3300050516 | Bacteria | 3222 |
| 629 | nmdc:mga0sz30_97976_c1 | 3300050516 | Bacteria | 1279 |
| 630 | Ga0495601_0007438 | 3300053077 | Bacteria | 6422 |
| 631 | Ga0495655_0002096 | 3300053083 | Bacteria | 3131 |
| 632 | Ga0495655_0020785 | 3300053083 | Bacteria | 1477 |
| 633 | Ga0495619_0046222 | 3300053085 | Bacteria | 2862 |
| 634 | Ga0500578_0054365 | 3300053086 | Bacteria | 2564 |
| 635 | Ga0500643_000272 | 3300053087 | Bacteria | 45523 |
| 636 | Ga0500646_0020067 | 3300053090 | Bacteria | 1773 |
| 637 | Ga0500583_0030175 | 3300053092 | Bacteria | 2372 |
| 638 | Ga0500583_0104032 | 3300053092 | Bacteria | 1393 |
| 639 | Ga0500566_0011157 | 3300053094 | Bacteria | 5295 |
| 640 | Ga0500650_0032741 | 3300053098 | Bacteria | 2369 |
| 641 | Ga0500555_001807 | 3300053103 | Bacteria | 6381 |
| 642 | Ga0500555_043784 | 3300053103 | Bacteria | 1240 |
| 643 | Ga0500556_0005396 | 3300053104 | Bacteria | 3610 |
| 644 | Ga0500557_000009 | 3300053105 | Bacteria | 125806 |
| 645 | Ga0500560_000929 | 3300053107 | Bacteria | 4624 |
| 646 | Ga0500562_049156 | 3300053108 | Bacteria | 1127 |
| 647 | Ga0500569_001637 | 3300053109 | Bacteria | 4263 |
| 648 | Ga0500595_026901 | 3300053119 | Bacteria | 1976 |
| 649 | Ga0500618_000109 | 3300053125 | Bacteria | 66318 |
| 650 | Ga0500618_000758 | 3300053125 | Bacteria | 18265 |
| 651 | Ga0500618_010434 | 3300053125 | Bacteria | 2492 |
| 652 | Ga0500642_0000126 | 3300053130 | Bacteria | 34999 |
| 653 | Ga0500559_0009874 | 3300053136 | Bacteria | 4115 |
| 654 | Ga0500568_0010767 | 3300053139 | Bacteria | 4268 |
| 655 | Ga0500568_0038714 | 3300053139 | Bacteria | 1929 |
| 656 | Ga0500574_004572 | 3300053141 | Bacteria | 2600 |
| 657 | Ga0500588_0048571 | 3300053146 | Bacteria | 1313 |
| 658 | Ga0500590_177452 | 3300053148 | Bacteria | 929 |
| 659 | Ga0500604_0013645 | 3300053151 | Bacteria | 2204 |
| 660 | Ga0500616_0000402 | 3300053153 | Bacteria | 59210 |
| 661 | Ga0500616_0078858 | 3300053153 | Bacteria | 1660 |
| 662 | Ga0500622_0000189 | 3300053156 | Bacteria | 65129 |
| 663 | Ga0500622_0012016 | 3300053156 | Bacteria | 4707 |
| 664 | Ga0500624_001860 | 3300053157 | Bacteria | 3054 |
| 665 | Ga0500634_0000143 | 3300053161 | Bacteria | 25845 |
| 666 | Ga0500636_0000005 | 3300053177 | Bacteria | 197561 |
| 667 | Ga0500636_0001421 | 3300053177 | Bacteria | 13046 |
| 668 | Ga0500636_0001769 | 3300053177 | Bacteria | 11836 |
| 669 | Ga0500625_026314 | 3300053729 | Bacteria | 2755 |
| 670 | Ga0500645_027106 | 3300053730 | Bacteria | 1739 |
| 671 | Ga0500601_000404 | 3300053737 | Bacteria | 7292 |
| 672 | Ga0501084_0067885 | 3300054114 | Bacteria | 2985 |
| 673 | Ga0500661_005829 | 3300055283 | Bacteria | 2297 |
| 674 | Ga0587084_000357 | 3300059477 | Bacteria | 3418 |
| 675 | Ga0587093_000659 | 3300059478 | Bacteria | 2548 |
| 676 | Ga0587066_000135 | 3300059490 | Bacteria | 4489 |
| 677 | Ga0587066_000656 | 3300059490 | Bacteria | 2987 |
| 678 | Ga0587070_001080 | 3300059491 | Bacteria | 2671 |
| 679 | Ga0587073_0001291 | 3300059492 | Bacteria | 2855 |
| 680 | Ga0587073_0003254 | 3300059492 | Bacteria | 2210 |
| 681 | Ga0587077_000087 | 3300059493 | Bacteria | 5018 |
| 682 | Ga0587077_000129 | 3300059493 | Bacteria | 4729 |
| 683 | Ga0587077_000304 | 3300059493 | Bacteria | 3818 |
| 684 | Ga0587077_000388 | 3300059493 | Bacteria | 3615 |
| 685 | Ga0587077_001130 | 3300059493 | Bacteria | 2738 |
| 686 | Ga0587077_001716 | 3300059493 | Bacteria | 2423 |
| 687 | Ga0587077_002096 | 3300059493 | Bacteria | 2297 |
| 688 | Ga0587077_004542 | 3300059493 | Bacteria | 1833 |
| 689 | Ga0587077_010618 | 3300059493 | Bacteria | 1428 |
| 690 | Ga0587080_000518 | 3300059503 | Bacteria | 3359 |
| 691 | Ga0587080_009095 | 3300059503 | Bacteria | 1437 |
| 692 | Ga0587080_014312 | 3300059503 | Bacteria | 1226 |
| 693 | Ga0587082_000655 | 3300059504 | Bacteria | 3080 |
| 694 | Ga0587082_000979 | 3300059504 | Bacteria | 2747 |
| 695 | Ga0587082_005145 | 3300059504 | Bacteria | 1685 |
| 696 | Ga0587082_006855 | 3300059504 | Bacteria | 1535 |
| 697 | Ga0587083_0000454 | 3300059505 | Bacteria | 3619 |
| 698 | Ga0587083_0018555 | 3300059505 | Bacteria | 1260 |
| 699 | Ga0587083_0018676 | 3300059505 | Bacteria | 1257 |
| 700 | Ga0587085_000934 | 3300059506 | Bacteria | 2480 |
| 701 | Ga0587086_000291 | 3300059507 | Bacteria | 3321 |
| 702 | Ga0587086_000870 | 3300059507 | Bacteria | 2421 |
| 703 | Ga0587086_002677 | 3300059507 | Bacteria | 1716 |
| 704 | Ga0587088_000088 | 3300059508 | Bacteria | 4950 |
| 705 | Ga0587088_000232 | 3300059508 | Bacteria | 3953 |
| 706 | Ga0587088_016005 | 3300059508 | Bacteria | 1189 |
| 707 | Ga0587090_000159 | 3300059510 | Bacteria | 4620 |
| 708 | Ga0587090_012561 | 3300059510 | Bacteria | 1210 |
| 709 | Ga0587091_005524 | 3300059511 | Bacteria | 1727 |
| 710 | Ga0587094_000967 | 3300059513 | Bacteria | 2538 |
| 711 | Ga0587094_004811 | 3300059513 | Bacteria | 1553 |
| 712 | Ga0587098_000159 | 3300059604 | Bacteria | 3320 |
| 713 | Ga0587098_000350 | 3300059604 | Bacteria | 2667 |
| 714 | Ga0587098_000719 | 3300059604 | Bacteria | 2197 |
| 715 | Ga0587098_001925 | 3300059604 | Bacteria | 1685 |
| 716 | Ga0587098_007867 | 3300059604 | Bacteria | 1120 |
| 717 | Ga0587106_000297 | 3300059605 | Bacteria | 3175 |
| 718 | Ga0587106_000609 | 3300059605 | Bacteria | 2665 |
| 719 | Ga0587125_000212 | 3300059607 | Bacteria | 2904 |
| 720 | Ga0587125_000670 | 3300059607 | Bacteria | 2157 |
| 721 | Ga0587129_000232 | 3300059608 | Bacteria | 2294 |
| 722 | Ga0587099_000098 | 3300059622 | Bacteria | 3439 |
| 723 | Ga0587101_000175 | 3300059623 | Bacteria | 3681 |
| 724 | Ga0587101_000271 | 3300059623 | Bacteria | 3302 |
| 725 | Ga0587101_000510 | 3300059623 | Bacteria | 2795 |
| 726 | Ga0587101_001063 | 3300059623 | Bacteria | 2239 |
| 727 | Ga0587101_011076 | 3300059623 | Bacteria | 1145 |
| 728 | Ga0587113_000218 | 3300059625 | Bacteria | 2675 |
| 729 | Ga0587115_000092 | 3300059626 | Bacteria | 4526 |
| 730 | Ga0587115_000779 | 3300059626 | Bacteria | 2598 |
| 731 | Ga0587117_001340 | 3300059627 | Bacteria | 2056 |
| 732 | Ga0587128_000033 | 3300059630 | Bacteria | 5729 |
| 733 | Ga0587128_000233 | 3300059630 | Bacteria | 3525 |
| 734 | Ga0587128_001934 | 3300059630 | Bacteria | 2069 |
| 735 | Ga0587128_013650 | 3300059630 | Bacteria | 1150 |
| 736 | Ga0587062_000077 | 3300059639 | Bacteria | 4636 |
| 737 | Ga0587062_000513 | 3300059639 | Bacteria | 2783 |
| 738 | Ga0587062_000878 | 3300059639 | Bacteria | 2355 |
| 739 | Ga0587067_000896 | 3300059640 | Bacteria | 2966 |
| 740 | Ga0587068_000701 | 3300059641 | Bacteria | 3293 |
| 741 | Ga0587069_000544 | 3300059642 | Bacteria | 2898 |
| 742 | Ga0587072_000323 | 3300059643 | Bacteria | 4535 |
| 743 | Ga0587072_001126 | 3300059643 | Bacteria | 3164 |
| 744 | Ga0587075_000291 | 3300059644 | Bacteria | 3625 |
| 745 | Ga0587075_000401 | 3300059644 | Bacteria | 3346 |
| 746 | Ga0587076_001077 | 3300059645 | Bacteria | 2648 |
| 747 | Ga0587076_005116 | 3300059645 | Bacteria | 1681 |
| 748 | Ga0587078_000332 | 3300059646 | Bacteria | 3358 |
| 749 | Ga0587079_000822 | 3300059647 | Bacteria | 3111 |
| 750 | Ga0587100_000069 | 3300059648 | Bacteria | 3621 |
| 751 | Ga0587102_000134 | 3300059649 | Bacteria | 3350 |
| 752 | Ga0587105_000149 | 3300059651 | Bacteria | 2263 |
| 753 | Ga0587107_000467 | 3300059652 | Bacteria | 2650 |
| 754 | Ga0587107_000611 | 3300059652 | Bacteria | 2463 |
| 755 | Ga0587110_003994 | 3300059654 | Bacteria | 1264 |
| 756 | Ga0587118_00239 | 3300059657 | Bacteria | 2532 |
| 757 | Ga0587119_000378 | 3300059658 | Bacteria | 2814 |
| 758 | Ga0587060_001450 | 3300060243 | Bacteria | 1555 |
| 759 | Ga0587096_00039 | 3300060247 | Bacteria | 2274 |
| 760 | Ga0587071_000669 | 3300060344 | Bacteria | 3653 |
| 761 | Ga0587071_030957 | 3300060344 | Bacteria | 1030 |
| 762 | Ga0587111_0000161 | 3300060346 | Bacteria | 4952 |
| 763 | Ga0587111_0001051 | 3300060346 | Bacteria | 3108 |
| 764 | Ga0501082_0010931 | 3300060353 | Bacteria | 7812 |
| 765 | Ga0466962_0041105 | 3300061719 | Bacteria | 2213 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005983 | Ga0081540_1069025 | Ga0081540_10690251 | 242 |
| 2 | 3300032004 | Ga0307414_10008732 | Ga0307414_100087324 | 242 |
| 3 | 3300044684 | Ga0466966_0089095 | Ga0466966_0089095_893_1705 | 244 |
| 4 | 3300044842 | Ga0466957_0021800 | Ga0466957_0021800_2796_3608 | 244 |
| 5 | 3300061719 | Ga0466962_0041105 | Ga0466962_0041105_1290_2102 | 244 |
| 6 | 3300053125 | Ga0500618_010434 | Ga0500618_010434_1244_2116 | 246 |
| 7 | 3300005334 | Ga0068869_100212736 | Ga0068869_1002127362 | 247 |
| 8 | 3300006178 | Ga0075367_10080727 | Ga0075367_100807272 | 248 |
| 9 | 3300046648 | Ga0495611_0138584 | Ga0495611_0138584_50_850 | 248 |
| 10 | 3300047472 | Ga0495686_0221231 | Ga0495686_0221231_29_829 | 248 |
| 11 | 3300048914 | Ga0496111_0399674 | Ga0496111_0399674_193_993 | 248 |
| 12 | 3300048927 | Ga0496124_0217407 | Ga0496124_0217407_24_824 | 248 |
| 13 | 3300048929 | Ga0496126_0270131 | Ga0496126_0270131_586_1386 | 248 |
| 14 | 3300049586 | Ga0501070_0521760 | Ga0501070_0521760_92_928 | 248 |
| 15 | 3300050494 | nmdc:mga06z11_163794_c1 | nmdc:mga06z11_163794_c1_183_1055 | 248 |
| 16 | 3300050496 | nmdc:mga07m45_352464_c1 | nmdc:mga07m45_352464_c1_10_810 | 248 |
| 17 | 3300053083 | Ga0495655_0020785 | Ga0495655_0020785_51_851 | 248 |
| 18 | 3300053139 | Ga0500568_0010767 | Ga0500568_0010767_175_1062 | 248 |
| 19 | 3300009545 | Ga0105237_10239726 | Ga0105237_102397262 | 250 |
| 20 | 3300025910 | Ga0207684_10151077 | Ga0207684_101510772 | 250 |
| 21 | 3300032004 | Ga0307414_10214893 | Ga0307414_102148932 | 250 |
| 22 | iso_pu_bacteria | 2876377896 | 2876380681 | 251 |
| 23 | 3300009176 | Ga0105242_10743290 | Ga0105242_107432901 | 254 |
| 24 | iso_pu_bacteria | 2838675328 | 2838680037 | 254 |
| 25 | iso_pu_bacteria | 2838724970 | 2838729679 | 254 |
| 26 | iso_pu_bacteria | 2842130223 | 2842134929 | 254 |
| 27 | iso_pu_bacteria | 2842224351 | 2842229724 | 254 |
| 28 | iso_pu_bacteria | 2933006813 | 2933006864 | 254 |
| 29 | 3300042004 | Ga0439445_0064834 | Ga0439445_0064834_82_933 | 255 |
| 30 | 3300002737 | JGI25162J39368_1000001 | JGI25162J39368_1000001127 | 256 |
| 31 | 3300002771 | JGI25163J39215_1004290 | JGI25163J39215_10042901 | 256 |
| 32 | 3300003214 | JGI25165J46597_1000001 | JGI25165J46597_1000001122 | 256 |
| 33 | 3300003751 | Ga0055538_1000001 | Ga0055538_1000001910 | 256 |
| 34 | 3300003752 | Ga0055539_1000001 | Ga0055539_1000001910 | 256 |
| 35 | 3300003756 | Ga0055533_1000003 | Ga0055533_1000003122 | 256 |
| 36 | 3300003759 | Ga0055525_1000003 | Ga0055525_1000003122 | 256 |
| 37 | 3300003841 | Ga0055541_1000001 | Ga0055541_1000001122 | 256 |
| 38 | 3300025224 | Ga0209784_100004 | Ga0209784_100004123 | 256 |
| 39 | 3300025225 | Ga0209566_100004 | Ga0209566_100004280 | 256 |
| 40 | 3300025226 | Ga0209674_100006 | Ga0209674_100006280 | 256 |
| 41 | 3300025230 | Ga0209563_100009 | Ga0209563_100009123 | 256 |
| 42 | 3300025231 | Ga0207427_100300 | Ga0207427_1003006 | 256 |
| 43 | 3300025233 | Ga0209437_100004 | Ga0209437_100004123 | 256 |
| 44 | 3300025253 | Ga0209677_100005 | Ga0209677_100005123 | 256 |
| 45 | 3300025261 | Ga0209233_1000005 | Ga0209233_1000005280 | 256 |
| 46 | 3300046454 | Ga0495592_0006028 | Ga0495592_0006028_6986_7915 | 256 |
| 47 | 3300046462 | Ga0495651_0014212 | Ga0495651_0014212_4025_4954 | 256 |
| 48 | 3300046463 | Ga0495653_0029927 | Ga0495653_0029927_2087_3016 | 256 |
| 49 | 3300046511 | Ga0495608_0010325 | Ga0495608_0010325_5318_6247 | 256 |
| 50 | 3300046516 | Ga0495628_0013956 | Ga0495628_0013956_4733_5662 | 256 |
| 51 | 3300046529 | Ga0495652_0033972 | Ga0495652_0033972_1380_2309 | 256 |
| 52 | 3300046675 | Ga0495657_0042744 | Ga0495657_0042744_407_1336 | 256 |
| 53 | 3300046690 | Ga0495624_0123402 | Ga0495624_0123402_238_1167 | 256 |
| 54 | 3300046809 | Ga0495600_0001805 | Ga0495600_0001805_7001_7930 | 256 |
| 55 | 3300047317 | Ga0495604_0111853 | Ga0495604_0111853_73_1002 | 256 |
| 56 | 3300053077 | Ga0495601_0007438 | Ga0495601_0007438_3526_4455 | 256 |
| 57 | 3300053119 | Ga0500595_026901 | Ga0500595_026901_397_1326 | 256 |
| 58 | 3300053141 | Ga0500574_004572 | Ga0500574_004572_1412_2341 | 256 |
| 59 | iso_pu_bacteria | 2599185210 | 2599603070 | 256 |
| 60 | iso_pu_bacteria | 2899792073 | 2899795908 | 256 |
| 61 | 3300049571 | Ga0501034_0251611 | Ga0501034_0251611_371_1207 | 257 |
| 62 | 3300049576 | Ga0501040_0002512 | Ga0501040_0002512_2553_3485 | 257 |
| 63 | 3300049578 | Ga0501042_0022636 | Ga0501042_0022636_919_1851 | 257 |
| 64 | 3300009553 | Ga0105249_10014920 | Ga0105249_100149206 | 259 |
| 65 | 3300025961 | Ga0207712_10035469 | Ga0207712_100354693 | 259 |
| 66 | 3300039437 | Ga0436365_1592281 | Ga0436365_1592281_57_905 | 259 |
| 67 | 3300046530 | Ga0495654_0079440 | Ga0495654_0079440_337_1209 | 259 |
| 68 | 3300048914 | Ga0496111_0010417 | Ga0496111_0010417_4800_5672 | 259 |
| 69 | 3300048924 | Ga0496121_0000180 | Ga0496121_0000180_51847_52752 | 259 |
| 70 | 3300048927 | Ga0496124_0050788 | Ga0496124_0050788_2276_3148 | 259 |
| 71 | 3300050491 | nmdc:mga00v17_78_c1 | nmdc:mga00v17_78_c1_22324_23157 | 259 |
| 72 | 3300053125 | Ga0500618_000109 | Ga0500618_000109_53623_54495 | 259 |
| 73 | 3300053125 | Ga0500618_000758 | Ga0500618_000758_16216_17088 | 259 |
| 74 | 3300003214 | JGI25165J46597_1001719 | JGI25165J46597_10017195 | 260 |
| 75 | 3300009036 | Ga0105244_10038235 | Ga0105244_100382353 | 260 |
| 76 | 3300009148 | Ga0105243_10070952 | Ga0105243_100709522 | 260 |
| 77 | 3300011119 | Ga0105246_10012435 | Ga0105246_100124356 | 260 |
| 78 | 3300013102 | Ga0157371_10000005 | Ga0157371_10000005382 | 260 |
| 79 | 3300037471 | Ga0395905_0456172 | Ga0395905_0456172_141_977 | 260 |
| 80 | 3300041404 | Ga0439436_0009638 | Ga0439436_0009638_1701_2537 | 260 |
| 81 | 3300041405 | Ga0439438_048316 | Ga0439438_048316_233_1069 | 260 |
| 82 | 3300041410 | Ga0439461_0028331 | Ga0439461_0028331_86_922 | 260 |
| 83 | 3300041411 | Ga0439466_0041491 | Ga0439466_0041491_152_988 | 260 |
| 84 | 3300042007 | Ga0439449_0030465 | Ga0439449_0030465_1060_1896 | 260 |
| 85 | 3300042122 | Ga0450920_008222 | Ga0450920_008222_173_1009 | 260 |
| 86 | 3300042435 | Ga0439434_0033988 | Ga0439434_0033988_261_1097 | 260 |
| 87 | 3300042531 | Ga0450918_007484 | Ga0450918_007484_653_1489 | 260 |
| 88 | 3300045051 | Ga0451576_0673963 | Ga0451576_0673963_220_1056 | 260 |
| 89 | 3300046522 | Ga0495643_0183023 | Ga0495643_0183023_40_876 | 260 |
| 90 | 3300046558 | Ga0495633_0059342 | Ga0495633_0059342_458_1294 | 260 |
| 91 | 3300046558 | Ga0495633_0172630 | Ga0495633_0172630_19_855 | 260 |
| 92 | 3300046660 | Ga0495625_0301726 | Ga0495625_0301726_145_981 | 260 |
| 93 | 3300048908 | Ga0496105_0376154 | Ga0496105_0376154_38_874 | 260 |
| 94 | 3300048913 | Ga0496110_0089212 | Ga0496110_0089212_1419_2255 | 260 |
| 95 | 3300048916 | Ga0496113_0054041 | Ga0496113_0054041_662_1498 | 260 |
| 96 | 3300048920 | Ga0496117_0000030 | Ga0496117_0000030_158639_159475 | 260 |
| 97 | 3300048920 | Ga0496117_0000036 | Ga0496117_0000036_300502_301338 | 260 |
| 98 | 3300048920 | Ga0496117_0002215 | Ga0496117_0002215_13352_14188 | 260 |
| 99 | 3300048921 | Ga0496118_0015347 | Ga0496118_0015347_39_875 | 260 |
| 100 | 3300048922 | Ga0496119_0056490 | Ga0496119_0056490_1479_2315 | 260 |
| 101 | 3300048923 | Ga0496120_0056525 | Ga0496120_0056525_1002_1838 | 260 |
| 102 | 3300048925 | Ga0496122_0000002 | Ga0496122_0000002_580026_580862 | 260 |
| 103 | 3300048925 | Ga0496122_0000050 | Ga0496122_0000050_10122_10958 | 260 |
| 104 | 3300048925 | Ga0496122_0131503 | Ga0496122_0131503_51_887 | 260 |
| 105 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_1230821_1231657 | 260 |
| 106 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_580026_580862 | 260 |
| 107 | 3300048926 | Ga0496123_0000023 | Ga0496123_0000023_117374_118210 | 260 |
| 108 | 3300048927 | Ga0496124_0001743 | Ga0496124_0001743_4610_5446 | 260 |
| 109 | 3300048927 | Ga0496124_0006693 | Ga0496124_0006693_1107_1943 | 260 |
| 110 | 3300048927 | Ga0496124_0049059 | Ga0496124_0049059_1974_2810 | 260 |
| 111 | 3300049568 | Ga0501031_0276600 | Ga0501031_0276600_234_1070 | 260 |
| 112 | 3300049569 | Ga0501032_0078299 | Ga0501032_0078299_736_1605 | 260 |
| 113 | 3300049572 | Ga0501036_0065241 | Ga0501036_0065241_1029_1898 | 260 |
| 114 | 3300049573 | Ga0501037_0175549 | Ga0501037_0175549_329_1198 | 260 |
| 115 | 3300049574 | Ga0501038_0187849 | Ga0501038_0187849_166_1035 | 260 |
| 116 | 3300049575 | Ga0501039_0002554 | Ga0501039_0002554_11365_12234 | 260 |
| 117 | 3300049577 | Ga0501041_0082274 | Ga0501041_0082274_307_1176 | 260 |
| 118 | 3300049578 | Ga0501042_0083948 | Ga0501042_0083948_619_1488 | 260 |
| 119 | 3300049587 | Ga0501071_0177923 | Ga0501071_0177923_62_931 | 260 |
| 120 | 3300049590 | Ga0501074_0106220 | Ga0501074_0106220_409_1278 | 260 |
| 121 | 3300049591 | Ga0501075_0420454 | Ga0501075_0420454_121_990 | 260 |
| 122 | 3300049592 | Ga0501076_0120412 | Ga0501076_0120412_803_1672 | 260 |
| 123 | 3300049741 | Ga0501079_0077058 | Ga0501079_0077058_1077_1946 | 260 |
| 124 | 3300050516 | nmdc:mga0sz30_97976_c1 | nmdc:mga0sz30_97976_c1_184_1020 | 260 |
| 125 | 3300053107 | Ga0500560_000929 | Ga0500560_000929_3645_4481 | 260 |
| 126 | 3300053157 | Ga0500624_001860 | Ga0500624_001860_1362_2198 | 260 |
| 127 | 3300054114 | Ga0501084_0067885 | Ga0501084_0067885_1068_1937 | 260 |
| 128 | 3300059506 | Ga0587085_000934 | Ga0587085_000934_1558_2394 | 260 |
| 129 | 3300049581 | Ga0501047_0314333 | Ga0501047_0314333_406_1245 | 261 |
| 130 | 3300005539 | Ga0068853_100050817 | Ga0068853_1000508172 | 262 |
| 131 | 3300006048 | Ga0075363_100015847 | Ga0075363_1000158472 | 262 |
| 132 | 3300006051 | Ga0075364_10086516 | Ga0075364_100865162 | 262 |
| 133 | 3300006178 | Ga0075367_10065836 | Ga0075367_100658362 | 262 |
| 134 | 3300009545 | Ga0105237_10076852 | Ga0105237_100768522 | 262 |
| 135 | 3300009551 | Ga0105238_10053821 | Ga0105238_100538212 | 262 |
| 136 | 3300010375 | Ga0105239_10038814 | Ga0105239_100388144 | 262 |
| 137 | 3300025914 | Ga0207671_10073634 | Ga0207671_100736342 | 262 |
| 138 | 3300025924 | Ga0207694_10033877 | Ga0207694_100338774 | 262 |
| 139 | 3300048905 | Ga0496102_0421276 | Ga0496102_0421276_201_1073 | 262 |
| 140 | 3300049571 | Ga0501034_0184508 | Ga0501034_0184508_138_1010 | 262 |
| 141 | 3300049591 | Ga0501075_0267942 | Ga0501075_0267942_180_1109 | 262 |
| 142 | 3300050491 | nmdc:mga00v17_68286_c1 | nmdc:mga00v17_68286_c1_465_1337 | 262 |
| 143 | 3300050493 | nmdc:mga0k408_44631_c1 | nmdc:mga0k408_44631_c1_1186_2058 | 262 |
| 144 | 3300050494 | nmdc:mga06z11_89330_c1 | nmdc:mga06z11_89330_c1_164_1036 | 262 |
| 145 | 3300050496 | nmdc:mga07m45_9056_c1 | nmdc:mga07m45_9056_c1_3112_3984 | 262 |
| 146 | 3300059492 | Ga0587073_0003254 | Ga0587073_0003254_460_1332 | 262 |
| 147 | 3300059493 | Ga0587077_001716 | Ga0587077_001716_985_1857 | 262 |
| 148 | 3300059503 | Ga0587080_014312 | Ga0587080_014312_331_1203 | 262 |
| 149 | 3300059504 | Ga0587082_005145 | Ga0587082_005145_656_1528 | 262 |
| 150 | 3300059505 | Ga0587083_0018676 | Ga0587083_0018676_44_916 | 262 |
| 151 | 3300059508 | Ga0587088_016005 | Ga0587088_016005_190_1062 | 262 |
| 152 | 3300059510 | Ga0587090_012561 | Ga0587090_012561_207_1079 | 262 |
| 153 | 3300059605 | Ga0587106_000297 | Ga0587106_000297_1407_2279 | 262 |
| 154 | 3300059627 | Ga0587117_001340 | Ga0587117_001340_1133_2005 | 262 |
| 155 | 3300059630 | Ga0587128_001934 | Ga0587128_001934_793_1665 | 262 |
| 156 | 3300059654 | Ga0587110_003994 | Ga0587110_003994_342_1214 | 262 |
| 157 | 3300025936 | Ga0207670_10277882 | Ga0207670_102778822 | 263 |
| 158 | 3300059630 | Ga0587128_013650 | Ga0587128_013650_112_984 | 263 |
| 159 | 3300003203 | JGI25406J46586_10007472 | JGI25406J46586_100074724 | 264 |
| 160 | 3300005985 | Ga0081539_10001859 | Ga0081539_1000185919 | 264 |
| 161 | 3300044765 | Ga0466970_0203836 | Ga0466970_0203836_160_1008 | 264 |
| 162 | 3300053139 | Ga0500568_0038714 | Ga0500568_0038714_387_1277 | 264 |
| 163 | 3300005347 | Ga0070668_100018004 | Ga0070668_1000180045 | 265 |
| 164 | 3300013306 | Ga0163162_10304059 | Ga0163162_103040592 | 265 |
| 165 | 3300021377 | Ga0213874_10005902 | Ga0213874_100059023 | 265 |
| 166 | 3300025972 | Ga0207668_10096919 | Ga0207668_100969192 | 265 |
| 167 | 3300039450 | Ga0436363_0259999 | Ga0436363_0259999_178_1092 | 265 |
| 168 | 3300039450 | Ga0436363_1697570 | Ga0436363_1697570_119_970 | 265 |
| 169 | 3300048921 | Ga0496118_0015167 | Ga0496118_0015167_3631_4524 | 265 |
| 170 | 3300050513 | nmdc:mga0rr50_99336_c1 | nmdc:mga0rr50_99336_c1_19_870 | 265 |
| 171 | 3300059607 | Ga0587125_000670 | Ga0587125_000670_975_1847 | 265 |
| 172 | 3300060344 | Ga0587071_030957 | Ga0587071_030957_37_918 | 265 |
| 173 | iso_pu_bacteria | 2838719591 | 2838723125 | 265 |
| 174 | iso_pu_bacteria | 2842187318 | 2842191156 | 265 |
| 175 | 3300005337 | Ga0070682_100279022 | Ga0070682_1002790221 | 267 |
| 176 | 3300044684 | Ga0466966_0165812 | Ga0466966_0165812_340_1257 | 267 |
| 177 | 3300059493 | Ga0587077_000304 | Ga0587077_000304_1497_2369 | 267 |
| 178 | 3300059623 | Ga0587101_000175 | Ga0587101_000175_1574_2446 | 267 |
| 179 | iso_pu_bacteria | 2643221563 | 2643835607 | 267 |
| 180 | iso_pu_bacteria | 2643221608 | 2644056533 | 267 |
| 181 | iso_pu_bacteria | 2937843397 | 2937845844 | 267 |
| 182 | 3300039062 | Ga0400483_146472 | Ga0400483_146472_4731_5591 | 268 |
| 183 | 3300039062 | Ga0400483_193432 | Ga0400483_193432_4474_5334 | 268 |
| 184 | 3300049571 | Ga0501034_0000712 | Ga0501034_0000712_45587_46459 | 268 |
| 185 | 3300059504 | Ga0587082_006855 | Ga0587082_006855_558_1427 | 268 |
| 186 | 3300059507 | Ga0587086_002677 | Ga0587086_002677_735_1607 | 268 |
| 187 | 3300059604 | Ga0587098_000719 | Ga0587098_000719_1221_2090 | 268 |
| 188 | 3300059607 | Ga0587125_000212 | Ga0587125_000212_496_1368 | 268 |
| 189 | 3300059623 | Ga0587101_000510 | Ga0587101_000510_135_1007 | 268 |
| 190 | 3300059648 | Ga0587100_000069 | Ga0587100_000069_1497_2369 | 268 |
| 191 | iso_pu_bacteria | 2507262055 | 2507507942 | 268 |
| 192 | iso_pu_bacteria | 2508501009 | 2508542055 | 268 |
| 193 | iso_pu_bacteria | 2508501042 | 2508692401 | 268 |
| 194 | iso_pu_bacteria | 2508501128 | 2509149478 | 268 |
| 195 | iso_pu_bacteria | 2510461069 | 2510840833 | 268 |
| 196 | iso_pu_bacteria | 2510917022 | 2511135966 | 268 |
| 197 | iso_pu_bacteria | 2510917026 | 2511171710 | 268 |
| 198 | iso_pu_bacteria | 2511231028 | 2511399350 | 268 |
| 199 | iso_pu_bacteria | 2513237092 | 2513622532 | 268 |
| 200 | iso_pu_bacteria | 2513237095 | 2513647236 | 268 |
| 201 | iso_pu_bacteria | 2513237096 | 2513657746 | 268 |
| 202 | iso_pu_bacteria | 2513237104 | 2513715215 | 268 |
| 203 | iso_pu_bacteria | 2513237137 | 2513864213 | 268 |
| 204 | iso_pu_bacteria | 2513237139 | 2513877568 | 268 |
| 205 | iso_pu_bacteria | 2513237145 | 2513919745 | 268 |
| 206 | iso_pu_bacteria | 2513237159 | 2513997560 | 268 |
| 207 | iso_pu_bacteria | 2513237161 | 2514009714 | 268 |
| 208 | iso_pu_bacteria | 2513237351 | 2514585914 | 268 |
| 209 | iso_pu_bacteria | 2515154112 | 2515626835 | 268 |
| 210 | iso_pu_bacteria | 2517093001 | 2517103850 | 268 |
| 211 | iso_pu_bacteria | 2517572143 | 2517895243 | 268 |
| 212 | iso_pu_bacteria | 2524023205 | 2524441840 | 268 |
| 213 | iso_pu_bacteria | 2524023209 | 2524459970 | 268 |
| 214 | iso_pu_bacteria | 2524023228 | 2524536377 | 268 |
| 215 | iso_pu_bacteria | 2537561587 | 2537877800 | 268 |
| 216 | iso_pu_bacteria | 2554235003 | 2554244566 | 268 |
| 217 | iso_pu_bacteria | 2554235003 | 2554245791 | 268 |
| 218 | iso_pu_bacteria | 2558860242 | 2559296442 | 268 |
| 219 | iso_pu_bacteria | 2582581283 | 2585167568 | 268 |
| 220 | iso_pu_bacteria | 2582581306 | 2585265794 | 268 |
| 221 | iso_pu_bacteria | 2582581308 | 2585282940 | 268 |
| 222 | iso_pu_bacteria | 2582581315 | 2585322480 | 268 |
| 223 | iso_pu_bacteria | 2582581316 | 2585335094 | 268 |
| 224 | iso_pu_bacteria | 2582581865 | 2585389041 | 268 |
| 225 | iso_pu_bacteria | 2582581866 | 2585395188 | 268 |
| 226 | iso_pu_bacteria | 2585427527 | 2585532433 | 268 |
| 227 | iso_pu_bacteria | 2585427530 | 2585554550 | 268 |
| 228 | iso_pu_bacteria | 2585427608 | 2585899039 | 268 |
| 229 | iso_pu_bacteria | 2585427609 | 2585903366 | 268 |
| 230 | iso_pu_bacteria | 2585427633 | 2585997253 | 268 |
| 231 | iso_pu_bacteria | 2585427634 | 2586001861 | 268 |
| 232 | iso_pu_bacteria | 2585428125 | 2587981515 | 268 |
| 233 | iso_pu_bacteria | 2599185156 | 2599332106 | 268 |
| 234 | iso_pu_bacteria | 2599185210 | 2599605515 | 268 |
| 235 | iso_pu_bacteria | 2599185210 | 2599606174 | 268 |
| 236 | iso_pu_bacteria | 2599185236 | 2599720004 | 268 |
| 237 | iso_pu_bacteria | 2600254933 | 2600373556 | 268 |
| 238 | iso_pu_bacteria | 2615840626 | 2616307497 | 268 |
| 239 | iso_pu_bacteria | 2615840698 | 2616555043 | 268 |
| 240 | iso_pu_bacteria | 2617270735 | 2617346518 | 268 |
| 241 | iso_pu_bacteria | 2617270741 | 2617378623 | 268 |
| 242 | iso_pu_bacteria | 2617270742 | 2617384330 | 268 |
| 243 | iso_pu_bacteria | 2643221551 | 2643777683 | 268 |
| 244 | iso_pu_bacteria | 2643221555 | 2643796131 | 268 |
| 245 | iso_pu_bacteria | 2643221568 | 2643853682 | 268 |
| 246 | iso_pu_bacteria | 2643221580 | 2643910387 | 268 |
| 247 | iso_pu_bacteria | 2643221582 | 2643917572 | 268 |
| 248 | iso_pu_bacteria | 2643221591 | 2643964855 | 268 |
| 249 | iso_pu_bacteria | 2643221623 | 2644133855 | 268 |
| 250 | iso_pu_bacteria | 2643221629 | 2644169206 | 268 |
| 251 | iso_pu_bacteria | 2643221636 | 2644204851 | 268 |
| 252 | iso_pu_bacteria | 2643221637 | 2644208683 | 268 |
| 253 | iso_pu_bacteria | 2643221653 | 2644298173 | 268 |
| 254 | iso_pu_bacteria | 2643221662 | 2644350620 | 268 |
| 255 | iso_pu_bacteria | 2643221674 | 2644411724 | 268 |
| 256 | iso_pu_bacteria | 2643221688 | 2644494201 | 268 |
| 257 | iso_pu_bacteria | 2643221718 | 2644652213 | 268 |
| 258 | iso_pu_bacteria | 2643221719 | 2644656425 | 268 |
| 259 | iso_pu_bacteria | 2667528174 | 2671112276 | 268 |
| 260 | iso_pu_bacteria | 2667528175 | 2671121733 | 268 |
| 261 | iso_pu_bacteria | 2693429783 | 2694628045 | 268 |
| 262 | iso_pu_bacteria | 2693429784 | 2694641098 | 268 |
| 263 | iso_pu_bacteria | 2728368998 | 2728752443 | 268 |
| 264 | iso_pu_bacteria | 2738543024 | 2739307355 | 268 |
| 265 | iso_pu_bacteria | 2744054633 | 2745081296 | 268 |
| 266 | iso_pu_bacteria | 2775507266 | 2778176107 | 268 |
| 267 | iso_pu_bacteria | 2791355197 | 2793069201 | 268 |
| 268 | iso_pu_bacteria | 2791355253 | 2793283757 | 268 |
| 269 | iso_pu_bacteria | 2802429603 | 2805918422 | 268 |
| 270 | iso_pu_bacteria | 2816332527 | 2818236273 | 268 |
| 271 | iso_pu_bacteria | 2818991272 | 2819244232 | 268 |
| 272 | iso_pu_bacteria | 2818991439 | 2819557637 | 268 |
| 273 | iso_pu_bacteria | 2818991448 | 2819609505 | 268 |
| 274 | iso_pu_bacteria | 2818991453 | 2819639603 | 268 |
| 275 | iso_pu_bacteria | 2818991461 | 2819686539 | 268 |
| 276 | iso_pu_bacteria | 2821123053 | 2821126252 | 268 |
| 277 | iso_pu_bacteria | 2824600985 | 2824607122 | 268 |
| 278 | iso_pu_bacteria | 2824609381 | 2824616577 | 268 |
| 279 | iso_pu_bacteria | 2824617872 | 2824624513 | 268 |
| 280 | iso_pu_bacteria | 2824626560 | 2824633428 | 268 |
| 281 | iso_pu_bacteria | 2824635225 | 2824642104 | 268 |
| 282 | iso_pu_bacteria | 2824644064 | 2824652081 | 268 |
| 283 | iso_pu_bacteria | 2824653114 | 2824659489 | 268 |
| 284 | iso_pu_bacteria | 2824661429 | 2824669250 | 268 |
| 285 | iso_pu_bacteria | 2824671348 | 2824675710 | 268 |
| 286 | iso_pu_bacteria | 2824679649 | 2824686888 | 268 |
| 287 | iso_pu_bacteria | 2824696289 | 2824700412 | 268 |
| 288 | iso_pu_bacteria | 2824704595 | 2824708106 | 268 |
| 289 | iso_pu_bacteria | 2824714736 | 2824722387 | 268 |
| 290 | iso_pu_bacteria | 2824723954 | 2824732076 | 268 |
| 291 | iso_pu_bacteria | 2824746037 | 2824751130 | 268 |
| 292 | iso_pu_bacteria | 2824753945 | 2824755757 | 268 |
| 293 | iso_pu_bacteria | 2824773399 | 2824774775 | 268 |
| 294 | iso_pu_bacteria | 2838029111 | 2838034705 | 268 |
| 295 | iso_pu_bacteria | 2838122688 | 2838122944 | 268 |
| 296 | iso_pu_bacteria | 2838714209 | 2838717402 | 268 |
| 297 | iso_pu_bacteria | 2838714209 | 2838717779 | 268 |
| 298 | iso_pu_bacteria | 2838736955 | 2838737272 | 268 |
| 299 | iso_pu_bacteria | 2841840854 | 2841842359 | 268 |
| 300 | iso_pu_bacteria | 2841846520 | 2841849941 | 268 |
| 301 | iso_pu_bacteria | 2841846520 | 2841850713 | 268 |
| 302 | iso_pu_bacteria | 2841941048 | 2841944774 | 268 |
| 303 | iso_pu_bacteria | 2841949485 | 2841957773 | 268 |
| 304 | iso_pu_bacteria | 2841957949 | 2841959984 | 268 |
| 305 | iso_pu_bacteria | 2841966195 | 2841974479 | 268 |
| 306 | iso_pu_bacteria | 2841974524 | 2841978642 | 268 |
| 307 | iso_pu_bacteria | 2841983080 | 2841989012 | 268 |
| 308 | iso_pu_bacteria | 2842038055 | 2842040370 | 268 |
| 309 | iso_pu_bacteria | 2842045827 | 2842046685 | 268 |
| 310 | iso_pu_bacteria | 2842124991 | 2842128413 | 268 |
| 311 | iso_pu_bacteria | 2842124991 | 2842129518 | 268 |
| 312 | iso_pu_bacteria | 2842140634 | 2842142139 | 268 |
| 313 | iso_pu_bacteria | 2842152218 | 2842155715 | 268 |
| 314 | iso_pu_bacteria | 2842170452 | 2842173077 | 268 |
| 315 | iso_pu_bacteria | 2842170452 | 2842174025 | 268 |
| 316 | iso_pu_bacteria | 2842175837 | 2842179635 | 268 |
| 317 | iso_pu_bacteria | 2842298080 | 2842298805 | 268 |
| 318 | iso_pu_bacteria | 2842357229 | 2842359326 | 268 |
| 319 | iso_pu_bacteria | 2842475841 | 2842481402 | 268 |
| 320 | iso_pu_bacteria | 2842482326 | 2842483292 | 268 |
| 321 | iso_pu_bacteria | 2842502639 | 2842508352 | 268 |
| 322 | iso_pu_bacteria | 2842509118 | 2842510838 | 268 |
| 323 | iso_pu_bacteria | 2842521101 | 2842522197 | 268 |
| 324 | iso_pu_bacteria | 2842922631 | 2842924461 | 268 |
| 325 | iso_pu_bacteria | 2844315083 | 2844319749 | 268 |
| 326 | iso_pu_bacteria | 2847930680 | 2847937066 | 268 |
| 327 | iso_pu_bacteria | 2847939898 | 2847947458 | 268 |
| 328 | iso_pu_bacteria | 2852387548 | 2852391324 | 268 |
| 329 | iso_pu_bacteria | 2854896431 | 2854897377 | 268 |
| 330 | iso_pu_bacteria | 2854916844 | 2854921489 | 268 |
| 331 | iso_pu_bacteria | 2855872281 | 2855873998 | 268 |
| 332 | iso_pu_bacteria | 2856349417 | 2856352033 | 268 |
| 333 | iso_pu_bacteria | 2856356410 | 2856357043 | 268 |
| 334 | iso_pu_bacteria | 2856364286 | 2856370057 | 268 |
| 335 | iso_pu_bacteria | 2857349434 | 2857352760 | 268 |
| 336 | iso_pu_bacteria | 2857509624 | 2857513060 | 268 |
| 337 | iso_pu_bacteria | 2857531043 | 2857532813 | 268 |
| 338 | iso_pu_bacteria | 2869285874 | 2869290854 | 268 |
| 339 | iso_pu_bacteria | 2871429161 | 2871433136 | 268 |
| 340 | iso_pu_bacteria | 2871488783 | 2871491224 | 268 |
| 341 | iso_pu_bacteria | 2874146452 | 2874153703 | 268 |
| 342 | iso_pu_bacteria | 2874155637 | 2874160968 | 268 |
| 343 | iso_pu_bacteria | 2874590934 | 2874599040 | 268 |
| 344 | iso_pu_bacteria | 2874612657 | 2874617208 | 268 |
| 345 | iso_pu_bacteria | 2874620515 | 2874626654 | 268 |
| 346 | iso_pu_bacteria | 2874628541 | 2874635296 | 268 |
| 347 | iso_pu_bacteria | 2874645413 | 2874650515 | 268 |
| 348 | iso_pu_bacteria | 2876413966 | 2876419008 | 268 |
| 349 | iso_pu_bacteria | 2876771140 | 2876779079 | 268 |
| 350 | iso_pu_bacteria | 2876818435 | 2876822683 | 268 |
| 351 | iso_pu_bacteria | 2878745973 | 2878750749 | 268 |
| 352 | iso_pu_bacteria | 2878753008 | 2878755642 | 268 |
| 353 | iso_pu_bacteria | 2879074833 | 2879082872 | 268 |
| 354 | iso_pu_bacteria | 2879083081 | 2879083250 | 268 |
| 355 | iso_pu_bacteria | 2879099564 | 2879101560 | 268 |
| 356 | iso_pu_bacteria | 2879127579 | 2879133063 | 268 |
| 357 | iso_pu_bacteria | 2879142872 | 2879149350 | 268 |
| 358 | iso_pu_bacteria | 2881155292 | 2881159126 | 268 |
| 359 | iso_pu_bacteria | 2881364244 | 2881368083 | 268 |
| 360 | iso_pu_bacteria | 2881665667 | 2881672042 | 268 |
| 361 | iso_pu_bacteria | 2881845957 | 2881846625 | 268 |
| 362 | iso_pu_bacteria | 2881853255 | 2881860054 | 268 |
| 363 | iso_pu_bacteria | 2881861095 | 2881864295 | 268 |
| 364 | iso_pu_bacteria | 2882912400 | 2882912931 | 268 |
| 365 | iso_pu_bacteria | 2885318864 | 2885320552 | 268 |
| 366 | iso_pu_bacteria | 2885342637 | 2885345137 | 268 |
| 367 | iso_pu_bacteria | 2885350715 | 2885357177 | 268 |
| 368 | iso_pu_bacteria | 2885366525 | 2885369618 | 268 |
| 369 | iso_pu_bacteria | 2885374607 | 2885381109 | 268 |
| 370 | iso_pu_bacteria | 2885409591 | 2885418201 | 268 |
| 371 | iso_pu_bacteria | 2888378607 | 2888385169 | 268 |
| 372 | iso_pu_bacteria | 2888388044 | 2888393070 | 268 |
| 373 | iso_pu_bacteria | 2888419890 | 2888425311 | 268 |
| 374 | iso_pu_bacteria | 2889010040 | 2889014713 | 268 |
| 375 | iso_pu_bacteria | 2898795034 | 2898798580 | 268 |
| 376 | iso_pu_bacteria | 2899845264 | 2899847640 | 268 |
| 377 | iso_pu_bacteria | 2903492973 | 2903496356 | 268 |
| 378 | iso_pu_bacteria | 2903492973 | 2903498892 | 268 |
| 379 | iso_pu_bacteria | 2903727486 | 2903730574 | 268 |
| 380 | iso_pu_bacteria | 2903748898 | 2903754329 | 268 |
| 381 | iso_pu_bacteria | 2904666416 | 2904671994 | 268 |
| 382 | iso_pu_bacteria | 2904690495 | 2904693249 | 268 |
| 383 | iso_pu_bacteria | 2904711408 | 2904712271 | 268 |
| 384 | iso_pu_bacteria | 2906308376 | 2906313674 | 268 |
| 385 | iso_pu_bacteria | 2906321335 | 2906326383 | 268 |
| 386 | iso_pu_bacteria | 2906602504 | 2906609622 | 268 |
| 387 | iso_pu_bacteria | 2906626472 | 2906628914 | 268 |
| 388 | iso_pu_bacteria | 2906635258 | 2906636340 | 268 |
| 389 | iso_pu_bacteria | 2906643746 | 2906652102 | 268 |
| 390 | iso_pu_bacteria | 2906660503 | 2906665407 | 268 |
| 391 | iso_pu_bacteria | 2908739725 | 2908740559 | 268 |
| 392 | iso_pu_bacteria | 2908756301 | 2908759321 | 268 |
| 393 | iso_pu_bacteria | 2908775508 | 2908780869 | 268 |
| 394 | iso_pu_bacteria | 2919114240 | 2919118059 | 268 |
| 395 | iso_pu_bacteria | 2919114240 | 2919119155 | 268 |
| 396 | iso_pu_bacteria | 2919166419 | 2919168111 | 268 |
| 397 | iso_pu_bacteria | 2919171160 | 2919173548 | 268 |
| 398 | iso_pu_bacteria | 2919408235 | 2919410763 | 268 |
| 399 | iso_pu_bacteria | 2922368715 | 2922372728 | 268 |
| 400 | iso_pu_bacteria | 2922393267 | 2922397358 | 268 |
| 401 | iso_pu_bacteria | 2922425934 | 2922427369 | 268 |
| 402 | iso_pu_bacteria | 2924784321 | 2924785622 | 268 |
| 403 | iso_pu_bacteria | 2926754445 | 2926757824 | 268 |
| 404 | iso_pu_bacteria | 2926754445 | 2926759184 | 268 |
| 405 | iso_pu_bacteria | 2926760298 | 2926763390 | 268 |
| 406 | iso_pu_bacteria | 2926760298 | 2926764552 | 268 |
| 407 | iso_pu_bacteria | 2929138655 | 2929141445 | 268 |
| 408 | iso_pu_bacteria | 2929615660 | 2929620543 | 268 |
| 409 | iso_pu_bacteria | 2932401849 | 2932402307 | 268 |
| 410 | iso_pu_bacteria | 2932784394 | 2932784693 | 268 |
| 411 | iso_pu_bacteria | 2932794094 | 2932795413 | 268 |
| 412 | iso_pu_bacteria | 2932801729 | 2932805944 | 268 |
| 413 | iso_pu_bacteria | 2932809354 | 2932809673 | 268 |
| 414 | iso_pu_bacteria | 2932818245 | 2932818584 | 268 |
| 415 | iso_pu_bacteria | 2932828146 | 2932828461 | 268 |
| 416 | iso_pu_bacteria | 2933577622 | 2933582461 | 268 |
| 417 | iso_pu_bacteria | 2933594066 | 2933595998 | 268 |
| 418 | iso_pu_bacteria | 2933594066 | 2933597306 | 268 |
| 419 | iso_pu_bacteria | 2935608549 | 2935609559 | 268 |
| 420 | iso_pu_bacteria | 2935616580 | 2935617434 | 268 |
| 421 | iso_pu_bacteria | 2935630451 | 2935637549 | 268 |
| 422 | iso_pu_bacteria | 2935638405 | 2935639084 | 268 |
| 423 | iso_pu_bacteria | 2935648319 | 2935652290 | 268 |
| 424 | iso_pu_bacteria | 2935656913 | 2935660872 | 268 |
| 425 | iso_pu_bacteria | 2935665750 | 2935666064 | 268 |
| 426 | iso_pu_bacteria | 2935675223 | 2935675712 | 268 |
| 427 | iso_pu_bacteria | 2935684952 | 2935685278 | 268 |
| 428 | iso_pu_bacteria | 2935694250 | 2935694968 | 268 |
| 429 | iso_pu_bacteria | 2935703347 | 2935704091 | 268 |
| 430 | iso_pu_bacteria | 2935713505 | 2935713831 | 268 |
| 431 | iso_pu_bacteria | 2935722832 | 2935724450 | 268 |
| 432 | iso_pu_bacteria | 2935732158 | 2935733192 | 268 |
| 433 | iso_pu_bacteria | 2935741537 | 2935742571 | 268 |
| 434 | iso_pu_bacteria | 2935750917 | 2935751243 | 268 |
| 435 | iso_pu_bacteria | 2935760218 | 2935760233 | 268 |
| 436 | iso_pu_bacteria | 2935769743 | 2935769957 | 268 |
| 437 | iso_pu_bacteria | 2935777560 | 2935782023 | 268 |
| 438 | iso_pu_bacteria | 2935785616 | 2935785801 | 268 |
| 439 | iso_pu_bacteria | 2935793552 | 2935794271 | 268 |
| 440 | iso_pu_bacteria | 2935801545 | 2935802174 | 268 |
| 441 | iso_pu_bacteria | 2935810662 | 2935810998 | 268 |
| 442 | iso_pu_bacteria | 2935819856 | 2935822721 | 268 |
| 443 | iso_pu_bacteria | 2935827899 | 2935828579 | 268 |
| 444 | iso_pu_bacteria | 2935837841 | 2935839955 | 268 |
| 445 | iso_pu_bacteria | 2935847175 | 2935848303 | 268 |
| 446 | iso_pu_bacteria | 2935855204 | 2935856059 | 268 |
| 447 | iso_pu_bacteria | 2935864058 | 2935865997 | 268 |
| 448 | iso_pu_bacteria | 2935873716 | 2935877678 | 268 |
| 449 | iso_pu_bacteria | 2935883170 | 2935883693 | 268 |
| 450 | iso_pu_bacteria | 2935908558 | 2935909894 | 268 |
| 451 | iso_pu_bacteria | 2935916978 | 2935917618 | 268 |
| 452 | iso_pu_bacteria | 2935926038 | 2935927374 | 268 |
| 453 | iso_pu_bacteria | 2935934488 | 2935936781 | 268 |
| 454 | iso_pu_bacteria | 2935942939 | 2935944916 | 268 |
| 455 | iso_pu_bacteria | 2935951376 | 2935953353 | 268 |
| 456 | iso_pu_bacteria | 2935959822 | 2935961156 | 268 |
| 457 | iso_pu_bacteria | 2935967501 | 2935970193 | 268 |
| 458 | iso_pu_bacteria | 2935975950 | 2935980480 | 268 |
| 459 | iso_pu_bacteria | 2935984226 | 2935986759 | 268 |
| 460 | iso_pu_bacteria | 2935992306 | 2935992622 | 268 |
| 461 | iso_pu_bacteria | 2936002035 | 2936002494 | 268 |
| 462 | iso_pu_bacteria | 2936011229 | 2936014928 | 268 |
| 463 | iso_pu_bacteria | 2936019824 | 2936022091 | 268 |
| 464 | iso_pu_bacteria | 2936028420 | 2936032779 | 268 |
| 465 | iso_pu_bacteria | 2936037263 | 2936037583 | 268 |
| 466 | iso_pu_bacteria | 2936046547 | 2936050669 | 268 |
| 467 | iso_pu_bacteria | 2936055302 | 2936059555 | 268 |
| 468 | iso_pu_bacteria | 2937813078 | 2937820021 | 268 |
| 469 | iso_pu_bacteria | 2938014810 | 2938017746 | 268 |
| 470 | iso_pu_bacteria | 2940556831 | 2940557955 | 268 |
| 471 | iso_pu_bacteria | 2941507105 | 2941514078 | 268 |
| 472 | iso_pu_bacteria | 2941515067 | 2941522039 | 268 |
| 473 | iso_pu_bacteria | 2941523033 | 2941529777 | 268 |
| 474 | iso_pu_bacteria | 2941531003 | 2941536790 | 268 |
| 475 | iso_pu_bacteria | 2941538514 | 2941540705 | 268 |
| 476 | iso_pu_bacteria | 2958041894 | 2958055465 | 268 |
| 477 | iso_pu_bacteria | 2958130278 | 2958135254 | 268 |
| 478 | iso_pu_bacteria | 2958179912 | 2958184283 | 268 |
| 479 | iso_pu_bacteria | 2961077736 | 2961082338 | 268 |
| 480 | iso_pu_bacteria | 2961127735 | 2961128689 | 268 |
| 481 | iso_pu_bacteria | 2961170736 | 2961176424 | 268 |
| 482 | iso_pu_bacteria | 2967996073 | 2967998817 | 268 |
| 483 | iso_pu_bacteria | 2968003550 | 2968007613 | 268 |
| 484 | iso_pu_bacteria | 2968117919 | 2968122102 | 268 |
| 485 | iso_pu_bacteria | 2970503327 | 2970509095 | 268 |
| 486 | iso_pu_bacteria | 2977821940 | 2977824846 | 268 |
| 487 | iso_pu_bacteria | 2977828996 | 2977830995 | 268 |
| 488 | iso_pu_bacteria | 2977843712 | 2977850435 | 268 |
| 489 | iso_pu_bacteria | 2977942078 | 2977946754 | 268 |
| 490 | iso_pu_bacteria | 2978969890 | 2978970781 | 268 |
| 491 | iso_pu_bacteria | 2979089926 | 2979090340 | 268 |
| 492 | iso_pu_bacteria | 2979089926 | 2979091577 | 268 |
| 493 | iso_pu_bacteria | 2979095461 | 2979095868 | 268 |
| 494 | iso_pu_bacteria | 2979095461 | 2979097098 | 268 |
| 495 | iso_pu_bacteria | 2979100975 | 2979102679 | 268 |
| 496 | iso_pu_bacteria | 2979808191 | 2979813774 | 268 |
| 497 | iso_pu_bacteria | 2984509177 | 2984509435 | 268 |
| 498 | iso_pu_bacteria | 2984518228 | 2984519865 | 268 |
| 499 | iso_pu_bacteria | 2984537506 | 2984537768 | 268 |
| 500 | iso_pu_bacteria | 2984587000 | 2984587889 | 268 |
| 501 | iso_pu_bacteria | 2984601300 | 2984604511 | 268 |
| 502 | iso_pu_bacteria | 2987636660 | 2987641353 | 268 |
| 503 | iso_pu_bacteria | 2989349275 | 2989352205 | 268 |
| 504 | iso_pu_bacteria | 2989776772 | 2989776871 | 268 |
| 505 | iso_pu_bacteria | 2996310559 | 2996316030 | 268 |
| 506 | iso_pu_bacteria | 2996336353 | 2996336529 | 268 |
| 507 | iso_pu_bacteria | 3004203850 | 3004210160 | 268 |
| 508 | iso_pu_bacteria | 3005416602 | 3005418387 | 268 |
| 509 | iso_pu_bacteria | 3005474847 | 3005477092 | 268 |
| 510 | iso_pu_bacteria | 3005483717 | 3005485039 | 268 |
| 511 | iso_pu_bacteria | 3005506211 | 3005507369 | 268 |
| 512 | iso_pu_bacteria | 3005587118 | 3005587330 | 268 |
| 513 | iso_pu_bacteria | 3005594810 | 3005599966 | 268 |
| 514 | iso_pu_bacteria | 3005710791 | 3005715561 | 268 |
| 515 | iso_pu_bacteria | 3005718088 | 3005722892 | 268 |
| 516 | iso_pu_bacteria | 650716007 | 650842839 | 268 |
| 517 | iso_pu_bacteria | 650716007 | 650844033 | 268 |
| 518 | iso_pu_bacteria | 8002285264 | 8002291007 | 268 |
| 519 | iso_pu_bacteria | 8004374579 | 8004377209 | 268 |
| 520 | iso_pu_bacteria | 8004387939 | 8004393143 | 268 |
| 521 | iso_pu_bacteria | 8004640170 | 8004644104 | 268 |
| 522 | iso_pu_bacteria | 8004714634 | 8004719930 | 268 |
| 523 | iso_pu_bacteria | 8005246636 | 8005247849 | 268 |
| 524 | iso_pu_bacteria | 8005314921 | 8005318721 | 268 |
| 525 | iso_pu_bacteria | 8005484373 | 8005488397 | 268 |
| 526 | iso_pu_bacteria | 8005645114 | 8005648866 | 268 |
| 527 | iso_pu_bacteria | 8005682033 | 8005682103 | 268 |
| 528 | iso_pu_bacteria | 8006933436 | 8006938304 | 268 |
| 529 | iso_pu_bacteria | 8006973647 | 8006978381 | 268 |
| 530 | iso_pu_bacteria | 8016511872 | 8016521050 | 268 |
| 531 | iso_pu_bacteria | 8016548790 | 8016554760 | 268 |
| 532 | iso_pu_bacteria | 8016583857 | 8016593829 | 268 |
| 533 | iso_pu_bacteria | 8016595262 | 8016600883 | 268 |
| 534 | iso_pu_bacteria | 8016603502 | 8016609593 | 268 |
| 535 | iso_pu_bacteria | 8016613128 | 8016615321 | 268 |
| 536 | iso_pu_bacteria | 8016622563 | 8016625888 | 268 |
| 537 | iso_pu_bacteria | 8016630954 | 8016639474 | 268 |
| 538 | iso_pu_bacteria | 8017057580 | 8017064555 | 268 |
| 539 | iso_pu_bacteria | 8019530166 | 8019533927 | 268 |
| 540 | iso_pu_bacteria | 8019555841 | 8019560728 | 268 |
| 541 | iso_pu_bacteria | 8019565922 | 8019570812 | 268 |
| 542 | iso_pu_bacteria | 8019576017 | 8019583932 | 268 |
| 543 | iso_pu_bacteria | 8019586578 | 8019591738 | 268 |
| 544 | iso_pu_bacteria | 8019597564 | 8019599599 | 268 |
| 545 | iso_pu_bacteria | 8019608314 | 8019618946 | 268 |
| 546 | iso_pu_bacteria | 8019619141 | 8019619521 | 268 |
| 547 | iso_pu_bacteria | 8019629233 | 8019633593 | 268 |
| 548 | iso_pu_bacteria | 8019638758 | 8019646306 | 268 |
| 549 | iso_pu_bacteria | 8019659431 | 8019661472 | 268 |
| 550 | iso_pu_bacteria | 8019668869 | 8019671013 | 268 |
| 551 | iso_pu_bacteria | 8019678201 | 8019685181 | 268 |
| 552 | iso_pu_bacteria | 8019687851 | 8019690774 | 268 |
| 553 | iso_pu_bacteria | 8046767195 | 8046769166 | 268 |
| 554 | iso_pu_bacteria | 8054460903 | 8054463540 | 268 |
| 555 | iso_pu_bacteria | 8054558443 | 8054561887 | 268 |
| 556 | iso_pu_bacteria | 8055742211 | 8055745405 | 268 |
| 557 | iso_pu_bacteria | 8056689827 | 8056695585 | 268 |
| 558 | iso_pu_bacteria | 8056875544 | 8056876254 | 268 |
| 559 | iso_pu_bacteria | 8057575449 | 8057581142 | 268 |
| 560 | 3300003214 | JGI25165J46597_1000078 | JGI25165J46597_10000783 | 269 |
| 561 | 3300003322 | rootL2_10015244 | rootL2_100152442 | 269 |
| 562 | 3300005262 | Ga0065165_1001104 | Ga0065165_100110425 | 269 |
| 563 | 3300005347 | Ga0070668_100023836 | Ga0070668_1000238365 | 269 |
| 564 | 3300005445 | Ga0070708_100234024 | Ga0070708_1002340242 | 269 |
| 565 | 3300005468 | Ga0070707_100007996 | Ga0070707_1000079964 | 269 |
| 566 | 3300005548 | Ga0070665_100000349 | Ga0070665_10000034921 | 269 |
| 567 | 3300005843 | Ga0068860_100387746 | Ga0068860_1003877462 | 269 |
| 568 | 3300006177 | Ga0075362_10002799 | Ga0075362_100027992 | 269 |
| 569 | 3300006177 | Ga0075362_10020346 | Ga0075362_100203462 | 269 |
| 570 | 3300006871 | Ga0075434_100102094 | Ga0075434_1001020943 | 269 |
| 571 | 3300009093 | Ga0105240_10216082 | Ga0105240_102160823 | 269 |
| 572 | 3300010375 | Ga0105239_10583899 | Ga0105239_105838992 | 269 |
| 573 | 3300025261 | Ga0209233_1000150 | Ga0209233_1000150178 | 269 |
| 574 | 3300025922 | Ga0207646_10057330 | Ga0207646_100573302 | 269 |
| 575 | 3300028379 | Ga0268266_10000092 | Ga0268266_10000092143 | 269 |
| 576 | 3300028786 | Ga0307517_10035058 | Ga0307517_100350584 | 269 |
| 577 | 3300037471 | Ga0395905_0060148 | Ga0395905_0060148_182_1054 | 269 |
| 578 | 3300042438 | Ga0439459_0016431 | Ga0439459_0016431_294_1157 | 269 |
| 579 | 3300048905 | Ga0496102_0241985 | Ga0496102_0241985_675_1538 | 269 |
| 580 | 3300048909 | Ga0496106_0554551 | Ga0496106_0554551_28_891 | 269 |
| 581 | 3300048911 | Ga0496108_0202889 | Ga0496108_0202889_414_1277 | 269 |
| 582 | 3300050489 | nmdc:mga03683_1610_c1 | nmdc:mga03683_1610_c1_3715_4623 | 269 |
| 583 | 3300053103 | Ga0500555_001807 | Ga0500555_001807_2124_3098 | 269 |
| 584 | 3300015261 | Ga0182006_1009455 | Ga0182006_10094555 | 270 |
| 585 | 3300015265 | Ga0182005_1025969 | Ga0182005_10259692 | 270 |
| 586 | 3300025913 | Ga0207695_10001193 | Ga0207695_100011938 | 270 |
| 587 | 3300028786 | Ga0307517_10000875 | Ga0307517_1000087510 | 270 |
| 588 | 3300031456 | Ga0307513_10053382 | Ga0307513_100533823 | 270 |
| 589 | 3300031911 | Ga0307412_10431317 | Ga0307412_104313171 | 270 |
| 590 | 3300032005 | Ga0307411_10062906 | Ga0307411_100629062 | 270 |
| 591 | 3300005441 | Ga0070700_100021063 | Ga0070700_1000210633 | 271 |
| 592 | 3300005545 | Ga0070695_100000980 | Ga0070695_1000009805 | 271 |
| 593 | 3300005719 | Ga0068861_100068365 | Ga0068861_1000683653 | 271 |
| 594 | 3300006163 | Ga0070715_10027017 | Ga0070715_100270172 | 271 |
| 595 | 3300006844 | Ga0075428_100013125 | Ga0075428_1000131256 | 271 |
| 596 | 3300009147 | Ga0114129_10012990 | Ga0114129_100129907 | 271 |
| 597 | 3300026067 | Ga0207678_10263401 | Ga0207678_102634012 | 271 |
| 598 | 3300026075 | Ga0207708_10017794 | Ga0207708_100177942 | 271 |
| 599 | 3300048927 | Ga0496124_0000239 | Ga0496124_0000239_51055_51924 | 271 |
| 600 | 3300049571 | Ga0501034_0002438 | Ga0501034_0002438_8866_9735 | 271 |
| 601 | 3300049824 | Ga0501045_0108466 | Ga0501045_0108466_360_1229 | 271 |
| 602 | 3300050507 | nmdc:mga05p37_13489_c1 | nmdc:mga05p37_13489_c1_4500_5369 | 271 |
| 603 | 3300053177 | Ga0500636_0001769 | Ga0500636_0001769_5138_6007 | 271 |
| 604 | 3300059493 | Ga0587077_001130 | Ga0587077_001130_1601_2470 | 271 |
| 605 | 3300059623 | Ga0587101_001063 | Ga0587101_001063_1253_2122 | 271 |
| 606 | 3300059639 | Ga0587062_000878 | Ga0587062_000878_1369_2238 | 271 |
| 607 | 3300001979 | JGI24740J21852_10001029 | JGI24740J21852_100010297 | 272 |
| 608 | 3300002704 | JGI25155J39150_1000012 | JGI25155J39150_100001271 | 272 |
| 609 | 3300002705 | JGI25156J39149_1000049 | JGI25156J39149_100004922 | 272 |
| 610 | 3300002737 | JGI25162J39368_1000146 | JGI25162J39368_100014613 | 272 |
| 611 | 3300002737 | JGI25162J39368_1000409 | JGI25162J39368_100040922 | 272 |
| 612 | 3300002738 | JGI25154J39366_1000033 | JGI25154J39366_1000033102 | 272 |
| 613 | 3300002741 | JGI25157J39369_1000055 | JGI25157J39369_100005571 | 272 |
| 614 | 3300002987 | JGI25159J45721_1000304 | JGI25159J45721_100030420 | 272 |
| 615 | 3300003187 | JGI25151J46595_10003057 | JGI25151J46595_100030575 | 272 |
| 616 | 3300003214 | JGI25165J46597_1000451 | JGI25165J46597_100045127 | 272 |
| 617 | 3300003214 | JGI25165J46597_1000751 | JGI25165J46597_100075113 | 272 |
| 618 | 3300003215 | JGI25153J46596_10001118 | JGI25153J46596_100011184 | 272 |
| 619 | 3300003215 | JGI25153J46596_10009829 | JGI25153J46596_100098292 | 272 |
| 620 | 3300003215 | JGI25153J46596_10025010 | JGI25153J46596_100250102 | 272 |
| 621 | 3300003215 | JGI25153J46596_10025075 | JGI25153J46596_100250752 | 272 |
| 622 | 3300003354 | JGI25160J50197_1000006 | JGI25160J50197_1000006190 | 272 |
| 623 | 3300003354 | JGI25160J50197_1001199 | JGI25160J50197_10011992 | 272 |
| 624 | 3300003354 | JGI25160J50197_1011660 | JGI25160J50197_10116602 | 272 |
| 625 | 3300003374 | JGI25161J50226_1000004 | JGI25161J50226_1000004190 | 272 |
| 626 | 3300003578 | Ga0006562J51391_1019963 | Ga0006562J51391_10199633 | 272 |
| 627 | 3300003759 | Ga0055525_1005814 | Ga0055525_10058141 | 272 |
| 628 | 3300003781 | Ga0055536_1004899 | Ga0055536_10048994 | 272 |
| 629 | 3300003791 | Ga0055530_10015159 | Ga0055530_100151592 | 272 |
| 630 | 3300003792 | Ga0055540_1007821 | Ga0055540_10078212 | 272 |
| 631 | 3300003794 | Ga0055531_10000916 | Ga0055531_100009164 | 272 |
| 632 | 3300003794 | Ga0055531_10009357 | Ga0055531_100093573 | 272 |
| 633 | 3300003856 | Ga0058692_1007093 | Ga0058692_10070933 | 272 |
| 634 | 3300003856 | Ga0058692_1011868 | Ga0058692_10118682 | 272 |
| 635 | 3300004625 | Ga0055543_1000002 | Ga0055543_1000002145 | 272 |
| 636 | 3300005262 | Ga0065165_1000217 | Ga0065165_100021772 | 272 |
| 637 | 3300005262 | Ga0065165_1001488 | Ga0065165_100148824 | 272 |
| 638 | 3300005262 | Ga0065165_1004881 | Ga0065165_10048816 | 272 |
| 639 | 3300005262 | Ga0065165_1006238 | Ga0065165_10062384 | 272 |
| 640 | 3300005289 | Ga0065704_10008449 | Ga0065704_100084493 | 272 |
| 641 | 3300005328 | Ga0070676_10369822 | Ga0070676_103698221 | 272 |
| 642 | 3300005335 | Ga0070666_10104128 | Ga0070666_101041282 | 272 |
| 643 | 3300005344 | Ga0070661_100428735 | Ga0070661_1004287351 | 272 |
| 644 | 3300005347 | Ga0070668_100016767 | Ga0070668_1000167675 | 272 |
| 645 | 3300005353 | Ga0070669_100010381 | Ga0070669_1000103815 | 272 |
| 646 | 3300005355 | Ga0070671_100028427 | Ga0070671_1000284273 | 272 |
| 647 | 3300005367 | Ga0070667_100077871 | Ga0070667_1000778711 | 272 |
| 648 | 3300005436 | Ga0070713_100154692 | Ga0070713_1001546922 | 272 |
| 649 | 3300005455 | Ga0070663_100393871 | Ga0070663_1003938712 | 272 |
| 650 | 3300005455 | Ga0070663_100471256 | Ga0070663_1004712561 | 272 |
| 651 | 3300005456 | Ga0070678_100238558 | Ga0070678_1002385582 | 272 |
| 652 | 3300005457 | Ga0070662_100207970 | Ga0070662_1002079702 | 272 |
| 653 | 3300005548 | Ga0070665_100019496 | Ga0070665_1000194961 | 272 |
| 654 | 3300005548 | Ga0070665_100044835 | Ga0070665_1000448354 | 272 |
| 655 | 3300005548 | Ga0070665_100048095 | Ga0070665_1000480954 | 272 |
| 656 | 3300005548 | Ga0070665_100123692 | Ga0070665_1001236922 | 272 |
| 657 | 3300005548 | Ga0070665_100173854 | Ga0070665_1001738542 | 272 |
| 658 | 3300005548 | Ga0070665_100551781 | Ga0070665_1005517811 | 272 |
| 659 | 3300005564 | Ga0070664_100650538 | Ga0070664_1006505381 | 272 |
| 660 | 3300005578 | Ga0068854_100290135 | Ga0068854_1002901352 | 272 |
| 661 | 3300005614 | Ga0068856_100049312 | Ga0068856_1000493124 | 272 |
| 662 | 3300005614 | Ga0068856_100191144 | Ga0068856_1001911442 | 272 |
| 663 | 3300005614 | Ga0068856_100287343 | Ga0068856_1002873432 | 272 |
| 664 | 3300005616 | Ga0068852_100478184 | Ga0068852_1004781842 | 272 |
| 665 | 3300005617 | Ga0068859_100279564 | Ga0068859_1002795641 | 272 |
| 666 | 3300005841 | Ga0068863_100370493 | Ga0068863_1003704932 | 272 |
| 667 | 3300005937 | Ga0081455_10053582 | Ga0081455_100535824 | 272 |
| 668 | 3300005983 | Ga0081540_1027415 | Ga0081540_10274153 | 272 |
| 669 | 3300005983 | Ga0081540_1053799 | Ga0081540_10537991 | 272 |
| 670 | 3300006038 | Ga0075365_10024820 | Ga0075365_100248202 | 272 |
| 671 | 3300006038 | Ga0075365_10104769 | Ga0075365_101047692 | 272 |
| 672 | 3300006048 | Ga0075363_100006188 | Ga0075363_1000061882 | 272 |
| 673 | 3300006051 | Ga0075364_10000074 | Ga0075364_1000007410 | 272 |
| 674 | 3300006051 | Ga0075364_10038218 | Ga0075364_100382183 | 272 |
| 675 | 3300006051 | Ga0075364_10079924 | Ga0075364_100799243 | 272 |
| 676 | 3300006178 | Ga0075367_10013641 | Ga0075367_100136412 | 272 |
| 677 | 3300006186 | Ga0075369_10009090 | Ga0075369_100090903 | 272 |
| 678 | 3300006353 | Ga0075370_10006154 | Ga0075370_100061545 | 272 |
| 679 | 3300006353 | Ga0075370_10034156 | Ga0075370_100341562 | 272 |
| 680 | 3300006871 | Ga0075434_100006769 | Ga0075434_1000067694 | 272 |
| 681 | 3300006931 | Ga0097620_100279579 | Ga0097620_1002795791 | 272 |
| 682 | 3300006941 | Ga0099825_1024201 | Ga0099825_10242014 | 272 |
| 683 | 3300006942 | Ga0099824_1006678 | Ga0099824_10066781 | 272 |
| 684 | 3300006943 | Ga0099822_1043467 | Ga0099822_10434672 | 272 |
| 685 | 3300006946 | Ga0079104_1000563 | Ga0079104_10005631 | 272 |
| 686 | 3300006948 | Ga0099826_10000045 | Ga0099826_1000004570 | 272 |
| 687 | 3300006948 | Ga0099826_10007422 | Ga0099826_100074226 | 272 |
| 688 | 3300009036 | Ga0105244_10156677 | Ga0105244_101566772 | 272 |
| 689 | 3300009093 | Ga0105240_10000019 | Ga0105240_1000001964 | 272 |
| 690 | 3300009093 | Ga0105240_10271139 | Ga0105240_102711391 | 272 |
| 691 | 3300009098 | Ga0105245_10202801 | Ga0105245_102028012 | 272 |
| 692 | 3300009101 | Ga0105247_10133439 | Ga0105247_101334392 | 272 |
| 693 | 3300009101 | Ga0105247_10166301 | Ga0105247_101663011 | 272 |
| 694 | 3300009148 | Ga0105243_10068288 | Ga0105243_100682882 | 272 |
| 695 | 3300009148 | Ga0105243_10073163 | Ga0105243_100731633 | 272 |
| 696 | 3300009174 | Ga0105241_10068288 | Ga0105241_100682882 | 272 |
| 697 | 3300009176 | Ga0105242_10354023 | Ga0105242_103540231 | 272 |
| 698 | 3300009177 | Ga0105248_10087965 | Ga0105248_100879653 | 272 |
| 699 | 3300009545 | Ga0105237_10002910 | Ga0105237_100029108 | 272 |
| 700 | 3300009545 | Ga0105237_10027706 | Ga0105237_100277062 | 272 |
| 701 | 3300009545 | Ga0105237_10332327 | Ga0105237_103323272 | 272 |
| 702 | 3300009545 | Ga0105237_10430298 | Ga0105237_104302982 | 272 |
| 703 | 3300010375 | Ga0105239_10006284 | Ga0105239_1000628411 | 272 |
| 704 | 3300010375 | Ga0105239_10042362 | Ga0105239_100423624 | 272 |
| 705 | 3300010375 | Ga0105239_10045034 | Ga0105239_100450342 | 272 |
| 706 | 3300010375 | Ga0105239_10271542 | Ga0105239_102715422 | 272 |
| 707 | 3300010375 | Ga0105239_10347186 | Ga0105239_103471862 | 272 |
| 708 | 3300011119 | Ga0105246_10031951 | Ga0105246_100319513 | 272 |
| 709 | 3300013100 | Ga0157373_10019415 | Ga0157373_100194152 | 272 |
| 710 | 3300013102 | Ga0157371_10088074 | Ga0157371_100880742 | 272 |
| 711 | 3300013104 | Ga0157370_10005600 | Ga0157370_1000560012 | 272 |
| 712 | 3300013105 | Ga0157369_10216291 | Ga0157369_102162912 | 272 |
| 713 | 3300013105 | Ga0157369_10301305 | Ga0157369_103013052 | 272 |
| 714 | 3300013105 | Ga0157369_10448858 | Ga0157369_104488582 | 272 |
| 715 | 3300013105 | Ga0157369_10564260 | Ga0157369_105642602 | 272 |
| 716 | 3300013296 | Ga0157374_10099050 | Ga0157374_100990502 | 272 |
| 717 | 3300014497 | Ga0182008_10128144 | Ga0182008_101281441 | 272 |
| 718 | 3300014968 | Ga0157379_10230010 | Ga0157379_102300102 | 272 |
| 719 | 3300014969 | Ga0157376_10529186 | Ga0157376_105291862 | 272 |
| 720 | 3300015262 | Ga0182007_10001799 | Ga0182007_100017994 | 272 |
| 721 | 3300015265 | Ga0182005_1024788 | Ga0182005_10247882 | 272 |
| 722 | 3300021320 | Ga0214544_1000004 | Ga0214544_1000004253 | 272 |
| 723 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001100 | 272 |
| 724 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001167 | 272 |
| 725 | 3300021327 | Ga0214543_1000006 | Ga0214543_1000006164 | 272 |
| 726 | 3300025206 | Ga0209435_100005 | Ga0209435_10000570 | 272 |
| 727 | 3300025208 | Ga0209436_115303 | Ga0209436_1153032 | 272 |
| 728 | 3300025230 | Ga0209563_102075 | Ga0209563_1020752 | 272 |
| 729 | 3300025233 | Ga0209437_100078 | Ga0209437_10007897 | 272 |
| 730 | 3300025233 | Ga0209437_100174 | Ga0209437_10017494 | 272 |
| 731 | 3300025246 | Ga0209646_1000011 | Ga0209646_100001170 | 272 |
| 732 | 3300025246 | Ga0209646_1005577 | Ga0209646_10055771 | 272 |
| 733 | 3300025250 | Ga0209026_1000008 | Ga0209026_100000870 | 272 |
| 734 | 3300025253 | Ga0209677_100155 | Ga0209677_10015528 | 272 |
| 735 | 3300025253 | Ga0209677_104509 | Ga0209677_1045093 | 272 |
| 736 | 3300025256 | Ga0209759_1000004 | Ga0209759_100000470 | 272 |
| 737 | 3300025261 | Ga0209233_1000163 | Ga0209233_100016397 | 272 |
| 738 | 3300025261 | Ga0209233_1000295 | Ga0209233_100029544 | 272 |
| 739 | 3300025261 | Ga0209233_1000441 | Ga0209233_10004415 | 272 |
| 740 | 3300025261 | Ga0209233_1000459 | Ga0209233_100045913 | 272 |
| 741 | 3300025261 | Ga0209233_1001854 | Ga0209233_10018545 | 272 |
| 742 | 3300025261 | Ga0209233_1012224 | Ga0209233_10122243 | 272 |
| 743 | 3300025272 | Ga0209455_1010339 | Ga0209455_10103392 | 272 |
| 744 | 3300025284 | Ga0209130_1000032 | Ga0209130_1000032183 | 272 |
| 745 | 3300025292 | Ga0209676_1002982 | Ga0209676_10029824 | 272 |
| 746 | 3300025294 | Ga0209025_1000445 | Ga0209025_100044571 | 272 |
| 747 | 3300025294 | Ga0209025_1001209 | Ga0209025_100120936 | 272 |
| 748 | 3300025294 | Ga0209025_1020477 | Ga0209025_10204771 | 272 |
| 749 | 3300025294 | Ga0209025_1051016 | Ga0209025_10510162 | 272 |
| 750 | 3300025294 | Ga0209025_1052966 | Ga0209025_10529662 | 272 |
| 751 | 3300025295 | Ga0209564_1008632 | Ga0209564_10086323 | 272 |
| 752 | 3300025297 | Ga0209758_1000011 | Ga0209758_100001116 | 272 |
| 753 | 3300025297 | Ga0209758_1000105 | Ga0209758_100010558 | 272 |
| 754 | 3300025297 | Ga0209758_1000345 | Ga0209758_100034528 | 272 |
| 755 | 3300025297 | Ga0209758_1001280 | Ga0209758_100128025 | 272 |
| 756 | 3300025297 | Ga0209758_1012480 | Ga0209758_10124802 | 272 |
| 757 | 3300025297 | Ga0209758_1034315 | Ga0209758_10343152 | 272 |
| 758 | 3300025298 | Ga0209050_1006042 | Ga0209050_10060425 | 272 |
| 759 | 3300025299 | Ga0209256_1002090 | Ga0209256_10020902 | 272 |
| 760 | 3300025299 | Ga0209256_1013546 | Ga0209256_10135463 | 272 |
| 761 | 3300025302 | Ga0207426_1000077 | Ga0207426_1000077183 | 272 |
| 762 | 3300025302 | Ga0207426_1000400 | Ga0207426_100040056 | 272 |
| 763 | 3300025302 | Ga0207426_1000402 | Ga0207426_100040270 | 272 |
| 764 | 3300025303 | Ga0209051_1005198 | Ga0209051_10051986 | 272 |
| 765 | 3300025304 | Ga0209257_1001089 | Ga0209257_10010896 | 272 |
| 766 | 3300025304 | Ga0209257_1003767 | Ga0209257_10037673 | 272 |
| 767 | 3300025900 | Ga0207710_10033009 | Ga0207710_100330091 | 272 |
| 768 | 3300025904 | Ga0207647_10002713 | Ga0207647_100027137 | 272 |
| 769 | 3300025909 | Ga0207705_10270945 | Ga0207705_102709452 | 272 |
| 770 | 3300025910 | Ga0207684_10177313 | Ga0207684_101773131 | 272 |
| 771 | 3300025911 | Ga0207654_10049356 | Ga0207654_100493563 | 272 |
| 772 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008528 | 272 |
| 773 | 3300025913 | Ga0207695_10000049 | Ga0207695_1000004966 | 272 |
| 774 | 3300025914 | Ga0207671_10000107 | Ga0207671_10000107103 | 272 |
| 775 | 3300025914 | Ga0207671_10001041 | Ga0207671_1000104129 | 272 |
| 776 | 3300025923 | Ga0207681_10018137 | Ga0207681_100181375 | 272 |
| 777 | 3300025927 | Ga0207687_10089190 | Ga0207687_100891902 | 272 |
| 778 | 3300025928 | Ga0207700_10098188 | Ga0207700_100981883 | 272 |
| 779 | 3300025931 | Ga0207644_10049516 | Ga0207644_100495162 | 272 |
| 780 | 3300025932 | Ga0207690_10123574 | Ga0207690_101235741 | 272 |
| 781 | 3300025933 | Ga0207706_10139987 | Ga0207706_101399872 | 272 |
| 782 | 3300025935 | Ga0207709_10090813 | Ga0207709_100908131 | 272 |
| 783 | 3300025935 | Ga0207709_10120968 | Ga0207709_101209682 | 272 |
| 784 | 3300025941 | Ga0207711_10043179 | Ga0207711_100431792 | 272 |
| 785 | 3300025972 | Ga0207668_10057399 | Ga0207668_100573992 | 272 |
| 786 | 3300025972 | Ga0207668_10081246 | Ga0207668_100812461 | 272 |
| 787 | 3300025981 | Ga0207640_10088366 | Ga0207640_100883662 | 272 |
| 788 | 3300026067 | Ga0207678_10088900 | Ga0207678_100889003 | 272 |
| 789 | 3300026078 | Ga0207702_10166633 | Ga0207702_101666332 | 272 |
| 790 | 3300026118 | Ga0207675_100303545 | Ga0207675_1003035452 | 272 |
| 791 | 3300026142 | Ga0207698_10150594 | Ga0207698_101505942 | 272 |
| 792 | 3300026142 | Ga0207698_10275362 | Ga0207698_102753622 | 272 |
| 793 | 3300026142 | Ga0207698_10562057 | Ga0207698_105620572 | 272 |
| 794 | 3300027111 | Ga0209281_1000032 | Ga0209281_1000032355 | 272 |
| 795 | 3300027296 | Ga0209389_1000001 | Ga0209389_1000001406 | 272 |
| 796 | 3300027296 | Ga0209389_1000010 | Ga0209389_1000010148 | 272 |
| 797 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003335 | 272 |
| 798 | 3300027312 | Ga0209371_1002352 | Ga0209371_10023526 | 272 |
| 799 | 3300027357 | Ga0209589_1000002 | Ga0209589_1000002205 | 272 |
| 800 | 3300027357 | Ga0209589_1000016 | Ga0209589_100001666 | 272 |
| 801 | 3300027361 | Ga0209489_100002 | Ga0209489_100002205 | 272 |
| 802 | 3300027361 | Ga0209489_100016 | Ga0209489_100016148 | 272 |
| 803 | 3300027361 | Ga0209489_113333 | Ga0209489_1133334 | 272 |
| 804 | 3300027363 | Ga0209700_100002 | Ga0209700_100002205 | 272 |
| 805 | 3300027363 | Ga0209700_100007 | Ga0209700_10000720 | 272 |
| 806 | 3300027666 | Ga0209282_1000210 | Ga0209282_10002102 | 272 |
| 807 | 3300027666 | Ga0209282_1008160 | Ga0209282_10081604 | 272 |
| 808 | 3300028379 | Ga0268266_10002356 | Ga0268266_1000235618 | 272 |
| 809 | 3300028379 | Ga0268266_10136273 | Ga0268266_101362732 | 272 |
| 810 | 3300028379 | Ga0268266_10174646 | Ga0268266_101746462 | 272 |
| 811 | 3300028379 | Ga0268266_10181379 | Ga0268266_101813792 | 272 |
| 812 | 3300028379 | Ga0268266_10362274 | Ga0268266_103622742 | 272 |
| 813 | 3300028556 | Ga0265337_1004861 | Ga0265337_10048612 | 272 |
| 814 | 3300028558 | Ga0265326_10006349 | Ga0265326_100063493 | 272 |
| 815 | 3300028563 | Ga0265319_1005704 | Ga0265319_10057046 | 272 |
| 816 | 3300028573 | Ga0265334_10001643 | Ga0265334_100016438 | 272 |
| 817 | 3300028577 | Ga0265318_10034833 | Ga0265318_100348331 | 272 |
| 818 | 3300028653 | Ga0265323_10000803 | Ga0265323_100008033 | 272 |
| 819 | 3300028666 | Ga0265336_10001030 | Ga0265336_100010306 | 272 |
| 820 | 3300028794 | Ga0307515_10000017 | Ga0307515_10000017220 | 272 |
| 821 | 3300028794 | Ga0307515_10005257 | Ga0307515_100052577 | 272 |
| 822 | 3300028794 | Ga0307515_10011281 | Ga0307515_100112815 | 272 |
| 823 | 3300028794 | Ga0307515_10079364 | Ga0307515_100793643 | 272 |
| 824 | 3300028800 | Ga0265338_10000076 | Ga0265338_1000007624 | 272 |
| 825 | 3300029957 | Ga0265324_10002044 | Ga0265324_100020447 | 272 |
| 826 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004716 | 272 |
| 827 | 3300030500 | Ga0268256_1001392 | Ga0268256_10013926 | 272 |
| 828 | 3300030522 | Ga0307512_10090549 | Ga0307512_100905493 | 272 |
| 829 | 3300031247 | Ga0265340_10050010 | Ga0265340_100500102 | 272 |
| 830 | 3300031548 | Ga0307408_100101330 | Ga0307408_1001013302 | 272 |
| 831 | 3300031595 | Ga0265313_10072373 | Ga0265313_100723732 | 272 |
| 832 | 3300031616 | Ga0307508_10087736 | Ga0307508_100877362 | 272 |
| 833 | 3300031616 | Ga0307508_10300855 | Ga0307508_103008552 | 272 |
| 834 | 3300031649 | Ga0307514_10030872 | Ga0307514_100308722 | 272 |
| 835 | 3300031711 | Ga0265314_10005339 | Ga0265314_100053399 | 272 |
| 836 | 3300031712 | Ga0265342_10035803 | Ga0265342_100358032 | 272 |
| 837 | 3300031730 | Ga0307516_10355366 | Ga0307516_103553661 | 272 |
| 838 | 3300031901 | Ga0307406_10033730 | Ga0307406_100337303 | 272 |
| 839 | 3300032004 | Ga0307414_10166766 | Ga0307414_101667662 | 272 |
| 840 | 3300033180 | Ga0307510_10003276 | Ga0307510_1000327614 | 272 |
| 841 | 3300033180 | Ga0307510_10120793 | Ga0307510_101207932 | 272 |
| 842 | 3300033180 | Ga0307510_10207436 | Ga0307510_102074362 | 272 |
| 843 | 3300033442 | Ga0315911_1000007 | Ga0315911_100000766 | 272 |
| 844 | 3300037418 | Ga0395900_0183744 | Ga0395900_0183744_1169_2041 | 272 |
| 845 | 3300037418 | Ga0395900_0268425 | Ga0395900_0268425_71_943 | 272 |
| 846 | 3300037418 | Ga0395900_0347928 | Ga0395900_0347928_324_1196 | 272 |
| 847 | 3300037466 | Ga0395898_0372586 | Ga0395898_0372586_381_1253 | 272 |
| 848 | 3300037471 | Ga0395905_0101885 | Ga0395905_0101885_1073_1945 | 272 |
| 849 | 3300037471 | Ga0395905_0306078 | Ga0395905_0306078_309_1181 | 272 |
| 850 | 3300038443 | Ga0395901_0219662 | Ga0395901_0219662_445_1356 | 272 |
| 851 | 3300038443 | Ga0395901_0305349 | Ga0395901_0305349_191_1063 | 272 |
| 852 | 3300038443 | Ga0395901_0531044 | Ga0395901_0531044_193_1065 | 272 |
| 853 | 3300038443 | Ga0395901_0569198 | Ga0395901_0569198_199_1071 | 272 |
| 854 | 3300039447 | Ga0436361_0847892 | Ga0436361_0847892_476_1348 | 272 |
| 855 | 3300039453 | Ga0436362_1201805 | Ga0436362_1201805_1237_2109 | 272 |
| 856 | 3300044658 | Ga0466972_0000223 | Ga0466972_0000223_19028_19933 | 272 |
| 857 | 3300044658 | Ga0466972_0064291 | Ga0466972_0064291_14_895 | 272 |
| 858 | 3300044683 | Ga0466965_0051073 | Ga0466965_0051073_837_1709 | 272 |
| 859 | 3300044683 | Ga0466965_0057454 | Ga0466965_0057454_886_1791 | 272 |
| 860 | 3300044684 | Ga0466966_0034491 | Ga0466966_0034491_2000_2908 | 272 |
| 861 | 3300044706 | Ga0466964_0030074 | Ga0466964_0030074_782_1750 | 272 |
| 862 | 3300044735 | Ga0466968_0152879 | Ga0466968_0152879_55_960 | 272 |
| 863 | 3300044765 | Ga0466970_0113606 | Ga0466970_0113606_38_946 | 272 |
| 864 | 3300044901 | Ga0466960_0058915 | Ga0466960_0058915_313_1194 | 272 |
| 865 | 3300046454 | Ga0495592_0042076 | Ga0495592_0042076_627_1499 | 272 |
| 866 | 3300046459 | Ga0495629_0007893 | Ga0495629_0007893_1508_2416 | 272 |
| 867 | 3300046460 | Ga0495638_0011564 | Ga0495638_0011564_4705_5613 | 272 |
| 868 | 3300046462 | Ga0495651_0003476 | Ga0495651_0003476_9316_10188 | 272 |
| 869 | 3300046471 | Ga0495650_0035367 | Ga0495650_0035367_195_1106 | 272 |
| 870 | 3300046476 | Ga0495662_0101687 | Ga0495662_0101687_175_1047 | 272 |
| 871 | 3300046507 | Ga0495606_0006924 | Ga0495606_0006924_7833_8741 | 272 |
| 872 | 3300046507 | Ga0495606_0053038 | Ga0495606_0053038_385_1293 | 272 |
| 873 | 3300046511 | Ga0495608_0010132 | Ga0495608_0010132_3116_3988 | 272 |
| 874 | 3300046516 | Ga0495628_0028035 | Ga0495628_0028035_1234_2106 | 272 |
| 875 | 3300046522 | Ga0495643_0077064 | Ga0495643_0077064_364_1236 | 272 |
| 876 | 3300046524 | Ga0495648_0009261 | Ga0495648_0009261_1299_2207 | 272 |
| 877 | 3300046529 | Ga0495652_0040135 | Ga0495652_0040135_393_1301 | 272 |
| 878 | 3300046529 | Ga0495652_0060027 | Ga0495652_0060027_361_1233 | 272 |
| 879 | 3300046533 | Ga0495640_0053526 | Ga0495640_0053526_498_1370 | 272 |
| 880 | 3300046536 | Ga0495587_0066043 | Ga0495587_0066043_533_1405 | 272 |
| 881 | 3300046542 | Ga0495597_0051636 | Ga0495597_0051636_719_1591 | 272 |
| 882 | 3300046542 | Ga0495597_0133895 | Ga0495597_0133895_58_930 | 272 |
| 883 | 3300046543 | Ga0495645_0032890 | Ga0495645_0032890_1387_2259 | 272 |
| 884 | 3300046557 | Ga0495622_0055998 | Ga0495622_0055998_761_1669 | 272 |
| 885 | 3300046559 | Ga0495667_0019541 | Ga0495667_0019541_3671_4543 | 272 |
| 886 | 3300046616 | Ga0495668_0062432 | Ga0495668_0062432_91_963 | 272 |
| 887 | 3300046642 | Ga0495634_0023196 | Ga0495634_0023196_794_1666 | 272 |
| 888 | 3300046660 | Ga0495625_0171361 | Ga0495625_0171361_301_1209 | 272 |
| 889 | 3300046663 | Ga0495635_0015040 | Ga0495635_0015040_796_1704 | 272 |
| 890 | 3300046663 | Ga0495635_0055541 | Ga0495635_0055541_1748_2620 | 272 |
| 891 | 3300046674 | Ga0495588_0000802 | Ga0495588_0000802_12847_13719 | 272 |
| 892 | 3300046674 | Ga0495588_0036609 | Ga0495588_0036609_1474_2382 | 272 |
| 893 | 3300046674 | Ga0495588_0065733 | Ga0495588_0065733_538_1530 | 272 |
| 894 | 3300046675 | Ga0495657_0001348 | Ga0495657_0001348_11046_11918 | 272 |
| 895 | 3300046680 | Ga0495646_0066146 | Ga0495646_0066146_437_1309 | 272 |
| 896 | 3300046692 | Ga0495671_0027713 | Ga0495671_0027713_1470_2342 | 272 |
| 897 | 3300046694 | Ga0495649_0006416 | Ga0495649_0006416_3888_4796 | 272 |
| 898 | 3300046794 | Ga0495589_0074662 | Ga0495589_0074662_629_1537 | 272 |
| 899 | 3300046809 | Ga0495600_0013217 | Ga0495600_0013217_1130_2002 | 272 |
| 900 | 3300046809 | Ga0495600_0020788 | Ga0495600_0020788_114_1022 | 272 |
| 901 | 3300047315 | Ga0495581_0059334 | Ga0495581_0059334_994_1902 | 272 |
| 902 | 3300047317 | Ga0495604_0006572 | Ga0495604_0006572_6379_7251 | 272 |
| 903 | 3300047317 | Ga0495604_0009422 | Ga0495604_0009422_1471_2379 | 272 |
| 904 | 3300047319 | Ga0495674_0061626 | Ga0495674_0061626_546_1418 | 272 |
| 905 | 3300047321 | Ga0495676_0031415 | Ga0495676_0031415_425_1333 | 272 |
| 906 | 3300047322 | Ga0495680_0061574 | Ga0495680_0061574_428_1300 | 272 |
| 907 | 3300047323 | Ga0495683_0032722 | Ga0495683_0032722_1061_1933 | 272 |
| 908 | 3300047443 | Ga0495687_007327 | Ga0495687_007327_3810_4682 | 272 |
| 909 | 3300047444 | Ga0495675_0013083 | Ga0495675_0013083_3029_3901 | 272 |
| 910 | 3300047470 | Ga0495681_0000633 | Ga0495681_0000633_2419_3291 | 272 |
| 911 | 3300047471 | Ga0495684_0036589 | Ga0495684_0036589_58_930 | 272 |
| 912 | 3300047472 | Ga0495686_0127232 | Ga0495686_0127232_206_1078 | 272 |
| 913 | 3300048088 | Ga0495602_0017394 | Ga0495602_0017394_702_1574 | 272 |
| 914 | 3300048903 | Ga0496100_0080677 | Ga0496100_0080677_793_1701 | 272 |
| 915 | 3300048904 | Ga0496101_0242986 | Ga0496101_0242986_120_1028 | 272 |
| 916 | 3300048905 | Ga0496102_0026452 | Ga0496102_0026452_1569_2441 | 272 |
| 917 | 3300048905 | Ga0496102_0198851 | Ga0496102_0198851_217_1125 | 272 |
| 918 | 3300048906 | Ga0496103_0011150 | Ga0496103_0011150_1751_2623 | 272 |
| 919 | 3300048906 | Ga0496103_0313582 | Ga0496103_0313582_82_954 | 272 |
| 920 | 3300048907 | Ga0496104_0023025 | Ga0496104_0023025_835_1707 | 272 |
| 921 | 3300048907 | Ga0496104_0094352 | Ga0496104_0094352_407_1315 | 272 |
| 922 | 3300048908 | Ga0496105_0030560 | Ga0496105_0030560_485_1357 | 272 |
| 923 | 3300048909 | Ga0496106_0123728 | Ga0496106_0123728_1039_1911 | 272 |
| 924 | 3300048910 | Ga0496107_0021362 | Ga0496107_0021362_436_1344 | 272 |
| 925 | 3300048911 | Ga0496108_0014576 | Ga0496108_0014576_1519_2391 | 272 |
| 926 | 3300048912 | Ga0496109_0023600 | Ga0496109_0023600_3097_3969 | 272 |
| 927 | 3300048913 | Ga0496110_0182006 | Ga0496110_0182006_856_1764 | 272 |
| 928 | 3300048915 | Ga0496112_0028981 | Ga0496112_0028981_2910_3782 | 272 |
| 929 | 3300048916 | Ga0496113_0072547 | Ga0496113_0072547_40_912 | 272 |
| 930 | 3300048916 | Ga0496113_0408218 | Ga0496113_0408218_64_972 | 272 |
| 931 | 3300048919 | Ga0496116_0000135 | Ga0496116_0000135_115326_116198 | 272 |
| 932 | 3300048919 | Ga0496116_0013446 | Ga0496116_0013446_5306_6214 | 272 |
| 933 | 3300048920 | Ga0496117_0027761 | Ga0496117_0027761_2635_3507 | 272 |
| 934 | 3300048920 | Ga0496117_0149213 | Ga0496117_0149213_78_950 | 272 |
| 935 | 3300048921 | Ga0496118_0045413 | Ga0496118_0045413_1070_1978 | 272 |
| 936 | 3300048921 | Ga0496118_0109917 | Ga0496118_0109917_791_1702 | 272 |
| 937 | 3300048921 | Ga0496118_0217436 | Ga0496118_0217436_26_898 | 272 |
| 938 | 3300048922 | Ga0496119_0013167 | Ga0496119_0013167_834_1706 | 272 |
| 939 | 3300048922 | Ga0496119_0088051 | Ga0496119_0088051_227_1099 | 272 |
| 940 | 3300048923 | Ga0496120_0001375 | Ga0496120_0001375_4128_5000 | 272 |
| 941 | 3300048923 | Ga0496120_0006733 | Ga0496120_0006733_7039_7947 | 272 |
| 942 | 3300048923 | Ga0496120_0031758 | Ga0496120_0031758_143_1015 | 272 |
| 943 | 3300048923 | Ga0496120_0097036 | Ga0496120_0097036_345_1217 | 272 |
| 944 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_1072190_1073062 | 272 |
| 945 | 3300048924 | Ga0496121_0090651 | Ga0496121_0090651_1083_1955 | 272 |
| 946 | 3300048924 | Ga0496121_0114301 | Ga0496121_0114301_622_1527 | 272 |
| 947 | 3300048924 | Ga0496121_0157261 | Ga0496121_0157261_683_1555 | 272 |
| 948 | 3300048924 | Ga0496121_0263191 | Ga0496121_0263191_138_1010 | 272 |
| 949 | 3300048924 | Ga0496121_0263192 | Ga0496121_0263192_255_1127 | 272 |
| 950 | 3300048925 | Ga0496122_0000107 | Ga0496122_0000107_138882_139787 | 272 |
| 951 | 3300048925 | Ga0496122_0043126 | Ga0496122_0043126_1642_2514 | 272 |
| 952 | 3300048926 | Ga0496123_0000063 | Ga0496123_0000063_53322_54227 | 272 |
| 953 | 3300048926 | Ga0496123_0022678 | Ga0496123_0022678_776_1648 | 272 |
| 954 | 3300048926 | Ga0496123_0116701 | Ga0496123_0116701_411_1283 | 272 |
| 955 | 3300048927 | Ga0496124_0032989 | Ga0496124_0032989_1138_2043 | 272 |
| 956 | 3300048927 | Ga0496124_0130593 | Ga0496124_0130593_701_1573 | 272 |
| 957 | 3300048927 | Ga0496124_0147380 | Ga0496124_0147380_820_1692 | 272 |
| 958 | 3300048927 | Ga0496124_0159222 | Ga0496124_0159222_24_896 | 272 |
| 959 | 3300048927 | Ga0496124_0274835 | Ga0496124_0274835_107_979 | 272 |
| 960 | 3300048928 | Ga0496125_0000200 | Ga0496125_0000200_117107_117979 | 272 |
| 961 | 3300048928 | Ga0496125_0000306 | Ga0496125_0000306_74448_75320 | 272 |
| 962 | 3300048928 | Ga0496125_0044724 | Ga0496125_0044724_1468_2340 | 272 |
| 963 | 3300048928 | Ga0496125_0201461 | Ga0496125_0201461_375_1247 | 272 |
| 964 | 3300048929 | Ga0496126_0000129 | Ga0496126_0000129_61199_62071 | 272 |
| 965 | 3300048929 | Ga0496126_0000188 | Ga0496126_0000188_4770_5642 | 272 |
| 966 | 3300048929 | Ga0496126_0022621 | Ga0496126_0022621_745_1653 | 272 |
| 967 | 3300048929 | Ga0496126_0108299 | Ga0496126_0108299_1153_2064 | 272 |
| 968 | 3300048929 | Ga0496126_0288362 | Ga0496126_0288362_321_1193 | 272 |
| 969 | 3300048929 | Ga0496126_0330264 | Ga0496126_0330264_253_1125 | 272 |
| 970 | 3300049460 | Ga0495682_0005057 | Ga0495682_0005057_1499_2407 | 272 |
| 971 | 3300049568 | Ga0501031_0042424 | Ga0501031_0042424_1318_2190 | 272 |
| 972 | 3300049568 | Ga0501031_0074864 | Ga0501031_0074864_553_1425 | 272 |
| 973 | 3300049569 | Ga0501032_0000004 | Ga0501032_0000004_161268_162149 | 272 |
| 974 | 3300049569 | Ga0501032_0002753 | Ga0501032_0002753_7840_8712 | 272 |
| 975 | 3300049570 | Ga0501033_0000016 | Ga0501033_0000016_55346_56227 | 272 |
| 976 | 3300049570 | Ga0501033_0000438 | Ga0501033_0000438_31483_32355 | 272 |
| 977 | 3300049570 | Ga0501033_0004986 | Ga0501033_0004986_8488_9423 | 272 |
| 978 | 3300049570 | Ga0501033_0019437 | Ga0501033_0019437_1371_2243 | 272 |
| 979 | 3300049571 | Ga0501034_0000011 | Ga0501034_0000011_161268_162149 | 272 |
| 980 | 3300049571 | Ga0501034_0002517 | Ga0501034_0002517_4844_5716 | 272 |
| 981 | 3300049571 | Ga0501034_0004793 | Ga0501034_0004793_6698_7633 | 272 |
| 982 | 3300049571 | Ga0501034_0045426 | Ga0501034_0045426_1676_2548 | 272 |
| 983 | 3300049571 | Ga0501034_0488861 | Ga0501034_0488861_210_1082 | 272 |
| 984 | 3300049572 | Ga0501036_0000001 | Ga0501036_0000001_161268_162149 | 272 |
| 985 | 3300049572 | Ga0501036_0003294 | Ga0501036_0003294_6063_6998 | 272 |
| 986 | 3300049572 | Ga0501036_0006995 | Ga0501036_0006995_796_1668 | 272 |
| 987 | 3300049572 | Ga0501036_0092384 | Ga0501036_0092384_905_1777 | 272 |
| 988 | 3300049572 | Ga0501036_0179313 | Ga0501036_0179313_133_1005 | 272 |
| 989 | 3300049573 | Ga0501037_0000006 | Ga0501037_0000006_55313_56194 | 272 |
| 990 | 3300049573 | Ga0501037_0000722 | Ga0501037_0000722_16381_17253 | 272 |
| 991 | 3300049573 | Ga0501037_0005086 | Ga0501037_0005086_7702_8637 | 272 |
| 992 | 3300049573 | Ga0501037_0048495 | Ga0501037_0048495_1707_2579 | 272 |
| 993 | 3300049573 | Ga0501037_0064525 | Ga0501037_0064525_591_1463 | 272 |
| 994 | 3300049574 | Ga0501038_0000003 | Ga0501038_0000003_161268_162149 | 272 |
| 995 | 3300049574 | Ga0501038_0000047 | Ga0501038_0000047_31379_32251 | 272 |
| 996 | 3300049574 | Ga0501038_0006213 | Ga0501038_0006213_9648_10583 | 272 |
| 997 | 3300049574 | Ga0501038_0071935 | Ga0501038_0071935_1108_1980 | 272 |
| 998 | 3300049574 | Ga0501038_0096508 | Ga0501038_0096508_72_944 | 272 |
| 999 | 3300049574 | Ga0501038_0256190 | Ga0501038_0256190_306_1178 | 272 |
| 1000 | 3300049575 | Ga0501039_0000004 | Ga0501039_0000004_161268_162149 | 272 |
| 1001 | 3300049575 | Ga0501039_0000038 | Ga0501039_0000038_38182_39054 | 272 |
| 1002 | 3300049575 | Ga0501039_0001298 | Ga0501039_0001298_9402_10337 | 272 |
| 1003 | 3300049576 | Ga0501040_0012498 | Ga0501040_0012498_955_1836 | 272 |
| 1004 | 3300049578 | Ga0501042_0370607 | Ga0501042_0370607_22_957 | 272 |
| 1005 | 3300049579 | Ga0501043_0000131 | Ga0501043_0000131_36986_37858 | 272 |
| 1006 | 3300049579 | Ga0501043_0000155 | Ga0501043_0000155_55466_56347 | 272 |
| 1007 | 3300049579 | Ga0501043_0011433 | Ga0501043_0011433_2110_3045 | 272 |
| 1008 | 3300049579 | Ga0501043_0013677 | Ga0501043_0013677_274_1146 | 272 |
| 1009 | 3300049579 | Ga0501043_0075709 | Ga0501043_0075709_755_1627 | 272 |
| 1010 | 3300049579 | Ga0501043_0148232 | Ga0501043_0148232_645_1517 | 272 |
| 1011 | 3300049580 | Ga0501046_0001714 | Ga0501046_0001714_10205_11140 | 272 |
| 1012 | 3300049580 | Ga0501046_0068786 | Ga0501046_0068786_332_1213 | 272 |
| 1013 | 3300049580 | Ga0501046_0139899 | Ga0501046_0139899_829_1701 | 272 |
| 1014 | 3300049581 | Ga0501047_0021199 | Ga0501047_0021199_2110_3045 | 272 |
| 1015 | 3300049581 | Ga0501047_0103798 | Ga0501047_0103798_781_1662 | 272 |
| 1016 | 3300049581 | Ga0501047_0191688 | Ga0501047_0191688_739_1611 | 272 |
| 1017 | 3300049582 | Ga0501048_0022766 | Ga0501048_0022766_1066_2001 | 272 |
| 1018 | 3300049582 | Ga0501048_0053324 | Ga0501048_0053324_440_1312 | 272 |
| 1019 | 3300049585 | Ga0501069_0002311 | Ga0501069_0002311_8632_9567 | 272 |
| 1020 | 3300049586 | Ga0501070_0022569 | Ga0501070_0022569_1592_2473 | 272 |
| 1021 | 3300049586 | Ga0501070_0047177 | Ga0501070_0047177_2480_3415 | 272 |
| 1022 | 3300049586 | Ga0501070_0178399 | Ga0501070_0178399_376_1248 | 272 |
| 1023 | 3300049587 | Ga0501071_0231418 | Ga0501071_0231418_321_1193 | 272 |
| 1024 | 3300049589 | Ga0501073_0002004 | Ga0501073_0002004_5886_6821 | 272 |
| 1025 | 3300049590 | Ga0501074_0005021 | Ga0501074_0005021_7806_8741 | 272 |
| 1026 | 3300049742 | Ga0501080_0002095 | Ga0501080_0002095_11140_12075 | 272 |
| 1027 | 3300049742 | Ga0501080_0092647 | Ga0501080_0092647_529_1401 | 272 |
| 1028 | 3300049742 | Ga0501080_0347999 | Ga0501080_0347999_38_910 | 272 |
| 1029 | 3300049744 | Ga0501083_0013585 | Ga0501083_0013585_2482_3417 | 272 |
| 1030 | 3300049744 | Ga0501083_0161515 | Ga0501083_0161515_183_1055 | 272 |
| 1031 | 3300049822 | Ga0501035_0000009 | Ga0501035_0000009_148679_149560 | 272 |
| 1032 | 3300049822 | Ga0501035_0000553 | Ga0501035_0000553_33074_33946 | 272 |
| 1033 | 3300049822 | Ga0501035_0011132 | Ga0501035_0011132_5120_6055 | 272 |
| 1034 | 3300049822 | Ga0501035_0070342 | Ga0501035_0070342_1233_2105 | 272 |
| 1035 | 3300049823 | Ga0501044_0000005 | Ga0501044_0000005_161268_162149 | 272 |
| 1036 | 3300049823 | Ga0501044_0002857 | Ga0501044_0002857_11356_12291 | 272 |
| 1037 | 3300049823 | Ga0501044_0013594 | Ga0501044_0013594_616_1488 | 272 |
| 1038 | 3300049823 | Ga0501044_0053088 | Ga0501044_0053088_1976_2848 | 272 |
| 1039 | 3300049823 | Ga0501044_0079125 | Ga0501044_0079125_1697_2569 | 272 |
| 1040 | 3300049823 | Ga0501044_0246023 | Ga0501044_0246023_372_1244 | 272 |
| 1041 | 3300049824 | Ga0501045_0030010 | Ga0501045_0030010_1306_2178 | 272 |
| 1042 | 3300049824 | Ga0501045_0178364 | Ga0501045_0178364_182_1063 | 272 |
| 1043 | 3300050491 | nmdc:mga00v17_32885_c1 | nmdc:mga00v17_32885_c1_634_1506 | 272 |
| 1044 | 3300050492 | nmdc:mga0yw44_5347_c1 | nmdc:mga0yw44_5347_c1_4979_5851 | 272 |
| 1045 | 3300050492 | nmdc:mga0yw44_849_c1 | nmdc:mga0yw44_849_c1_258_1130 | 272 |
| 1046 | 3300050493 | nmdc:mga0k408_5881_c1 | nmdc:mga0k408_5881_c1_3983_4855 | 272 |
| 1047 | 3300050493 | nmdc:mga0k408_96574_c1 | nmdc:mga0k408_96574_c1_357_1229 | 272 |
| 1048 | 3300050494 | nmdc:mga06z11_4521_c1 | nmdc:mga06z11_4521_c1_2998_3870 | 272 |
| 1049 | 3300050496 | nmdc:mga07m45_7487_c1 | nmdc:mga07m45_7487_c1_635_1507 | 272 |
| 1050 | 3300050507 | nmdc:mga05p37_704927_c1 | nmdc:mga05p37_704927_c1_179_1051 | 272 |
| 1051 | 3300050512 | nmdc:mga0n895_5560_c1 | nmdc:mga0n895_5560_c1_3477_4349 | 272 |
| 1052 | 3300050514 | nmdc:mga08x19_122782_c1 | nmdc:mga08x19_122782_c1_798_1670 | 272 |
| 1053 | 3300050516 | nmdc:mga0sz30_13288_c1 | nmdc:mga0sz30_13288_c1_800_1672 | 272 |
| 1054 | 3300053083 | Ga0495655_0002096 | Ga0495655_0002096_1421_2293 | 272 |
| 1055 | 3300053085 | Ga0495619_0046222 | Ga0495619_0046222_600_1472 | 272 |
| 1056 | 3300053086 | Ga0500578_0054365 | Ga0500578_0054365_532_1440 | 272 |
| 1057 | 3300053087 | Ga0500643_000272 | Ga0500643_000272_22070_22942 | 272 |
| 1058 | 3300053090 | Ga0500646_0020067 | Ga0500646_0020067_607_1515 | 272 |
| 1059 | 3300053092 | Ga0500583_0030175 | Ga0500583_0030175_628_1539 | 272 |
| 1060 | 3300053092 | Ga0500583_0104032 | Ga0500583_0104032_221_1093 | 272 |
| 1061 | 3300053094 | Ga0500566_0011157 | Ga0500566_0011157_2492_3364 | 272 |
| 1062 | 3300053098 | Ga0500650_0032741 | Ga0500650_0032741_898_1770 | 272 |
| 1063 | 3300053103 | Ga0500555_043784 | Ga0500555_043784_207_1118 | 272 |
| 1064 | 3300053104 | Ga0500556_0005396 | Ga0500556_0005396_603_1511 | 272 |
| 1065 | 3300053105 | Ga0500557_000009 | Ga0500557_000009_21620_22492 | 272 |
| 1066 | 3300053108 | Ga0500562_049156 | Ga0500562_049156_160_1032 | 272 |
| 1067 | 3300053109 | Ga0500569_001637 | Ga0500569_001637_1632_2543 | 272 |
| 1068 | 3300053130 | Ga0500642_0000126 | Ga0500642_0000126_3670_4542 | 272 |
| 1069 | 3300053136 | Ga0500559_0009874 | Ga0500559_0009874_622_1530 | 272 |
| 1070 | 3300053146 | Ga0500588_0048571 | Ga0500588_0048571_293_1204 | 272 |
| 1071 | 3300053148 | Ga0500590_177452 | Ga0500590_177452_31_903 | 272 |
| 1072 | 3300053151 | Ga0500604_0013645 | Ga0500604_0013645_521_1393 | 272 |
| 1073 | 3300053153 | Ga0500616_0000402 | Ga0500616_0000402_43676_44548 | 272 |
| 1074 | 3300053153 | Ga0500616_0078858 | Ga0500616_0078858_169_1041 | 272 |
| 1075 | 3300053156 | Ga0500622_0000189 | Ga0500622_0000189_14046_14918 | 272 |
| 1076 | 3300053156 | Ga0500622_0012016 | Ga0500622_0012016_2281_3189 | 272 |
| 1077 | 3300053161 | Ga0500634_0000143 | Ga0500634_0000143_20855_21727 | 272 |
| 1078 | 3300053177 | Ga0500636_0000005 | Ga0500636_0000005_185305_186177 | 272 |
| 1079 | 3300053177 | Ga0500636_0001421 | Ga0500636_0001421_2276_3184 | 272 |
| 1080 | 3300053729 | Ga0500625_026314 | Ga0500625_026314_451_1323 | 272 |
| 1081 | 3300053730 | Ga0500645_027106 | Ga0500645_027106_201_1109 | 272 |
| 1082 | 3300053737 | Ga0500601_000404 | Ga0500601_000404_852_1724 | 272 |
| 1083 | 3300055283 | Ga0500661_005829 | Ga0500661_005829_750_1658 | 272 |
| 1084 | 3300059477 | Ga0587084_000357 | Ga0587084_000357_1502_2374 | 272 |
| 1085 | 3300059478 | Ga0587093_000659 | Ga0587093_000659_830_1702 | 272 |
| 1086 | 3300059490 | Ga0587066_000135 | Ga0587066_000135_2035_2955 | 272 |
| 1087 | 3300059490 | Ga0587066_000656 | Ga0587066_000656_961_1833 | 272 |
| 1088 | 3300059491 | Ga0587070_001080 | Ga0587070_001080_838_1710 | 272 |
| 1089 | 3300059492 | Ga0587073_0001291 | Ga0587073_0001291_1045_1917 | 272 |
| 1090 | 3300059493 | Ga0587077_000087 | Ga0587077_000087_2643_3515 | 272 |
| 1091 | 3300059493 | Ga0587077_000129 | Ga0587077_000129_2291_3163 | 272 |
| 1092 | 3300059493 | Ga0587077_000388 | Ga0587077_000388_1477_2397 | 272 |
| 1093 | 3300059493 | Ga0587077_002096 | Ga0587077_002096_25_993 | 272 |
| 1094 | 3300059493 | Ga0587077_004542 | Ga0587077_004542_857_1729 | 272 |
| 1095 | 3300059493 | Ga0587077_010618 | Ga0587077_010618_96_968 | 272 |
| 1096 | 3300059503 | Ga0587080_000518 | Ga0587080_000518_984_1856 | 272 |
| 1097 | 3300059503 | Ga0587080_009095 | Ga0587080_009095_101_973 | 272 |
| 1098 | 3300059504 | Ga0587082_000655 | Ga0587082_000655_1504_2376 | 272 |
| 1099 | 3300059504 | Ga0587082_000979 | Ga0587082_000979_362_1234 | 272 |
| 1100 | 3300059505 | Ga0587083_0000454 | Ga0587083_0000454_1267_2139 | 272 |
| 1101 | 3300059505 | Ga0587083_0018555 | Ga0587083_0018555_111_983 | 272 |
| 1102 | 3300059507 | Ga0587086_000291 | Ga0587086_000291_1491_2363 | 272 |
| 1103 | 3300059507 | Ga0587086_000870 | Ga0587086_000870_26_898 | 272 |
| 1104 | 3300059508 | Ga0587088_000088 | Ga0587088_000088_1491_2363 | 272 |
| 1105 | 3300059508 | Ga0587088_000232 | Ga0587088_000232_1566_2438 | 272 |
| 1106 | 3300059510 | Ga0587090_000159 | Ga0587090_000159_2927_3799 | 272 |
| 1107 | 3300059511 | Ga0587091_005524 | Ga0587091_005524_29_997 | 272 |
| 1108 | 3300059513 | Ga0587094_000967 | Ga0587094_000967_825_1697 | 272 |
| 1109 | 3300059513 | Ga0587094_004811 | Ga0587094_004811_577_1449 | 272 |
| 1110 | 3300059604 | Ga0587098_000159 | Ga0587098_000159_1471_2391 | 272 |
| 1111 | 3300059604 | Ga0587098_000350 | Ga0587098_000350_865_1737 | 272 |
| 1112 | 3300059604 | Ga0587098_001925 | Ga0587098_001925_766_1638 | 272 |
| 1113 | 3300059604 | Ga0587098_007867 | Ga0587098_007867_124_1005 | 272 |
| 1114 | 3300059605 | Ga0587106_000609 | Ga0587106_000609_931_1803 | 272 |
| 1115 | 3300059608 | Ga0587129_000232 | Ga0587129_000232_603_1475 | 272 |
| 1116 | 3300059622 | Ga0587099_000098 | Ga0587099_000098_1064_1936 | 272 |
| 1117 | 3300059623 | Ga0587101_000271 | Ga0587101_000271_1504_2376 | 272 |
| 1118 | 3300059623 | Ga0587101_011076 | Ga0587101_011076_31_903 | 272 |
| 1119 | 3300059625 | Ga0587113_000218 | Ga0587113_000218_918_1790 | 272 |
| 1120 | 3300059626 | Ga0587115_000092 | Ga0587115_000092_1470_2390 | 272 |
| 1121 | 3300059626 | Ga0587115_000779 | Ga0587115_000779_820_1692 | 272 |
| 1122 | 3300059630 | Ga0587128_000033 | Ga0587128_000033_3171_4091 | 272 |
| 1123 | 3300059630 | Ga0587128_000233 | Ga0587128_000233_1508_2380 | 272 |
| 1124 | 3300059639 | Ga0587062_000077 | Ga0587062_000077_1748_2668 | 272 |
| 1125 | 3300059639 | Ga0587062_000513 | Ga0587062_000513_380_1252 | 272 |
| 1126 | 3300059640 | Ga0587067_000896 | Ga0587067_000896_868_1740 | 272 |
| 1127 | 3300059641 | Ga0587068_000701 | Ga0587068_000701_1491_2363 | 272 |
| 1128 | 3300059642 | Ga0587069_000544 | Ga0587069_000544_873_1745 | 272 |
| 1129 | 3300059643 | Ga0587072_000323 | Ga0587072_000323_1571_2491 | 272 |
| 1130 | 3300059643 | Ga0587072_001126 | Ga0587072_001126_829_1701 | 272 |
| 1131 | 3300059644 | Ga0587075_000291 | Ga0587075_000291_1471_2391 | 272 |
| 1132 | 3300059644 | Ga0587075_000401 | Ga0587075_000401_1544_2416 | 272 |
| 1133 | 3300059645 | Ga0587076_001077 | Ga0587076_001077_846_1718 | 272 |
| 1134 | 3300059645 | Ga0587076_005116 | Ga0587076_005116_36_908 | 272 |
| 1135 | 3300059646 | Ga0587078_000332 | Ga0587078_000332_984_1856 | 272 |
| 1136 | 3300059647 | Ga0587079_000822 | Ga0587079_000822_1013_1885 | 272 |
| 1137 | 3300059649 | Ga0587102_000134 | Ga0587102_000134_621_1493 | 272 |
| 1138 | 3300059651 | Ga0587105_000149 | Ga0587105_000149_547_1419 | 272 |
| 1139 | 3300059652 | Ga0587107_000467 | Ga0587107_000467_848_1720 | 272 |
| 1140 | 3300059652 | Ga0587107_000611 | Ga0587107_000611_1567_2439 | 272 |
| 1141 | 3300059657 | Ga0587118_00239 | Ga0587118_00239_701_1573 | 272 |
| 1142 | 3300059658 | Ga0587119_000378 | Ga0587119_000378_820_1692 | 272 |
| 1143 | 3300060243 | Ga0587060_001450 | Ga0587060_001450_103_975 | 272 |
| 1144 | 3300060247 | Ga0587096_00039 | Ga0587096_00039_583_1455 | 272 |
| 1145 | 3300060344 | Ga0587071_000669 | Ga0587071_000669_1504_2376 | 272 |
| 1146 | 3300060346 | Ga0587111_0000161 | Ga0587111_0000161_2577_3449 | 272 |
| 1147 | 3300060346 | Ga0587111_0001051 | Ga0587111_0001051_1571_2491 | 272 |
| 1148 | 3300060353 | Ga0501082_0010931 | Ga0501082_0010931_6711_7646 | 272 |
| 1149 | iso_pu_bacteria | 2524023210 | 2524465038 | 272 |
| 1150 | iso_pu_bacteria | 2582581307 | 2585274389 | 272 |
| 1151 | iso_pu_bacteria | 2585427531 | 2585560838 | 272 |
| 1152 | iso_pu_bacteria | 8016539877 | 8016547384 | 272 |
| 1153 | iso_pu_bacteria | 8016566248 | 8016572494 | 272 |
| 1154 | iso_pu_bacteria | 8016575299 | 8016576662 | 272 |
| 1155 | iso_pu_bacteria | 8019538911 | 8019545752 | 272 |
| 1156 | iso_pu_bacteria | 8019547302 | 8019552971 | 272 |
| 1157 | iso_pu_bacteria | 8056967851 | 8056968755 | 272 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
46
330
0.88
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rlf-assembly1.cif.gz_F | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.4608 | 45 | 260 |
| 2r6g-assembly1.cif.gz_F | the crystal structure of the e. coli maltose transporter | 0.4568 | 45 | 262 |
| 3pv0-assembly1.cif.gz_F | crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide | 0.4541 | 45 | 260 |
| 4jbw-assembly1.cif.gz_F | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.4406 | 45 | 265 |
| 1s1f-assembly1.cif.gz_A | crystal structure of streptomyces coelicolor a3(2) cyp158a2 from antibiotic biosynthetic pathways | 0.4308 | 208 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.499 | 49 | 272 | 1.10.3720.10 |
| af_I6XFF3_60_302_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.4879 | 49 | 269 | 1.10.3720.10 |
| af_P10905_52_292_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.4831 | 49 | 268 | 1.10.3720.10 |
| af_P0AF01_2_224_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.4738 | 25 | 263 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.4564 | 49 | 272 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535Q4G9-F1-model_v4 | Sugar ABC transporter permease | 0.6614 | 66 | 224 |
GO:0005886
GO:0055085 |
| AF-A0A535PCK3-F1-model_v4 | Sugar ABC transporter permease | 0.6172 | 93 | 271 |
GO:0005886
GO:0055085 |
| AF-A0A4Q5P1H9-F1-model_v4 | Sugar ABC transporter permease | 0.612 | 97 | 270 |
GO:0005886
GO:0055085 |
| AF-A0A4Q5P1H9-F1-model_v4 | Sugar ABC transporter permease | 0.6055 | 97 | 270 |
GO:0005886
GO:0055085 |
| AF-A0A836ZLD8-F1-model_v4 | deleted | 0.604 | 54 | 178 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar