F490962

General Info

Members Datasets Scaffolds Average Seq Length
1157 788 765 288

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0065733|Ga0495588_0065733_538_1530
Length 330
Sequence VRAVVTAADVRLFLKKTKAAGLLPSRWGGCLYRHQREGVEMATQNTRVLARWMMAPSVGLLLIWMIVPLAMTLWFSFQNYNLLNPGNVSFAGLFNYQYFYSDPAFFQSIWNTLLIVCGVLFITVIGGIAIALMLDQPMWGQGLVRILVISPFFVMPPVAALVWKNMIMHPQYGVFADISRFFGLQPVDWFGQYPLFSIIIIVAWQWLPFATLILLTALQSLDGEQKEAAEMDGAGFVNRFIYLTVPHLARSITVVILIQTIFLLGVYAEILVTTNGGPGYASTNLPFLIYRTALLGYDVGGASAGGIIAVILANIVAFFLMRAVGKNLDK

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
8 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
9 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
17 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
18 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
24 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
25 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
26 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
27 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
28 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
29 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
30 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
31 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
32 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
33 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
34 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
35 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
36 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
37 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
38 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
39 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
40 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
41 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
42 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
43 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
44 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
45 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
46 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
47 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
48 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
49 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
50 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
51 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
52 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
53 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
54 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
55 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
56 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
57 2643221568 Rhizobium sp. Root564 Isolate Unclassified
58 2643221580 Devosia sp. Root635 Isolate Unclassified
59 2643221582 Rhizobium sp. Root651 Isolate Unclassified
60 2643221591 Devosia sp. Root685 Isolate Unclassified
61 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
62 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
63 2643221629 Devosia sp. Root105 Isolate Unclassified
64 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
65 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
66 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
67 2643221662 Devosia sp. Root413D1 Isolate Unclassified
68 2643221674 Devosia sp. Root436 Isolate Unclassified
69 2643221688 Rhizobium sp. Root482 Isolate Unclassified
70 2643221718 Rhizobium sp. Root268 Isolate Unclassified
71 2643221719 Rhizobium sp. Root274 Isolate Unclassified
72 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
73 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
74 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
75 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
76 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
77 2738543024 Aminobacter sp. AP02 Isolate Unclassified
78 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
79 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
80 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
81 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
82 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
83 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
84 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
85 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
86 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
87 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
88 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
89 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
90 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
91 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
92 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
93 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
94 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
95 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
96 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
97 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
98 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
99 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
100 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
101 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
102 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
103 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
104 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
105 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
106 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
107 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
108 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
109 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
110 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
111 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
112 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
113 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
114 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
115 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
116 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
117 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
118 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
119 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
120 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
121 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
122 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
123 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
124 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
125 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
126 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
127 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
128 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
129 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
130 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
131 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
132 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
133 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
134 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
135 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
136 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
137 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
138 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
139 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
140 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
141 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
142 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
143 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
144 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
145 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
146 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
147 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
148 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
149 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
150 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
151 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
152 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
153 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
154 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
155 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
156 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
157 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
158 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
159 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
160 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
161 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
162 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
163 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
164 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
165 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
166 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
167 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
168 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
169 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
170 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
171 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
172 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
173 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
174 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
175 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
176 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
177 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
178 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
179 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
180 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
181 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
182 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
183 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
184 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
185 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
186 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
187 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
188 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
189 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
190 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
191 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
192 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
193 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
194 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
195 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
196 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
197 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
198 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
199 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
200 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
201 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
202 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
203 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
204 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
205 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
206 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
207 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
208 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
209 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
210 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
211 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
212 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
213 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
214 2922368715
215 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
216 2922425934
217 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
218 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
219 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
220 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
221 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
222 2932401849 Devosia sp. 2618 Isolate Rhizosphere
223 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
224 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
225 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
226 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
227 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
228 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
229 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
230 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
231 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
232 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
233 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
234 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
235 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
236 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
237 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
238 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
239 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
240 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
241 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
242 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
243 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
244 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
245 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
246 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
247 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
248 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
249 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
250 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
251 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
252 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
253 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
254 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
255 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
256 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
257 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
258 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
259 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
260 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
261 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
262 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
263 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
264 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
265 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
266 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
267 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
268 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
269 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
270 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
271 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
272 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
273 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
274 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
275 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
276 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
277 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
278 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
279 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
280 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
281 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
282 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
283 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
284 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
285 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
286 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
287 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
288 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
289 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
290 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
291 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
292 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
293 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
294 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
295 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
296 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
297 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
298 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
299 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
300 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
301 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
302 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
303 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
304 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
305 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
306 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
307 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
308 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
309 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
310 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
311 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
312 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
313 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
314 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
315 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
316 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
317 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
318 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
319 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
320 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
321 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
322 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
323 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
324 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
325 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
326 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
327 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
328 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
329 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
330 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
331 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
332 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
333 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
334 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
335 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
336 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
337 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
338 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
339 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
340 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
341 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
342 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
343 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
344 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
345 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
346 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
347 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
348 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
349 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
350 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
351 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
352 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
353 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
354 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
355 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
356 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
357 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
358 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
359 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
360 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
361 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
362 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
363 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
364 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
365 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
366 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
367 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
368 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
369 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
370 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
371 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
372 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
373 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
374 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
375 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
376 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
377 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
378 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
379 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
380 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
381 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
382 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
383 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
384 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
385 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
386 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
387 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
388 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
389 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
390 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
391 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
392 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
393 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
394 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
395 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
396 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
397 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
398 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
399 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
400 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
401 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
402 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
403 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
404 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
405 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
406 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
407 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
408 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
409 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
410 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
411 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
412 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
413 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
414 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
415 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
416 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
417 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
418 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
419 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
420 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
421 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
422 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
423 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
424 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
425 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
426 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
427 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
428 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
429 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
430 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
431 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
432 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
433 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
434 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
435 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
436 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
437 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
438 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
439 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
440 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
441 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
442 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
443 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
444 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
445 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
446 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
447 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
448 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
449 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
450 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
451 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
452 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
453 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
454 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
455 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
456 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
457 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
458 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
479 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
482 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
483 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
484 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
485 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
486 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
487 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
488 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
489 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
490 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
491 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
493 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
494 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
495 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
496 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
497 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
498 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
499 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
500 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
501 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
502 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
503 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
504 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
505 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
506 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
507 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
508 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
509 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
510 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
511 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
512 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
513 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
514 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
515 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
516 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
517 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
518 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
519 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
520 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
521 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
522 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
523 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
524 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
525 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
526 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
527 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
528 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
529 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
530 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
531 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
532 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
533 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
534 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
535 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
536 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
537 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
538 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
539 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
540 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
541 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
542 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
543 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
544 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
545 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
546 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
547 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
548 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
549 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
550 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
551 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
552 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
553 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
554 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
555 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
556 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
557 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
558 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
559 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
560 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
561 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
562 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
563 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
564 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
565 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
566 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
567 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
568 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
569 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
570 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
571 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
572 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
573 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
574 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
575 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
576 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
577 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
578 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
579 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
580 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
581 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
582 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
583 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
584 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
585 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
586 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
587 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
588 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
589 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
590 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
591 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
592 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
593 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
594 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
595 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
596 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
597 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
598 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
599 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
600 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
601 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
602 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
603 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
604 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
605 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
606 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
607 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
608 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
609 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
610 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
611 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
612 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
613 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
614 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
615 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
616 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
617 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
618 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
619 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
620 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
621 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
622 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
623 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
624 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
625 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
626 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
627 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
628 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
629 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
630 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
631 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
632 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
633 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
634 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
635 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
636 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
637 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
638 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
639 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
640 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
641 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
642 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
643 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
644 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
645 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
646 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
647 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
648 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
649 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
650 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
651 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
652 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
653 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
654 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
655 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
656 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
657 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
658 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
659 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
660 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
661 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
662 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
663 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
664 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
665 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
666 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
667 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
668 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
669 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
670 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
671 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
672 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
673 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
674 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
675 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
676 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
677 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
678 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
679 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
680 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
681 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
682 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
683 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
684 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
685 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
686 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
687 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
688 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
689 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
690 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
691 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
692 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
693 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
694 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
695 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
696 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
697 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
698 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
699 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
700 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
701 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
702 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
703 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
704 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
705 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
706 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
707 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
708 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
709 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
710 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
711 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
712 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
713 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
714 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
715 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
716 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
717 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
718 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
719 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
720 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
721 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
722 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
723 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
724 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
725 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
726 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
727 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
728 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
729 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
730 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
731 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
732 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
733 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
734 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
735 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
736 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
737 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
738 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
739 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
740 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
741 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
742 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
743 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
744 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
745 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
746 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
747 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
748 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
749 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
750 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
751 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
752 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
753 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
754 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
755 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
756 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
757 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
758 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
759 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
760 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
761 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
762 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
763 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
764 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
765 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
766 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
767 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
768 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
769 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
770 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
771 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
772 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
773 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
774 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
775 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
776 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
777 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
778 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
779 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
780 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
781 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
782 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
783 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
784 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
785 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
786 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
787 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
788 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 58.44
Metatranscriptomes 7.88
Isolates 33.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 13.22
Nodule 22.47
Rhizoplane 2.94
Rhizosphere 44.34
Stem 0
Stem Tuber 0
Unclassified 16.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001029 3300001979 Bacteria 12506
2 JGI25155J39150_1000012 3300002704 Bacteria 199435
3 JGI25156J39149_1000049 3300002705 Bacteria 91988
4 JGI25162J39368_1000001 3300002737 Bacteria 740113
5 JGI25162J39368_1000146 3300002737 Bacteria 76858
6 JGI25162J39368_1000409 3300002737 Bacteria 35106
7 JGI25154J39366_1000033 3300002738 Bacteria 184379
8 JGI25157J39369_1000055 3300002741 Bacteria 107875
9 JGI25163J39215_1004290 3300002771 Bacteria 1021
10 JGI25159J45721_1000304 3300002987 Bacteria 23104
11 JGI25151J46595_10003057 3300003187 Bacteria 9463
12 JGI25406J46586_10007472 3300003203 Bacteria 4986
13 JGI25165J46597_1000001 3300003214 Bacteria 1111887
14 JGI25165J46597_1000078 3300003214 Bacteria 179320
15 JGI25165J46597_1000451 3300003214 Bacteria 41309
16 JGI25165J46597_1000751 3300003214 Bacteria 24993
17 JGI25165J46597_1001719 3300003214 Bacteria 9753
18 JGI25153J46596_10001118 3300003215 Bacteria 16267
19 JGI25153J46596_10009829 3300003215 Bacteria 4391
20 JGI25153J46596_10025010 3300003215 Bacteria 2142
21 JGI25153J46596_10025075 3300003215 Bacteria 2138
22 rootL2_10015244 3300003322 Bacteria 2097
23 JGI25160J50197_1000006 3300003354 Bacteria 316247
24 JGI25160J50197_1001199 3300003354 Bacteria 13171
25 JGI25160J50197_1011660 3300003354 Bacteria 3098
26 JGI25161J50226_1000004 3300003374 Bacteria 316212
27 Ga0006562J51391_1019963 3300003578 Bacteria 2966
28 Ga0055538_1000001 3300003751 Bacteria 1111887
29 Ga0055539_1000001 3300003752 Bacteria 1111887
30 Ga0055533_1000003 3300003756 Bacteria 1111887
31 Ga0055525_1000003 3300003759 Bacteria 962094
32 Ga0055525_1005814 3300003759 Bacteria 1045
33 Ga0055536_1004899 3300003781 Bacteria 6680
34 Ga0055530_10015159 3300003791 Bacteria 2533
35 Ga0055540_1007821 3300003792 Bacteria 3958
36 Ga0055531_10000916 3300003794 Bacteria 23920
37 Ga0055531_10009357 3300003794 Bacteria 5015
38 Ga0055541_1000001 3300003841 Bacteria 1111887
39 Ga0058692_1007093 3300003856 Bacteria 3006
40 Ga0058692_1011868 3300003856 Bacteria 2088
41 Ga0055543_1000002 3300004625 Bacteria 390020
42 Ga0065165_1000217 3300005262 Bacteria 100170
43 Ga0065165_1001104 3300005262 Bacteria 32057
44 Ga0065165_1001488 3300005262 Bacteria 24882
45 Ga0065165_1004881 3300005262 Bacteria 7928
46 Ga0065165_1006238 3300005262 Bacteria 6340
47 Ga0065704_10008449 3300005289 Bacteria 2339
48 Ga0070676_10369822 3300005328 Bacteria 990
49 Ga0068869_100212736 3300005334 Bacteria 1529
50 Ga0070666_10104128 3300005335 Bacteria 1958
51 Ga0070682_100279022 3300005337 Bacteria 1217
52 Ga0070661_100428735 3300005344 Bacteria 1049
53 Ga0070668_100016767 3300005347 Bacteria 5477
54 Ga0070668_100018004 3300005347 Bacteria 5300
55 Ga0070668_100023836 3300005347 Bacteria 4633
56 Ga0070669_100010381 3300005353 Bacteria 6614
57 Ga0070671_100028427 3300005355 Bacteria 4604
58 Ga0070667_100077871 3300005367 Bacteria 2832
59 Ga0070713_100154692 3300005436 Bacteria 2043
60 Ga0070700_100021063 3300005441 Bacteria 3787
61 Ga0070708_100234024 3300005445 Bacteria 1724
62 Ga0070663_100393871 3300005455 Bacteria 1131
63 Ga0070663_100471256 3300005455 Bacteria 1038
64 Ga0070678_100238558 3300005456 Bacteria 1519
65 Ga0070662_100207970 3300005457 Bacteria 1556
66 Ga0070707_100007996 3300005468 Bacteria 9825
67 Ga0068853_100050817 3300005539 Bacteria 3566
68 Ga0070695_100000980 3300005545 Bacteria 15536
69 Ga0070665_100000349 3300005548 Bacteria 69493
70 Ga0070665_100019496 3300005548 Bacteria 6809
71 Ga0070665_100044835 3300005548 Bacteria 4439
72 Ga0070665_100048095 3300005548 Bacteria 4283
73 Ga0070665_100123692 3300005548 Bacteria 2589
74 Ga0070665_100173854 3300005548 Bacteria 2154
75 Ga0070665_100551781 3300005548 Bacteria 1164
76 Ga0070664_100650538 3300005564 Bacteria 980
77 Ga0068854_100290135 3300005578 Bacteria 1320
78 Ga0068856_100049312 3300005614 Bacteria 4150
79 Ga0068856_100191144 3300005614 Bacteria 2061
80 Ga0068856_100287343 3300005614 Bacteria 1661
81 Ga0068852_100478184 3300005616 Bacteria 1237
82 Ga0068859_100279564 3300005617 Bacteria 1762
83 Ga0068861_100068365 3300005719 Bacteria 2745
84 Ga0068863_100370493 3300005841 Bacteria 1397
85 Ga0068860_100387746 3300005843 Bacteria 1380
86 Ga0081455_10053582 3300005937 Bacteria 3445
87 Ga0081540_1027415 3300005983 Bacteria 3228
88 Ga0081540_1053799 3300005983 Bacteria 1971
89 Ga0081540_1069025 3300005983 Bacteria 1644
90 Ga0081539_10001859 3300005985 Bacteria 33250
91 Ga0075365_10024820 3300006038 Bacteria 3788
92 Ga0075365_10104769 3300006038 Bacteria 1940
93 Ga0075363_100006188 3300006048 Bacteria 5410
94 Ga0075363_100015847 3300006048 Bacteria 3712
95 Ga0075364_10000074 3300006051 Bacteria 38784
96 Ga0075364_10038218 3300006051 Bacteria 3109
97 Ga0075364_10079924 3300006051 Bacteria 2161
98 Ga0075364_10086516 3300006051 Bacteria 2077
99 Ga0070715_10027017 3300006163 Bacteria 2289
100 Ga0075362_10002799 3300006177 Bacteria 5947
101 Ga0075362_10020346 3300006177 Bacteria 2772
102 Ga0075367_10013641 3300006178 Bacteria 4376
103 Ga0075367_10065836 3300006178 Bacteria 2171
104 Ga0075367_10080727 3300006178 Bacteria 1967
105 Ga0075369_10009090 3300006186 Bacteria 3848
106 Ga0075370_10006154 3300006353 Bacteria 6019
107 Ga0075370_10034156 3300006353 Bacteria 2851
108 Ga0075428_100013125 3300006844 Bacteria 9215
109 Ga0075434_100006769 3300006871 Bacteria 10534
110 Ga0075434_100102094 3300006871 Bacteria 2875
111 Ga0097620_100279579 3300006931 Bacteria 1762
112 Ga0099825_1024201 3300006941 Bacteria 3593
113 Ga0099824_1006678 3300006942 Bacteria 15704
114 Ga0099822_1043467 3300006943 Bacteria 2281
115 Ga0079104_1000563 3300006946 Bacteria 37845
116 Ga0099826_10000045 3300006948 Bacteria 75912
117 Ga0099826_10007422 3300006948 Bacteria 8096
118 Ga0105244_10038235 3300009036 Bacteria 2503
119 Ga0105244_10156677 3300009036 Bacteria 1089
120 Ga0105240_10000019 3300009093 Bacteria 406211
121 Ga0105240_10216082 3300009093 Bacteria 2237
122 Ga0105240_10271139 3300009093 Bacteria 1954
123 Ga0105245_10202801 3300009098 Bacteria 1905
124 Ga0105247_10133439 3300009101 Bacteria 1620
125 Ga0105247_10166301 3300009101 Bacteria 1464
126 Ga0114129_10012990 3300009147 Bacteria 11857
127 Ga0105243_10068288 3300009148 Bacteria 2864
128 Ga0105243_10070952 3300009148 Bacteria 2815
129 Ga0105243_10073163 3300009148 Bacteria 2776
130 Ga0105241_10068288 3300009174 Bacteria 2754
131 Ga0105242_10354023 3300009176 Bacteria 1357
132 Ga0105242_10743290 3300009176 Bacteria 965
133 Ga0105248_10087965 3300009177 Bacteria 3497
134 Ga0105237_10002910 3300009545 Bacteria 20751
135 Ga0105237_10027706 3300009545 Bacteria 5777
136 Ga0105237_10076852 3300009545 Bacteria 3329
137 Ga0105237_10239726 3300009545 Bacteria 1815
138 Ga0105237_10332327 3300009545 Bacteria 1524
139 Ga0105237_10430298 3300009545 Bacteria 1325
140 Ga0105238_10053821 3300009551 Bacteria 4044
141 Ga0105249_10014920 3300009553 Bacteria 6873
142 Ga0105239_10006284 3300010375 Bacteria 13818
143 Ga0105239_10038814 3300010375 Bacteria 5217
144 Ga0105239_10042362 3300010375 Bacteria 4989
145 Ga0105239_10045034 3300010375 Bacteria 4836
146 Ga0105239_10271542 3300010375 Bacteria 1907
147 Ga0105239_10347186 3300010375 Bacteria 1675
148 Ga0105239_10583899 3300010375 Bacteria 1274
149 Ga0105246_10012435 3300011119 Bacteria 5312
150 Ga0105246_10031951 3300011119 Bacteria 3488
151 Ga0157373_10019415 3300013100 Bacteria 4946
152 Ga0157371_10000005 3300013102 Bacteria 416456
153 Ga0157371_10088074 3300013102 Bacteria 2198
154 Ga0157370_10005600 3300013104 Bacteria 14063
155 Ga0157369_10216291 3300013105 Bacteria 2007
156 Ga0157369_10301305 3300013105 Bacteria 1667
157 Ga0157369_10448858 3300013105 Bacteria 1335
158 Ga0157369_10564260 3300013105 Bacteria 1176
159 Ga0157374_10099050 3300013296 Bacteria 2792
160 Ga0163162_10304059 3300013306 Bacteria 1727
161 Ga0182008_10128144 3300014497 Bacteria 1264
162 Ga0157379_10230010 3300014968 Bacteria 1680
163 Ga0157376_10529186 3300014969 Bacteria 1163
164 Ga0182006_1009455 3300015261 Bacteria 4367
165 Ga0182007_10001799 3300015262 Bacteria 11183
166 Ga0182005_1024788 3300015265 Bacteria 1638
167 Ga0182005_1025969 3300015265 Bacteria 1598
168 Ga0214544_1000004 3300021320 Bacteria 455869
169 Ga0214542_1000001 3300021321 Bacteria 1018696
170 Ga0214545_1000001 3300021324 Bacteria 1092817
171 Ga0214543_1000006 3300021327 Bacteria 443395
172 Ga0213874_10005902 3300021377 Bacteria 2875
173 Ga0209435_100005 3300025206 Bacteria 573745
174 Ga0209436_115303 3300025208 Bacteria 1191
175 Ga0209784_100004 3300025224 Bacteria 1378156
176 Ga0209566_100004 3300025225 Bacteria 1531866
177 Ga0209674_100006 3300025226 Bacteria 1531866
178 Ga0209563_100009 3300025230 Bacteria 1378156
179 Ga0209563_102075 3300025230 Bacteria 4743
180 Ga0207427_100300 3300025231 Bacteria 34562
181 Ga0209437_100004 3300025233 Bacteria 1378156
182 Ga0209437_100078 3300025233 Bacteria 278088
183 Ga0209437_100174 3300025233 Bacteria 138811
184 Ga0209646_1000011 3300025246 Bacteria 573745
185 Ga0209646_1005577 3300025246 Bacteria 2180
186 Ga0209026_1000008 3300025250 Bacteria 573745
187 Ga0209677_100005 3300025253 Bacteria 1378156
188 Ga0209677_100155 3300025253 Bacteria 62873
189 Ga0209677_104509 3300025253 Bacteria 3986
190 Ga0209759_1000004 3300025256 Bacteria 573745
191 Ga0209233_1000005 3300025261 Bacteria 1531866
192 Ga0209233_1000150 3300025261 Bacteria 179401
193 Ga0209233_1000163 3300025261 Bacteria 152912
194 Ga0209233_1000295 3300025261 Bacteria 62548
195 Ga0209233_1000441 3300025261 Bacteria 28814
196 Ga0209233_1000459 3300025261 Bacteria 26552
197 Ga0209233_1001854 3300025261 Bacteria 8120
198 Ga0209233_1012224 3300025261 Bacteria 2495
199 Ga0209455_1010339 3300025272 Bacteria 2378
200 Ga0209130_1000032 3300025284 Bacteria 316240
201 Ga0209676_1002982 3300025292 Bacteria 11009
202 Ga0209025_1000445 3300025294 Bacteria 81092
203 Ga0209025_1001209 3300025294 Bacteria 36250
204 Ga0209025_1020477 3300025294 Bacteria 3618
205 Ga0209025_1051016 3300025294 Bacteria 1648
206 Ga0209025_1052966 3300025294 Bacteria 1597
207 Ga0209564_1008632 3300025295 Bacteria 4994
208 Ga0209758_1000011 3300025297 Bacteria 1049685
209 Ga0209758_1000105 3300025297 Bacteria 221415
210 Ga0209758_1000345 3300025297 Bacteria 84958
211 Ga0209758_1001280 3300025297 Bacteria 31015
212 Ga0209758_1012480 3300025297 Bacteria 4753
213 Ga0209758_1034315 3300025297 Bacteria 2021
214 Ga0209050_1006042 3300025298 Bacteria 7329
215 Ga0209256_1002090 3300025299 Bacteria 17511
216 Ga0209256_1013546 3300025299 Bacteria 3016
217 Ga0207426_1000077 3300025302 Bacteria 316246
218 Ga0207426_1000400 3300025302 Bacteria 73493
219 Ga0207426_1000402 3300025302 Bacteria 72738
220 Ga0209051_1005198 3300025303 Bacteria 7700
221 Ga0209257_1001089 3300025304 Bacteria 35523
222 Ga0209257_1003767 3300025304 Bacteria 12521
223 Ga0207710_10033009 3300025900 Bacteria 2269
224 Ga0207647_10002713 3300025904 Bacteria 13371
225 Ga0207705_10270945 3300025909 Bacteria 1298
226 Ga0207684_10151077 3300025910 Bacteria 1998
227 Ga0207684_10177313 3300025910 Bacteria 1837
228 Ga0207654_10049356 3300025911 Bacteria 2413
229 Ga0207695_10000008 3300025913 Bacteria 1058268
230 Ga0207695_10000049 3300025913 Bacteria 406233
231 Ga0207695_10001193 3300025913 Bacteria 44667
232 Ga0207671_10000107 3300025914 Bacteria 128950
233 Ga0207671_10001041 3300025914 Bacteria 33720
234 Ga0207671_10073634 3300025914 Bacteria 2552
235 Ga0207646_10057330 3300025922 Bacteria 3481
236 Ga0207681_10018137 3300025923 Bacteria 4431
237 Ga0207694_10033877 3300025924 Bacteria 3914
238 Ga0207687_10089190 3300025927 Bacteria 2245
239 Ga0207700_10098188 3300025928 Bacteria 2329
240 Ga0207644_10049516 3300025931 Bacteria 3008
241 Ga0207690_10123574 3300025932 Bacteria 1884
242 Ga0207706_10139987 3300025933 Bacteria 2128
243 Ga0207709_10090813 3300025935 Bacteria 1996
244 Ga0207709_10120968 3300025935 Bacteria 1767
245 Ga0207670_10277882 3300025936 Bacteria 1304
246 Ga0207711_10043179 3300025941 Bacteria 3844
247 Ga0207712_10035469 3300025961 Bacteria 3389
248 Ga0207668_10057399 3300025972 Bacteria 2715
249 Ga0207668_10081246 3300025972 Bacteria 2350
250 Ga0207668_10096919 3300025972 Bacteria 2181
251 Ga0207640_10088366 3300025981 Bacteria 2139
252 Ga0207678_10088900 3300026067 Bacteria 2640
253 Ga0207678_10263401 3300026067 Bacteria 1478
254 Ga0207708_10017794 3300026075 Bacteria 5348
255 Ga0207702_10166633 3300026078 Bacteria 2016
256 Ga0207675_100303545 3300026118 Bacteria 1555
257 Ga0207698_10150594 3300026142 Bacteria 2018
258 Ga0207698_10275362 3300026142 Bacteria 1554
259 Ga0207698_10562057 3300026142 Bacteria 1120
260 Ga0209281_1000032 3300027111 Bacteria 401727
261 Ga0209389_1000001 3300027296 Bacteria 463799
262 Ga0209389_1000010 3300027296 Bacteria 223892
263 Ga0209371_1000003 3300027312 Bacteria 1122971
264 Ga0209371_1002352 3300027312 Bacteria 10747
265 Ga0209589_1000002 3300027357 Bacteria 708598
266 Ga0209589_1000016 3300027357 Bacteria 223788
267 Ga0209489_100002 3300027361 Bacteria 708609
268 Ga0209489_100016 3300027361 Bacteria 223873
269 Ga0209489_113333 3300027361 Bacteria 6704
270 Ga0209700_100002 3300027363 Bacteria 708598
271 Ga0209700_100007 3300027363 Bacteria 454608
272 Ga0209282_1000210 3300027666 Bacteria 31123
273 Ga0209282_1008160 3300027666 Bacteria 6594
274 Ga0268266_10000092 3300028379 Bacteria 192109
275 Ga0268266_10002356 3300028379 Bacteria 20435
276 Ga0268266_10136273 3300028379 Bacteria 2199
277 Ga0268266_10174646 3300028379 Bacteria 1952
278 Ga0268266_10181379 3300028379 Bacteria 1917
279 Ga0268266_10362274 3300028379 Bacteria 1364
280 Ga0265337_1004861 3300028556 Bacteria 5485
281 Ga0265326_10006349 3300028558 Bacteria 3682
282 Ga0265319_1005704 3300028563 Bacteria 5907
283 Ga0265334_10001643 3300028573 Bacteria 10718
284 Ga0265318_10034833 3300028577 Bacteria 1938
285 Ga0265323_10000803 3300028653 Bacteria 16860
286 Ga0265336_10001030 3300028666 Bacteria 13681
287 Ga0307517_10000875 3300028786 Bacteria 51286
288 Ga0307517_10035058 3300028786 Bacteria 5692
289 Ga0307515_10000017 3300028794 Bacteria 550465
290 Ga0307515_10005257 3300028794 Bacteria 26313
291 Ga0307515_10011281 3300028794 Bacteria 16963
292 Ga0307515_10079364 3300028794 Bacteria 4300
293 Ga0265338_10000076 3300028800 Bacteria 180204
294 Ga0265324_10002044 3300029957 Bacteria 10728
295 Ga0268256_1000004 3300030500 Bacteria 1122967
296 Ga0268256_1001392 3300030500 Bacteria 14681
297 Ga0307512_10090549 3300030522 Bacteria 2133
298 Ga0265340_10050010 3300031247 Bacteria 2029
299 Ga0307513_10053382 3300031456 Bacteria 4345
300 Ga0307408_100101330 3300031548 Bacteria 2194
301 Ga0265313_10072373 3300031595 Bacteria 1584
302 Ga0307508_10087736 3300031616 Bacteria 2695
303 Ga0307508_10300855 3300031616 Bacteria 1197
304 Ga0307514_10030872 3300031649 Bacteria 4299
305 Ga0265314_10005339 3300031711 Bacteria 11618
306 Ga0265342_10035803 3300031712 Bacteria 3035
307 Ga0307516_10355366 3300031730 Bacteria 1130
308 Ga0307406_10033730 3300031901 Bacteria 3135
309 Ga0307412_10431317 3300031911 Bacteria 1081
310 Ga0307414_10008732 3300032004 Bacteria 5775
311 Ga0307414_10166766 3300032004 Bacteria 1756
312 Ga0307414_10214893 3300032004 Bacteria 1574
313 Ga0307411_10062906 3300032005 Bacteria 2478
314 Ga0307510_10003276 3300033180 Bacteria 18841
315 Ga0307510_10120793 3300033180 Bacteria 2326
316 Ga0307510_10207436 3300033180 Bacteria 1486
317 Ga0315911_1000007 3300033442 Bacteria 413725
318 Ga0395900_0183744 3300037418 Bacteria 2123
319 Ga0395900_0268425 3300037418 Bacteria 1702
320 Ga0395900_0347928 3300037418 Bacteria 1456
321 Ga0395898_0372586 3300037466 Bacteria 1362
322 Ga0395905_0060148 3300037471 Bacteria 3552
323 Ga0395905_0101885 3300037471 Bacteria 2695
324 Ga0395905_0306078 3300037471 Bacteria 1477
325 Ga0395905_0456172 3300037471 Bacteria 1176
326 Ga0395901_0219662 3300038443 Bacteria 1987
327 Ga0395901_0305349 3300038443 Bacteria 1649
328 Ga0395901_0531044 3300038443 Bacteria 1194
329 Ga0395901_0569198 3300038443 Bacteria 1146
330 Ga0400483_146472 3300039062 Bacteria 8547
331 Ga0400483_193432 3300039062 Bacteria 9134
332 Ga0436365_1592281 3300039437 Bacteria 2915
333 Ga0436361_0847892 3300039447 Bacteria 2203
334 Ga0436363_0259999 3300039450 Bacteria 4253
335 Ga0436363_1697570 3300039450 Bacteria 1316
336 Ga0436362_1201805 3300039453 Bacteria 2123
337 Ga0439436_0009638 3300041404 Bacteria 2960
338 Ga0439438_048316 3300041405 Bacteria 1089
339 Ga0439461_0028331 3300041410 Bacteria 1153
340 Ga0439466_0041491 3300041411 Bacteria 1535
341 Ga0439445_0064834 3300042004 Bacteria 1004
342 Ga0439449_0030465 3300042007 Bacteria 2011
343 Ga0450920_008222 3300042122 Bacteria 1904
344 Ga0439434_0033988 3300042435 Bacteria 1556
345 Ga0439459_0016431 3300042438 Bacteria 1368
346 Ga0450918_007484 3300042531 Bacteria 1930
347 Ga0466972_0000223 3300044658 Bacteria 40015
348 Ga0466972_0064291 3300044658 Bacteria 1756
349 Ga0466965_0051073 3300044683 Bacteria 2051
350 Ga0466965_0057454 3300044683 Bacteria 1939
351 Ga0466966_0034491 3300044684 Bacteria 3271
352 Ga0466966_0089095 3300044684 Bacteria 1917
353 Ga0466966_0165812 3300044684 Bacteria 1344
354 Ga0466964_0030074 3300044706 Bacteria 2148
355 Ga0466968_0152879 3300044735 Bacteria 1061
356 Ga0466970_0113606 3300044765 Bacteria 1480
357 Ga0466970_0203836 3300044765 Bacteria 1101
358 Ga0466957_0021800 3300044842 Bacteria 3776
359 Ga0466960_0058915 3300044901 Bacteria 1877
360 Ga0451576_0673963 3300045051 Bacteria 1087
361 Ga0495592_0006028 3300046454 Bacteria 9014
362 Ga0495592_0042076 3300046454 Bacteria 3422
363 Ga0495629_0007893 3300046459 Bacteria 7829
364 Ga0495638_0011564 3300046460 Bacteria 6081
365 Ga0495651_0003476 3300046462 Bacteria 12075
366 Ga0495651_0014212 3300046462 Bacteria 6153
367 Ga0495653_0029927 3300046463 Bacteria 4339
368 Ga0495650_0035367 3300046471 Bacteria 2200
369 Ga0495662_0101687 3300046476 Bacteria 1406
370 Ga0495606_0006924 3300046507 Bacteria 10312
371 Ga0495606_0053038 3300046507 Bacteria 2633
372 Ga0495608_0010132 3300046511 Bacteria 6573
373 Ga0495608_0010325 3300046511 Bacteria 6517
374 Ga0495628_0013956 3300046516 Bacteria 6746
375 Ga0495628_0028035 3300046516 Bacteria 4580
376 Ga0495643_0077064 3300046522 Bacteria 1742
377 Ga0495643_0183023 3300046522 Bacteria 1017
378 Ga0495648_0009261 3300046524 Bacteria 7654
379 Ga0495652_0033972 3300046529 Bacteria 4447
380 Ga0495652_0040135 3300046529 Bacteria 4045
381 Ga0495652_0060027 3300046529 Bacteria 3215
382 Ga0495654_0079440 3300046530 Bacteria 1541
383 Ga0495640_0053526 3300046533 Bacteria 2767
384 Ga0495587_0066043 3300046536 Bacteria 2111
385 Ga0495597_0051636 3300046542 Bacteria 1812
386 Ga0495597_0133895 3300046542 Bacteria 1026
387 Ga0495645_0032890 3300046543 Bacteria 3783
388 Ga0495622_0055998 3300046557 Bacteria 1828
389 Ga0495633_0059342 3300046558 Bacteria 1794
390 Ga0495633_0172630 3300046558 Bacteria 996
391 Ga0495667_0019541 3300046559 Bacteria 4571
392 Ga0495668_0062432 3300046616 Bacteria 2053
393 Ga0495634_0023196 3300046642 Bacteria 4364
394 Ga0495611_0138584 3300046648 Bacteria 1136
395 Ga0495625_0171361 3300046660 Bacteria 1449
396 Ga0495625_0301726 3300046660 Bacteria 1025
397 Ga0495635_0015040 3300046663 Bacteria 5413
398 Ga0495635_0055541 3300046663 Bacteria 2728
399 Ga0495588_0000802 3300046674 Bacteria 14062
400 Ga0495588_0036609 3300046674 Bacteria 2490
401 Ga0495588_0065733 3300046674 Bacteria 1882
402 Ga0495657_0001348 3300046675 Bacteria 21351
403 Ga0495657_0042744 3300046675 Bacteria 3092
404 Ga0495646_0066146 3300046680 Bacteria 2138
405 Ga0495624_0123402 3300046690 Bacteria 1590
406 Ga0495671_0027713 3300046692 Bacteria 2923
407 Ga0495649_0006416 3300046694 Bacteria 7323
408 Ga0495589_0074662 3300046794 Bacteria 1654
409 Ga0495600_0001805 3300046809 Bacteria 11977
410 Ga0495600_0013217 3300046809 Bacteria 5183
411 Ga0495600_0020788 3300046809 Bacteria 4200
412 Ga0495581_0059334 3300047315 Bacteria 2211
413 Ga0495604_0006572 3300047317 Bacteria 9216
414 Ga0495604_0009422 3300047317 Bacteria 7724
415 Ga0495604_0111853 3300047317 Bacteria 1990
416 Ga0495674_0061626 3300047319 Bacteria 3268
417 Ga0495676_0031415 3300047321 Bacteria 4492
418 Ga0495680_0061574 3300047322 Bacteria 2886
419 Ga0495683_0032722 3300047323 Bacteria 2648
420 Ga0495687_007327 3300047443 Bacteria 6524
421 Ga0495675_0013083 3300047444 Bacteria 5234
422 Ga0495681_0000633 3300047470 Bacteria 26818
423 Ga0495684_0036589 3300047471 Bacteria 3763
424 Ga0495686_0127232 3300047472 Bacteria 1514
425 Ga0495686_0221231 3300047472 Bacteria 1077
426 Ga0495602_0017394 3300048088 Bacteria 7209
427 Ga0496100_0080677 3300048903 Bacteria 2196
428 Ga0496101_0242986 3300048904 Bacteria 1401
429 Ga0496102_0026452 3300048905 Bacteria 5174
430 Ga0496102_0198851 3300048905 Bacteria 1889
431 Ga0496102_0241985 3300048905 Bacteria 1701
432 Ga0496102_0421276 3300048905 Bacteria 1254
433 Ga0496103_0011150 3300048906 Bacteria 5323
434 Ga0496103_0313582 3300048906 Bacteria 1009
435 Ga0496104_0023025 3300048907 Bacteria 5724
436 Ga0496104_0094352 3300048907 Bacteria 2862
437 Ga0496105_0030560 3300048908 Bacteria 4413
438 Ga0496105_0376154 3300048908 Bacteria 1131
439 Ga0496106_0123728 3300048909 Bacteria 2023
440 Ga0496106_0554551 3300048909 Bacteria 922
441 Ga0496107_0021362 3300048910 Bacteria 4575
442 Ga0496108_0014576 3300048911 Bacteria 6417
443 Ga0496108_0202889 3300048911 Bacteria 1721
444 Ga0496109_0023600 3300048912 Bacteria 5460
445 Ga0496110_0089212 3300048913 Bacteria 2756
446 Ga0496110_0182006 3300048913 Bacteria 1908
447 Ga0496111_0010417 3300048914 Bacteria 6238
448 Ga0496111_0399674 3300048914 Bacteria 1015
449 Ga0496112_0028981 3300048915 Bacteria 5350
450 Ga0496113_0054041 3300048916 Bacteria 3005
451 Ga0496113_0072547 3300048916 Bacteria 2620
452 Ga0496113_0408218 3300048916 Bacteria 1091
453 Ga0496116_0000135 3300048919 Bacteria 153165
454 Ga0496116_0013446 3300048919 Bacteria 6598
455 Ga0496117_0000030 3300048920 Bacteria 389141
456 Ga0496117_0000036 3300048920 Bacteria 325635
457 Ga0496117_0002215 3300048920 Bacteria 25150
458 Ga0496117_0027761 3300048920 Bacteria 4399
459 Ga0496117_0149213 3300048920 Bacteria 1386
460 Ga0496118_0015167 3300048921 Bacteria 7155
461 Ga0496118_0015347 3300048921 Bacteria 7096
462 Ga0496118_0045413 3300048921 Bacteria 3430
463 Ga0496118_0109917 3300048921 Bacteria 1833
464 Ga0496118_0217436 3300048921 Bacteria 1115
465 Ga0496119_0013167 3300048922 Bacteria 6617
466 Ga0496119_0056490 3300048922 Bacteria 2378
467 Ga0496119_0088051 3300048922 Bacteria 1771
468 Ga0496120_0001375 3300048923 Bacteria 29703
469 Ga0496120_0006733 3300048923 Bacteria 8733
470 Ga0496120_0031758 3300048923 Bacteria 3193
471 Ga0496120_0056525 3300048923 Bacteria 2214
472 Ga0496120_0097036 3300048923 Bacteria 1564
473 Ga0496121_0000003 3300048924 Bacteria 1191431
474 Ga0496121_0000180 3300048924 Bacteria 141128
475 Ga0496121_0090651 3300048924 Bacteria 2389
476 Ga0496121_0114301 3300048924 Bacteria 2052
477 Ga0496121_0157261 3300048924 Bacteria 1666
478 Ga0496121_0263191 3300048924 Bacteria 1189
479 Ga0496121_0263192 3300048924 Bacteria 1189
480 Ga0496122_0000002 3300048925 Bacteria 905834
481 Ga0496122_0000050 3300048925 Bacteria 267874
482 Ga0496122_0000107 3300048925 Bacteria 193163
483 Ga0496122_0043126 3300048925 Bacteria 3538
484 Ga0496122_0131503 3300048925 Bacteria 1588
485 Ga0496123_0000002 3300048926 Bacteria 1811682
486 Ga0496123_0000023 3300048926 Bacteria 346894
487 Ga0496123_0000063 3300048926 Bacteria 216072
488 Ga0496123_0022678 3300048926 Bacteria 4830
489 Ga0496123_0116701 3300048926 Bacteria 1511
490 Ga0496124_0000239 3300048927 Bacteria 106633
491 Ga0496124_0001743 3300048927 Bacteria 30475
492 Ga0496124_0006693 3300048927 Bacteria 12475
493 Ga0496124_0032989 3300048927 Bacteria 4563
494 Ga0496124_0049059 3300048927 Bacteria 3603
495 Ga0496124_0050788 3300048927 Bacteria 3531
496 Ga0496124_0130593 3300048927 Bacteria 1996
497 Ga0496124_0147380 3300048927 Bacteria 1851
498 Ga0496124_0159222 3300048927 Bacteria 1762
499 Ga0496124_0217407 3300048927 Bacteria 1440
500 Ga0496124_0274835 3300048927 Bacteria 1231
501 Ga0496125_0000200 3300048928 Bacteria 126369
502 Ga0496125_0000306 3300048928 Bacteria 96360
503 Ga0496125_0044724 3300048928 Bacteria 3738
504 Ga0496125_0201461 3300048928 Bacteria 1302
505 Ga0496126_0000129 3300048929 Bacteria 174059
506 Ga0496126_0000188 3300048929 Bacteria 139625
507 Ga0496126_0022621 3300048929 Bacteria 6110
508 Ga0496126_0108299 3300048929 Bacteria 2423
509 Ga0496126_0270131 3300048929 Bacteria 1411
510 Ga0496126_0288362 3300048929 Bacteria 1358
511 Ga0496126_0330264 3300048929 Bacteria 1251
512 Ga0495682_0005057 3300049460 Bacteria 5538
513 Ga0501031_0042424 3300049568 Bacteria 2969
514 Ga0501031_0074864 3300049568 Bacteria 2204
515 Ga0501031_0276600 3300049568 Bacteria 1089
516 Ga0501032_0000004 3300049569 Bacteria 310855
517 Ga0501032_0002753 3300049569 Bacteria 13683
518 Ga0501032_0078299 3300049569 Bacteria 2201
519 Ga0501033_0000016 3300049570 Bacteria 217458
520 Ga0501033_0000438 3300049570 Bacteria 39916
521 Ga0501033_0004986 3300049570 Bacteria 10556
522 Ga0501033_0019437 3300049570 Bacteria 5137
523 Ga0501034_0000011 3300049571 Bacteria 310855
524 Ga0501034_0000712 3300049571 Bacteria 50543
525 Ga0501034_0002438 3300049571 Bacteria 22442
526 Ga0501034_0002517 3300049571 Bacteria 21984
527 Ga0501034_0004793 3300049571 Bacteria 14958
528 Ga0501034_0045426 3300049571 Bacteria 4438
529 Ga0501034_0184508 3300049571 Bacteria 2050
530 Ga0501034_0251611 3300049571 Bacteria 1711
531 Ga0501034_0488861 3300049571 Bacteria 1145
532 Ga0501036_0000001 3300049572 Bacteria 310855
533 Ga0501036_0003294 3300049572 Bacteria 12883
534 Ga0501036_0006995 3300049572 Bacteria 9182
535 Ga0501036_0065241 3300049572 Bacteria 3082
536 Ga0501036_0092384 3300049572 Bacteria 2556
537 Ga0501036_0179313 3300049572 Bacteria 1784
538 Ga0501037_0000006 3300049573 Bacteria 217461
539 Ga0501037_0000722 3300049573 Bacteria 25036
540 Ga0501037_0005086 3300049573 Bacteria 9569
541 Ga0501037_0048495 3300049573 Bacteria 3111
542 Ga0501037_0064525 3300049573 Bacteria 2669
543 Ga0501037_0175549 3300049573 Bacteria 1522
544 Ga0501038_0000003 3300049574 Bacteria 310855
545 Ga0501038_0000047 3300049574 Bacteria 104311
546 Ga0501038_0006213 3300049574 Bacteria 11049
547 Ga0501038_0071935 3300049574 Bacteria 2932
548 Ga0501038_0096508 3300049574 Bacteria 2467
549 Ga0501038_0187849 3300049574 Bacteria 1664
550 Ga0501038_0256190 3300049574 Bacteria 1384
551 Ga0501039_0000004 3300049575 Bacteria 310855
552 Ga0501039_0000038 3300049575 Bacteria 119484
553 Ga0501039_0001298 3300049575 Bacteria 18251
554 Ga0501039_0002554 3300049575 Bacteria 13579
555 Ga0501040_0002512 3300049576 Bacteria 11813
556 Ga0501040_0012498 3300049576 Bacteria 5563
557 Ga0501041_0082274 3300049577 Bacteria 1983
558 Ga0501042_0022636 3300049578 Bacteria 4390
559 Ga0501042_0083948 3300049578 Bacteria 2283
560 Ga0501042_0370607 3300049578 Bacteria 1036
561 Ga0501043_0000131 3300049579 Bacteria 69743
562 Ga0501043_0000155 3300049579 Bacteria 62570
563 Ga0501043_0011433 3300049579 Bacteria 6949
564 Ga0501043_0013677 3300049579 Bacteria 6352
565 Ga0501043_0075709 3300049579 Bacteria 2643
566 Ga0501043_0148232 3300049579 Bacteria 1836
567 Ga0501046_0001714 3300049580 Bacteria 20920
568 Ga0501046_0068786 3300049580 Bacteria 2756
569 Ga0501046_0139899 3300049580 Bacteria 1832
570 Ga0501047_0021199 3300049581 Bacteria 6240
571 Ga0501047_0103798 3300049581 Bacteria 2723
572 Ga0501047_0191688 3300049581 Bacteria 1907
573 Ga0501047_0314333 3300049581 Bacteria 1407
574 Ga0501048_0022766 3300049582 Bacteria 4581
575 Ga0501048_0053324 3300049582 Bacteria 2876
576 Ga0501069_0002311 3300049585 Bacteria 9623
577 Ga0501070_0022569 3300049586 Bacteria 5271
578 Ga0501070_0047177 3300049586 Bacteria 3581
579 Ga0501070_0178399 3300049586 Bacteria 1748
580 Ga0501070_0521760 3300049586 Bacteria 953
581 Ga0501071_0177923 3300049587 Bacteria 1593
582 Ga0501071_0231418 3300049587 Bacteria 1392
583 Ga0501073_0002004 3300049589 Bacteria 15198
584 Ga0501074_0005021 3300049590 Bacteria 9496
585 Ga0501074_0106220 3300049590 Bacteria 2010
586 Ga0501075_0267942 3300049591 Bacteria 1302
587 Ga0501075_0420454 3300049591 Bacteria 1019
588 Ga0501076_0120412 3300049592 Bacteria 2125
589 Ga0501079_0077058 3300049741 Bacteria 2579
590 Ga0501080_0002095 3300049742 Bacteria 17315
591 Ga0501080_0092647 3300049742 Bacteria 2806
592 Ga0501080_0347999 3300049742 Bacteria 1339
593 Ga0501083_0013585 3300049744 Bacteria 5693
594 Ga0501083_0161515 3300049744 Bacteria 1466
595 Ga0501035_0000009 3300049822 Bacteria 310827
596 Ga0501035_0000553 3300049822 Bacteria 41541
597 Ga0501035_0011132 3300049822 Bacteria 8331
598 Ga0501035_0070342 3300049822 Bacteria 3100
599 Ga0501044_0000005 3300049823 Bacteria 310855
600 Ga0501044_0002857 3300049823 Bacteria 19658
601 Ga0501044_0013594 3300049823 Bacteria 8797
602 Ga0501044_0053088 3300049823 Bacteria 4172
603 Ga0501044_0079125 3300049823 Bacteria 3331
604 Ga0501044_0246023 3300049823 Bacteria 1731
605 Ga0501045_0030010 3300049824 Bacteria 3933
606 Ga0501045_0108466 3300049824 Bacteria 2058
607 Ga0501045_0178364 3300049824 Bacteria 1583
608 nmdc:mga03683_1610_c1 3300050489 Bacteria 6761
609 nmdc:mga00v17_32885_c1 3300050491 Bacteria 3069
610 nmdc:mga00v17_68286_c1 3300050491 Bacteria 2197
611 nmdc:mga00v17_78_c1 3300050491 Bacteria 40508
612 nmdc:mga0yw44_5347_c1 3300050492 Bacteria 6047
613 nmdc:mga0yw44_849_c1 3300050492 Bacteria 1904
614 nmdc:mga0k408_44631_c1 3300050493 Bacteria 2557
615 nmdc:mga0k408_5881_c1 3300050493 Bacteria 6539
616 nmdc:mga0k408_96574_c1 3300050493 Bacteria 1740
617 nmdc:mga06z11_163794_c1 3300050494 Bacteria 1273
618 nmdc:mga06z11_4521_c1 3300050494 Bacteria 5477
619 nmdc:mga06z11_89330_c1 3300050494 Bacteria 1670
620 nmdc:mga07m45_352464_c1 3300050496 Bacteria 855
621 nmdc:mga07m45_7487_c1 3300050496 Bacteria 5580
622 nmdc:mga07m45_9056_c1 3300050496 Bacteria 5143
623 nmdc:mga05p37_13489_c1 3300050507 Bacteria 9792
624 nmdc:mga05p37_704927_c1 3300050507 Bacteria 1120
625 nmdc:mga0n895_5560_c1 3300050512 Bacteria 10552
626 nmdc:mga0rr50_99336_c1 3300050513 Bacteria 2283
627 nmdc:mga08x19_122782_c1 3300050514 Bacteria 1742
628 nmdc:mga0sz30_13288_c1 3300050516 Bacteria 3222
629 nmdc:mga0sz30_97976_c1 3300050516 Bacteria 1279
630 Ga0495601_0007438 3300053077 Bacteria 6422
631 Ga0495655_0002096 3300053083 Bacteria 3131
632 Ga0495655_0020785 3300053083 Bacteria 1477
633 Ga0495619_0046222 3300053085 Bacteria 2862
634 Ga0500578_0054365 3300053086 Bacteria 2564
635 Ga0500643_000272 3300053087 Bacteria 45523
636 Ga0500646_0020067 3300053090 Bacteria 1773
637 Ga0500583_0030175 3300053092 Bacteria 2372
638 Ga0500583_0104032 3300053092 Bacteria 1393
639 Ga0500566_0011157 3300053094 Bacteria 5295
640 Ga0500650_0032741 3300053098 Bacteria 2369
641 Ga0500555_001807 3300053103 Bacteria 6381
642 Ga0500555_043784 3300053103 Bacteria 1240
643 Ga0500556_0005396 3300053104 Bacteria 3610
644 Ga0500557_000009 3300053105 Bacteria 125806
645 Ga0500560_000929 3300053107 Bacteria 4624
646 Ga0500562_049156 3300053108 Bacteria 1127
647 Ga0500569_001637 3300053109 Bacteria 4263
648 Ga0500595_026901 3300053119 Bacteria 1976
649 Ga0500618_000109 3300053125 Bacteria 66318
650 Ga0500618_000758 3300053125 Bacteria 18265
651 Ga0500618_010434 3300053125 Bacteria 2492
652 Ga0500642_0000126 3300053130 Bacteria 34999
653 Ga0500559_0009874 3300053136 Bacteria 4115
654 Ga0500568_0010767 3300053139 Bacteria 4268
655 Ga0500568_0038714 3300053139 Bacteria 1929
656 Ga0500574_004572 3300053141 Bacteria 2600
657 Ga0500588_0048571 3300053146 Bacteria 1313
658 Ga0500590_177452 3300053148 Bacteria 929
659 Ga0500604_0013645 3300053151 Bacteria 2204
660 Ga0500616_0000402 3300053153 Bacteria 59210
661 Ga0500616_0078858 3300053153 Bacteria 1660
662 Ga0500622_0000189 3300053156 Bacteria 65129
663 Ga0500622_0012016 3300053156 Bacteria 4707
664 Ga0500624_001860 3300053157 Bacteria 3054
665 Ga0500634_0000143 3300053161 Bacteria 25845
666 Ga0500636_0000005 3300053177 Bacteria 197561
667 Ga0500636_0001421 3300053177 Bacteria 13046
668 Ga0500636_0001769 3300053177 Bacteria 11836
669 Ga0500625_026314 3300053729 Bacteria 2755
670 Ga0500645_027106 3300053730 Bacteria 1739
671 Ga0500601_000404 3300053737 Bacteria 7292
672 Ga0501084_0067885 3300054114 Bacteria 2985
673 Ga0500661_005829 3300055283 Bacteria 2297
674 Ga0587084_000357 3300059477 Bacteria 3418
675 Ga0587093_000659 3300059478 Bacteria 2548
676 Ga0587066_000135 3300059490 Bacteria 4489
677 Ga0587066_000656 3300059490 Bacteria 2987
678 Ga0587070_001080 3300059491 Bacteria 2671
679 Ga0587073_0001291 3300059492 Bacteria 2855
680 Ga0587073_0003254 3300059492 Bacteria 2210
681 Ga0587077_000087 3300059493 Bacteria 5018
682 Ga0587077_000129 3300059493 Bacteria 4729
683 Ga0587077_000304 3300059493 Bacteria 3818
684 Ga0587077_000388 3300059493 Bacteria 3615
685 Ga0587077_001130 3300059493 Bacteria 2738
686 Ga0587077_001716 3300059493 Bacteria 2423
687 Ga0587077_002096 3300059493 Bacteria 2297
688 Ga0587077_004542 3300059493 Bacteria 1833
689 Ga0587077_010618 3300059493 Bacteria 1428
690 Ga0587080_000518 3300059503 Bacteria 3359
691 Ga0587080_009095 3300059503 Bacteria 1437
692 Ga0587080_014312 3300059503 Bacteria 1226
693 Ga0587082_000655 3300059504 Bacteria 3080
694 Ga0587082_000979 3300059504 Bacteria 2747
695 Ga0587082_005145 3300059504 Bacteria 1685
696 Ga0587082_006855 3300059504 Bacteria 1535
697 Ga0587083_0000454 3300059505 Bacteria 3619
698 Ga0587083_0018555 3300059505 Bacteria 1260
699 Ga0587083_0018676 3300059505 Bacteria 1257
700 Ga0587085_000934 3300059506 Bacteria 2480
701 Ga0587086_000291 3300059507 Bacteria 3321
702 Ga0587086_000870 3300059507 Bacteria 2421
703 Ga0587086_002677 3300059507 Bacteria 1716
704 Ga0587088_000088 3300059508 Bacteria 4950
705 Ga0587088_000232 3300059508 Bacteria 3953
706 Ga0587088_016005 3300059508 Bacteria 1189
707 Ga0587090_000159 3300059510 Bacteria 4620
708 Ga0587090_012561 3300059510 Bacteria 1210
709 Ga0587091_005524 3300059511 Bacteria 1727
710 Ga0587094_000967 3300059513 Bacteria 2538
711 Ga0587094_004811 3300059513 Bacteria 1553
712 Ga0587098_000159 3300059604 Bacteria 3320
713 Ga0587098_000350 3300059604 Bacteria 2667
714 Ga0587098_000719 3300059604 Bacteria 2197
715 Ga0587098_001925 3300059604 Bacteria 1685
716 Ga0587098_007867 3300059604 Bacteria 1120
717 Ga0587106_000297 3300059605 Bacteria 3175
718 Ga0587106_000609 3300059605 Bacteria 2665
719 Ga0587125_000212 3300059607 Bacteria 2904
720 Ga0587125_000670 3300059607 Bacteria 2157
721 Ga0587129_000232 3300059608 Bacteria 2294
722 Ga0587099_000098 3300059622 Bacteria 3439
723 Ga0587101_000175 3300059623 Bacteria 3681
724 Ga0587101_000271 3300059623 Bacteria 3302
725 Ga0587101_000510 3300059623 Bacteria 2795
726 Ga0587101_001063 3300059623 Bacteria 2239
727 Ga0587101_011076 3300059623 Bacteria 1145
728 Ga0587113_000218 3300059625 Bacteria 2675
729 Ga0587115_000092 3300059626 Bacteria 4526
730 Ga0587115_000779 3300059626 Bacteria 2598
731 Ga0587117_001340 3300059627 Bacteria 2056
732 Ga0587128_000033 3300059630 Bacteria 5729
733 Ga0587128_000233 3300059630 Bacteria 3525
734 Ga0587128_001934 3300059630 Bacteria 2069
735 Ga0587128_013650 3300059630 Bacteria 1150
736 Ga0587062_000077 3300059639 Bacteria 4636
737 Ga0587062_000513 3300059639 Bacteria 2783
738 Ga0587062_000878 3300059639 Bacteria 2355
739 Ga0587067_000896 3300059640 Bacteria 2966
740 Ga0587068_000701 3300059641 Bacteria 3293
741 Ga0587069_000544 3300059642 Bacteria 2898
742 Ga0587072_000323 3300059643 Bacteria 4535
743 Ga0587072_001126 3300059643 Bacteria 3164
744 Ga0587075_000291 3300059644 Bacteria 3625
745 Ga0587075_000401 3300059644 Bacteria 3346
746 Ga0587076_001077 3300059645 Bacteria 2648
747 Ga0587076_005116 3300059645 Bacteria 1681
748 Ga0587078_000332 3300059646 Bacteria 3358
749 Ga0587079_000822 3300059647 Bacteria 3111
750 Ga0587100_000069 3300059648 Bacteria 3621
751 Ga0587102_000134 3300059649 Bacteria 3350
752 Ga0587105_000149 3300059651 Bacteria 2263
753 Ga0587107_000467 3300059652 Bacteria 2650
754 Ga0587107_000611 3300059652 Bacteria 2463
755 Ga0587110_003994 3300059654 Bacteria 1264
756 Ga0587118_00239 3300059657 Bacteria 2532
757 Ga0587119_000378 3300059658 Bacteria 2814
758 Ga0587060_001450 3300060243 Bacteria 1555
759 Ga0587096_00039 3300060247 Bacteria 2274
760 Ga0587071_000669 3300060344 Bacteria 3653
761 Ga0587071_030957 3300060344 Bacteria 1030
762 Ga0587111_0000161 3300060346 Bacteria 4952
763 Ga0587111_0001051 3300060346 Bacteria 3108
764 Ga0501082_0010931 3300060353 Bacteria 7812
765 Ga0466962_0041105 3300061719 Bacteria 2213

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1069025 Ga0081540_10690251 242
2 3300032004 Ga0307414_10008732 Ga0307414_100087324 242
3 3300044684 Ga0466966_0089095 Ga0466966_0089095_893_1705 244
4 3300044842 Ga0466957_0021800 Ga0466957_0021800_2796_3608 244
5 3300061719 Ga0466962_0041105 Ga0466962_0041105_1290_2102 244
6 3300053125 Ga0500618_010434 Ga0500618_010434_1244_2116 246
7 3300005334 Ga0068869_100212736 Ga0068869_1002127362 247
8 3300006178 Ga0075367_10080727 Ga0075367_100807272 248
9 3300046648 Ga0495611_0138584 Ga0495611_0138584_50_850 248
10 3300047472 Ga0495686_0221231 Ga0495686_0221231_29_829 248
11 3300048914 Ga0496111_0399674 Ga0496111_0399674_193_993 248
12 3300048927 Ga0496124_0217407 Ga0496124_0217407_24_824 248
13 3300048929 Ga0496126_0270131 Ga0496126_0270131_586_1386 248
14 3300049586 Ga0501070_0521760 Ga0501070_0521760_92_928 248
15 3300050494 nmdc:mga06z11_163794_c1 nmdc:mga06z11_163794_c1_183_1055 248
16 3300050496 nmdc:mga07m45_352464_c1 nmdc:mga07m45_352464_c1_10_810 248
17 3300053083 Ga0495655_0020785 Ga0495655_0020785_51_851 248
18 3300053139 Ga0500568_0010767 Ga0500568_0010767_175_1062 248
19 3300009545 Ga0105237_10239726 Ga0105237_102397262 250
20 3300025910 Ga0207684_10151077 Ga0207684_101510772 250
21 3300032004 Ga0307414_10214893 Ga0307414_102148932 250
22 iso_pu_bacteria 2876377896 2876380681 251
23 3300009176 Ga0105242_10743290 Ga0105242_107432901 254
24 iso_pu_bacteria 2838675328 2838680037 254
25 iso_pu_bacteria 2838724970 2838729679 254
26 iso_pu_bacteria 2842130223 2842134929 254
27 iso_pu_bacteria 2842224351 2842229724 254
28 iso_pu_bacteria 2933006813 2933006864 254
29 3300042004 Ga0439445_0064834 Ga0439445_0064834_82_933 255
30 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001127 256
31 3300002771 JGI25163J39215_1004290 JGI25163J39215_10042901 256
32 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001122 256
33 3300003751 Ga0055538_1000001 Ga0055538_1000001910 256
34 3300003752 Ga0055539_1000001 Ga0055539_1000001910 256
35 3300003756 Ga0055533_1000003 Ga0055533_1000003122 256
36 3300003759 Ga0055525_1000003 Ga0055525_1000003122 256
37 3300003841 Ga0055541_1000001 Ga0055541_1000001122 256
38 3300025224 Ga0209784_100004 Ga0209784_100004123 256
39 3300025225 Ga0209566_100004 Ga0209566_100004280 256
40 3300025226 Ga0209674_100006 Ga0209674_100006280 256
41 3300025230 Ga0209563_100009 Ga0209563_100009123 256
42 3300025231 Ga0207427_100300 Ga0207427_1003006 256
43 3300025233 Ga0209437_100004 Ga0209437_100004123 256
44 3300025253 Ga0209677_100005 Ga0209677_100005123 256
45 3300025261 Ga0209233_1000005 Ga0209233_1000005280 256
46 3300046454 Ga0495592_0006028 Ga0495592_0006028_6986_7915 256
47 3300046462 Ga0495651_0014212 Ga0495651_0014212_4025_4954 256
48 3300046463 Ga0495653_0029927 Ga0495653_0029927_2087_3016 256
49 3300046511 Ga0495608_0010325 Ga0495608_0010325_5318_6247 256
50 3300046516 Ga0495628_0013956 Ga0495628_0013956_4733_5662 256
51 3300046529 Ga0495652_0033972 Ga0495652_0033972_1380_2309 256
52 3300046675 Ga0495657_0042744 Ga0495657_0042744_407_1336 256
53 3300046690 Ga0495624_0123402 Ga0495624_0123402_238_1167 256
54 3300046809 Ga0495600_0001805 Ga0495600_0001805_7001_7930 256
55 3300047317 Ga0495604_0111853 Ga0495604_0111853_73_1002 256
56 3300053077 Ga0495601_0007438 Ga0495601_0007438_3526_4455 256
57 3300053119 Ga0500595_026901 Ga0500595_026901_397_1326 256
58 3300053141 Ga0500574_004572 Ga0500574_004572_1412_2341 256
59 iso_pu_bacteria 2599185210 2599603070 256
60 iso_pu_bacteria 2899792073 2899795908 256
61 3300049571 Ga0501034_0251611 Ga0501034_0251611_371_1207 257
62 3300049576 Ga0501040_0002512 Ga0501040_0002512_2553_3485 257
63 3300049578 Ga0501042_0022636 Ga0501042_0022636_919_1851 257
64 3300009553 Ga0105249_10014920 Ga0105249_100149206 259
65 3300025961 Ga0207712_10035469 Ga0207712_100354693 259
66 3300039437 Ga0436365_1592281 Ga0436365_1592281_57_905 259
67 3300046530 Ga0495654_0079440 Ga0495654_0079440_337_1209 259
68 3300048914 Ga0496111_0010417 Ga0496111_0010417_4800_5672 259
69 3300048924 Ga0496121_0000180 Ga0496121_0000180_51847_52752 259
70 3300048927 Ga0496124_0050788 Ga0496124_0050788_2276_3148 259
71 3300050491 nmdc:mga00v17_78_c1 nmdc:mga00v17_78_c1_22324_23157 259
72 3300053125 Ga0500618_000109 Ga0500618_000109_53623_54495 259
73 3300053125 Ga0500618_000758 Ga0500618_000758_16216_17088 259
74 3300003214 JGI25165J46597_1001719 JGI25165J46597_10017195 260
75 3300009036 Ga0105244_10038235 Ga0105244_100382353 260
76 3300009148 Ga0105243_10070952 Ga0105243_100709522 260
77 3300011119 Ga0105246_10012435 Ga0105246_100124356 260
78 3300013102 Ga0157371_10000005 Ga0157371_10000005382 260
79 3300037471 Ga0395905_0456172 Ga0395905_0456172_141_977 260
80 3300041404 Ga0439436_0009638 Ga0439436_0009638_1701_2537 260
81 3300041405 Ga0439438_048316 Ga0439438_048316_233_1069 260
82 3300041410 Ga0439461_0028331 Ga0439461_0028331_86_922 260
83 3300041411 Ga0439466_0041491 Ga0439466_0041491_152_988 260
84 3300042007 Ga0439449_0030465 Ga0439449_0030465_1060_1896 260
85 3300042122 Ga0450920_008222 Ga0450920_008222_173_1009 260
86 3300042435 Ga0439434_0033988 Ga0439434_0033988_261_1097 260
87 3300042531 Ga0450918_007484 Ga0450918_007484_653_1489 260
88 3300045051 Ga0451576_0673963 Ga0451576_0673963_220_1056 260
89 3300046522 Ga0495643_0183023 Ga0495643_0183023_40_876 260
90 3300046558 Ga0495633_0059342 Ga0495633_0059342_458_1294 260
91 3300046558 Ga0495633_0172630 Ga0495633_0172630_19_855 260
92 3300046660 Ga0495625_0301726 Ga0495625_0301726_145_981 260
93 3300048908 Ga0496105_0376154 Ga0496105_0376154_38_874 260
94 3300048913 Ga0496110_0089212 Ga0496110_0089212_1419_2255 260
95 3300048916 Ga0496113_0054041 Ga0496113_0054041_662_1498 260
96 3300048920 Ga0496117_0000030 Ga0496117_0000030_158639_159475 260
97 3300048920 Ga0496117_0000036 Ga0496117_0000036_300502_301338 260
98 3300048920 Ga0496117_0002215 Ga0496117_0002215_13352_14188 260
99 3300048921 Ga0496118_0015347 Ga0496118_0015347_39_875 260
100 3300048922 Ga0496119_0056490 Ga0496119_0056490_1479_2315 260
101 3300048923 Ga0496120_0056525 Ga0496120_0056525_1002_1838 260
102 3300048925 Ga0496122_0000002 Ga0496122_0000002_580026_580862 260
103 3300048925 Ga0496122_0000050 Ga0496122_0000050_10122_10958 260
104 3300048925 Ga0496122_0131503 Ga0496122_0131503_51_887 260
105 3300048926 Ga0496123_0000002 Ga0496123_0000002_1230821_1231657 260
106 3300048926 Ga0496123_0000002 Ga0496123_0000002_580026_580862 260
107 3300048926 Ga0496123_0000023 Ga0496123_0000023_117374_118210 260
108 3300048927 Ga0496124_0001743 Ga0496124_0001743_4610_5446 260
109 3300048927 Ga0496124_0006693 Ga0496124_0006693_1107_1943 260
110 3300048927 Ga0496124_0049059 Ga0496124_0049059_1974_2810 260
111 3300049568 Ga0501031_0276600 Ga0501031_0276600_234_1070 260
112 3300049569 Ga0501032_0078299 Ga0501032_0078299_736_1605 260
113 3300049572 Ga0501036_0065241 Ga0501036_0065241_1029_1898 260
114 3300049573 Ga0501037_0175549 Ga0501037_0175549_329_1198 260
115 3300049574 Ga0501038_0187849 Ga0501038_0187849_166_1035 260
116 3300049575 Ga0501039_0002554 Ga0501039_0002554_11365_12234 260
117 3300049577 Ga0501041_0082274 Ga0501041_0082274_307_1176 260
118 3300049578 Ga0501042_0083948 Ga0501042_0083948_619_1488 260
119 3300049587 Ga0501071_0177923 Ga0501071_0177923_62_931 260
120 3300049590 Ga0501074_0106220 Ga0501074_0106220_409_1278 260
121 3300049591 Ga0501075_0420454 Ga0501075_0420454_121_990 260
122 3300049592 Ga0501076_0120412 Ga0501076_0120412_803_1672 260
123 3300049741 Ga0501079_0077058 Ga0501079_0077058_1077_1946 260
124 3300050516 nmdc:mga0sz30_97976_c1 nmdc:mga0sz30_97976_c1_184_1020 260
125 3300053107 Ga0500560_000929 Ga0500560_000929_3645_4481 260
126 3300053157 Ga0500624_001860 Ga0500624_001860_1362_2198 260
127 3300054114 Ga0501084_0067885 Ga0501084_0067885_1068_1937 260
128 3300059506 Ga0587085_000934 Ga0587085_000934_1558_2394 260
129 3300049581 Ga0501047_0314333 Ga0501047_0314333_406_1245 261
130 3300005539 Ga0068853_100050817 Ga0068853_1000508172 262
131 3300006048 Ga0075363_100015847 Ga0075363_1000158472 262
132 3300006051 Ga0075364_10086516 Ga0075364_100865162 262
133 3300006178 Ga0075367_10065836 Ga0075367_100658362 262
134 3300009545 Ga0105237_10076852 Ga0105237_100768522 262
135 3300009551 Ga0105238_10053821 Ga0105238_100538212 262
136 3300010375 Ga0105239_10038814 Ga0105239_100388144 262
137 3300025914 Ga0207671_10073634 Ga0207671_100736342 262
138 3300025924 Ga0207694_10033877 Ga0207694_100338774 262
139 3300048905 Ga0496102_0421276 Ga0496102_0421276_201_1073 262
140 3300049571 Ga0501034_0184508 Ga0501034_0184508_138_1010 262
141 3300049591 Ga0501075_0267942 Ga0501075_0267942_180_1109 262
142 3300050491 nmdc:mga00v17_68286_c1 nmdc:mga00v17_68286_c1_465_1337 262
143 3300050493 nmdc:mga0k408_44631_c1 nmdc:mga0k408_44631_c1_1186_2058 262
144 3300050494 nmdc:mga06z11_89330_c1 nmdc:mga06z11_89330_c1_164_1036 262
145 3300050496 nmdc:mga07m45_9056_c1 nmdc:mga07m45_9056_c1_3112_3984 262
146 3300059492 Ga0587073_0003254 Ga0587073_0003254_460_1332 262
147 3300059493 Ga0587077_001716 Ga0587077_001716_985_1857 262
148 3300059503 Ga0587080_014312 Ga0587080_014312_331_1203 262
149 3300059504 Ga0587082_005145 Ga0587082_005145_656_1528 262
150 3300059505 Ga0587083_0018676 Ga0587083_0018676_44_916 262
151 3300059508 Ga0587088_016005 Ga0587088_016005_190_1062 262
152 3300059510 Ga0587090_012561 Ga0587090_012561_207_1079 262
153 3300059605 Ga0587106_000297 Ga0587106_000297_1407_2279 262
154 3300059627 Ga0587117_001340 Ga0587117_001340_1133_2005 262
155 3300059630 Ga0587128_001934 Ga0587128_001934_793_1665 262
156 3300059654 Ga0587110_003994 Ga0587110_003994_342_1214 262
157 3300025936 Ga0207670_10277882 Ga0207670_102778822 263
158 3300059630 Ga0587128_013650 Ga0587128_013650_112_984 263
159 3300003203 JGI25406J46586_10007472 JGI25406J46586_100074724 264
160 3300005985 Ga0081539_10001859 Ga0081539_1000185919 264
161 3300044765 Ga0466970_0203836 Ga0466970_0203836_160_1008 264
162 3300053139 Ga0500568_0038714 Ga0500568_0038714_387_1277 264
163 3300005347 Ga0070668_100018004 Ga0070668_1000180045 265
164 3300013306 Ga0163162_10304059 Ga0163162_103040592 265
165 3300021377 Ga0213874_10005902 Ga0213874_100059023 265
166 3300025972 Ga0207668_10096919 Ga0207668_100969192 265
167 3300039450 Ga0436363_0259999 Ga0436363_0259999_178_1092 265
168 3300039450 Ga0436363_1697570 Ga0436363_1697570_119_970 265
169 3300048921 Ga0496118_0015167 Ga0496118_0015167_3631_4524 265
170 3300050513 nmdc:mga0rr50_99336_c1 nmdc:mga0rr50_99336_c1_19_870 265
171 3300059607 Ga0587125_000670 Ga0587125_000670_975_1847 265
172 3300060344 Ga0587071_030957 Ga0587071_030957_37_918 265
173 iso_pu_bacteria 2838719591 2838723125 265
174 iso_pu_bacteria 2842187318 2842191156 265
175 3300005337 Ga0070682_100279022 Ga0070682_1002790221 267
176 3300044684 Ga0466966_0165812 Ga0466966_0165812_340_1257 267
177 3300059493 Ga0587077_000304 Ga0587077_000304_1497_2369 267
178 3300059623 Ga0587101_000175 Ga0587101_000175_1574_2446 267
179 iso_pu_bacteria 2643221563 2643835607 267
180 iso_pu_bacteria 2643221608 2644056533 267
181 iso_pu_bacteria 2937843397 2937845844 267
182 3300039062 Ga0400483_146472 Ga0400483_146472_4731_5591 268
183 3300039062 Ga0400483_193432 Ga0400483_193432_4474_5334 268
184 3300049571 Ga0501034_0000712 Ga0501034_0000712_45587_46459 268
185 3300059504 Ga0587082_006855 Ga0587082_006855_558_1427 268
186 3300059507 Ga0587086_002677 Ga0587086_002677_735_1607 268
187 3300059604 Ga0587098_000719 Ga0587098_000719_1221_2090 268
188 3300059607 Ga0587125_000212 Ga0587125_000212_496_1368 268
189 3300059623 Ga0587101_000510 Ga0587101_000510_135_1007 268
190 3300059648 Ga0587100_000069 Ga0587100_000069_1497_2369 268
191 iso_pu_bacteria 2507262055 2507507942 268
192 iso_pu_bacteria 2508501009 2508542055 268
193 iso_pu_bacteria 2508501042 2508692401 268
194 iso_pu_bacteria 2508501128 2509149478 268
195 iso_pu_bacteria 2510461069 2510840833 268
196 iso_pu_bacteria 2510917022 2511135966 268
197 iso_pu_bacteria 2510917026 2511171710 268
198 iso_pu_bacteria 2511231028 2511399350 268
199 iso_pu_bacteria 2513237092 2513622532 268
200 iso_pu_bacteria 2513237095 2513647236 268
201 iso_pu_bacteria 2513237096 2513657746 268
202 iso_pu_bacteria 2513237104 2513715215 268
203 iso_pu_bacteria 2513237137 2513864213 268
204 iso_pu_bacteria 2513237139 2513877568 268
205 iso_pu_bacteria 2513237145 2513919745 268
206 iso_pu_bacteria 2513237159 2513997560 268
207 iso_pu_bacteria 2513237161 2514009714 268
208 iso_pu_bacteria 2513237351 2514585914 268
209 iso_pu_bacteria 2515154112 2515626835 268
210 iso_pu_bacteria 2517093001 2517103850 268
211 iso_pu_bacteria 2517572143 2517895243 268
212 iso_pu_bacteria 2524023205 2524441840 268
213 iso_pu_bacteria 2524023209 2524459970 268
214 iso_pu_bacteria 2524023228 2524536377 268
215 iso_pu_bacteria 2537561587 2537877800 268
216 iso_pu_bacteria 2554235003 2554244566 268
217 iso_pu_bacteria 2554235003 2554245791 268
218 iso_pu_bacteria 2558860242 2559296442 268
219 iso_pu_bacteria 2582581283 2585167568 268
220 iso_pu_bacteria 2582581306 2585265794 268
221 iso_pu_bacteria 2582581308 2585282940 268
222 iso_pu_bacteria 2582581315 2585322480 268
223 iso_pu_bacteria 2582581316 2585335094 268
224 iso_pu_bacteria 2582581865 2585389041 268
225 iso_pu_bacteria 2582581866 2585395188 268
226 iso_pu_bacteria 2585427527 2585532433 268
227 iso_pu_bacteria 2585427530 2585554550 268
228 iso_pu_bacteria 2585427608 2585899039 268
229 iso_pu_bacteria 2585427609 2585903366 268
230 iso_pu_bacteria 2585427633 2585997253 268
231 iso_pu_bacteria 2585427634 2586001861 268
232 iso_pu_bacteria 2585428125 2587981515 268
233 iso_pu_bacteria 2599185156 2599332106 268
234 iso_pu_bacteria 2599185210 2599605515 268
235 iso_pu_bacteria 2599185210 2599606174 268
236 iso_pu_bacteria 2599185236 2599720004 268
237 iso_pu_bacteria 2600254933 2600373556 268
238 iso_pu_bacteria 2615840626 2616307497 268
239 iso_pu_bacteria 2615840698 2616555043 268
240 iso_pu_bacteria 2617270735 2617346518 268
241 iso_pu_bacteria 2617270741 2617378623 268
242 iso_pu_bacteria 2617270742 2617384330 268
243 iso_pu_bacteria 2643221551 2643777683 268
244 iso_pu_bacteria 2643221555 2643796131 268
245 iso_pu_bacteria 2643221568 2643853682 268
246 iso_pu_bacteria 2643221580 2643910387 268
247 iso_pu_bacteria 2643221582 2643917572 268
248 iso_pu_bacteria 2643221591 2643964855 268
249 iso_pu_bacteria 2643221623 2644133855 268
250 iso_pu_bacteria 2643221629 2644169206 268
251 iso_pu_bacteria 2643221636 2644204851 268
252 iso_pu_bacteria 2643221637 2644208683 268
253 iso_pu_bacteria 2643221653 2644298173 268
254 iso_pu_bacteria 2643221662 2644350620 268
255 iso_pu_bacteria 2643221674 2644411724 268
256 iso_pu_bacteria 2643221688 2644494201 268
257 iso_pu_bacteria 2643221718 2644652213 268
258 iso_pu_bacteria 2643221719 2644656425 268
259 iso_pu_bacteria 2667528174 2671112276 268
260 iso_pu_bacteria 2667528175 2671121733 268
261 iso_pu_bacteria 2693429783 2694628045 268
262 iso_pu_bacteria 2693429784 2694641098 268
263 iso_pu_bacteria 2728368998 2728752443 268
264 iso_pu_bacteria 2738543024 2739307355 268
265 iso_pu_bacteria 2744054633 2745081296 268
266 iso_pu_bacteria 2775507266 2778176107 268
267 iso_pu_bacteria 2791355197 2793069201 268
268 iso_pu_bacteria 2791355253 2793283757 268
269 iso_pu_bacteria 2802429603 2805918422 268
270 iso_pu_bacteria 2816332527 2818236273 268
271 iso_pu_bacteria 2818991272 2819244232 268
272 iso_pu_bacteria 2818991439 2819557637 268
273 iso_pu_bacteria 2818991448 2819609505 268
274 iso_pu_bacteria 2818991453 2819639603 268
275 iso_pu_bacteria 2818991461 2819686539 268
276 iso_pu_bacteria 2821123053 2821126252 268
277 iso_pu_bacteria 2824600985 2824607122 268
278 iso_pu_bacteria 2824609381 2824616577 268
279 iso_pu_bacteria 2824617872 2824624513 268
280 iso_pu_bacteria 2824626560 2824633428 268
281 iso_pu_bacteria 2824635225 2824642104 268
282 iso_pu_bacteria 2824644064 2824652081 268
283 iso_pu_bacteria 2824653114 2824659489 268
284 iso_pu_bacteria 2824661429 2824669250 268
285 iso_pu_bacteria 2824671348 2824675710 268
286 iso_pu_bacteria 2824679649 2824686888 268
287 iso_pu_bacteria 2824696289 2824700412 268
288 iso_pu_bacteria 2824704595 2824708106 268
289 iso_pu_bacteria 2824714736 2824722387 268
290 iso_pu_bacteria 2824723954 2824732076 268
291 iso_pu_bacteria 2824746037 2824751130 268
292 iso_pu_bacteria 2824753945 2824755757 268
293 iso_pu_bacteria 2824773399 2824774775 268
294 iso_pu_bacteria 2838029111 2838034705 268
295 iso_pu_bacteria 2838122688 2838122944 268
296 iso_pu_bacteria 2838714209 2838717402 268
297 iso_pu_bacteria 2838714209 2838717779 268
298 iso_pu_bacteria 2838736955 2838737272 268
299 iso_pu_bacteria 2841840854 2841842359 268
300 iso_pu_bacteria 2841846520 2841849941 268
301 iso_pu_bacteria 2841846520 2841850713 268
302 iso_pu_bacteria 2841941048 2841944774 268
303 iso_pu_bacteria 2841949485 2841957773 268
304 iso_pu_bacteria 2841957949 2841959984 268
305 iso_pu_bacteria 2841966195 2841974479 268
306 iso_pu_bacteria 2841974524 2841978642 268
307 iso_pu_bacteria 2841983080 2841989012 268
308 iso_pu_bacteria 2842038055 2842040370 268
309 iso_pu_bacteria 2842045827 2842046685 268
310 iso_pu_bacteria 2842124991 2842128413 268
311 iso_pu_bacteria 2842124991 2842129518 268
312 iso_pu_bacteria 2842140634 2842142139 268
313 iso_pu_bacteria 2842152218 2842155715 268
314 iso_pu_bacteria 2842170452 2842173077 268
315 iso_pu_bacteria 2842170452 2842174025 268
316 iso_pu_bacteria 2842175837 2842179635 268
317 iso_pu_bacteria 2842298080 2842298805 268
318 iso_pu_bacteria 2842357229 2842359326 268
319 iso_pu_bacteria 2842475841 2842481402 268
320 iso_pu_bacteria 2842482326 2842483292 268
321 iso_pu_bacteria 2842502639 2842508352 268
322 iso_pu_bacteria 2842509118 2842510838 268
323 iso_pu_bacteria 2842521101 2842522197 268
324 iso_pu_bacteria 2842922631 2842924461 268
325 iso_pu_bacteria 2844315083 2844319749 268
326 iso_pu_bacteria 2847930680 2847937066 268
327 iso_pu_bacteria 2847939898 2847947458 268
328 iso_pu_bacteria 2852387548 2852391324 268
329 iso_pu_bacteria 2854896431 2854897377 268
330 iso_pu_bacteria 2854916844 2854921489 268
331 iso_pu_bacteria 2855872281 2855873998 268
332 iso_pu_bacteria 2856349417 2856352033 268
333 iso_pu_bacteria 2856356410 2856357043 268
334 iso_pu_bacteria 2856364286 2856370057 268
335 iso_pu_bacteria 2857349434 2857352760 268
336 iso_pu_bacteria 2857509624 2857513060 268
337 iso_pu_bacteria 2857531043 2857532813 268
338 iso_pu_bacteria 2869285874 2869290854 268
339 iso_pu_bacteria 2871429161 2871433136 268
340 iso_pu_bacteria 2871488783 2871491224 268
341 iso_pu_bacteria 2874146452 2874153703 268
342 iso_pu_bacteria 2874155637 2874160968 268
343 iso_pu_bacteria 2874590934 2874599040 268
344 iso_pu_bacteria 2874612657 2874617208 268
345 iso_pu_bacteria 2874620515 2874626654 268
346 iso_pu_bacteria 2874628541 2874635296 268
347 iso_pu_bacteria 2874645413 2874650515 268
348 iso_pu_bacteria 2876413966 2876419008 268
349 iso_pu_bacteria 2876771140 2876779079 268
350 iso_pu_bacteria 2876818435 2876822683 268
351 iso_pu_bacteria 2878745973 2878750749 268
352 iso_pu_bacteria 2878753008 2878755642 268
353 iso_pu_bacteria 2879074833 2879082872 268
354 iso_pu_bacteria 2879083081 2879083250 268
355 iso_pu_bacteria 2879099564 2879101560 268
356 iso_pu_bacteria 2879127579 2879133063 268
357 iso_pu_bacteria 2879142872 2879149350 268
358 iso_pu_bacteria 2881155292 2881159126 268
359 iso_pu_bacteria 2881364244 2881368083 268
360 iso_pu_bacteria 2881665667 2881672042 268
361 iso_pu_bacteria 2881845957 2881846625 268
362 iso_pu_bacteria 2881853255 2881860054 268
363 iso_pu_bacteria 2881861095 2881864295 268
364 iso_pu_bacteria 2882912400 2882912931 268
365 iso_pu_bacteria 2885318864 2885320552 268
366 iso_pu_bacteria 2885342637 2885345137 268
367 iso_pu_bacteria 2885350715 2885357177 268
368 iso_pu_bacteria 2885366525 2885369618 268
369 iso_pu_bacteria 2885374607 2885381109 268
370 iso_pu_bacteria 2885409591 2885418201 268
371 iso_pu_bacteria 2888378607 2888385169 268
372 iso_pu_bacteria 2888388044 2888393070 268
373 iso_pu_bacteria 2888419890 2888425311 268
374 iso_pu_bacteria 2889010040 2889014713 268
375 iso_pu_bacteria 2898795034 2898798580 268
376 iso_pu_bacteria 2899845264 2899847640 268
377 iso_pu_bacteria 2903492973 2903496356 268
378 iso_pu_bacteria 2903492973 2903498892 268
379 iso_pu_bacteria 2903727486 2903730574 268
380 iso_pu_bacteria 2903748898 2903754329 268
381 iso_pu_bacteria 2904666416 2904671994 268
382 iso_pu_bacteria 2904690495 2904693249 268
383 iso_pu_bacteria 2904711408 2904712271 268
384 iso_pu_bacteria 2906308376 2906313674 268
385 iso_pu_bacteria 2906321335 2906326383 268
386 iso_pu_bacteria 2906602504 2906609622 268
387 iso_pu_bacteria 2906626472 2906628914 268
388 iso_pu_bacteria 2906635258 2906636340 268
389 iso_pu_bacteria 2906643746 2906652102 268
390 iso_pu_bacteria 2906660503 2906665407 268
391 iso_pu_bacteria 2908739725 2908740559 268
392 iso_pu_bacteria 2908756301 2908759321 268
393 iso_pu_bacteria 2908775508 2908780869 268
394 iso_pu_bacteria 2919114240 2919118059 268
395 iso_pu_bacteria 2919114240 2919119155 268
396 iso_pu_bacteria 2919166419 2919168111 268
397 iso_pu_bacteria 2919171160 2919173548 268
398 iso_pu_bacteria 2919408235 2919410763 268
399 iso_pu_bacteria 2922368715 2922372728 268
400 iso_pu_bacteria 2922393267 2922397358 268
401 iso_pu_bacteria 2922425934 2922427369 268
402 iso_pu_bacteria 2924784321 2924785622 268
403 iso_pu_bacteria 2926754445 2926757824 268
404 iso_pu_bacteria 2926754445 2926759184 268
405 iso_pu_bacteria 2926760298 2926763390 268
406 iso_pu_bacteria 2926760298 2926764552 268
407 iso_pu_bacteria 2929138655 2929141445 268
408 iso_pu_bacteria 2929615660 2929620543 268
409 iso_pu_bacteria 2932401849 2932402307 268
410 iso_pu_bacteria 2932784394 2932784693 268
411 iso_pu_bacteria 2932794094 2932795413 268
412 iso_pu_bacteria 2932801729 2932805944 268
413 iso_pu_bacteria 2932809354 2932809673 268
414 iso_pu_bacteria 2932818245 2932818584 268
415 iso_pu_bacteria 2932828146 2932828461 268
416 iso_pu_bacteria 2933577622 2933582461 268
417 iso_pu_bacteria 2933594066 2933595998 268
418 iso_pu_bacteria 2933594066 2933597306 268
419 iso_pu_bacteria 2935608549 2935609559 268
420 iso_pu_bacteria 2935616580 2935617434 268
421 iso_pu_bacteria 2935630451 2935637549 268
422 iso_pu_bacteria 2935638405 2935639084 268
423 iso_pu_bacteria 2935648319 2935652290 268
424 iso_pu_bacteria 2935656913 2935660872 268
425 iso_pu_bacteria 2935665750 2935666064 268
426 iso_pu_bacteria 2935675223 2935675712 268
427 iso_pu_bacteria 2935684952 2935685278 268
428 iso_pu_bacteria 2935694250 2935694968 268
429 iso_pu_bacteria 2935703347 2935704091 268
430 iso_pu_bacteria 2935713505 2935713831 268
431 iso_pu_bacteria 2935722832 2935724450 268
432 iso_pu_bacteria 2935732158 2935733192 268
433 iso_pu_bacteria 2935741537 2935742571 268
434 iso_pu_bacteria 2935750917 2935751243 268
435 iso_pu_bacteria 2935760218 2935760233 268
436 iso_pu_bacteria 2935769743 2935769957 268
437 iso_pu_bacteria 2935777560 2935782023 268
438 iso_pu_bacteria 2935785616 2935785801 268
439 iso_pu_bacteria 2935793552 2935794271 268
440 iso_pu_bacteria 2935801545 2935802174 268
441 iso_pu_bacteria 2935810662 2935810998 268
442 iso_pu_bacteria 2935819856 2935822721 268
443 iso_pu_bacteria 2935827899 2935828579 268
444 iso_pu_bacteria 2935837841 2935839955 268
445 iso_pu_bacteria 2935847175 2935848303 268
446 iso_pu_bacteria 2935855204 2935856059 268
447 iso_pu_bacteria 2935864058 2935865997 268
448 iso_pu_bacteria 2935873716 2935877678 268
449 iso_pu_bacteria 2935883170 2935883693 268
450 iso_pu_bacteria 2935908558 2935909894 268
451 iso_pu_bacteria 2935916978 2935917618 268
452 iso_pu_bacteria 2935926038 2935927374 268
453 iso_pu_bacteria 2935934488 2935936781 268
454 iso_pu_bacteria 2935942939 2935944916 268
455 iso_pu_bacteria 2935951376 2935953353 268
456 iso_pu_bacteria 2935959822 2935961156 268
457 iso_pu_bacteria 2935967501 2935970193 268
458 iso_pu_bacteria 2935975950 2935980480 268
459 iso_pu_bacteria 2935984226 2935986759 268
460 iso_pu_bacteria 2935992306 2935992622 268
461 iso_pu_bacteria 2936002035 2936002494 268
462 iso_pu_bacteria 2936011229 2936014928 268
463 iso_pu_bacteria 2936019824 2936022091 268
464 iso_pu_bacteria 2936028420 2936032779 268
465 iso_pu_bacteria 2936037263 2936037583 268
466 iso_pu_bacteria 2936046547 2936050669 268
467 iso_pu_bacteria 2936055302 2936059555 268
468 iso_pu_bacteria 2937813078 2937820021 268
469 iso_pu_bacteria 2938014810 2938017746 268
470 iso_pu_bacteria 2940556831 2940557955 268
471 iso_pu_bacteria 2941507105 2941514078 268
472 iso_pu_bacteria 2941515067 2941522039 268
473 iso_pu_bacteria 2941523033 2941529777 268
474 iso_pu_bacteria 2941531003 2941536790 268
475 iso_pu_bacteria 2941538514 2941540705 268
476 iso_pu_bacteria 2958041894 2958055465 268
477 iso_pu_bacteria 2958130278 2958135254 268
478 iso_pu_bacteria 2958179912 2958184283 268
479 iso_pu_bacteria 2961077736 2961082338 268
480 iso_pu_bacteria 2961127735 2961128689 268
481 iso_pu_bacteria 2961170736 2961176424 268
482 iso_pu_bacteria 2967996073 2967998817 268
483 iso_pu_bacteria 2968003550 2968007613 268
484 iso_pu_bacteria 2968117919 2968122102 268
485 iso_pu_bacteria 2970503327 2970509095 268
486 iso_pu_bacteria 2977821940 2977824846 268
487 iso_pu_bacteria 2977828996 2977830995 268
488 iso_pu_bacteria 2977843712 2977850435 268
489 iso_pu_bacteria 2977942078 2977946754 268
490 iso_pu_bacteria 2978969890 2978970781 268
491 iso_pu_bacteria 2979089926 2979090340 268
492 iso_pu_bacteria 2979089926 2979091577 268
493 iso_pu_bacteria 2979095461 2979095868 268
494 iso_pu_bacteria 2979095461 2979097098 268
495 iso_pu_bacteria 2979100975 2979102679 268
496 iso_pu_bacteria 2979808191 2979813774 268
497 iso_pu_bacteria 2984509177 2984509435 268
498 iso_pu_bacteria 2984518228 2984519865 268
499 iso_pu_bacteria 2984537506 2984537768 268
500 iso_pu_bacteria 2984587000 2984587889 268
501 iso_pu_bacteria 2984601300 2984604511 268
502 iso_pu_bacteria 2987636660 2987641353 268
503 iso_pu_bacteria 2989349275 2989352205 268
504 iso_pu_bacteria 2989776772 2989776871 268
505 iso_pu_bacteria 2996310559 2996316030 268
506 iso_pu_bacteria 2996336353 2996336529 268
507 iso_pu_bacteria 3004203850 3004210160 268
508 iso_pu_bacteria 3005416602 3005418387 268
509 iso_pu_bacteria 3005474847 3005477092 268
510 iso_pu_bacteria 3005483717 3005485039 268
511 iso_pu_bacteria 3005506211 3005507369 268
512 iso_pu_bacteria 3005587118 3005587330 268
513 iso_pu_bacteria 3005594810 3005599966 268
514 iso_pu_bacteria 3005710791 3005715561 268
515 iso_pu_bacteria 3005718088 3005722892 268
516 iso_pu_bacteria 650716007 650842839 268
517 iso_pu_bacteria 650716007 650844033 268
518 iso_pu_bacteria 8002285264 8002291007 268
519 iso_pu_bacteria 8004374579 8004377209 268
520 iso_pu_bacteria 8004387939 8004393143 268
521 iso_pu_bacteria 8004640170 8004644104 268
522 iso_pu_bacteria 8004714634 8004719930 268
523 iso_pu_bacteria 8005246636 8005247849 268
524 iso_pu_bacteria 8005314921 8005318721 268
525 iso_pu_bacteria 8005484373 8005488397 268
526 iso_pu_bacteria 8005645114 8005648866 268
527 iso_pu_bacteria 8005682033 8005682103 268
528 iso_pu_bacteria 8006933436 8006938304 268
529 iso_pu_bacteria 8006973647 8006978381 268
530 iso_pu_bacteria 8016511872 8016521050 268
531 iso_pu_bacteria 8016548790 8016554760 268
532 iso_pu_bacteria 8016583857 8016593829 268
533 iso_pu_bacteria 8016595262 8016600883 268
534 iso_pu_bacteria 8016603502 8016609593 268
535 iso_pu_bacteria 8016613128 8016615321 268
536 iso_pu_bacteria 8016622563 8016625888 268
537 iso_pu_bacteria 8016630954 8016639474 268
538 iso_pu_bacteria 8017057580 8017064555 268
539 iso_pu_bacteria 8019530166 8019533927 268
540 iso_pu_bacteria 8019555841 8019560728 268
541 iso_pu_bacteria 8019565922 8019570812 268
542 iso_pu_bacteria 8019576017 8019583932 268
543 iso_pu_bacteria 8019586578 8019591738 268
544 iso_pu_bacteria 8019597564 8019599599 268
545 iso_pu_bacteria 8019608314 8019618946 268
546 iso_pu_bacteria 8019619141 8019619521 268
547 iso_pu_bacteria 8019629233 8019633593 268
548 iso_pu_bacteria 8019638758 8019646306 268
549 iso_pu_bacteria 8019659431 8019661472 268
550 iso_pu_bacteria 8019668869 8019671013 268
551 iso_pu_bacteria 8019678201 8019685181 268
552 iso_pu_bacteria 8019687851 8019690774 268
553 iso_pu_bacteria 8046767195 8046769166 268
554 iso_pu_bacteria 8054460903 8054463540 268
555 iso_pu_bacteria 8054558443 8054561887 268
556 iso_pu_bacteria 8055742211 8055745405 268
557 iso_pu_bacteria 8056689827 8056695585 268
558 iso_pu_bacteria 8056875544 8056876254 268
559 iso_pu_bacteria 8057575449 8057581142 268
560 3300003214 JGI25165J46597_1000078 JGI25165J46597_10000783 269
561 3300003322 rootL2_10015244 rootL2_100152442 269
562 3300005262 Ga0065165_1001104 Ga0065165_100110425 269
563 3300005347 Ga0070668_100023836 Ga0070668_1000238365 269
564 3300005445 Ga0070708_100234024 Ga0070708_1002340242 269
565 3300005468 Ga0070707_100007996 Ga0070707_1000079964 269
566 3300005548 Ga0070665_100000349 Ga0070665_10000034921 269
567 3300005843 Ga0068860_100387746 Ga0068860_1003877462 269
568 3300006177 Ga0075362_10002799 Ga0075362_100027992 269
569 3300006177 Ga0075362_10020346 Ga0075362_100203462 269
570 3300006871 Ga0075434_100102094 Ga0075434_1001020943 269
571 3300009093 Ga0105240_10216082 Ga0105240_102160823 269
572 3300010375 Ga0105239_10583899 Ga0105239_105838992 269
573 3300025261 Ga0209233_1000150 Ga0209233_1000150178 269
574 3300025922 Ga0207646_10057330 Ga0207646_100573302 269
575 3300028379 Ga0268266_10000092 Ga0268266_10000092143 269
576 3300028786 Ga0307517_10035058 Ga0307517_100350584 269
577 3300037471 Ga0395905_0060148 Ga0395905_0060148_182_1054 269
578 3300042438 Ga0439459_0016431 Ga0439459_0016431_294_1157 269
579 3300048905 Ga0496102_0241985 Ga0496102_0241985_675_1538 269
580 3300048909 Ga0496106_0554551 Ga0496106_0554551_28_891 269
581 3300048911 Ga0496108_0202889 Ga0496108_0202889_414_1277 269
582 3300050489 nmdc:mga03683_1610_c1 nmdc:mga03683_1610_c1_3715_4623 269
583 3300053103 Ga0500555_001807 Ga0500555_001807_2124_3098 269
584 3300015261 Ga0182006_1009455 Ga0182006_10094555 270
585 3300015265 Ga0182005_1025969 Ga0182005_10259692 270
586 3300025913 Ga0207695_10001193 Ga0207695_100011938 270
587 3300028786 Ga0307517_10000875 Ga0307517_1000087510 270
588 3300031456 Ga0307513_10053382 Ga0307513_100533823 270
589 3300031911 Ga0307412_10431317 Ga0307412_104313171 270
590 3300032005 Ga0307411_10062906 Ga0307411_100629062 270
591 3300005441 Ga0070700_100021063 Ga0070700_1000210633 271
592 3300005545 Ga0070695_100000980 Ga0070695_1000009805 271
593 3300005719 Ga0068861_100068365 Ga0068861_1000683653 271
594 3300006163 Ga0070715_10027017 Ga0070715_100270172 271
595 3300006844 Ga0075428_100013125 Ga0075428_1000131256 271
596 3300009147 Ga0114129_10012990 Ga0114129_100129907 271
597 3300026067 Ga0207678_10263401 Ga0207678_102634012 271
598 3300026075 Ga0207708_10017794 Ga0207708_100177942 271
599 3300048927 Ga0496124_0000239 Ga0496124_0000239_51055_51924 271
600 3300049571 Ga0501034_0002438 Ga0501034_0002438_8866_9735 271
601 3300049824 Ga0501045_0108466 Ga0501045_0108466_360_1229 271
602 3300050507 nmdc:mga05p37_13489_c1 nmdc:mga05p37_13489_c1_4500_5369 271
603 3300053177 Ga0500636_0001769 Ga0500636_0001769_5138_6007 271
604 3300059493 Ga0587077_001130 Ga0587077_001130_1601_2470 271
605 3300059623 Ga0587101_001063 Ga0587101_001063_1253_2122 271
606 3300059639 Ga0587062_000878 Ga0587062_000878_1369_2238 271
607 3300001979 JGI24740J21852_10001029 JGI24740J21852_100010297 272
608 3300002704 JGI25155J39150_1000012 JGI25155J39150_100001271 272
609 3300002705 JGI25156J39149_1000049 JGI25156J39149_100004922 272
610 3300002737 JGI25162J39368_1000146 JGI25162J39368_100014613 272
611 3300002737 JGI25162J39368_1000409 JGI25162J39368_100040922 272
612 3300002738 JGI25154J39366_1000033 JGI25154J39366_1000033102 272
613 3300002741 JGI25157J39369_1000055 JGI25157J39369_100005571 272
614 3300002987 JGI25159J45721_1000304 JGI25159J45721_100030420 272
615 3300003187 JGI25151J46595_10003057 JGI25151J46595_100030575 272
616 3300003214 JGI25165J46597_1000451 JGI25165J46597_100045127 272
617 3300003214 JGI25165J46597_1000751 JGI25165J46597_100075113 272
618 3300003215 JGI25153J46596_10001118 JGI25153J46596_100011184 272
619 3300003215 JGI25153J46596_10009829 JGI25153J46596_100098292 272
620 3300003215 JGI25153J46596_10025010 JGI25153J46596_100250102 272
621 3300003215 JGI25153J46596_10025075 JGI25153J46596_100250752 272
622 3300003354 JGI25160J50197_1000006 JGI25160J50197_1000006190 272
623 3300003354 JGI25160J50197_1001199 JGI25160J50197_10011992 272
624 3300003354 JGI25160J50197_1011660 JGI25160J50197_10116602 272
625 3300003374 JGI25161J50226_1000004 JGI25161J50226_1000004190 272
626 3300003578 Ga0006562J51391_1019963 Ga0006562J51391_10199633 272
627 3300003759 Ga0055525_1005814 Ga0055525_10058141 272
628 3300003781 Ga0055536_1004899 Ga0055536_10048994 272
629 3300003791 Ga0055530_10015159 Ga0055530_100151592 272
630 3300003792 Ga0055540_1007821 Ga0055540_10078212 272
631 3300003794 Ga0055531_10000916 Ga0055531_100009164 272
632 3300003794 Ga0055531_10009357 Ga0055531_100093573 272
633 3300003856 Ga0058692_1007093 Ga0058692_10070933 272
634 3300003856 Ga0058692_1011868 Ga0058692_10118682 272
635 3300004625 Ga0055543_1000002 Ga0055543_1000002145 272
636 3300005262 Ga0065165_1000217 Ga0065165_100021772 272
637 3300005262 Ga0065165_1001488 Ga0065165_100148824 272
638 3300005262 Ga0065165_1004881 Ga0065165_10048816 272
639 3300005262 Ga0065165_1006238 Ga0065165_10062384 272
640 3300005289 Ga0065704_10008449 Ga0065704_100084493 272
641 3300005328 Ga0070676_10369822 Ga0070676_103698221 272
642 3300005335 Ga0070666_10104128 Ga0070666_101041282 272
643 3300005344 Ga0070661_100428735 Ga0070661_1004287351 272
644 3300005347 Ga0070668_100016767 Ga0070668_1000167675 272
645 3300005353 Ga0070669_100010381 Ga0070669_1000103815 272
646 3300005355 Ga0070671_100028427 Ga0070671_1000284273 272
647 3300005367 Ga0070667_100077871 Ga0070667_1000778711 272
648 3300005436 Ga0070713_100154692 Ga0070713_1001546922 272
649 3300005455 Ga0070663_100393871 Ga0070663_1003938712 272
650 3300005455 Ga0070663_100471256 Ga0070663_1004712561 272
651 3300005456 Ga0070678_100238558 Ga0070678_1002385582 272
652 3300005457 Ga0070662_100207970 Ga0070662_1002079702 272
653 3300005548 Ga0070665_100019496 Ga0070665_1000194961 272
654 3300005548 Ga0070665_100044835 Ga0070665_1000448354 272
655 3300005548 Ga0070665_100048095 Ga0070665_1000480954 272
656 3300005548 Ga0070665_100123692 Ga0070665_1001236922 272
657 3300005548 Ga0070665_100173854 Ga0070665_1001738542 272
658 3300005548 Ga0070665_100551781 Ga0070665_1005517811 272
659 3300005564 Ga0070664_100650538 Ga0070664_1006505381 272
660 3300005578 Ga0068854_100290135 Ga0068854_1002901352 272
661 3300005614 Ga0068856_100049312 Ga0068856_1000493124 272
662 3300005614 Ga0068856_100191144 Ga0068856_1001911442 272
663 3300005614 Ga0068856_100287343 Ga0068856_1002873432 272
664 3300005616 Ga0068852_100478184 Ga0068852_1004781842 272
665 3300005617 Ga0068859_100279564 Ga0068859_1002795641 272
666 3300005841 Ga0068863_100370493 Ga0068863_1003704932 272
667 3300005937 Ga0081455_10053582 Ga0081455_100535824 272
668 3300005983 Ga0081540_1027415 Ga0081540_10274153 272
669 3300005983 Ga0081540_1053799 Ga0081540_10537991 272
670 3300006038 Ga0075365_10024820 Ga0075365_100248202 272
671 3300006038 Ga0075365_10104769 Ga0075365_101047692 272
672 3300006048 Ga0075363_100006188 Ga0075363_1000061882 272
673 3300006051 Ga0075364_10000074 Ga0075364_1000007410 272
674 3300006051 Ga0075364_10038218 Ga0075364_100382183 272
675 3300006051 Ga0075364_10079924 Ga0075364_100799243 272
676 3300006178 Ga0075367_10013641 Ga0075367_100136412 272
677 3300006186 Ga0075369_10009090 Ga0075369_100090903 272
678 3300006353 Ga0075370_10006154 Ga0075370_100061545 272
679 3300006353 Ga0075370_10034156 Ga0075370_100341562 272
680 3300006871 Ga0075434_100006769 Ga0075434_1000067694 272
681 3300006931 Ga0097620_100279579 Ga0097620_1002795791 272
682 3300006941 Ga0099825_1024201 Ga0099825_10242014 272
683 3300006942 Ga0099824_1006678 Ga0099824_10066781 272
684 3300006943 Ga0099822_1043467 Ga0099822_10434672 272
685 3300006946 Ga0079104_1000563 Ga0079104_10005631 272
686 3300006948 Ga0099826_10000045 Ga0099826_1000004570 272
687 3300006948 Ga0099826_10007422 Ga0099826_100074226 272
688 3300009036 Ga0105244_10156677 Ga0105244_101566772 272
689 3300009093 Ga0105240_10000019 Ga0105240_1000001964 272
690 3300009093 Ga0105240_10271139 Ga0105240_102711391 272
691 3300009098 Ga0105245_10202801 Ga0105245_102028012 272
692 3300009101 Ga0105247_10133439 Ga0105247_101334392 272
693 3300009101 Ga0105247_10166301 Ga0105247_101663011 272
694 3300009148 Ga0105243_10068288 Ga0105243_100682882 272
695 3300009148 Ga0105243_10073163 Ga0105243_100731633 272
696 3300009174 Ga0105241_10068288 Ga0105241_100682882 272
697 3300009176 Ga0105242_10354023 Ga0105242_103540231 272
698 3300009177 Ga0105248_10087965 Ga0105248_100879653 272
699 3300009545 Ga0105237_10002910 Ga0105237_100029108 272
700 3300009545 Ga0105237_10027706 Ga0105237_100277062 272
701 3300009545 Ga0105237_10332327 Ga0105237_103323272 272
702 3300009545 Ga0105237_10430298 Ga0105237_104302982 272
703 3300010375 Ga0105239_10006284 Ga0105239_1000628411 272
704 3300010375 Ga0105239_10042362 Ga0105239_100423624 272
705 3300010375 Ga0105239_10045034 Ga0105239_100450342 272
706 3300010375 Ga0105239_10271542 Ga0105239_102715422 272
707 3300010375 Ga0105239_10347186 Ga0105239_103471862 272
708 3300011119 Ga0105246_10031951 Ga0105246_100319513 272
709 3300013100 Ga0157373_10019415 Ga0157373_100194152 272
710 3300013102 Ga0157371_10088074 Ga0157371_100880742 272
711 3300013104 Ga0157370_10005600 Ga0157370_1000560012 272
712 3300013105 Ga0157369_10216291 Ga0157369_102162912 272
713 3300013105 Ga0157369_10301305 Ga0157369_103013052 272
714 3300013105 Ga0157369_10448858 Ga0157369_104488582 272
715 3300013105 Ga0157369_10564260 Ga0157369_105642602 272
716 3300013296 Ga0157374_10099050 Ga0157374_100990502 272
717 3300014497 Ga0182008_10128144 Ga0182008_101281441 272
718 3300014968 Ga0157379_10230010 Ga0157379_102300102 272
719 3300014969 Ga0157376_10529186 Ga0157376_105291862 272
720 3300015262 Ga0182007_10001799 Ga0182007_100017994 272
721 3300015265 Ga0182005_1024788 Ga0182005_10247882 272
722 3300021320 Ga0214544_1000004 Ga0214544_1000004253 272
723 3300021321 Ga0214542_1000001 Ga0214542_1000001100 272
724 3300021324 Ga0214545_1000001 Ga0214545_1000001167 272
725 3300021327 Ga0214543_1000006 Ga0214543_1000006164 272
726 3300025206 Ga0209435_100005 Ga0209435_10000570 272
727 3300025208 Ga0209436_115303 Ga0209436_1153032 272
728 3300025230 Ga0209563_102075 Ga0209563_1020752 272
729 3300025233 Ga0209437_100078 Ga0209437_10007897 272
730 3300025233 Ga0209437_100174 Ga0209437_10017494 272
731 3300025246 Ga0209646_1000011 Ga0209646_100001170 272
732 3300025246 Ga0209646_1005577 Ga0209646_10055771 272
733 3300025250 Ga0209026_1000008 Ga0209026_100000870 272
734 3300025253 Ga0209677_100155 Ga0209677_10015528 272
735 3300025253 Ga0209677_104509 Ga0209677_1045093 272
736 3300025256 Ga0209759_1000004 Ga0209759_100000470 272
737 3300025261 Ga0209233_1000163 Ga0209233_100016397 272
738 3300025261 Ga0209233_1000295 Ga0209233_100029544 272
739 3300025261 Ga0209233_1000441 Ga0209233_10004415 272
740 3300025261 Ga0209233_1000459 Ga0209233_100045913 272
741 3300025261 Ga0209233_1001854 Ga0209233_10018545 272
742 3300025261 Ga0209233_1012224 Ga0209233_10122243 272
743 3300025272 Ga0209455_1010339 Ga0209455_10103392 272
744 3300025284 Ga0209130_1000032 Ga0209130_1000032183 272
745 3300025292 Ga0209676_1002982 Ga0209676_10029824 272
746 3300025294 Ga0209025_1000445 Ga0209025_100044571 272
747 3300025294 Ga0209025_1001209 Ga0209025_100120936 272
748 3300025294 Ga0209025_1020477 Ga0209025_10204771 272
749 3300025294 Ga0209025_1051016 Ga0209025_10510162 272
750 3300025294 Ga0209025_1052966 Ga0209025_10529662 272
751 3300025295 Ga0209564_1008632 Ga0209564_10086323 272
752 3300025297 Ga0209758_1000011 Ga0209758_100001116 272
753 3300025297 Ga0209758_1000105 Ga0209758_100010558 272
754 3300025297 Ga0209758_1000345 Ga0209758_100034528 272
755 3300025297 Ga0209758_1001280 Ga0209758_100128025 272
756 3300025297 Ga0209758_1012480 Ga0209758_10124802 272
757 3300025297 Ga0209758_1034315 Ga0209758_10343152 272
758 3300025298 Ga0209050_1006042 Ga0209050_10060425 272
759 3300025299 Ga0209256_1002090 Ga0209256_10020902 272
760 3300025299 Ga0209256_1013546 Ga0209256_10135463 272
761 3300025302 Ga0207426_1000077 Ga0207426_1000077183 272
762 3300025302 Ga0207426_1000400 Ga0207426_100040056 272
763 3300025302 Ga0207426_1000402 Ga0207426_100040270 272
764 3300025303 Ga0209051_1005198 Ga0209051_10051986 272
765 3300025304 Ga0209257_1001089 Ga0209257_10010896 272
766 3300025304 Ga0209257_1003767 Ga0209257_10037673 272
767 3300025900 Ga0207710_10033009 Ga0207710_100330091 272
768 3300025904 Ga0207647_10002713 Ga0207647_100027137 272
769 3300025909 Ga0207705_10270945 Ga0207705_102709452 272
770 3300025910 Ga0207684_10177313 Ga0207684_101773131 272
771 3300025911 Ga0207654_10049356 Ga0207654_100493563 272
772 3300025913 Ga0207695_10000008 Ga0207695_10000008528 272
773 3300025913 Ga0207695_10000049 Ga0207695_1000004966 272
774 3300025914 Ga0207671_10000107 Ga0207671_10000107103 272
775 3300025914 Ga0207671_10001041 Ga0207671_1000104129 272
776 3300025923 Ga0207681_10018137 Ga0207681_100181375 272
777 3300025927 Ga0207687_10089190 Ga0207687_100891902 272
778 3300025928 Ga0207700_10098188 Ga0207700_100981883 272
779 3300025931 Ga0207644_10049516 Ga0207644_100495162 272
780 3300025932 Ga0207690_10123574 Ga0207690_101235741 272
781 3300025933 Ga0207706_10139987 Ga0207706_101399872 272
782 3300025935 Ga0207709_10090813 Ga0207709_100908131 272
783 3300025935 Ga0207709_10120968 Ga0207709_101209682 272
784 3300025941 Ga0207711_10043179 Ga0207711_100431792 272
785 3300025972 Ga0207668_10057399 Ga0207668_100573992 272
786 3300025972 Ga0207668_10081246 Ga0207668_100812461 272
787 3300025981 Ga0207640_10088366 Ga0207640_100883662 272
788 3300026067 Ga0207678_10088900 Ga0207678_100889003 272
789 3300026078 Ga0207702_10166633 Ga0207702_101666332 272
790 3300026118 Ga0207675_100303545 Ga0207675_1003035452 272
791 3300026142 Ga0207698_10150594 Ga0207698_101505942 272
792 3300026142 Ga0207698_10275362 Ga0207698_102753622 272
793 3300026142 Ga0207698_10562057 Ga0207698_105620572 272
794 3300027111 Ga0209281_1000032 Ga0209281_1000032355 272
795 3300027296 Ga0209389_1000001 Ga0209389_1000001406 272
796 3300027296 Ga0209389_1000010 Ga0209389_1000010148 272
797 3300027312 Ga0209371_1000003 Ga0209371_1000003335 272
798 3300027312 Ga0209371_1002352 Ga0209371_10023526 272
799 3300027357 Ga0209589_1000002 Ga0209589_1000002205 272
800 3300027357 Ga0209589_1000016 Ga0209589_100001666 272
801 3300027361 Ga0209489_100002 Ga0209489_100002205 272
802 3300027361 Ga0209489_100016 Ga0209489_100016148 272
803 3300027361 Ga0209489_113333 Ga0209489_1133334 272
804 3300027363 Ga0209700_100002 Ga0209700_100002205 272
805 3300027363 Ga0209700_100007 Ga0209700_10000720 272
806 3300027666 Ga0209282_1000210 Ga0209282_10002102 272
807 3300027666 Ga0209282_1008160 Ga0209282_10081604 272
808 3300028379 Ga0268266_10002356 Ga0268266_1000235618 272
809 3300028379 Ga0268266_10136273 Ga0268266_101362732 272
810 3300028379 Ga0268266_10174646 Ga0268266_101746462 272
811 3300028379 Ga0268266_10181379 Ga0268266_101813792 272
812 3300028379 Ga0268266_10362274 Ga0268266_103622742 272
813 3300028556 Ga0265337_1004861 Ga0265337_10048612 272
814 3300028558 Ga0265326_10006349 Ga0265326_100063493 272
815 3300028563 Ga0265319_1005704 Ga0265319_10057046 272
816 3300028573 Ga0265334_10001643 Ga0265334_100016438 272
817 3300028577 Ga0265318_10034833 Ga0265318_100348331 272
818 3300028653 Ga0265323_10000803 Ga0265323_100008033 272
819 3300028666 Ga0265336_10001030 Ga0265336_100010306 272
820 3300028794 Ga0307515_10000017 Ga0307515_10000017220 272
821 3300028794 Ga0307515_10005257 Ga0307515_100052577 272
822 3300028794 Ga0307515_10011281 Ga0307515_100112815 272
823 3300028794 Ga0307515_10079364 Ga0307515_100793643 272
824 3300028800 Ga0265338_10000076 Ga0265338_1000007624 272
825 3300029957 Ga0265324_10002044 Ga0265324_100020447 272
826 3300030500 Ga0268256_1000004 Ga0268256_1000004716 272
827 3300030500 Ga0268256_1001392 Ga0268256_10013926 272
828 3300030522 Ga0307512_10090549 Ga0307512_100905493 272
829 3300031247 Ga0265340_10050010 Ga0265340_100500102 272
830 3300031548 Ga0307408_100101330 Ga0307408_1001013302 272
831 3300031595 Ga0265313_10072373 Ga0265313_100723732 272
832 3300031616 Ga0307508_10087736 Ga0307508_100877362 272
833 3300031616 Ga0307508_10300855 Ga0307508_103008552 272
834 3300031649 Ga0307514_10030872 Ga0307514_100308722 272
835 3300031711 Ga0265314_10005339 Ga0265314_100053399 272
836 3300031712 Ga0265342_10035803 Ga0265342_100358032 272
837 3300031730 Ga0307516_10355366 Ga0307516_103553661 272
838 3300031901 Ga0307406_10033730 Ga0307406_100337303 272
839 3300032004 Ga0307414_10166766 Ga0307414_101667662 272
840 3300033180 Ga0307510_10003276 Ga0307510_1000327614 272
841 3300033180 Ga0307510_10120793 Ga0307510_101207932 272
842 3300033180 Ga0307510_10207436 Ga0307510_102074362 272
843 3300033442 Ga0315911_1000007 Ga0315911_100000766 272
844 3300037418 Ga0395900_0183744 Ga0395900_0183744_1169_2041 272
845 3300037418 Ga0395900_0268425 Ga0395900_0268425_71_943 272
846 3300037418 Ga0395900_0347928 Ga0395900_0347928_324_1196 272
847 3300037466 Ga0395898_0372586 Ga0395898_0372586_381_1253 272
848 3300037471 Ga0395905_0101885 Ga0395905_0101885_1073_1945 272
849 3300037471 Ga0395905_0306078 Ga0395905_0306078_309_1181 272
850 3300038443 Ga0395901_0219662 Ga0395901_0219662_445_1356 272
851 3300038443 Ga0395901_0305349 Ga0395901_0305349_191_1063 272
852 3300038443 Ga0395901_0531044 Ga0395901_0531044_193_1065 272
853 3300038443 Ga0395901_0569198 Ga0395901_0569198_199_1071 272
854 3300039447 Ga0436361_0847892 Ga0436361_0847892_476_1348 272
855 3300039453 Ga0436362_1201805 Ga0436362_1201805_1237_2109 272
856 3300044658 Ga0466972_0000223 Ga0466972_0000223_19028_19933 272
857 3300044658 Ga0466972_0064291 Ga0466972_0064291_14_895 272
858 3300044683 Ga0466965_0051073 Ga0466965_0051073_837_1709 272
859 3300044683 Ga0466965_0057454 Ga0466965_0057454_886_1791 272
860 3300044684 Ga0466966_0034491 Ga0466966_0034491_2000_2908 272
861 3300044706 Ga0466964_0030074 Ga0466964_0030074_782_1750 272
862 3300044735 Ga0466968_0152879 Ga0466968_0152879_55_960 272
863 3300044765 Ga0466970_0113606 Ga0466970_0113606_38_946 272
864 3300044901 Ga0466960_0058915 Ga0466960_0058915_313_1194 272
865 3300046454 Ga0495592_0042076 Ga0495592_0042076_627_1499 272
866 3300046459 Ga0495629_0007893 Ga0495629_0007893_1508_2416 272
867 3300046460 Ga0495638_0011564 Ga0495638_0011564_4705_5613 272
868 3300046462 Ga0495651_0003476 Ga0495651_0003476_9316_10188 272
869 3300046471 Ga0495650_0035367 Ga0495650_0035367_195_1106 272
870 3300046476 Ga0495662_0101687 Ga0495662_0101687_175_1047 272
871 3300046507 Ga0495606_0006924 Ga0495606_0006924_7833_8741 272
872 3300046507 Ga0495606_0053038 Ga0495606_0053038_385_1293 272
873 3300046511 Ga0495608_0010132 Ga0495608_0010132_3116_3988 272
874 3300046516 Ga0495628_0028035 Ga0495628_0028035_1234_2106 272
875 3300046522 Ga0495643_0077064 Ga0495643_0077064_364_1236 272
876 3300046524 Ga0495648_0009261 Ga0495648_0009261_1299_2207 272
877 3300046529 Ga0495652_0040135 Ga0495652_0040135_393_1301 272
878 3300046529 Ga0495652_0060027 Ga0495652_0060027_361_1233 272
879 3300046533 Ga0495640_0053526 Ga0495640_0053526_498_1370 272
880 3300046536 Ga0495587_0066043 Ga0495587_0066043_533_1405 272
881 3300046542 Ga0495597_0051636 Ga0495597_0051636_719_1591 272
882 3300046542 Ga0495597_0133895 Ga0495597_0133895_58_930 272
883 3300046543 Ga0495645_0032890 Ga0495645_0032890_1387_2259 272
884 3300046557 Ga0495622_0055998 Ga0495622_0055998_761_1669 272
885 3300046559 Ga0495667_0019541 Ga0495667_0019541_3671_4543 272
886 3300046616 Ga0495668_0062432 Ga0495668_0062432_91_963 272
887 3300046642 Ga0495634_0023196 Ga0495634_0023196_794_1666 272
888 3300046660 Ga0495625_0171361 Ga0495625_0171361_301_1209 272
889 3300046663 Ga0495635_0015040 Ga0495635_0015040_796_1704 272
890 3300046663 Ga0495635_0055541 Ga0495635_0055541_1748_2620 272
891 3300046674 Ga0495588_0000802 Ga0495588_0000802_12847_13719 272
892 3300046674 Ga0495588_0036609 Ga0495588_0036609_1474_2382 272
893 3300046674 Ga0495588_0065733 Ga0495588_0065733_538_1530 272
894 3300046675 Ga0495657_0001348 Ga0495657_0001348_11046_11918 272
895 3300046680 Ga0495646_0066146 Ga0495646_0066146_437_1309 272
896 3300046692 Ga0495671_0027713 Ga0495671_0027713_1470_2342 272
897 3300046694 Ga0495649_0006416 Ga0495649_0006416_3888_4796 272
898 3300046794 Ga0495589_0074662 Ga0495589_0074662_629_1537 272
899 3300046809 Ga0495600_0013217 Ga0495600_0013217_1130_2002 272
900 3300046809 Ga0495600_0020788 Ga0495600_0020788_114_1022 272
901 3300047315 Ga0495581_0059334 Ga0495581_0059334_994_1902 272
902 3300047317 Ga0495604_0006572 Ga0495604_0006572_6379_7251 272
903 3300047317 Ga0495604_0009422 Ga0495604_0009422_1471_2379 272
904 3300047319 Ga0495674_0061626 Ga0495674_0061626_546_1418 272
905 3300047321 Ga0495676_0031415 Ga0495676_0031415_425_1333 272
906 3300047322 Ga0495680_0061574 Ga0495680_0061574_428_1300 272
907 3300047323 Ga0495683_0032722 Ga0495683_0032722_1061_1933 272
908 3300047443 Ga0495687_007327 Ga0495687_007327_3810_4682 272
909 3300047444 Ga0495675_0013083 Ga0495675_0013083_3029_3901 272
910 3300047470 Ga0495681_0000633 Ga0495681_0000633_2419_3291 272
911 3300047471 Ga0495684_0036589 Ga0495684_0036589_58_930 272
912 3300047472 Ga0495686_0127232 Ga0495686_0127232_206_1078 272
913 3300048088 Ga0495602_0017394 Ga0495602_0017394_702_1574 272
914 3300048903 Ga0496100_0080677 Ga0496100_0080677_793_1701 272
915 3300048904 Ga0496101_0242986 Ga0496101_0242986_120_1028 272
916 3300048905 Ga0496102_0026452 Ga0496102_0026452_1569_2441 272
917 3300048905 Ga0496102_0198851 Ga0496102_0198851_217_1125 272
918 3300048906 Ga0496103_0011150 Ga0496103_0011150_1751_2623 272
919 3300048906 Ga0496103_0313582 Ga0496103_0313582_82_954 272
920 3300048907 Ga0496104_0023025 Ga0496104_0023025_835_1707 272
921 3300048907 Ga0496104_0094352 Ga0496104_0094352_407_1315 272
922 3300048908 Ga0496105_0030560 Ga0496105_0030560_485_1357 272
923 3300048909 Ga0496106_0123728 Ga0496106_0123728_1039_1911 272
924 3300048910 Ga0496107_0021362 Ga0496107_0021362_436_1344 272
925 3300048911 Ga0496108_0014576 Ga0496108_0014576_1519_2391 272
926 3300048912 Ga0496109_0023600 Ga0496109_0023600_3097_3969 272
927 3300048913 Ga0496110_0182006 Ga0496110_0182006_856_1764 272
928 3300048915 Ga0496112_0028981 Ga0496112_0028981_2910_3782 272
929 3300048916 Ga0496113_0072547 Ga0496113_0072547_40_912 272
930 3300048916 Ga0496113_0408218 Ga0496113_0408218_64_972 272
931 3300048919 Ga0496116_0000135 Ga0496116_0000135_115326_116198 272
932 3300048919 Ga0496116_0013446 Ga0496116_0013446_5306_6214 272
933 3300048920 Ga0496117_0027761 Ga0496117_0027761_2635_3507 272
934 3300048920 Ga0496117_0149213 Ga0496117_0149213_78_950 272
935 3300048921 Ga0496118_0045413 Ga0496118_0045413_1070_1978 272
936 3300048921 Ga0496118_0109917 Ga0496118_0109917_791_1702 272
937 3300048921 Ga0496118_0217436 Ga0496118_0217436_26_898 272
938 3300048922 Ga0496119_0013167 Ga0496119_0013167_834_1706 272
939 3300048922 Ga0496119_0088051 Ga0496119_0088051_227_1099 272
940 3300048923 Ga0496120_0001375 Ga0496120_0001375_4128_5000 272
941 3300048923 Ga0496120_0006733 Ga0496120_0006733_7039_7947 272
942 3300048923 Ga0496120_0031758 Ga0496120_0031758_143_1015 272
943 3300048923 Ga0496120_0097036 Ga0496120_0097036_345_1217 272
944 3300048924 Ga0496121_0000003 Ga0496121_0000003_1072190_1073062 272
945 3300048924 Ga0496121_0090651 Ga0496121_0090651_1083_1955 272
946 3300048924 Ga0496121_0114301 Ga0496121_0114301_622_1527 272
947 3300048924 Ga0496121_0157261 Ga0496121_0157261_683_1555 272
948 3300048924 Ga0496121_0263191 Ga0496121_0263191_138_1010 272
949 3300048924 Ga0496121_0263192 Ga0496121_0263192_255_1127 272
950 3300048925 Ga0496122_0000107 Ga0496122_0000107_138882_139787 272
951 3300048925 Ga0496122_0043126 Ga0496122_0043126_1642_2514 272
952 3300048926 Ga0496123_0000063 Ga0496123_0000063_53322_54227 272
953 3300048926 Ga0496123_0022678 Ga0496123_0022678_776_1648 272
954 3300048926 Ga0496123_0116701 Ga0496123_0116701_411_1283 272
955 3300048927 Ga0496124_0032989 Ga0496124_0032989_1138_2043 272
956 3300048927 Ga0496124_0130593 Ga0496124_0130593_701_1573 272
957 3300048927 Ga0496124_0147380 Ga0496124_0147380_820_1692 272
958 3300048927 Ga0496124_0159222 Ga0496124_0159222_24_896 272
959 3300048927 Ga0496124_0274835 Ga0496124_0274835_107_979 272
960 3300048928 Ga0496125_0000200 Ga0496125_0000200_117107_117979 272
961 3300048928 Ga0496125_0000306 Ga0496125_0000306_74448_75320 272
962 3300048928 Ga0496125_0044724 Ga0496125_0044724_1468_2340 272
963 3300048928 Ga0496125_0201461 Ga0496125_0201461_375_1247 272
964 3300048929 Ga0496126_0000129 Ga0496126_0000129_61199_62071 272
965 3300048929 Ga0496126_0000188 Ga0496126_0000188_4770_5642 272
966 3300048929 Ga0496126_0022621 Ga0496126_0022621_745_1653 272
967 3300048929 Ga0496126_0108299 Ga0496126_0108299_1153_2064 272
968 3300048929 Ga0496126_0288362 Ga0496126_0288362_321_1193 272
969 3300048929 Ga0496126_0330264 Ga0496126_0330264_253_1125 272
970 3300049460 Ga0495682_0005057 Ga0495682_0005057_1499_2407 272
971 3300049568 Ga0501031_0042424 Ga0501031_0042424_1318_2190 272
972 3300049568 Ga0501031_0074864 Ga0501031_0074864_553_1425 272
973 3300049569 Ga0501032_0000004 Ga0501032_0000004_161268_162149 272
974 3300049569 Ga0501032_0002753 Ga0501032_0002753_7840_8712 272
975 3300049570 Ga0501033_0000016 Ga0501033_0000016_55346_56227 272
976 3300049570 Ga0501033_0000438 Ga0501033_0000438_31483_32355 272
977 3300049570 Ga0501033_0004986 Ga0501033_0004986_8488_9423 272
978 3300049570 Ga0501033_0019437 Ga0501033_0019437_1371_2243 272
979 3300049571 Ga0501034_0000011 Ga0501034_0000011_161268_162149 272
980 3300049571 Ga0501034_0002517 Ga0501034_0002517_4844_5716 272
981 3300049571 Ga0501034_0004793 Ga0501034_0004793_6698_7633 272
982 3300049571 Ga0501034_0045426 Ga0501034_0045426_1676_2548 272
983 3300049571 Ga0501034_0488861 Ga0501034_0488861_210_1082 272
984 3300049572 Ga0501036_0000001 Ga0501036_0000001_161268_162149 272
985 3300049572 Ga0501036_0003294 Ga0501036_0003294_6063_6998 272
986 3300049572 Ga0501036_0006995 Ga0501036_0006995_796_1668 272
987 3300049572 Ga0501036_0092384 Ga0501036_0092384_905_1777 272
988 3300049572 Ga0501036_0179313 Ga0501036_0179313_133_1005 272
989 3300049573 Ga0501037_0000006 Ga0501037_0000006_55313_56194 272
990 3300049573 Ga0501037_0000722 Ga0501037_0000722_16381_17253 272
991 3300049573 Ga0501037_0005086 Ga0501037_0005086_7702_8637 272
992 3300049573 Ga0501037_0048495 Ga0501037_0048495_1707_2579 272
993 3300049573 Ga0501037_0064525 Ga0501037_0064525_591_1463 272
994 3300049574 Ga0501038_0000003 Ga0501038_0000003_161268_162149 272
995 3300049574 Ga0501038_0000047 Ga0501038_0000047_31379_32251 272
996 3300049574 Ga0501038_0006213 Ga0501038_0006213_9648_10583 272
997 3300049574 Ga0501038_0071935 Ga0501038_0071935_1108_1980 272
998 3300049574 Ga0501038_0096508 Ga0501038_0096508_72_944 272
999 3300049574 Ga0501038_0256190 Ga0501038_0256190_306_1178 272
1000 3300049575 Ga0501039_0000004 Ga0501039_0000004_161268_162149 272
1001 3300049575 Ga0501039_0000038 Ga0501039_0000038_38182_39054 272
1002 3300049575 Ga0501039_0001298 Ga0501039_0001298_9402_10337 272
1003 3300049576 Ga0501040_0012498 Ga0501040_0012498_955_1836 272
1004 3300049578 Ga0501042_0370607 Ga0501042_0370607_22_957 272
1005 3300049579 Ga0501043_0000131 Ga0501043_0000131_36986_37858 272
1006 3300049579 Ga0501043_0000155 Ga0501043_0000155_55466_56347 272
1007 3300049579 Ga0501043_0011433 Ga0501043_0011433_2110_3045 272
1008 3300049579 Ga0501043_0013677 Ga0501043_0013677_274_1146 272
1009 3300049579 Ga0501043_0075709 Ga0501043_0075709_755_1627 272
1010 3300049579 Ga0501043_0148232 Ga0501043_0148232_645_1517 272
1011 3300049580 Ga0501046_0001714 Ga0501046_0001714_10205_11140 272
1012 3300049580 Ga0501046_0068786 Ga0501046_0068786_332_1213 272
1013 3300049580 Ga0501046_0139899 Ga0501046_0139899_829_1701 272
1014 3300049581 Ga0501047_0021199 Ga0501047_0021199_2110_3045 272
1015 3300049581 Ga0501047_0103798 Ga0501047_0103798_781_1662 272
1016 3300049581 Ga0501047_0191688 Ga0501047_0191688_739_1611 272
1017 3300049582 Ga0501048_0022766 Ga0501048_0022766_1066_2001 272
1018 3300049582 Ga0501048_0053324 Ga0501048_0053324_440_1312 272
1019 3300049585 Ga0501069_0002311 Ga0501069_0002311_8632_9567 272
1020 3300049586 Ga0501070_0022569 Ga0501070_0022569_1592_2473 272
1021 3300049586 Ga0501070_0047177 Ga0501070_0047177_2480_3415 272
1022 3300049586 Ga0501070_0178399 Ga0501070_0178399_376_1248 272
1023 3300049587 Ga0501071_0231418 Ga0501071_0231418_321_1193 272
1024 3300049589 Ga0501073_0002004 Ga0501073_0002004_5886_6821 272
1025 3300049590 Ga0501074_0005021 Ga0501074_0005021_7806_8741 272
1026 3300049742 Ga0501080_0002095 Ga0501080_0002095_11140_12075 272
1027 3300049742 Ga0501080_0092647 Ga0501080_0092647_529_1401 272
1028 3300049742 Ga0501080_0347999 Ga0501080_0347999_38_910 272
1029 3300049744 Ga0501083_0013585 Ga0501083_0013585_2482_3417 272
1030 3300049744 Ga0501083_0161515 Ga0501083_0161515_183_1055 272
1031 3300049822 Ga0501035_0000009 Ga0501035_0000009_148679_149560 272
1032 3300049822 Ga0501035_0000553 Ga0501035_0000553_33074_33946 272
1033 3300049822 Ga0501035_0011132 Ga0501035_0011132_5120_6055 272
1034 3300049822 Ga0501035_0070342 Ga0501035_0070342_1233_2105 272
1035 3300049823 Ga0501044_0000005 Ga0501044_0000005_161268_162149 272
1036 3300049823 Ga0501044_0002857 Ga0501044_0002857_11356_12291 272
1037 3300049823 Ga0501044_0013594 Ga0501044_0013594_616_1488 272
1038 3300049823 Ga0501044_0053088 Ga0501044_0053088_1976_2848 272
1039 3300049823 Ga0501044_0079125 Ga0501044_0079125_1697_2569 272
1040 3300049823 Ga0501044_0246023 Ga0501044_0246023_372_1244 272
1041 3300049824 Ga0501045_0030010 Ga0501045_0030010_1306_2178 272
1042 3300049824 Ga0501045_0178364 Ga0501045_0178364_182_1063 272
1043 3300050491 nmdc:mga00v17_32885_c1 nmdc:mga00v17_32885_c1_634_1506 272
1044 3300050492 nmdc:mga0yw44_5347_c1 nmdc:mga0yw44_5347_c1_4979_5851 272
1045 3300050492 nmdc:mga0yw44_849_c1 nmdc:mga0yw44_849_c1_258_1130 272
1046 3300050493 nmdc:mga0k408_5881_c1 nmdc:mga0k408_5881_c1_3983_4855 272
1047 3300050493 nmdc:mga0k408_96574_c1 nmdc:mga0k408_96574_c1_357_1229 272
1048 3300050494 nmdc:mga06z11_4521_c1 nmdc:mga06z11_4521_c1_2998_3870 272
1049 3300050496 nmdc:mga07m45_7487_c1 nmdc:mga07m45_7487_c1_635_1507 272
1050 3300050507 nmdc:mga05p37_704927_c1 nmdc:mga05p37_704927_c1_179_1051 272
1051 3300050512 nmdc:mga0n895_5560_c1 nmdc:mga0n895_5560_c1_3477_4349 272
1052 3300050514 nmdc:mga08x19_122782_c1 nmdc:mga08x19_122782_c1_798_1670 272
1053 3300050516 nmdc:mga0sz30_13288_c1 nmdc:mga0sz30_13288_c1_800_1672 272
1054 3300053083 Ga0495655_0002096 Ga0495655_0002096_1421_2293 272
1055 3300053085 Ga0495619_0046222 Ga0495619_0046222_600_1472 272
1056 3300053086 Ga0500578_0054365 Ga0500578_0054365_532_1440 272
1057 3300053087 Ga0500643_000272 Ga0500643_000272_22070_22942 272
1058 3300053090 Ga0500646_0020067 Ga0500646_0020067_607_1515 272
1059 3300053092 Ga0500583_0030175 Ga0500583_0030175_628_1539 272
1060 3300053092 Ga0500583_0104032 Ga0500583_0104032_221_1093 272
1061 3300053094 Ga0500566_0011157 Ga0500566_0011157_2492_3364 272
1062 3300053098 Ga0500650_0032741 Ga0500650_0032741_898_1770 272
1063 3300053103 Ga0500555_043784 Ga0500555_043784_207_1118 272
1064 3300053104 Ga0500556_0005396 Ga0500556_0005396_603_1511 272
1065 3300053105 Ga0500557_000009 Ga0500557_000009_21620_22492 272
1066 3300053108 Ga0500562_049156 Ga0500562_049156_160_1032 272
1067 3300053109 Ga0500569_001637 Ga0500569_001637_1632_2543 272
1068 3300053130 Ga0500642_0000126 Ga0500642_0000126_3670_4542 272
1069 3300053136 Ga0500559_0009874 Ga0500559_0009874_622_1530 272
1070 3300053146 Ga0500588_0048571 Ga0500588_0048571_293_1204 272
1071 3300053148 Ga0500590_177452 Ga0500590_177452_31_903 272
1072 3300053151 Ga0500604_0013645 Ga0500604_0013645_521_1393 272
1073 3300053153 Ga0500616_0000402 Ga0500616_0000402_43676_44548 272
1074 3300053153 Ga0500616_0078858 Ga0500616_0078858_169_1041 272
1075 3300053156 Ga0500622_0000189 Ga0500622_0000189_14046_14918 272
1076 3300053156 Ga0500622_0012016 Ga0500622_0012016_2281_3189 272
1077 3300053161 Ga0500634_0000143 Ga0500634_0000143_20855_21727 272
1078 3300053177 Ga0500636_0000005 Ga0500636_0000005_185305_186177 272
1079 3300053177 Ga0500636_0001421 Ga0500636_0001421_2276_3184 272
1080 3300053729 Ga0500625_026314 Ga0500625_026314_451_1323 272
1081 3300053730 Ga0500645_027106 Ga0500645_027106_201_1109 272
1082 3300053737 Ga0500601_000404 Ga0500601_000404_852_1724 272
1083 3300055283 Ga0500661_005829 Ga0500661_005829_750_1658 272
1084 3300059477 Ga0587084_000357 Ga0587084_000357_1502_2374 272
1085 3300059478 Ga0587093_000659 Ga0587093_000659_830_1702 272
1086 3300059490 Ga0587066_000135 Ga0587066_000135_2035_2955 272
1087 3300059490 Ga0587066_000656 Ga0587066_000656_961_1833 272
1088 3300059491 Ga0587070_001080 Ga0587070_001080_838_1710 272
1089 3300059492 Ga0587073_0001291 Ga0587073_0001291_1045_1917 272
1090 3300059493 Ga0587077_000087 Ga0587077_000087_2643_3515 272
1091 3300059493 Ga0587077_000129 Ga0587077_000129_2291_3163 272
1092 3300059493 Ga0587077_000388 Ga0587077_000388_1477_2397 272
1093 3300059493 Ga0587077_002096 Ga0587077_002096_25_993 272
1094 3300059493 Ga0587077_004542 Ga0587077_004542_857_1729 272
1095 3300059493 Ga0587077_010618 Ga0587077_010618_96_968 272
1096 3300059503 Ga0587080_000518 Ga0587080_000518_984_1856 272
1097 3300059503 Ga0587080_009095 Ga0587080_009095_101_973 272
1098 3300059504 Ga0587082_000655 Ga0587082_000655_1504_2376 272
1099 3300059504 Ga0587082_000979 Ga0587082_000979_362_1234 272
1100 3300059505 Ga0587083_0000454 Ga0587083_0000454_1267_2139 272
1101 3300059505 Ga0587083_0018555 Ga0587083_0018555_111_983 272
1102 3300059507 Ga0587086_000291 Ga0587086_000291_1491_2363 272
1103 3300059507 Ga0587086_000870 Ga0587086_000870_26_898 272
1104 3300059508 Ga0587088_000088 Ga0587088_000088_1491_2363 272
1105 3300059508 Ga0587088_000232 Ga0587088_000232_1566_2438 272
1106 3300059510 Ga0587090_000159 Ga0587090_000159_2927_3799 272
1107 3300059511 Ga0587091_005524 Ga0587091_005524_29_997 272
1108 3300059513 Ga0587094_000967 Ga0587094_000967_825_1697 272
1109 3300059513 Ga0587094_004811 Ga0587094_004811_577_1449 272
1110 3300059604 Ga0587098_000159 Ga0587098_000159_1471_2391 272
1111 3300059604 Ga0587098_000350 Ga0587098_000350_865_1737 272
1112 3300059604 Ga0587098_001925 Ga0587098_001925_766_1638 272
1113 3300059604 Ga0587098_007867 Ga0587098_007867_124_1005 272
1114 3300059605 Ga0587106_000609 Ga0587106_000609_931_1803 272
1115 3300059608 Ga0587129_000232 Ga0587129_000232_603_1475 272
1116 3300059622 Ga0587099_000098 Ga0587099_000098_1064_1936 272
1117 3300059623 Ga0587101_000271 Ga0587101_000271_1504_2376 272
1118 3300059623 Ga0587101_011076 Ga0587101_011076_31_903 272
1119 3300059625 Ga0587113_000218 Ga0587113_000218_918_1790 272
1120 3300059626 Ga0587115_000092 Ga0587115_000092_1470_2390 272
1121 3300059626 Ga0587115_000779 Ga0587115_000779_820_1692 272
1122 3300059630 Ga0587128_000033 Ga0587128_000033_3171_4091 272
1123 3300059630 Ga0587128_000233 Ga0587128_000233_1508_2380 272
1124 3300059639 Ga0587062_000077 Ga0587062_000077_1748_2668 272
1125 3300059639 Ga0587062_000513 Ga0587062_000513_380_1252 272
1126 3300059640 Ga0587067_000896 Ga0587067_000896_868_1740 272
1127 3300059641 Ga0587068_000701 Ga0587068_000701_1491_2363 272
1128 3300059642 Ga0587069_000544 Ga0587069_000544_873_1745 272
1129 3300059643 Ga0587072_000323 Ga0587072_000323_1571_2491 272
1130 3300059643 Ga0587072_001126 Ga0587072_001126_829_1701 272
1131 3300059644 Ga0587075_000291 Ga0587075_000291_1471_2391 272
1132 3300059644 Ga0587075_000401 Ga0587075_000401_1544_2416 272
1133 3300059645 Ga0587076_001077 Ga0587076_001077_846_1718 272
1134 3300059645 Ga0587076_005116 Ga0587076_005116_36_908 272
1135 3300059646 Ga0587078_000332 Ga0587078_000332_984_1856 272
1136 3300059647 Ga0587079_000822 Ga0587079_000822_1013_1885 272
1137 3300059649 Ga0587102_000134 Ga0587102_000134_621_1493 272
1138 3300059651 Ga0587105_000149 Ga0587105_000149_547_1419 272
1139 3300059652 Ga0587107_000467 Ga0587107_000467_848_1720 272
1140 3300059652 Ga0587107_000611 Ga0587107_000611_1567_2439 272
1141 3300059657 Ga0587118_00239 Ga0587118_00239_701_1573 272
1142 3300059658 Ga0587119_000378 Ga0587119_000378_820_1692 272
1143 3300060243 Ga0587060_001450 Ga0587060_001450_103_975 272
1144 3300060247 Ga0587096_00039 Ga0587096_00039_583_1455 272
1145 3300060344 Ga0587071_000669 Ga0587071_000669_1504_2376 272
1146 3300060346 Ga0587111_0000161 Ga0587111_0000161_2577_3449 272
1147 3300060346 Ga0587111_0001051 Ga0587111_0001051_1571_2491 272
1148 3300060353 Ga0501082_0010931 Ga0501082_0010931_6711_7646 272
1149 iso_pu_bacteria 2524023210 2524465038 272
1150 iso_pu_bacteria 2582581307 2585274389 272
1151 iso_pu_bacteria 2585427531 2585560838 272
1152 iso_pu_bacteria 8016539877 8016547384 272
1153 iso_pu_bacteria 8016566248 8016572494 272
1154 iso_pu_bacteria 8016575299 8016576662 272
1155 iso_pu_bacteria 8019538911 8019545752 272
1156 iso_pu_bacteria 8019547302 8019552971 272
1157 iso_pu_bacteria 8056967851 8056968755 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

46

330

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.4608 45 260
2r6g-assembly1.cif.gz_F the crystal structure of the e. coli maltose transporter 0.4568 45 262
3pv0-assembly1.cif.gz_F crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide 0.4541 45 260
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.4406 45 265
1s1f-assembly1.cif.gz_A crystal structure of streptomyces coelicolor a3(2) cyp158a2 from antibiotic biosynthetic pathways 0.4308 208 260
ID Description Score Start End Superfamily
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.499 49 272 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4879 49 269 1.10.3720.10
af_P10905_52_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4831 49 268 1.10.3720.10
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4738 25 263 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4564 49 272 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A535Q4G9-F1-model_v4 Sugar ABC transporter permease 0.6614 66 224 GO:0005886
GO:0055085
AF-A0A535PCK3-F1-model_v4 Sugar ABC transporter permease 0.6172 93 271 GO:0005886
GO:0055085
AF-A0A4Q5P1H9-F1-model_v4 Sugar ABC transporter permease 0.612 97 270 GO:0005886
GO:0055085
AF-A0A4Q5P1H9-F1-model_v4 Sugar ABC transporter permease 0.6055 97 270 GO:0005886
GO:0055085
AF-A0A836ZLD8-F1-model_v4 deleted 0.604 54 178

Feature Viewer

pLDDT pTM Quality
69.34 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map