F490864
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1151 | 752 | 803 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0020949|Ga0466963_0020949_1439_1966 |
| Length | 175 |
| Sequence | VKAKGRRPLKLFERAIKEIAMISPFVKVQREDFELQTEIDRLRSGRRDIGAVVTFSGLCRDEGGSLGALELEHYPGMAEAEITRIAKLAVERFELLGLTAIHRYGKIEPGENIVLVIAAASHRQAAFDGANFVMDFLKTSAPFWKKEHGKDGTEGGWVSAKDADDAARAKWSGNK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 6 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 7 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 8 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 9 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 10 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 11 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 12 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 13 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 14 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 15 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 16 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 17 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 18 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 19 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 20 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 21 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 22 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 23 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 24 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 25 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 26 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 27 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 28 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 29 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 30 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 31 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 32 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 33 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 34 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 35 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 36 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 37 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 38 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 39 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 40 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 41 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 42 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 43 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 44 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 45 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 46 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 47 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 48 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 49 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 50 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 51 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 52 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 53 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 54 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 55 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 56 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 57 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 58 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 59 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 60 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 61 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 62 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 63 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 64 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 65 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 66 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 67 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 68 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 69 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 70 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 71 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 72 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 73 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 74 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 75 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 76 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 77 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 78 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 79 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 80 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 81 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 82 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 83 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 84 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 85 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 86 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 87 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 88 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 89 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 90 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 91 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 92 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 93 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 94 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 95 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 96 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 97 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 98 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 99 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 100 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 101 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 102 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 103 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 104 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 105 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 106 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 107 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 108 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 109 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 110 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 111 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 112 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 113 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 114 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 115 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 116 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 117 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 118 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 119 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 120 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 121 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 122 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 123 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 124 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 125 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 126 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 127 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 128 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 129 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 130 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 131 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 132 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 133 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 134 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 135 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 136 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 137 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 138 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 139 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 140 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 141 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 142 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 143 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 144 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 145 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 146 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 147 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 148 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 149 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 150 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 151 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 152 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 153 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 154 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 155 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 156 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 157 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 158 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 159 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 160 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 161 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 162 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 163 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 164 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 165 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 166 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 167 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 168 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 169 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 170 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 171 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 172 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 173 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 174 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 175 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 176 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 177 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 178 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 179 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 180 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 181 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 182 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 183 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 184 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 185 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 186 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 187 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 188 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 189 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 190 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 191 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 192 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 193 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 194 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 195 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 196 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 197 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 198 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 199 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 200 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 201 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 202 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 203 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 204 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 205 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 206 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 207 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 208 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 209 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 210 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 211 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 212 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 213 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 214 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 215 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 216 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 217 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 218 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 219 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 220 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 221 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 222 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 223 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 224 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 225 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 226 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 227 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 228 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 229 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 230 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 231 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 232 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 233 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 234 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 235 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 236 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 237 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 238 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 239 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 240 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 241 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 242 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 243 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 244 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 245 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 246 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 247 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 248 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 249 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 250 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 251 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 252 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 253 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 254 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 255 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 256 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 257 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 258 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 259 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 260 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 261 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 262 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 263 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 264 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 265 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 266 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 267 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 268 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 269 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 270 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 271 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 272 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 273 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 274 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 275 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 276 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 277 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 278 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 279 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 280 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 281 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 282 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 283 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 284 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 285 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 286 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 287 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 288 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 289 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 290 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 291 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 292 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 293 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 294 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 295 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 296 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 297 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 298 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 299 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 300 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 301 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 302 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 303 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 304 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 305 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 306 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 307 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 308 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 309 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 310 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 311 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 312 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 313 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 314 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 315 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 316 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 317 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 318 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 319 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 320 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 321 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 322 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 323 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 324 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 325 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 326 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 327 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 328 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 329 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 330 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 331 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 332 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 333 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 334 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 335 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 336 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 337 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 338 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 339 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 340 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 341 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 342 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 343 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 344 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 345 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 346 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 347 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 348 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 349 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 350 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 351 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 352 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 353 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 354 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 355 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 356 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 357 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 358 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 359 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 360 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 361 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 362 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 363 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 364 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 365 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 366 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 367 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 368 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 369 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 370 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 371 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 372 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 373 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 374 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 375 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 376 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 378 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 379 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 380 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 381 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 383 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 384 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 385 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 386 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 387 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 388 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 389 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 390 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 391 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 392 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 393 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 394 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 395 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 396 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 397 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 398 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 399 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 400 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 401 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 402 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 403 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 404 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 405 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 406 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 407 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 408 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 409 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 410 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 411 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 412 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 413 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 414 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 415 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 416 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 417 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 418 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 419 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 420 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 421 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 422 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 423 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 424 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 425 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 426 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 427 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 428 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 452 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 454 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 455 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 456 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 457 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 458 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 459 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 460 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 461 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 462 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 463 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 464 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 465 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 466 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 467 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 468 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 469 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 470 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 471 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 472 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 473 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 474 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 475 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 476 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 477 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 478 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 479 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 480 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 481 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 482 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 483 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 484 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 485 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 486 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 487 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 488 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 489 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 490 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 491 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 492 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 493 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 494 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 495 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 496 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 497 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 498 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 499 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 500 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 501 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 502 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 503 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 504 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 505 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 506 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 507 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 508 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 509 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 510 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 511 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 512 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 513 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 514 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 515 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 516 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 517 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 518 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 519 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 520 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 521 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 522 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 523 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 524 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 525 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 526 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 527 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 528 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 529 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 530 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 531 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 603 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 604 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 605 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 606 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 607 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 608 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 609 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 610 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 611 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 612 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 613 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 614 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 615 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 616 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 617 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 618 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 619 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 620 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 621 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 622 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 623 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 624 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 625 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 627 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 628 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 629 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 630 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 631 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 632 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 633 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 634 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 635 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 636 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 637 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 638 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 639 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 640 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 641 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 642 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 643 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 644 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 645 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 646 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 647 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 648 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 649 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 650 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 651 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 652 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 653 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 654 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 655 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 656 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 657 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 658 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 659 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 660 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 661 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 662 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 663 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 664 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 665 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 666 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 667 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 668 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 669 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 670 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 671 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 677 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 678 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 679 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 680 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 681 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 682 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 683 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 684 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 685 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 686 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 687 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 688 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 689 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 690 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 691 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 692 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 693 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 694 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 695 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 696 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 697 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 698 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 699 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 700 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 701 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 702 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 703 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 704 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 705 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 706 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 707 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 708 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 709 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 710 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 711 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 712 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 713 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 714 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 715 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 716 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 717 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 718 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 719 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 720 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 721 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 722 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 723 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 724 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 725 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 726 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 727 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 728 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 729 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 730 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 731 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 732 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 733 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 734 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 735 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 736 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 737 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 738 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 739 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 740 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 741 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 742 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 743 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 744 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 745 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 746 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 747 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 748 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 749 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 750 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 751 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 752 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 69.77 |
| Metatranscriptomes | 0 |
| Isolates | 30.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.55 |
| Nodule | 20.59 |
| Rhizoplane | 2.35 |
| Rhizosphere | 41.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000032 | 3300002704 | Bacteria | 105511 |
| 2 | JGI25156J39149_1000129 | 3300002705 | Bacteria | 54812 |
| 3 | JGI25162J39368_1001169 | 3300002737 | Bacteria | 15592 |
| 4 | JGI25162J39368_1001727 | 3300002737 | Bacteria | 10548 |
| 5 | JGI25162J39368_1003463 | 3300002737 | Bacteria | 4530 |
| 6 | JGI25154J39366_1000324 | 3300002738 | Bacteria | 27739 |
| 7 | JGI25158J39367_1000210 | 3300002739 | Bacteria | 13780 |
| 8 | JGI25157J39369_1000061 | 3300002741 | Bacteria | 105511 |
| 9 | JGI25157J39369_1000624 | 3300002741 | Bacteria | 19993 |
| 10 | JGI25152J39213_1000438 | 3300002773 | Bacteria | 24994 |
| 11 | JGI25152J39213_1001642 | 3300002773 | Bacteria | 9322 |
| 12 | JGI25152J39213_1003410 | 3300002773 | Bacteria | 5438 |
| 13 | JGI25150J39212_1000033 | 3300002774 | Bacteria | 96269 |
| 14 | JGI25150J39212_1017949 | 3300002774 | Bacteria | 1135 |
| 15 | JGI25159J45721_1000136 | 3300002987 | Bacteria | 34768 |
| 16 | JGI25159J45721_1000544 | 3300002987 | Bacteria | 17146 |
| 17 | JGI25151J46595_10000108 | 3300003187 | Bacteria | 112874 |
| 18 | JGI25151J46595_10000591 | 3300003187 | Bacteria | 32186 |
| 19 | JGI25151J46595_10012339 | 3300003187 | Bacteria | 3891 |
| 20 | JGI25151J46595_10025237 | 3300003187 | Bacteria | 2421 |
| 21 | JGI25151J46595_10025400 | 3300003187 | Bacteria | 2411 |
| 22 | JGI25151J46595_10034315 | 3300003187 | Bacteria | 1942 |
| 23 | JGI25165J46597_1000630 | 3300003214 | Bacteria | 29232 |
| 24 | JGI25165J46597_1000944 | 3300003214 | Bacteria | 19880 |
| 25 | JGI25165J46597_1020336 | 3300003214 | Bacteria | 870 |
| 26 | JGI25153J46596_10009089 | 3300003215 | Bacteria | 4666 |
| 27 | JGI25153J46596_10010252 | 3300003215 | Bacteria | 4255 |
| 28 | rootH1_10055154 | 3300003316 | Bacteria | 1402 |
| 29 | rootH2_10025055 | 3300003320 | Bacteria | 4537 |
| 30 | rootL2_10082663 | 3300003322 | Bacteria | 3939 |
| 31 | rootH1_10117768 | 3300003323 | Bacteria | 2152 |
| 32 | rootH1_10117786 | 3300003323 | Bacteria | 1654 |
| 33 | JGI25160J50197_1000008 | 3300003354 | Bacteria | 289163 |
| 34 | JGI25160J50197_1000015 | 3300003354 | Bacteria | 250902 |
| 35 | JGI25160J50197_1005784 | 3300003354 | Bacteria | 5097 |
| 36 | JGI25161J50226_1000005 | 3300003374 | Bacteria | 292548 |
| 37 | JGI25161J50226_1000051 | 3300003374 | Bacteria | 110051 |
| 38 | JGI25161J50226_1000489 | 3300003374 | Bacteria | 17865 |
| 39 | Ga0055526_1001653 | 3300003771 | Bacteria | 15643 |
| 40 | Ga0055526_1021859 | 3300003771 | Bacteria | 2204 |
| 41 | Ga0055524_1035421 | 3300003775 | Bacteria | 1361 |
| 42 | Ga0055536_1000984 | 3300003781 | Bacteria | 18060 |
| 43 | Ga0055536_1004520 | 3300003781 | Bacteria | 7076 |
| 44 | Ga0055536_1067949 | 3300003781 | Bacteria | 713 |
| 45 | Ga0055528_1000201 | 3300003790 | Bacteria | 50283 |
| 46 | Ga0055528_1001727 | 3300003790 | Bacteria | 12649 |
| 47 | Ga0055530_10011768 | 3300003791 | Bacteria | 3110 |
| 48 | Ga0055530_10015824 | 3300003791 | Bacteria | 2440 |
| 49 | Ga0055540_1003756 | 3300003792 | Bacteria | 7166 |
| 50 | Ga0055531_10002233 | 3300003794 | Bacteria | 13122 |
| 51 | Ga0055531_10017167 | 3300003794 | Bacteria | 3071 |
| 52 | Ga0055543_1000012 | 3300004625 | Bacteria | 186581 |
| 53 | Ga0055543_1000040 | 3300004625 | Bacteria | 122485 |
| 54 | Ga0055543_1000258 | 3300004625 | Bacteria | 39859 |
| 55 | Ga0065165_1000015 | 3300005262 | Bacteria | 289201 |
| 56 | Ga0065165_1000125 | 3300005262 | Bacteria | 130283 |
| 57 | Ga0065165_1058493 | 3300005262 | Bacteria | 1064 |
| 58 | Ga0065704_10479362 | 3300005289 | Bacteria | 683 |
| 59 | Ga0070658_10144746 | 3300005327 | Bacteria | 1987 |
| 60 | Ga0070670_100009220 | 3300005331 | Bacteria | 8432 |
| 61 | Ga0070677_10285255 | 3300005333 | Bacteria | 833 |
| 62 | Ga0070666_10002410 | 3300005335 | Bacteria | 11315 |
| 63 | Ga0070660_100128574 | 3300005339 | Bacteria | 2026 |
| 64 | Ga0070691_10442712 | 3300005341 | Bacteria | 740 |
| 65 | Ga0070669_100070984 | 3300005353 | Bacteria | 2575 |
| 66 | Ga0070669_100287538 | 3300005353 | Bacteria | 1319 |
| 67 | Ga0070675_100036014 | 3300005354 | Bacteria | 4025 |
| 68 | Ga0070675_100384468 | 3300005354 | Bacteria | 1250 |
| 69 | Ga0070673_100006321 | 3300005364 | Bacteria | 7693 |
| 70 | Ga0070673_100869340 | 3300005364 | Bacteria | 835 |
| 71 | Ga0070673_101504416 | 3300005364 | Bacteria | 635 |
| 72 | Ga0070659_100008914 | 3300005366 | Bacteria | 7352 |
| 73 | Ga0070659_100582170 | 3300005366 | Bacteria | 960 |
| 74 | Ga0070709_10088941 | 3300005434 | Bacteria | 2033 |
| 75 | Ga0070714_100003030 | 3300005435 | Bacteria | 12460 |
| 76 | Ga0070713_100714982 | 3300005436 | Bacteria | 957 |
| 77 | Ga0070710_10010191 | 3300005437 | Bacteria | 4611 |
| 78 | Ga0070710_10049739 | 3300005437 | Bacteria | 2346 |
| 79 | Ga0070663_100038200 | 3300005455 | Bacteria | 3348 |
| 80 | Ga0070678_100430520 | 3300005456 | Bacteria | 1152 |
| 81 | Ga0070684_101212096 | 3300005535 | Bacteria | 710 |
| 82 | Ga0068853_100072636 | 3300005539 | Bacteria | 2999 |
| 83 | Ga0068853_101286883 | 3300005539 | Bacteria | 707 |
| 84 | Ga0068853_101583866 | 3300005539 | Bacteria | 635 |
| 85 | Ga0068853_101588326 | 3300005539 | Bacteria | 634 |
| 86 | Ga0070672_101211925 | 3300005543 | Bacteria | 673 |
| 87 | Ga0070665_100000418 | 3300005548 | Bacteria | 62048 |
| 88 | Ga0070665_100165027 | 3300005548 | Bacteria | 2217 |
| 89 | Ga0070665_100584620 | 3300005548 | Bacteria | 1129 |
| 90 | Ga0070664_100558241 | 3300005564 | Bacteria | 1059 |
| 91 | Ga0068857_100815023 | 3300005577 | Bacteria | 892 |
| 92 | Ga0068854_100244926 | 3300005578 | Bacteria | 1429 |
| 93 | Ga0068852_100682644 | 3300005616 | Bacteria | 1036 |
| 94 | Ga0068859_101235347 | 3300005617 | Bacteria | 823 |
| 95 | Ga0068851_10039881 | 3300005834 | Bacteria | 2359 |
| 96 | Ga0068862_101206625 | 3300005844 | Bacteria | 755 |
| 97 | Ga0081455_10013647 | 3300005937 | Bacteria | 8003 |
| 98 | Ga0081455_10111115 | 3300005937 | Bacteria | 2178 |
| 99 | Ga0081455_10190567 | 3300005937 | Bacteria | 1544 |
| 100 | Ga0081540_1000508 | 3300005983 | Bacteria | 38223 |
| 101 | Ga0081540_1047720 | 3300005983 | Bacteria | 2151 |
| 102 | Ga0081539_10057281 | 3300005985 | Bacteria | 2157 |
| 103 | Ga0070717_10471537 | 3300006028 | Bacteria | 1133 |
| 104 | Ga0075365_10011590 | 3300006038 | Bacteria | 5192 |
| 105 | Ga0075365_10045727 | 3300006038 | Bacteria | 2873 |
| 106 | Ga0075365_10053431 | 3300006038 | Bacteria | 2675 |
| 107 | Ga0075365_10196597 | 3300006038 | Bacteria | 1412 |
| 108 | Ga0075365_10413135 | 3300006038 | Bacteria | 952 |
| 109 | Ga0075368_10101990 | 3300006042 | Bacteria | 1179 |
| 110 | Ga0075368_10296925 | 3300006042 | Bacteria | 696 |
| 111 | Ga0075363_100251247 | 3300006048 | Bacteria | 1018 |
| 112 | Ga0075363_100457570 | 3300006048 | Bacteria | 754 |
| 113 | Ga0075364_10012041 | 3300006051 | Bacteria | 5276 |
| 114 | Ga0075364_10027201 | 3300006051 | Bacteria | 3653 |
| 115 | Ga0075364_10056208 | 3300006051 | Bacteria | 2576 |
| 116 | Ga0075364_10442295 | 3300006051 | Bacteria | 888 |
| 117 | Ga0075364_10498885 | 3300006051 | Bacteria | 832 |
| 118 | Ga0070715_10240494 | 3300006163 | Bacteria | 941 |
| 119 | Ga0070716_100115964 | 3300006173 | Bacteria | 1668 |
| 120 | Ga0070712_100077924 | 3300006175 | Bacteria | 2390 |
| 121 | Ga0075362_10033044 | 3300006177 | Bacteria | 2248 |
| 122 | Ga0075366_10061087 | 3300006195 | Bacteria | 2239 |
| 123 | Ga0075370_10023755 | 3300006353 | Bacteria | 3380 |
| 124 | Ga0075428_100079844 | 3300006844 | Bacteria | 3570 |
| 125 | Ga0075428_101667206 | 3300006844 | Bacteria | 666 |
| 126 | Ga0075430_100150852 | 3300006846 | Bacteria | 1936 |
| 127 | Ga0075430_100199560 | 3300006846 | Bacteria | 1661 |
| 128 | Ga0075431_100320676 | 3300006847 | Bacteria | 1562 |
| 129 | Ga0075433_10011744 | 3300006852 | Bacteria | 7052 |
| 130 | Ga0075434_100001723 | 3300006871 | Bacteria | 18762 |
| 131 | Ga0075434_101093193 | 3300006871 | Bacteria | 811 |
| 132 | Ga0097620_101235450 | 3300006931 | Bacteria | 823 |
| 133 | Ga0075435_100010424 | 3300007076 | Bacteria | 6799 |
| 134 | Ga0099795_10002608 | 3300007788 | Bacteria | 4283 |
| 135 | Ga0105244_10382877 | 3300009036 | Bacteria | 647 |
| 136 | Ga0105240_10000032 | 3300009093 | Bacteria | 283907 |
| 137 | Ga0105240_10148249 | 3300009093 | Bacteria | 2797 |
| 138 | Ga0114129_10836149 | 3300009147 | Bacteria | 1172 |
| 139 | Ga0105243_10008523 | 3300009148 | Bacteria | 7866 |
| 140 | Ga0105237_10002365 | 3300009545 | Bacteria | 23399 |
| 141 | Ga0105238_10054013 | 3300009551 | Bacteria | 4036 |
| 142 | Ga0105238_10742544 | 3300009551 | Bacteria | 995 |
| 143 | Ga0099796_10004809 | 3300010159 | Bacteria | 3307 |
| 144 | Ga0105239_10013157 | 3300010375 | Bacteria | 9193 |
| 145 | Ga0105246_10382362 | 3300011119 | Bacteria | 1164 |
| 146 | Ga0157347_1013101 | 3300012502 | Bacteria | 902 |
| 147 | Ga0157373_10123458 | 3300013100 | Bacteria | 1820 |
| 148 | Ga0157371_10000073 | 3300013102 | Bacteria | 163215 |
| 149 | Ga0157370_10001154 | 3300013104 | Bacteria | 32919 |
| 150 | Ga0157370_10003636 | 3300013104 | Bacteria | 18019 |
| 151 | Ga0157369_10185520 | 3300013105 | Bacteria | 2188 |
| 152 | Ga0163163_10559799 | 3300014325 | Bacteria | 1206 |
| 153 | Ga0157380_10862629 | 3300014326 | Bacteria | 928 |
| 154 | Ga0157380_11110246 | 3300014326 | Bacteria | 830 |
| 155 | Ga0182008_10075376 | 3300014497 | Bacteria | 1659 |
| 156 | Ga0157377_10534060 | 3300014745 | Bacteria | 826 |
| 157 | Ga0182007_10000460 | 3300015262 | Bacteria | 24598 |
| 158 | Ga0163161_10316219 | 3300017792 | Bacteria | 1233 |
| 159 | Ga0214544_1000017 | 3300021320 | Bacteria | 193638 |
| 160 | Ga0214542_1000006 | 3300021321 | Bacteria | 345164 |
| 161 | Ga0214542_1021608 | 3300021321 | Bacteria | 4357 |
| 162 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 163 | Ga0214543_1000014 | 3300021327 | Bacteria | 324986 |
| 164 | Ga0213874_10038285 | 3300021377 | Bacteria | 1423 |
| 165 | Ga0213874_10095906 | 3300021377 | Bacteria | 980 |
| 166 | Ga0213876_10001897 | 3300021384 | Bacteria | 12584 |
| 167 | Ga0213876_10003588 | 3300021384 | Bacteria | 8828 |
| 168 | Ga0213875_10004740 | 3300021388 | Bacteria | 7397 |
| 169 | Ga0209435_100042 | 3300025206 | Bacteria | 105563 |
| 170 | Ga0209436_100173 | 3300025208 | Bacteria | 30923 |
| 171 | Ga0209436_101739 | 3300025208 | Bacteria | 7155 |
| 172 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 173 | Ga0209437_100075 | 3300025233 | Bacteria | 297202 |
| 174 | Ga0207425_1000031 | 3300025245 | Bacteria | 261181 |
| 175 | Ga0207425_1001353 | 3300025245 | Bacteria | 10502 |
| 176 | Ga0207425_1004550 | 3300025245 | Bacteria | 4125 |
| 177 | Ga0207425_1025968 | 3300025245 | Bacteria | 1205 |
| 178 | Ga0207425_1031518 | 3300025245 | Bacteria | 1055 |
| 179 | Ga0207425_1058915 | 3300025245 | Bacteria | 682 |
| 180 | Ga0209646_1000145 | 3300025246 | Bacteria | 105563 |
| 181 | Ga0209646_1005325 | 3300025246 | Bacteria | 2255 |
| 182 | Ga0209026_1000120 | 3300025250 | Bacteria | 130091 |
| 183 | Ga0209026_1000160 | 3300025250 | Bacteria | 105563 |
| 184 | Ga0209677_100845 | 3300025253 | Bacteria | 15183 |
| 185 | Ga0209759_1000177 | 3300025256 | Bacteria | 105563 |
| 186 | Ga0209759_1000288 | 3300025256 | Bacteria | 69733 |
| 187 | Ga0209129_1000053 | 3300025258 | Bacteria | 262823 |
| 188 | Ga0209129_1000137 | 3300025258 | Bacteria | 123213 |
| 189 | Ga0209129_1000932 | 3300025258 | Bacteria | 17735 |
| 190 | Ga0209129_1001774 | 3300025258 | Bacteria | 11508 |
| 191 | Ga0209129_1002015 | 3300025258 | Bacteria | 10537 |
| 192 | Ga0209129_1002041 | 3300025258 | Bacteria | 10434 |
| 193 | Ga0209233_1000056 | 3300025261 | Bacteria | 438104 |
| 194 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 195 | Ga0209233_1000209 | 3300025261 | Bacteria | 115124 |
| 196 | Ga0209455_1021938 | 3300025272 | Bacteria | 1227 |
| 197 | Ga0209673_1000041 | 3300025273 | Bacteria | 307397 |
| 198 | Ga0209673_1000603 | 3300025273 | Bacteria | 55646 |
| 199 | Ga0209673_1005348 | 3300025273 | Bacteria | 6492 |
| 200 | Ga0209130_1000006 | 3300025284 | Bacteria | 596528 |
| 201 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 202 | Ga0209130_1000018 | 3300025284 | Bacteria | 388301 |
| 203 | Ga0209675_1036412 | 3300025291 | Bacteria | 1115 |
| 204 | Ga0209676_1000694 | 3300025292 | Bacteria | 47316 |
| 205 | Ga0209676_1004264 | 3300025292 | Bacteria | 8065 |
| 206 | Ga0209676_1014196 | 3300025292 | Bacteria | 3010 |
| 207 | Ga0209025_1000074 | 3300025294 | Bacteria | 277445 |
| 208 | Ga0209025_1000080 | 3300025294 | Bacteria | 267244 |
| 209 | Ga0209025_1000087 | 3300025294 | Bacteria | 261181 |
| 210 | Ga0209025_1000199 | 3300025294 | Bacteria | 146058 |
| 211 | Ga0209025_1000580 | 3300025294 | Bacteria | 66332 |
| 212 | Ga0209025_1001440 | 3300025294 | Bacteria | 31293 |
| 213 | Ga0209025_1001600 | 3300025294 | Bacteria | 28497 |
| 214 | Ga0209025_1002011 | 3300025294 | Bacteria | 23229 |
| 215 | Ga0209025_1010350 | 3300025294 | Bacteria | 6330 |
| 216 | Ga0209564_1000425 | 3300025295 | Bacteria | 74279 |
| 217 | Ga0209564_1001342 | 3300025295 | Bacteria | 26169 |
| 218 | Ga0209564_1012875 | 3300025295 | Bacteria | 3604 |
| 219 | Ga0209758_1000081 | 3300025297 | Bacteria | 261181 |
| 220 | Ga0209758_1000890 | 3300025297 | Bacteria | 40935 |
| 221 | Ga0209758_1002000 | 3300025297 | Bacteria | 21958 |
| 222 | Ga0209758_1003116 | 3300025297 | Bacteria | 15659 |
| 223 | Ga0209758_1003638 | 3300025297 | Bacteria | 13764 |
| 224 | Ga0209758_1008032 | 3300025297 | Bacteria | 6972 |
| 225 | Ga0209758_1060745 | 3300025297 | Bacteria | 1249 |
| 226 | Ga0209050_1002170 | 3300025298 | Bacteria | 17758 |
| 227 | Ga0209050_1007237 | 3300025298 | Bacteria | 6292 |
| 228 | Ga0209256_1001698 | 3300025299 | Bacteria | 21247 |
| 229 | Ga0209256_1001781 | 3300025299 | Bacteria | 20391 |
| 230 | Ga0209256_1005451 | 3300025299 | Bacteria | 7322 |
| 231 | Ga0209256_1031272 | 3300025299 | Bacteria | 1457 |
| 232 | Ga0209256_1051441 | 3300025299 | Bacteria | 994 |
| 233 | Ga0209256_1070692 | 3300025299 | Bacteria | 786 |
| 234 | Ga0207426_1000044 | 3300025302 | Bacteria | 428043 |
| 235 | Ga0207426_1000064 | 3300025302 | Bacteria | 358276 |
| 236 | Ga0207426_1000106 | 3300025302 | Bacteria | 244368 |
| 237 | Ga0207426_1005259 | 3300025302 | Bacteria | 5969 |
| 238 | Ga0209051_1006558 | 3300025303 | Bacteria | 6535 |
| 239 | Ga0209051_1011758 | 3300025303 | Bacteria | 4293 |
| 240 | Ga0209051_1015125 | 3300025303 | Bacteria | 3565 |
| 241 | Ga0209051_1021615 | 3300025303 | Bacteria | 2731 |
| 242 | Ga0209257_1004833 | 3300025304 | Bacteria | 9982 |
| 243 | Ga0209257_1005277 | 3300025304 | Bacteria | 9211 |
| 244 | Ga0209257_1028296 | 3300025304 | Bacteria | 1847 |
| 245 | Ga0209257_1038965 | 3300025304 | Bacteria | 1433 |
| 246 | Ga0207680_10276331 | 3300025903 | Bacteria | 1166 |
| 247 | Ga0207705_10064487 | 3300025909 | Bacteria | 2647 |
| 248 | Ga0207705_10681695 | 3300025909 | Bacteria | 799 |
| 249 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 250 | Ga0207695_10466095 | 3300025913 | Bacteria | 1146 |
| 251 | Ga0207671_10000718 | 3300025914 | Bacteria | 42274 |
| 252 | Ga0207693_10020160 | 3300025915 | Bacteria | 5304 |
| 253 | Ga0207657_10038823 | 3300025919 | Bacteria | 4235 |
| 254 | Ga0207657_10055853 | 3300025919 | Bacteria | 3409 |
| 255 | Ga0207694_10112227 | 3300025924 | Bacteria | 2169 |
| 256 | Ga0207694_10869492 | 3300025924 | Bacteria | 762 |
| 257 | Ga0207650_10005961 | 3300025925 | Bacteria | 8320 |
| 258 | Ga0207659_10027967 | 3300025926 | Bacteria | 3825 |
| 259 | Ga0207659_10674789 | 3300025926 | Bacteria | 884 |
| 260 | Ga0207690_10000898 | 3300025932 | Bacteria | 18981 |
| 261 | Ga0207690_10147147 | 3300025932 | Bacteria | 1742 |
| 262 | Ga0207709_10011235 | 3300025935 | Bacteria | 4939 |
| 263 | Ga0207669_10243384 | 3300025937 | Bacteria | 1335 |
| 264 | Ga0207669_10367659 | 3300025937 | Bacteria | 1117 |
| 265 | Ga0207711_10727584 | 3300025941 | Bacteria | 925 |
| 266 | Ga0207689_10208958 | 3300025942 | Bacteria | 1612 |
| 267 | Ga0207712_10564920 | 3300025961 | Bacteria | 980 |
| 268 | Ga0207640_10155131 | 3300025981 | Bacteria | 1687 |
| 269 | Ga0207658_10313549 | 3300025986 | Bacteria | 1356 |
| 270 | Ga0207639_10137030 | 3300026041 | Bacteria | 2035 |
| 271 | Ga0207639_11116563 | 3300026041 | Bacteria | 739 |
| 272 | Ga0207639_11334151 | 3300026041 | Bacteria | 673 |
| 273 | Ga0207678_10058238 | 3300026067 | Bacteria | 3324 |
| 274 | Ga0207675_100404760 | 3300026118 | Bacteria | 1345 |
| 275 | Ga0207683_10177284 | 3300026121 | Bacteria | 1932 |
| 276 | Ga0209371_1001249 | 3300027312 | Bacteria | 18174 |
| 277 | Ga0209179_1005563 | 3300027512 | Bacteria | 1980 |
| 278 | Ga0209813_10014272 | 3300027866 | Bacteria | 2137 |
| 279 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 280 | Ga0268266_10025861 | 3300028379 | Bacteria | 4994 |
| 281 | Ga0268266_10446129 | 3300028379 | Bacteria | 1229 |
| 282 | Ga0268266_10763304 | 3300028379 | Bacteria | 934 |
| 283 | Ga0268266_10823368 | 3300028379 | Bacteria | 897 |
| 284 | Ga0265318_10189588 | 3300028577 | Bacteria | 752 |
| 285 | Ga0307515_10000070 | 3300028794 | Bacteria | 239322 |
| 286 | Ga0307515_10003909 | 3300028794 | Bacteria | 31077 |
| 287 | Ga0307515_10267812 | 3300028794 | Bacteria | 1434 |
| 288 | Ga0307515_10586595 | 3300028794 | Bacteria | 725 |
| 289 | Ga0268256_1000660 | 3300030500 | Bacteria | 26255 |
| 290 | Ga0265330_10010747 | 3300031235 | Bacteria | 4307 |
| 291 | Ga0265320_10033467 | 3300031240 | Bacteria | 2623 |
| 292 | Ga0265325_10000030 | 3300031241 | Bacteria | 103532 |
| 293 | Ga0265340_10016838 | 3300031247 | Bacteria | 3781 |
| 294 | Ga0265339_10009125 | 3300031249 | Bacteria | 6263 |
| 295 | Ga0265339_10283907 | 3300031249 | Bacteria | 793 |
| 296 | Ga0265331_10027092 | 3300031250 | Bacteria | 2876 |
| 297 | Ga0265316_10051098 | 3300031344 | Bacteria | 3248 |
| 298 | Ga0307513_10005256 | 3300031456 | Bacteria | 17150 |
| 299 | Ga0307513_10006330 | 3300031456 | Bacteria | 15498 |
| 300 | Ga0265313_10015602 | 3300031595 | Bacteria | 4411 |
| 301 | Ga0265314_10014456 | 3300031711 | Bacteria | 6315 |
| 302 | Ga0265314_10040213 | 3300031711 | Bacteria | 3358 |
| 303 | Ga0265342_10024159 | 3300031712 | Bacteria | 3838 |
| 304 | Ga0307516_10306592 | 3300031730 | Bacteria | 1262 |
| 305 | Ga0307405_10001577 | 3300031731 | Bacteria | 9669 |
| 306 | Ga0316577_10349912 | 3300031733 | Bacteria | 839 |
| 307 | Ga0307413_11086396 | 3300031824 | Bacteria | 690 |
| 308 | Ga0307410_10108694 | 3300031852 | Bacteria | 2003 |
| 309 | Ga0307412_10000728 | 3300031911 | Bacteria | 18975 |
| 310 | Ga0307412_10278721 | 3300031911 | Bacteria | 1312 |
| 311 | Ga0307416_100957728 | 3300032002 | Bacteria | 958 |
| 312 | Ga0307414_10391314 | 3300032004 | Bacteria | 1205 |
| 313 | Ga0307414_10582248 | 3300032004 | Bacteria | 1001 |
| 314 | Ga0307510_10456960 | 3300033180 | Bacteria | 718 |
| 315 | Ga0373948_0018441 | 3300034817 | Bacteria | 1310 |
| 316 | Ga0373959_0182204 | 3300034820 | Bacteria | 546 |
| 317 | Ga0373938_0033350 | 3300034957 | Bacteria | 1113 |
| 318 | Ga0373944_0000529 | 3300035089 | Bacteria | 8958 |
| 319 | Ga0373944_0058964 | 3300035089 | Unclassified | 1227 |
| 320 | Ga0373923_0003265 | 3300035111 | Bacteria | 5169 |
| 321 | Ga0373923_0035541 | 3300035111 | Bacteria | 2029 |
| 322 | Ga0373932_0049998 | 3300035112 | Bacteria | 1237 |
| 323 | Ga0373936_0012172 | 3300035113 | Bacteria | 3268 |
| 324 | Ga0373936_0050391 | 3300035113 | Bacteria | 1684 |
| 325 | Ga0373945_0007229 | 3300035116 | Bacteria | 3593 |
| 326 | Ga0373953_0018712 | 3300035117 | Bacteria | 2567 |
| 327 | Ga0373954_0136734 | 3300035118 | Bacteria | 1194 |
| 328 | Ga0373956_0020733 | 3300035119 | Bacteria | 2800 |
| 329 | Ga0373956_0073404 | 3300035119 | Unclassified | 1563 |
| 330 | Ga0373943_0011141 | 3300035170 | Bacteria | 4041 |
| 331 | Ga0373943_0036951 | 3300035170 | Bacteria | 2342 |
| 332 | Ga0373946_0004260 | 3300035171 | Bacteria | 5112 |
| 333 | Ga0373955_0003253 | 3300035172 | Bacteria | 7119 |
| 334 | Ga0373955_0007509 | 3300035172 | Bacteria | 5014 |
| 335 | Ga0373961_0040947 | 3300035241 | Bacteria | 1337 |
| 336 | Ga0373962_0212680 | 3300035242 | Bacteria | 658 |
| 337 | Ga0373924_0012335 | 3300035410 | Bacteria | 3191 |
| 338 | Ga0373931_0012369 | 3300035691 | Bacteria | 4134 |
| 339 | Ga0373935_0009847 | 3300035692 | Bacteria | 5723 |
| 340 | Ga0373935_0029599 | 3300035692 | Bacteria | 3389 |
| 341 | Ga0373927_0000423 | 3300035695 | Bacteria | 32523 |
| 342 | Ga0373927_0120840 | 3300035695 | Bacteria | 1709 |
| 343 | Ga0373933_0016565 | 3300035724 | Bacteria | 4124 |
| 344 | Ga0373933_0307132 | 3300035724 | Unclassified | 1027 |
| 345 | Ga0373947_0999520 | 3300035725 | Bacteria | 571 |
| 346 | Ga0373937_0004072 | 3300036401 | Bacteria | 12397 |
| 347 | Ga0373937_0077705 | 3300036401 | Bacteria | 3067 |
| 348 | Ga0316582_0282134 | 3300036647 | Bacteria | 1140 |
| 349 | Ga0316584_0214959 | 3300036712 | Bacteria | 1414 |
| 350 | Ga0373925_0004073 | 3300037068 | Bacteria | 11101 |
| 351 | Ga0373925_0037474 | 3300037068 | Bacteria | 3580 |
| 352 | Ga0373925_0972714 | 3300037068 | Bacteria | 699 |
| 353 | Ga0395905_0070011 | 3300037471 | Bacteria | 3286 |
| 354 | Ga0395905_0171747 | 3300037471 | Bacteria | 2036 |
| 355 | Ga0395905_0253353 | 3300037471 | Bacteria | 1644 |
| 356 | Ga0436364_0004734 | 3300037853 | Bacteria | 1483 |
| 357 | Ga0395901_1033950 | 3300038443 | Bacteria | 795 |
| 358 | Ga0242420_047025 | 3300038996 | Bacteria | 836 |
| 359 | Ga0436365_0747759 | 3300039437 | Bacteria | 9382 |
| 360 | Ga0436365_1182852 | 3300039437 | Bacteria | 33948 |
| 361 | Ga0436363_0613257 | 3300039450 | Bacteria | 1028 |
| 362 | Ga0436363_0671159 | 3300039450 | Bacteria | 3270 |
| 363 | Ga0436362_1228876 | 3300039453 | Bacteria | 6133 |
| 364 | Ga0439466_0046568 | 3300041411 | Bacteria | 1432 |
| 365 | Ga0439466_0080570 | 3300041411 | Bacteria | 1027 |
| 366 | Ga0439465_0006038 | 3300041413 | Bacteria | 3851 |
| 367 | Ga0439465_0044117 | 3300041413 | Bacteria | 1448 |
| 368 | Ga0439465_0222994 | 3300041413 | Bacteria | 692 |
| 369 | Ga0439465_0384304 | 3300041413 | Bacteria | 533 |
| 370 | Ga0451791_1486979 | 3300041451 | Bacteria | 1674 |
| 371 | Ga0451798_0628856 | 3300041458 | Bacteria | 1466 |
| 372 | Ga0451807_0188350 | 3300041486 | Bacteria | 1075 |
| 373 | Ga0451835_0004513 | 3300041492 | Bacteria | 3521 |
| 374 | Ga0451839_1200455 | 3300041496 | Bacteria | 3440 |
| 375 | Ga0451841_0820092 | 3300041498 | Bacteria | 989 |
| 376 | Ga0451847_0585144 | 3300041503 | Bacteria | 3750 |
| 377 | Ga0451851_0586227 | 3300041507 | Bacteria | 4095 |
| 378 | Ga0451851_1332789 | 3300041507 | Bacteria | 855 |
| 379 | Ga0451855_0014339 | 3300041511 | Bacteria | 1200 |
| 380 | Ga0451853_1077003 | 3300041512 | Bacteria | 2478 |
| 381 | Ga0451853_3777698 | 3300041512 | Bacteria | 852 |
| 382 | Ga0439432_009466 | 3300042006 | Bacteria | 3397 |
| 383 | Ga0439432_223602 | 3300042006 | Bacteria | 543 |
| 384 | Ga0439449_0001047 | 3300042007 | Bacteria | 10900 |
| 385 | Ga0439440_0108126 | 3300042993 | Bacteria | 763 |
| 386 | Ga0466965_0132840 | 3300044683 | Bacteria | 1292 |
| 387 | Ga0466963_0020949 | 3300044694 | Bacteria | 4119 |
| 388 | Ga0466968_0101681 | 3300044735 | Bacteria | 1284 |
| 389 | Ga0466970_0107199 | 3300044765 | Bacteria | 1524 |
| 390 | Ga0466970_0590770 | 3300044765 | Bacteria | 644 |
| 391 | Ga0466957_0092513 | 3300044842 | Bacteria | 1897 |
| 392 | Ga0466959_0307358 | 3300045049 | Bacteria | 1085 |
| 393 | Ga0466958_0033441 | 3300045836 | Bacteria | 3063 |
| 394 | Ga0495617_021608 | 3300046452 | Bacteria | 2173 |
| 395 | Ga0495592_0004354 | 3300046454 | Bacteria | 10357 |
| 396 | Ga0495592_0013017 | 3300046454 | Bacteria | 6329 |
| 397 | Ga0495603_0054603 | 3300046455 | Bacteria | 2367 |
| 398 | Ga0495629_0015781 | 3300046459 | Bacteria | 5424 |
| 399 | Ga0495629_0026890 | 3300046459 | Bacteria | 4086 |
| 400 | Ga0495638_0016460 | 3300046460 | Bacteria | 4953 |
| 401 | Ga0495638_0046065 | 3300046460 | Bacteria | 2741 |
| 402 | Ga0495638_0310741 | 3300046460 | Bacteria | 846 |
| 403 | Ga0495641_0017376 | 3300046461 | Bacteria | 3750 |
| 404 | Ga0495651_0013614 | 3300046462 | Bacteria | 6288 |
| 405 | Ga0495653_0275834 | 3300046463 | Bacteria | 1105 |
| 406 | Ga0495653_0664333 | 3300046463 | Unclassified | 635 |
| 407 | Ga0495580_0006887 | 3300046472 | Bacteria | 9181 |
| 408 | Ga0495582_0028805 | 3300046473 | Bacteria | 3048 |
| 409 | Ga0495639_0049882 | 3300046475 | Bacteria | 1900 |
| 410 | Ga0495662_0031142 | 3300046476 | Bacteria | 2576 |
| 411 | Ga0495662_0165504 | 3300046476 | Bacteria | 1089 |
| 412 | Ga0495664_0007402 | 3300046477 | Bacteria | 6096 |
| 413 | Ga0495664_0151452 | 3300046477 | Bacteria | 1407 |
| 414 | Ga0495664_0183156 | 3300046477 | Bacteria | 1270 |
| 415 | Ga0495585_0003052 | 3300046492 | Bacteria | 11521 |
| 416 | Ga0495585_0031255 | 3300046492 | Bacteria | 3023 |
| 417 | Ga0495594_0012401 | 3300046499 | Bacteria | 4439 |
| 418 | Ga0495607_0010403 | 3300046501 | Bacteria | 6256 |
| 419 | Ga0495607_0273420 | 3300046501 | Bacteria | 804 |
| 420 | Ga0495583_0038523 | 3300046506 | Bacteria | 2258 |
| 421 | Ga0495606_0010031 | 3300046507 | Bacteria | 7916 |
| 422 | Ga0495606_0039845 | 3300046507 | Bacteria | 3160 |
| 423 | Ga0495606_0088887 | 3300046507 | Bacteria | 1904 |
| 424 | Ga0495606_0184012 | 3300046507 | Bacteria | 1202 |
| 425 | Ga0495606_0425488 | 3300046507 | Bacteria | 686 |
| 426 | Ga0495608_0024299 | 3300046511 | Bacteria | 4146 |
| 427 | Ga0495610_0006212 | 3300046512 | Bacteria | 8290 |
| 428 | Ga0495610_0063217 | 3300046512 | Bacteria | 1754 |
| 429 | Ga0495618_0210941 | 3300046514 | Bacteria | 1227 |
| 430 | Ga0495620_0215919 | 3300046515 | Bacteria | 735 |
| 431 | Ga0495628_0004416 | 3300046516 | Bacteria | 12472 |
| 432 | Ga0495628_0064395 | 3300046516 | Bacteria | 2870 |
| 433 | Ga0495631_0266792 | 3300046518 | Bacteria | 729 |
| 434 | Ga0495632_0023614 | 3300046519 | Bacteria | 3281 |
| 435 | Ga0495643_0037538 | 3300046522 | Bacteria | 2656 |
| 436 | Ga0495643_0099346 | 3300046522 | Bacteria | 1493 |
| 437 | Ga0495643_0120084 | 3300046522 | Bacteria | 1328 |
| 438 | Ga0495644_0000312 | 3300046523 | Bacteria | 22452 |
| 439 | Ga0495648_0172602 | 3300046524 | Bacteria | 1107 |
| 440 | Ga0495663_0124739 | 3300046525 | Bacteria | 865 |
| 441 | Ga0495666_0009011 | 3300046526 | Bacteria | 4990 |
| 442 | Ga0495652_0019039 | 3300046529 | Bacteria | 6115 |
| 443 | Ga0495652_0077529 | 3300046529 | Bacteria | 2754 |
| 444 | Ga0495665_0008576 | 3300046531 | Bacteria | 5546 |
| 445 | Ga0495640_0051842 | 3300046533 | Bacteria | 2818 |
| 446 | Ga0495640_0129488 | 3300046533 | Unclassified | 1634 |
| 447 | Ga0495586_0029905 | 3300046535 | Bacteria | 2916 |
| 448 | Ga0495587_0124187 | 3300046536 | Bacteria | 1477 |
| 449 | Ga0495598_0004060 | 3300046537 | Bacteria | 3147 |
| 450 | Ga0495609_0154328 | 3300046538 | Bacteria | 976 |
| 451 | Ga0495609_0219341 | 3300046538 | Bacteria | 790 |
| 452 | Ga0495645_0001254 | 3300046543 | Bacteria | 17310 |
| 453 | Ga0495645_0021226 | 3300046543 | Bacteria | 4693 |
| 454 | Ga0495622_0106271 | 3300046557 | Bacteria | 1286 |
| 455 | Ga0495622_0140544 | 3300046557 | Bacteria | 1096 |
| 456 | Ga0495633_0001295 | 3300046558 | Bacteria | 19775 |
| 457 | Ga0495633_0035017 | 3300046558 | Bacteria | 2412 |
| 458 | Ga0495667_0002953 | 3300046559 | Bacteria | 11410 |
| 459 | Ga0495667_0010839 | 3300046559 | Bacteria | 6163 |
| 460 | Ga0495611_0013926 | 3300046648 | Bacteria | 3431 |
| 461 | Ga0495625_0067416 | 3300046660 | Bacteria | 2518 |
| 462 | Ga0495625_0229256 | 3300046660 | Bacteria | 1214 |
| 463 | Ga0495625_0399071 | 3300046660 | Bacteria | 859 |
| 464 | Ga0495635_0011422 | 3300046663 | Bacteria | 6229 |
| 465 | Ga0495635_0582818 | 3300046663 | Bacteria | 731 |
| 466 | Ga0495661_0204431 | 3300046665 | Bacteria | 1032 |
| 467 | Ga0495588_0020199 | 3300046674 | Bacteria | 3270 |
| 468 | Ga0495588_0048206 | 3300046674 | Bacteria | 2188 |
| 469 | Ga0495657_0072858 | 3300046675 | Bacteria | 2239 |
| 470 | Ga0495657_0096886 | 3300046675 | Bacteria | 1884 |
| 471 | Ga0495657_0303578 | 3300046675 | Bacteria | 952 |
| 472 | Ga0495599_0028256 | 3300046678 | Bacteria | 3515 |
| 473 | Ga0495599_0045818 | 3300046678 | Bacteria | 2742 |
| 474 | Ga0495623_0001432 | 3300046679 | Bacteria | 16175 |
| 475 | Ga0495623_0257965 | 3300046679 | Bacteria | 978 |
| 476 | Ga0495646_0022616 | 3300046680 | Bacteria | 3964 |
| 477 | Ga0495646_0055996 | 3300046680 | Bacteria | 2365 |
| 478 | Ga0495658_0031443 | 3300046683 | Bacteria | 2891 |
| 479 | Ga0495613_0205294 | 3300046689 | Bacteria | 1387 |
| 480 | Ga0495624_0016426 | 3300046690 | Bacteria | 4982 |
| 481 | Ga0495624_0185559 | 3300046690 | Bacteria | 1266 |
| 482 | Ga0495624_0250687 | 3300046690 | Unclassified | 1071 |
| 483 | Ga0495671_0267601 | 3300046692 | Bacteria | 824 |
| 484 | Ga0495649_0033921 | 3300046694 | Bacteria | 2809 |
| 485 | Ga0495589_0108077 | 3300046794 | Bacteria | 1344 |
| 486 | Ga0495589_0115222 | 3300046794 | Bacteria | 1296 |
| 487 | Ga0495600_0016229 | 3300046809 | Bacteria | 4722 |
| 488 | Ga0495600_0017641 | 3300046809 | Bacteria | 4542 |
| 489 | Ga0495600_0123827 | 3300046809 | Bacteria | 1681 |
| 490 | Ga0495581_0003328 | 3300047315 | Bacteria | 9232 |
| 491 | Ga0495604_0026381 | 3300047317 | Bacteria | 4625 |
| 492 | Ga0495604_0028877 | 3300047317 | Bacteria | 4413 |
| 493 | Ga0495604_0068329 | 3300047317 | Bacteria | 2697 |
| 494 | Ga0495604_0609226 | 3300047317 | Bacteria | 699 |
| 495 | Ga0495674_0168369 | 3300047319 | Bacteria | 1829 |
| 496 | Ga0495676_0122884 | 3300047321 | Bacteria | 1885 |
| 497 | Ga0495680_0005660 | 3300047322 | Bacteria | 11705 |
| 498 | Ga0495680_0011455 | 3300047322 | Bacteria | 7851 |
| 499 | Ga0495687_095090 | 3300047443 | Bacteria | 1131 |
| 500 | Ga0495675_0138086 | 3300047444 | Unclassified | 1512 |
| 501 | Ga0495675_0228898 | 3300047444 | Bacteria | 1122 |
| 502 | Ga0495679_021031 | 3300047446 | Bacteria | 2263 |
| 503 | Ga0495681_0080705 | 3300047470 | Bacteria | 1453 |
| 504 | Ga0495684_0005490 | 3300047471 | Bacteria | 9867 |
| 505 | Ga0495684_0977660 | 3300047471 | Unclassified | 539 |
| 506 | Ga0495686_0002844 | 3300047472 | Bacteria | 15625 |
| 507 | Ga0495686_0011672 | 3300047472 | Bacteria | 6185 |
| 508 | Ga0495686_0028624 | 3300047472 | Bacteria | 3628 |
| 509 | Ga0495686_0127810 | 3300047472 | Bacteria | 1510 |
| 510 | Ga0495686_0481227 | 3300047472 | Bacteria | 656 |
| 511 | Ga0495686_0549215 | 3300047472 | Bacteria | 603 |
| 512 | Ga0495593_0026639 | 3300047673 | Bacteria | 3190 |
| 513 | Ga0495602_0016985 | 3300048088 | Bacteria | 7301 |
| 514 | Ga0495602_0358943 | 3300048088 | Bacteria | 1050 |
| 515 | Ga0495626_0025458 | 3300048091 | Bacteria | 2894 |
| 516 | Ga0496101_0421716 | 3300048904 | Bacteria | 1052 |
| 517 | Ga0496103_0043920 | 3300048906 | Bacteria | 2752 |
| 518 | Ga0496104_0000065 | 3300048907 | Bacteria | 108770 |
| 519 | Ga0496105_0002520 | 3300048908 | Bacteria | 13285 |
| 520 | Ga0496105_0555077 | 3300048908 | Bacteria | 896 |
| 521 | Ga0496106_0016430 | 3300048909 | Bacteria | 5476 |
| 522 | Ga0496106_0231570 | 3300048909 | Bacteria | 1475 |
| 523 | Ga0496107_0358993 | 3300048910 | Bacteria | 1084 |
| 524 | Ga0496107_0560046 | 3300048910 | Bacteria | 846 |
| 525 | Ga0496108_0899354 | 3300048911 | Bacteria | 760 |
| 526 | Ga0496110_0549658 | 3300048913 | Bacteria | 1049 |
| 527 | Ga0496110_1366227 | 3300048913 | Bacteria | 618 |
| 528 | Ga0496111_0002285 | 3300048914 | Bacteria | 11511 |
| 529 | Ga0496111_1229960 | 3300048914 | Bacteria | 530 |
| 530 | Ga0496113_0067946 | 3300048916 | Bacteria | 2704 |
| 531 | Ga0496114_0130392 | 3300048917 | Bacteria | 2170 |
| 532 | Ga0496115_0022968 | 3300048918 | Bacteria | 4837 |
| 533 | Ga0496115_0091630 | 3300048918 | Bacteria | 2484 |
| 534 | Ga0496116_0002669 | 3300048919 | Bacteria | 18458 |
| 535 | Ga0496116_0002740 | 3300048919 | Bacteria | 18103 |
| 536 | Ga0496116_0042204 | 3300048919 | Bacteria | 3121 |
| 537 | Ga0496116_0047842 | 3300048919 | Bacteria | 2875 |
| 538 | Ga0496116_0061983 | 3300048919 | Bacteria | 2417 |
| 539 | Ga0496116_0076480 | 3300048919 | Bacteria | 2096 |
| 540 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 541 | Ga0496117_0011444 | 3300048920 | Bacteria | 7948 |
| 542 | Ga0496117_0024779 | 3300048920 | Bacteria | 4732 |
| 543 | Ga0496117_0078547 | 3300048920 | Bacteria | 2178 |
| 544 | Ga0496117_0080253 | 3300048920 | Bacteria | 2146 |
| 545 | Ga0496118_0000214 | 3300048921 | Bacteria | 100898 |
| 546 | Ga0496118_0010030 | 3300048921 | Bacteria | 9443 |
| 547 | Ga0496118_0154472 | 3300048921 | Bacteria | 1430 |
| 548 | Ga0496118_0156127 | 3300048921 | Bacteria | 1419 |
| 549 | Ga0496118_0184052 | 3300048921 | Bacteria | 1258 |
| 550 | Ga0496119_0036191 | 3300048922 | Bacteria | 3225 |
| 551 | Ga0496119_0039161 | 3300048922 | Bacteria | 3049 |
| 552 | Ga0496119_0042057 | 3300048922 | Bacteria | 2901 |
| 553 | Ga0496119_0064344 | 3300048922 | Bacteria | 2178 |
| 554 | Ga0496119_0212972 | 3300048922 | Bacteria | 993 |
| 555 | Ga0496120_0000125 | 3300048923 | Bacteria | 128983 |
| 556 | Ga0496120_0117948 | 3300048923 | Bacteria | 1376 |
| 557 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 558 | Ga0496121_0001948 | 3300048924 | Bacteria | 32895 |
| 559 | Ga0496121_0018097 | 3300048924 | Bacteria | 7128 |
| 560 | Ga0496121_0033723 | 3300048924 | Bacteria | 4627 |
| 561 | Ga0496121_0045342 | 3300048924 | Bacteria | 3779 |
| 562 | Ga0496121_0058860 | 3300048924 | Bacteria | 3172 |
| 563 | Ga0496121_0065852 | 3300048924 | Bacteria | 2945 |
| 564 | Ga0496121_0123848 | 3300048924 | Bacteria | 1947 |
| 565 | Ga0496121_0203937 | 3300048924 | Bacteria | 1407 |
| 566 | Ga0496121_0257917 | 3300048924 | Bacteria | 1205 |
| 567 | Ga0496121_0262482 | 3300048924 | Bacteria | 1191 |
| 568 | Ga0496121_0265597 | 3300048924 | Bacteria | 1182 |
| 569 | Ga0496121_0619162 | 3300048924 | Bacteria | 665 |
| 570 | Ga0496121_0636799 | 3300048924 | Bacteria | 652 |
| 571 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 572 | Ga0496122_0000160 | 3300048925 | Bacteria | 159236 |
| 573 | Ga0496122_0023327 | 3300048925 | Bacteria | 5460 |
| 574 | Ga0496122_0031570 | 3300048925 | Bacteria | 4405 |
| 575 | Ga0496122_0048526 | 3300048925 | Bacteria | 3262 |
| 576 | Ga0496122_0049230 | 3300048925 | Bacteria | 3230 |
| 577 | Ga0496122_0050641 | 3300048925 | Bacteria | 3165 |
| 578 | Ga0496122_0053638 | 3300048925 | Bacteria | 3037 |
| 579 | Ga0496122_0078819 | 3300048925 | Bacteria | 2305 |
| 580 | Ga0496122_0092237 | 3300048925 | Bacteria | 2059 |
| 581 | Ga0496122_0397960 | 3300048925 | Bacteria | 700 |
| 582 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 583 | Ga0496123_0000034 | 3300048926 | Bacteria | 274836 |
| 584 | Ga0496123_0007779 | 3300048926 | Bacteria | 9986 |
| 585 | Ga0496123_0011987 | 3300048926 | Bacteria | 7438 |
| 586 | Ga0496123_0019336 | 3300048926 | Bacteria | 5373 |
| 587 | Ga0496123_0035527 | 3300048926 | Bacteria | 3549 |
| 588 | Ga0496123_0045367 | 3300048926 | Bacteria | 2995 |
| 589 | Ga0496123_0050675 | 3300048926 | Bacteria | 2771 |
| 590 | Ga0496123_0052247 | 3300048926 | Bacteria | 2714 |
| 591 | Ga0496123_0074486 | 3300048926 | Bacteria | 2101 |
| 592 | Ga0496123_0115970 | 3300048926 | Bacteria | 1518 |
| 593 | Ga0496123_0124906 | 3300048926 | Bacteria | 1438 |
| 594 | Ga0496123_0128494 | 3300048926 | Bacteria | 1409 |
| 595 | Ga0496124_0000349 | 3300048927 | Bacteria | 84498 |
| 596 | Ga0496124_0015423 | 3300048927 | Bacteria | 7324 |
| 597 | Ga0496124_0043901 | 3300048927 | Bacteria | 3839 |
| 598 | Ga0496124_0054556 | 3300048927 | Bacteria | 3382 |
| 599 | Ga0496124_0071748 | 3300048927 | Bacteria | 2869 |
| 600 | Ga0496124_0076226 | 3300048927 | Bacteria | 2769 |
| 601 | Ga0496124_0105943 | 3300048927 | Bacteria | 2270 |
| 602 | Ga0496124_0109569 | 3300048927 | Bacteria | 2225 |
| 603 | Ga0496124_0140818 | 3300048927 | Bacteria | 1903 |
| 604 | Ga0496124_0169581 | 3300048927 | Bacteria | 1692 |
| 605 | Ga0496124_0208982 | 3300048927 | Bacteria | 1478 |
| 606 | Ga0496124_0210530 | 3300048927 | Bacteria | 1471 |
| 607 | Ga0496124_0594332 | 3300048927 | Bacteria | 721 |
| 608 | Ga0496124_0680278 | 3300048927 | Bacteria | 655 |
| 609 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 610 | Ga0496125_0004855 | 3300048928 | Bacteria | 15262 |
| 611 | Ga0496125_0039868 | 3300048928 | Bacteria | 4037 |
| 612 | Ga0496125_0053493 | 3300048928 | Bacteria | 3308 |
| 613 | Ga0496125_0069516 | 3300048928 | Bacteria | 2763 |
| 614 | Ga0496125_0083675 | 3300048928 | Bacteria | 2426 |
| 615 | Ga0496125_0167661 | 3300048928 | Bacteria | 1481 |
| 616 | Ga0496125_0332290 | 3300048928 | Bacteria | 916 |
| 617 | Ga0496125_0422569 | 3300048928 | Bacteria | 772 |
| 618 | Ga0496125_0468510 | 3300048928 | Bacteria | 717 |
| 619 | Ga0496126_0000069 | 3300048929 | Bacteria | 246935 |
| 620 | Ga0496126_0084495 | 3300048929 | Bacteria | 2799 |
| 621 | Ga0496126_0099712 | 3300048929 | Bacteria | 2543 |
| 622 | Ga0496126_0108899 | 3300048929 | Bacteria | 2415 |
| 623 | Ga0496126_0122274 | 3300048929 | Bacteria | 2256 |
| 624 | Ga0496126_0123340 | 3300048929 | Bacteria | 2244 |
| 625 | Ga0496126_0151182 | 3300048929 | Bacteria | 1990 |
| 626 | Ga0496126_0167746 | 3300048929 | Bacteria | 1872 |
| 627 | Ga0496126_0205952 | 3300048929 | Bacteria | 1658 |
| 628 | Ga0496126_0335600 | 3300048929 | Bacteria | 1239 |
| 629 | Ga0496126_0341959 | 3300048929 | Bacteria | 1225 |
| 630 | Ga0496126_0502536 | 3300048929 | Bacteria | 969 |
| 631 | Ga0496126_0709665 | 3300048929 | Bacteria | 780 |
| 632 | Ga0495678_013134 | 3300049459 | Bacteria | 3899 |
| 633 | Ga0501031_0258179 | 3300049568 | Bacteria | 1132 |
| 634 | Ga0501032_0317906 | 3300049569 | Bacteria | 1005 |
| 635 | Ga0501032_1035752 | 3300049569 | Bacteria | 515 |
| 636 | Ga0501033_0001969 | 3300049570 | Bacteria | 17888 |
| 637 | Ga0501033_0002091 | 3300049570 | Bacteria | 17309 |
| 638 | Ga0501033_0026545 | 3300049570 | Bacteria | 4359 |
| 639 | Ga0501033_0228181 | 3300049570 | Bacteria | 1324 |
| 640 | Ga0501033_0408738 | 3300049570 | Bacteria | 946 |
| 641 | Ga0501034_0118094 | 3300049571 | Bacteria | 2640 |
| 642 | Ga0501034_0285789 | 3300049571 | Bacteria | 1588 |
| 643 | Ga0501034_0389914 | 3300049571 | Bacteria | 1317 |
| 644 | Ga0501036_0110480 | 3300049572 | Bacteria | 2323 |
| 645 | Ga0501036_0843996 | 3300049572 | Bacteria | 753 |
| 646 | Ga0501036_0949517 | 3300049572 | Bacteria | 705 |
| 647 | Ga0501036_1008746 | 3300049572 | Bacteria | 681 |
| 648 | Ga0501037_0248906 | 3300049573 | Bacteria | 1244 |
| 649 | Ga0501038_0028485 | 3300049574 | Bacteria | 4963 |
| 650 | Ga0501038_0164765 | 3300049574 | Bacteria | 1799 |
| 651 | Ga0501038_0221631 | 3300049574 | Bacteria | 1509 |
| 652 | Ga0501038_0556034 | 3300049574 | Bacteria | 872 |
| 653 | Ga0501038_0772873 | 3300049574 | Bacteria | 715 |
| 654 | Ga0501038_0785534 | 3300049574 | Bacteria | 708 |
| 655 | Ga0501038_0852636 | 3300049574 | Bacteria | 675 |
| 656 | Ga0501039_0189852 | 3300049575 | Bacteria | 1616 |
| 657 | Ga0501040_0134996 | 3300049576 | Bacteria | 1737 |
| 658 | Ga0501041_0080393 | 3300049577 | Bacteria | 2007 |
| 659 | Ga0501041_0217892 | 3300049577 | Bacteria | 1198 |
| 660 | Ga0501042_0178616 | 3300049578 | Bacteria | 1531 |
| 661 | Ga0501042_0548906 | 3300049578 | Bacteria | 840 |
| 662 | Ga0501043_0311036 | 3300049579 | Bacteria | 1202 |
| 663 | Ga0501043_0316072 | 3300049579 | Bacteria | 1191 |
| 664 | Ga0501046_0110885 | 3300049580 | Bacteria | 2096 |
| 665 | Ga0501046_0180697 | 3300049580 | Bacteria | 1578 |
| 666 | Ga0501047_0037480 | 3300049581 | Bacteria | 4688 |
| 667 | Ga0501047_0057902 | 3300049581 | Bacteria | 3746 |
| 668 | Ga0501047_0135061 | 3300049581 | Bacteria | 2347 |
| 669 | Ga0501047_0538013 | 3300049581 | Bacteria | 993 |
| 670 | Ga0501048_0152009 | 3300049582 | Bacteria | 1638 |
| 671 | Ga0501068_0118313 | 3300049584 | Bacteria | 1651 |
| 672 | Ga0501068_0243769 | 3300049584 | Bacteria | 1144 |
| 673 | Ga0501069_0287303 | 3300049585 | Bacteria | 963 |
| 674 | Ga0501069_0405145 | 3300049585 | Bacteria | 807 |
| 675 | Ga0501070_0000931 | 3300049586 | Bacteria | 26365 |
| 676 | Ga0501071_0129028 | 3300049587 | Bacteria | 1878 |
| 677 | Ga0501072_0069722 | 3300049588 | Bacteria | 2776 |
| 678 | Ga0501073_0092940 | 3300049589 | Bacteria | 2096 |
| 679 | Ga0501073_0431891 | 3300049589 | Bacteria | 910 |
| 680 | Ga0501073_0468436 | 3300049589 | Bacteria | 871 |
| 681 | Ga0501075_0023581 | 3300049591 | Bacteria | 4507 |
| 682 | Ga0501075_0028748 | 3300049591 | Bacteria | 4106 |
| 683 | Ga0501075_0092368 | 3300049591 | Bacteria | 2297 |
| 684 | Ga0501075_0182805 | 3300049591 | Bacteria | 1599 |
| 685 | Ga0501076_0058305 | 3300049592 | Bacteria | 3069 |
| 686 | Ga0501076_0140447 | 3300049592 | Bacteria | 1962 |
| 687 | Ga0501076_0145684 | 3300049592 | Bacteria | 1926 |
| 688 | Ga0501077_0145195 | 3300049593 | Bacteria | 1505 |
| 689 | Ga0501079_0131347 | 3300049741 | Bacteria | 1949 |
| 690 | Ga0501079_1136870 | 3300049741 | Bacteria | 615 |
| 691 | Ga0501080_0001450 | 3300049742 | Bacteria | 19946 |
| 692 | Ga0501080_0466425 | 3300049742 | Bacteria | 1131 |
| 693 | Ga0501080_0629858 | 3300049742 | Bacteria | 950 |
| 694 | Ga0501080_0854079 | 3300049742 | Bacteria | 796 |
| 695 | Ga0501081_0060560 | 3300049743 | Bacteria | 2623 |
| 696 | Ga0501081_0306285 | 3300049743 | Bacteria | 1166 |
| 697 | Ga0501081_1519851 | 3300049743 | Bacteria | 509 |
| 698 | Ga0501083_0041595 | 3300049744 | Bacteria | 3116 |
| 699 | Ga0501083_0404206 | 3300049744 | Bacteria | 888 |
| 700 | Ga0501083_0453250 | 3300049744 | Bacteria | 835 |
| 701 | Ga0501035_0000690 | 3300049822 | Bacteria | 36838 |
| 702 | Ga0501035_0000752 | 3300049822 | Bacteria | 34903 |
| 703 | Ga0501035_0003184 | 3300049822 | Bacteria | 15735 |
| 704 | Ga0501035_0012136 | 3300049822 | Bacteria | 7968 |
| 705 | Ga0501044_0002922 | 3300049823 | Bacteria | 19435 |
| 706 | Ga0501044_0021665 | 3300049823 | Bacteria | 6852 |
| 707 | Ga0501044_0098827 | 3300049823 | Bacteria | 2938 |
| 708 | Ga0501044_0131509 | 3300049823 | Bacteria | 2496 |
| 709 | Ga0501045_0048465 | 3300049824 | Bacteria | 3097 |
| 710 | nmdc:mga03683_46187_c1 | 3300050489 | Bacteria | 1805 |
| 711 | nmdc:mga03n38_169285_c1 | 3300050490 | Bacteria | 1112 |
| 712 | nmdc:mga00v17_107251_c1 | 3300050491 | Bacteria | 1769 |
| 713 | nmdc:mga00v17_115_c2 | 3300050491 | Bacteria | 47780 |
| 714 | nmdc:mga00v17_1990_c1 | 3300050491 | Bacteria | 10551 |
| 715 | nmdc:mga00v17_221916_c1 | 3300050491 | Bacteria | 1224 |
| 716 | nmdc:mga00v17_300630_c1 | 3300050491 | Bacteria | 1042 |
| 717 | nmdc:mga00v17_458236_c1 | 3300050491 | Bacteria | 828 |
| 718 | nmdc:mga00v17_651025_c1 | 3300050491 | Bacteria | 677 |
| 719 | nmdc:mga0yw44_1016101_c1 | 3300050492 | Bacteria | 561 |
| 720 | nmdc:mga0yw44_30251_c1 | 3300050492 | Bacteria | 3135 |
| 721 | nmdc:mga0yw44_3065_c1 | 3300050492 | Bacteria | 7319 |
| 722 | nmdc:mga0yw44_332942_c1 | 3300050492 | Bacteria | 1020 |
| 723 | nmdc:mga0yw44_37408_c1 | 3300050492 | Bacteria | 2865 |
| 724 | nmdc:mga0yw44_404194_c1 | 3300050492 | Bacteria | 923 |
| 725 | nmdc:mga0k408_122389_c1 | 3300050493 | Bacteria | 1541 |
| 726 | nmdc:mga0k408_25230_c1 | 3300050493 | Bacteria | 3366 |
| 727 | nmdc:mga06z11_145556_c1 | 3300050494 | Bacteria | 1343 |
| 728 | nmdc:mga06z11_222987_c1 | 3300050494 | Bacteria | 1102 |
| 729 | nmdc:mga04h51_2806_c1 | 3300050495 | Bacteria | 4163 |
| 730 | nmdc:mga04h51_94977_c1 | 3300050495 | Bacteria | 1078 |
| 731 | nmdc:mga05p37_717116_c1 | 3300050507 | Bacteria | 1108 |
| 732 | nmdc:mga09592_388423_c1 | 3300050508 | Bacteria | 1206 |
| 733 | nmdc:mga06r32_457974_c1 | 3300050510 | Bacteria | 1255 |
| 734 | nmdc:mga0n895_428501_c1 | 3300050512 | Bacteria | 1337 |
| 735 | nmdc:mga0n895_9964_c1 | 3300050512 | Bacteria | 8361 |
| 736 | nmdc:mga0rr50_31876_c1 | 3300050513 | Bacteria | 3748 |
| 737 | nmdc:mga0a205_20405_c1 | 3300050515 | Bacteria | 6251 |
| 738 | nmdc:mga0sz30_172683_c1 | 3300050516 | Bacteria | 958 |
| 739 | nmdc:mga0sz30_2149_c1 | 3300050516 | Bacteria | 3102 |
| 740 | nmdc:mga0sz30_3703_c1 | 3300050516 | Bacteria | 5511 |
| 741 | Ga0495601_0000225 | 3300053077 | Bacteria | 30328 |
| 742 | Ga0495612_0007085 | 3300053078 | Bacteria | 4587 |
| 743 | Ga0495612_0032470 | 3300053078 | Bacteria | 2109 |
| 744 | Ga0495655_0088245 | 3300053083 | Bacteria | 899 |
| 745 | Ga0495655_0111615 | 3300053083 | Bacteria | 822 |
| 746 | Ga0495595_0005154 | 3300053084 | Bacteria | 5279 |
| 747 | Ga0495595_0124223 | 3300053084 | Bacteria | 1258 |
| 748 | Ga0495619_0001284 | 3300053085 | Bacteria | 16486 |
| 749 | Ga0495619_0308281 | 3300053085 | Bacteria | 1096 |
| 750 | Ga0495619_0443229 | 3300053085 | Unclassified | 895 |
| 751 | Ga0500643_040126 | 3300053087 | Bacteria | 1380 |
| 752 | Ga0500644_0014616 | 3300053088 | Bacteria | 2220 |
| 753 | Ga0500581_280337 | 3300053089 | Bacteria | 678 |
| 754 | Ga0500583_0094286 | 3300053092 | Bacteria | 1460 |
| 755 | Ga0500651_0116484 | 3300053093 | Bacteria | 1626 |
| 756 | Ga0500566_0107352 | 3300053094 | Bacteria | 1522 |
| 757 | Ga0500641_0030707 | 3300053096 | Bacteria | 2114 |
| 758 | Ga0500560_001526 | 3300053107 | Bacteria | 4065 |
| 759 | Ga0500572_012167 | 3300053111 | Bacteria | 2102 |
| 760 | Ga0500595_037747 | 3300053119 | Bacteria | 1574 |
| 761 | Ga0500618_000227 | 3300053125 | Bacteria | 44231 |
| 762 | Ga0500618_002042 | 3300053125 | Bacteria | 8158 |
| 763 | Ga0500618_012633 | 3300053125 | Bacteria | 2205 |
| 764 | Ga0500618_031503 | 3300053125 | Bacteria | 1243 |
| 765 | Ga0500618_066038 | 3300053125 | Bacteria | 813 |
| 766 | Ga0500658_0103484 | 3300053134 | Bacteria | 1245 |
| 767 | Ga0500659_0328656 | 3300053135 | Bacteria | 677 |
| 768 | Ga0500559_0003764 | 3300053136 | Bacteria | 7366 |
| 769 | Ga0500561_0001954 | 3300053137 | Bacteria | 3412 |
| 770 | Ga0500568_0003084 | 3300053139 | Bacteria | 9512 |
| 771 | Ga0500573_0027095 | 3300053140 | Bacteria | 3294 |
| 772 | Ga0500573_0049947 | 3300053140 | Bacteria | 2406 |
| 773 | Ga0500577_0280617 | 3300053142 | Bacteria | 726 |
| 774 | Ga0500590_001637 | 3300053148 | Bacteria | 9350 |
| 775 | Ga0500604_0093981 | 3300053151 | Bacteria | 982 |
| 776 | Ga0500604_0098761 | 3300053151 | Bacteria | 960 |
| 777 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 778 | Ga0500616_0001190 | 3300053153 | Bacteria | 26447 |
| 779 | Ga0500616_0047030 | 3300053153 | Bacteria | 2292 |
| 780 | Ga0500616_0059686 | 3300053153 | Bacteria | 1980 |
| 781 | Ga0500616_0341745 | 3300053153 | Bacteria | 611 |
| 782 | Ga0500622_0000364 | 3300053156 | Bacteria | 43740 |
| 783 | Ga0500622_0000757 | 3300053156 | Bacteria | 28152 |
| 784 | Ga0500624_000577 | 3300053157 | Bacteria | 10121 |
| 785 | Ga0500627_0127639 | 3300053158 | Bacteria | 1148 |
| 786 | Ga0500627_0228484 | 3300053158 | Bacteria | 828 |
| 787 | Ga0500633_0005625 | 3300053160 | Bacteria | 2997 |
| 788 | Ga0500634_0046216 | 3300053161 | Bacteria | 2353 |
| 789 | Ga0500636_0000070 | 3300053177 | Bacteria | 50168 |
| 790 | Ga0500636_0007711 | 3300053177 | Bacteria | 6224 |
| 791 | Ga0500636_0008368 | 3300053177 | Bacteria | 6001 |
| 792 | Ga0500636_0139974 | 3300053177 | Bacteria | 1340 |
| 793 | Ga0500636_0290197 | 3300053177 | Bacteria | 811 |
| 794 | Ga0501084_0134150 | 3300054114 | Bacteria | 2084 |
| 795 | Ga0501082_0086058 | 3300060353 | Bacteria | 2711 |
| 796 | Ga0501082_0136418 | 3300060353 | Bacteria | 2129 |
| 797 | Ga0501082_0321173 | 3300060353 | Bacteria | 1349 |
| 798 | Ga0501082_0359398 | 3300060353 | Bacteria | 1270 |
| 799 | Ga0501082_0476446 | 3300060353 | Bacteria | 1091 |
| 800 | Ga0501082_0526819 | 3300060353 | Bacteria | 1033 |
| 801 | Ga0530510_0123370 | 3300061734 | Bacteria | 1903 |
| 802 | Ga0530510_0314327 | 3300061734 | Bacteria | 1173 |
| 803 | Ga0530510_0948710 | 3300061734 | Bacteria | 658 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046692 | Ga0495671_0267601 | Ga0495671_0267601_397_789 | 121 |
| 2 | 3300049574 | Ga0501038_0852636 | Ga0501038_0852636_125_595 | 125 |
| 3 | 3300049578 | Ga0501042_0178616 | Ga0501042_0178616_683_1153 | 129 |
| 4 | 3300049591 | Ga0501075_0028748 | Ga0501075_0028748_2210_2680 | 129 |
| 5 | 3300003316 | rootH1_10055154 | rootH1_100551542 | 130 |
| 6 | 3300003320 | rootH2_10025055 | rootH2_100250556 | 130 |
| 7 | 3300003322 | rootL2_10082663 | rootL2_100826634 | 130 |
| 8 | 3300003323 | rootH1_10117768 | rootH1_101177682 | 130 |
| 9 | 3300006175 | Ga0070712_100077924 | Ga0070712_1000779244 | 133 |
| 10 | 3300025915 | Ga0207693_10020160 | Ga0207693_100201604 | 133 |
| 11 | 3300031911 | Ga0307412_10278721 | Ga0307412_102787213 | 133 |
| 12 | 3300047470 | Ga0495681_0080705 | Ga0495681_0080705_405_866 | 135 |
| 13 | 3300006038 | Ga0075365_10413135 | Ga0075365_104131353 | 136 |
| 14 | 3300006042 | Ga0075368_10101990 | Ga0075368_101019903 | 136 |
| 15 | 3300037471 | Ga0395905_0171747 | Ga0395905_0171747_1101_1580 | 136 |
| 16 | 3300038443 | Ga0395901_1033950 | Ga0395901_1033950_46_525 | 136 |
| 17 | 3300044683 | Ga0466965_0132840 | Ga0466965_0132840_321_800 | 136 |
| 18 | 3300046512 | Ga0495610_0063217 | Ga0495610_0063217_1265_1741 | 136 |
| 19 | 3300050492 | nmdc:mga0yw44_3065_c1 | nmdc:mga0yw44_3065_c1_4770_5252 | 136 |
| 20 | 3300050492 | nmdc:mga0yw44_404194_c1 | nmdc:mga0yw44_404194_c1_358_840 | 136 |
| 21 | 3300050493 | nmdc:mga0k408_122389_c1 | nmdc:mga0k408_122389_c1_54_536 | 136 |
| 22 | 3300050494 | nmdc:mga06z11_222987_c1 | nmdc:mga06z11_222987_c1_446_922 | 136 |
| 23 | 3300050495 | nmdc:mga04h51_94977_c1 | nmdc:mga04h51_94977_c1_236_718 | 136 |
| 24 | 3300050516 | nmdc:mga0sz30_2149_c1 | nmdc:mga0sz30_2149_c1_2458_2940 | 136 |
| 25 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1440342_1440824 | 136 |
| 26 | 3300025961 | Ga0207712_10564920 | Ga0207712_105649201 | 138 |
| 27 | 3300005455 | Ga0070663_100038200 | Ga0070663_1000382004 | 139 |
| 28 | 3300014325 | Ga0163163_10559799 | Ga0163163_105597992 | 139 |
| 29 | 3300025302 | Ga0207426_1005259 | Ga0207426_10052595 | 139 |
| 30 | 3300025903 | Ga0207680_10276331 | Ga0207680_102763312 | 139 |
| 31 | 3300026067 | Ga0207678_10058238 | Ga0207678_100582384 | 139 |
| 32 | 3300037471 | Ga0395905_0253353 | Ga0395905_0253353_927_1406 | 139 |
| 33 | 3300046525 | Ga0495663_0124739 | Ga0495663_0124739_203_682 | 139 |
| 34 | 3300048911 | Ga0496108_0899354 | Ga0496108_0899354_176_643 | 139 |
| 35 | 3300048925 | Ga0496122_0397960 | Ga0496122_0397960_46_513 | 139 |
| 36 | 3300005539 | Ga0068853_101588326 | Ga0068853_1015883261 | 140 |
| 37 | 3300005937 | Ga0081455_10190567 | Ga0081455_101905673 | 140 |
| 38 | 3300026041 | Ga0207639_11334151 | Ga0207639_113341512 | 140 |
| 39 | 3300048919 | Ga0496116_0002669 | Ga0496116_0002669_4631_5092 | 140 |
| 40 | 3300048925 | Ga0496122_0000160 | Ga0496122_0000160_84552_85031 | 140 |
| 41 | 3300048926 | Ga0496123_0000034 | Ga0496123_0000034_114230_114709 | 140 |
| 42 | 3300003781 | Ga0055536_1004520 | Ga0055536_10045201 | 141 |
| 43 | 3300003791 | Ga0055530_10015824 | Ga0055530_100158242 | 141 |
| 44 | 3300003794 | Ga0055531_10002233 | Ga0055531_100022334 | 141 |
| 45 | 3300025292 | Ga0209676_1004264 | Ga0209676_10042642 | 141 |
| 46 | 3300025298 | Ga0209050_1007237 | Ga0209050_10072374 | 141 |
| 47 | 3300025303 | Ga0209051_1006558 | Ga0209051_10065582 | 141 |
| 48 | 3300025304 | Ga0209257_1004833 | Ga0209257_10048339 | 141 |
| 49 | 3300049577 | Ga0501041_0217892 | Ga0501041_0217892_117_587 | 141 |
| 50 | 3300061734 | Ga0530510_0123370 | Ga0530510_0123370_474_944 | 141 |
| 51 | 3300025297 | Ga0209758_1000890 | Ga0209758_100089013 | 142 |
| 52 | 3300048913 | Ga0496110_1366227 | Ga0496110_1366227_22_483 | 143 |
| 53 | 3300053083 | Ga0495655_0088245 | Ga0495655_0088245_67_543 | 143 |
| 54 | 3300036647 | Ga0316582_0282134 | Ga0316582_0282134_690_1124 | 144 |
| 55 | iso_pu_bacteria | 2829745981 | 2829746606 | 144 |
| 56 | iso_pu_bacteria | 641522639 | 641642005 | 144 |
| 57 | 3300005339 | Ga0070660_100128574 | Ga0070660_1001285743 | 145 |
| 58 | 3300005364 | Ga0070673_101504416 | Ga0070673_1015044161 | 145 |
| 59 | 3300005366 | Ga0070659_100008914 | Ga0070659_1000089148 | 145 |
| 60 | 3300005548 | Ga0070665_100000418 | Ga0070665_10000041825 | 145 |
| 61 | 3300009093 | Ga0105240_10148249 | Ga0105240_101482494 | 145 |
| 62 | 3300009551 | Ga0105238_10054013 | Ga0105238_100540134 | 145 |
| 63 | 3300025909 | Ga0207705_10681695 | Ga0207705_106816952 | 145 |
| 64 | 3300025913 | Ga0207695_10466095 | Ga0207695_104660953 | 145 |
| 65 | 3300025919 | Ga0207657_10038823 | Ga0207657_100388235 | 145 |
| 66 | 3300025919 | Ga0207657_10055853 | Ga0207657_100558535 | 145 |
| 67 | 3300025924 | Ga0207694_10112227 | Ga0207694_101122274 | 145 |
| 68 | 3300025932 | Ga0207690_10000898 | Ga0207690_100008984 | 145 |
| 69 | 3300028379 | Ga0268266_10000003 | Ga0268266_100000031160 | 145 |
| 70 | 3300028379 | Ga0268266_10446129 | Ga0268266_104461292 | 145 |
| 71 | 3300048918 | Ga0496115_0022968 | Ga0496115_0022968_3615_4070 | 145 |
| 72 | 3300049570 | Ga0501033_0228181 | Ga0501033_0228181_16_453 | 145 |
| 73 | 3300053089 | Ga0500581_280337 | Ga0500581_280337_223_660 | 145 |
| 74 | 3300053140 | Ga0500573_0049947 | Ga0500573_0049947_991_1458 | 145 |
| 75 | 3300005327 | Ga0070658_10144746 | Ga0070658_101447462 | 146 |
| 76 | 3300025909 | Ga0207705_10064487 | Ga0207705_100644874 | 146 |
| 77 | 3300026118 | Ga0207675_100404760 | Ga0207675_1004047602 | 146 |
| 78 | 3300028577 | Ga0265318_10189588 | Ga0265318_101895882 | 146 |
| 79 | 3300031235 | Ga0265330_10010747 | Ga0265330_100107472 | 146 |
| 80 | 3300031240 | Ga0265320_10033467 | Ga0265320_100334673 | 146 |
| 81 | 3300031247 | Ga0265340_10016838 | Ga0265340_100168382 | 146 |
| 82 | 3300031249 | Ga0265339_10009125 | Ga0265339_100091253 | 146 |
| 83 | 3300031250 | Ga0265331_10027092 | Ga0265331_100270924 | 146 |
| 84 | 3300031344 | Ga0265316_10051098 | Ga0265316_100510984 | 146 |
| 85 | 3300031595 | Ga0265313_10015602 | Ga0265313_100156024 | 146 |
| 86 | 3300031711 | Ga0265314_10040213 | Ga0265314_100402134 | 146 |
| 87 | 3300031712 | Ga0265342_10024159 | Ga0265342_100241592 | 146 |
| 88 | 3300050512 | nmdc:mga0n895_428501_c1 | nmdc:mga0n895_428501_c1_853_1320 | 146 |
| 89 | 3300053094 | Ga0500566_0107352 | Ga0500566_0107352_633_1100 | 146 |
| 90 | iso_pu_bacteria | 2913295892 | 2913297406 | 146 |
| 91 | 3300005535 | Ga0070684_101212096 | Ga0070684_1012120962 | 147 |
| 92 | 3300005577 | Ga0068857_100815023 | Ga0068857_1008150232 | 147 |
| 93 | 3300047472 | Ga0495686_0481227 | Ga0495686_0481227_129_572 | 147 |
| 94 | iso_pu_bacteria | 2508501114 | 2509077599 | 147 |
| 95 | iso_pu_bacteria | 2554235003 | 2554247144 | 147 |
| 96 | iso_pu_bacteria | 2558860242 | 2559294368 | 147 |
| 97 | iso_pu_bacteria | 2643221693 | 2644518714 | 147 |
| 98 | iso_pu_bacteria | 2718217882 | 2719180323 | 147 |
| 99 | iso_pu_bacteria | 2718218009 | 2719731072 | 147 |
| 100 | iso_pu_bacteria | 2718218363 | 2721146417 | 147 |
| 101 | iso_pu_bacteria | 2718218365 | 2721157938 | 147 |
| 102 | iso_pu_bacteria | 2718218366 | 2721163296 | 147 |
| 103 | iso_pu_bacteria | 2721755514 | 2722839466 | 147 |
| 104 | iso_pu_bacteria | 2721755810 | 2724043828 | 147 |
| 105 | iso_pu_bacteria | 2728369365 | 2730163560 | 147 |
| 106 | iso_pu_bacteria | 2728369397 | 2730297570 | 147 |
| 107 | iso_pu_bacteria | 2791355264 | 2793347964 | 147 |
| 108 | iso_pu_bacteria | 2808606387 | 2808985859 | 147 |
| 109 | iso_pu_bacteria | 2841911363 | 2841915796 | 147 |
| 110 | iso_pu_bacteria | 2841917233 | 2841921823 | 147 |
| 111 | iso_pu_bacteria | 2899845264 | 2899846991 | 147 |
| 112 | iso_pu_bacteria | 2926760298 | 2926760969 | 147 |
| 113 | iso_pu_bacteria | 2928125067 | 2928130098 | 147 |
| 114 | iso_pu_bacteria | 2979089926 | 2979093753 | 147 |
| 115 | iso_pu_bacteria | 2979095461 | 2979098862 | 147 |
| 116 | iso_pu_bacteria | 650716007 | 650739565 | 147 |
| 117 | 3300005353 | Ga0070669_100287538 | Ga0070669_1002875382 | 148 |
| 118 | 3300005354 | Ga0070675_100036014 | Ga0070675_1000360144 | 148 |
| 119 | 3300005543 | Ga0070672_101211925 | Ga0070672_1012119251 | 148 |
| 120 | 3300014326 | Ga0157380_11110246 | Ga0157380_111102462 | 148 |
| 121 | 3300014745 | Ga0157377_10534060 | Ga0157377_105340601 | 148 |
| 122 | 3300025926 | Ga0207659_10027967 | Ga0207659_100279675 | 148 |
| 123 | 3300041486 | Ga0451807_0188350 | Ga0451807_0188350_274_729 | 148 |
| 124 | 3300041512 | Ga0451853_1077003 | Ga0451853_1077003_1653_2108 | 148 |
| 125 | 3300046477 | Ga0495664_0151452 | Ga0495664_0151452_249_767 | 148 |
| 126 | 3300049589 | Ga0501073_0431891 | Ga0501073_0431891_128_583 | 148 |
| 127 | iso_pu_bacteria | 2585427633 | 2585995151 | 148 |
| 128 | iso_pu_bacteria | 2600254933 | 2600375301 | 148 |
| 129 | iso_pu_bacteria | 2615840624 | 2616296182 | 148 |
| 130 | iso_pu_bacteria | 2643221653 | 2644296794 | 148 |
| 131 | iso_pu_bacteria | 2643221689 | 2644502362 | 148 |
| 132 | iso_pu_bacteria | 2643221719 | 2644655048 | 148 |
| 133 | iso_pu_bacteria | 2721755823 | 2724109358 | 148 |
| 134 | iso_pu_bacteria | 2838016132 | 2838017315 | 148 |
| 135 | iso_pu_bacteria | 2838061910 | 2838063353 | 148 |
| 136 | iso_pu_bacteria | 2989776772 | 2989778222 | 148 |
| 137 | iso_pu_bacteria | 8005301065 | 8005304626 | 148 |
| 138 | iso_pu_bacteria | 8005619151 | 8005620555 | 148 |
| 139 | iso_pu_bacteria | 8018127388 | 8018131363 | 148 |
| 140 | 3300005333 | Ga0070677_10285255 | Ga0070677_102852551 | 149 |
| 141 | 3300005539 | Ga0068853_100072636 | Ga0068853_1000726362 | 149 |
| 142 | 3300006852 | Ga0075433_10011744 | Ga0075433_100117444 | 149 |
| 143 | 3300006871 | Ga0075434_100001723 | Ga0075434_1000017234 | 149 |
| 144 | 3300007076 | Ga0075435_100010424 | Ga0075435_1000104242 | 149 |
| 145 | 3300014326 | Ga0157380_10862629 | Ga0157380_108626292 | 149 |
| 146 | 3300021320 | Ga0214544_1000017 | Ga0214544_1000017150 | 149 |
| 147 | 3300021321 | Ga0214542_1000006 | Ga0214542_100000680 | 149 |
| 148 | 3300021327 | Ga0214543_1000014 | Ga0214543_1000014243 | 149 |
| 149 | 3300021377 | Ga0213874_10095906 | Ga0213874_100959062 | 149 |
| 150 | 3300025941 | Ga0207711_10727584 | Ga0207711_107275842 | 149 |
| 151 | 3300026041 | Ga0207639_11116563 | Ga0207639_111165632 | 149 |
| 152 | 3300031456 | Ga0307513_10005256 | Ga0307513_1000525613 | 149 |
| 153 | 3300031730 | Ga0307516_10306592 | Ga0307516_103065921 | 149 |
| 154 | 3300033180 | Ga0307510_10456960 | Ga0307510_104569601 | 149 |
| 155 | 3300034817 | Ga0373948_0018441 | Ga0373948_0018441_382_849 | 149 |
| 156 | 3300034820 | Ga0373959_0182204 | Ga0373959_0182204_23_490 | 149 |
| 157 | 3300034957 | Ga0373938_0033350 | Ga0373938_0033350_421_888 | 149 |
| 158 | 3300035112 | Ga0373932_0049998 | Ga0373932_0049998_649_1116 | 149 |
| 159 | 3300035241 | Ga0373961_0040947 | Ga0373961_0040947_686_1153 | 149 |
| 160 | 3300035691 | Ga0373931_0012369 | Ga0373931_0012369_2533_3000 | 149 |
| 161 | 3300037853 | Ga0436364_0004734 | Ga0436364_0004734_595_1047 | 149 |
| 162 | 3300038996 | Ga0242420_047025 | Ga0242420_047025_338_805 | 149 |
| 163 | 3300039450 | Ga0436363_0613257 | Ga0436363_0613257_96_617 | 149 |
| 164 | 3300046460 | Ga0495638_0310741 | Ga0495638_0310741_173_628 | 149 |
| 165 | 3300049744 | Ga0501083_0041595 | Ga0501083_0041595_2135_2614 | 149 |
| 166 | 3300050512 | nmdc:mga0n895_9964_c1 | nmdc:mga0n895_9964_c1_5063_5530 | 149 |
| 167 | 3300050513 | nmdc:mga0rr50_31876_c1 | nmdc:mga0rr50_31876_c1_242_709 | 149 |
| 168 | 3300050515 | nmdc:mga0a205_20405_c1 | nmdc:mga0a205_20405_c1_174_641 | 149 |
| 169 | 3300053092 | Ga0500583_0094286 | Ga0500583_0094286_37_492 | 149 |
| 170 | 3300053093 | Ga0500651_0116484 | Ga0500651_0116484_1147_1602 | 149 |
| 171 | 3300061734 | Ga0530510_0948710 | Ga0530510_0948710_65_526 | 149 |
| 172 | iso_pu_bacteria | 2509276021 | 2509387685 | 149 |
| 173 | iso_pu_bacteria | 2509276033 | 2509443043 | 149 |
| 174 | iso_pu_bacteria | 2510461076 | 2510898668 | 149 |
| 175 | iso_pu_bacteria | 2510917030 | 2511197165 | 149 |
| 176 | iso_pu_bacteria | 2513237084 | 2513569167 | 149 |
| 177 | iso_pu_bacteria | 2513237085 | 2513578843 | 149 |
| 178 | iso_pu_bacteria | 2513237093 | 2513632725 | 149 |
| 179 | iso_pu_bacteria | 2513237103 | 2513709177 | 149 |
| 180 | iso_pu_bacteria | 2513237146 | 2513925734 | 149 |
| 181 | iso_pu_bacteria | 2513237162 | 2514020720 | 149 |
| 182 | iso_pu_bacteria | 2515075009 | 2515111313 | 149 |
| 183 | iso_pu_bacteria | 2515154113 | 2515638487 | 149 |
| 184 | iso_pu_bacteria | 2515154114 | 2515642552 | 149 |
| 185 | iso_pu_bacteria | 2515154116 | 2515659161 | 149 |
| 186 | iso_pu_bacteria | 2515154134 | 2515740500 | 149 |
| 187 | iso_pu_bacteria | 2516653077 | 2517039956 | 149 |
| 188 | iso_pu_bacteria | 2516653085 | 2517075506 | 149 |
| 189 | iso_pu_bacteria | 2517287029 | 2517405906 | 149 |
| 190 | iso_pu_bacteria | 2519899620 | 2520375243 | 149 |
| 191 | iso_pu_bacteria | 2529292951 | 2530643855 | 149 |
| 192 | iso_pu_bacteria | 2582581298 | 2585221025 | 149 |
| 193 | iso_pu_bacteria | 2585427526 | 2585528003 | 149 |
| 194 | iso_pu_bacteria | 2585427528 | 2585541395 | 149 |
| 195 | iso_pu_bacteria | 2585427529 | 2585549875 | 149 |
| 196 | iso_pu_bacteria | 2585427593 | 2585839473 | 149 |
| 197 | iso_pu_bacteria | 2585427594 | 2585847181 | 149 |
| 198 | iso_pu_bacteria | 2599185156 | 2599333724 | 149 |
| 199 | iso_pu_bacteria | 2599185170 | 2599418562 | 149 |
| 200 | iso_pu_bacteria | 2643221568 | 2643857854 | 149 |
| 201 | iso_pu_bacteria | 2718217997 | 2719664645 | 149 |
| 202 | iso_pu_bacteria | 2718218199 | 2720491065 | 149 |
| 203 | iso_pu_bacteria | 2738541293 | 2738802194 | 149 |
| 204 | iso_pu_bacteria | 2738541333 | 2739035933 | 149 |
| 205 | iso_pu_bacteria | 2775507049 | 2776912857 | 149 |
| 206 | iso_pu_bacteria | 2791355259 | 2793317555 | 149 |
| 207 | iso_pu_bacteria | 2791355260 | 2793321068 | 149 |
| 208 | iso_pu_bacteria | 2791355261 | 2793327100 | 149 |
| 209 | iso_pu_bacteria | 2791355263 | 2793339759 | 149 |
| 210 | iso_pu_bacteria | 2791355265 | 2793357399 | 149 |
| 211 | iso_pu_bacteria | 2791355266 | 2793358948 | 149 |
| 212 | iso_pu_bacteria | 2802429633 | 2806046888 | 149 |
| 213 | iso_pu_bacteria | 2802429634 | 2806052471 | 149 |
| 214 | iso_pu_bacteria | 2802429635 | 2806058758 | 149 |
| 215 | iso_pu_bacteria | 2802429636 | 2806067474 | 149 |
| 216 | iso_pu_bacteria | 2802429637 | 2806074021 | 149 |
| 217 | iso_pu_bacteria | 2818991461 | 2819684078 | 149 |
| 218 | iso_pu_bacteria | 2838022645 | 2838023114 | 149 |
| 219 | iso_pu_bacteria | 2838035591 | 2838037742 | 149 |
| 220 | iso_pu_bacteria | 2838042994 | 2838047938 | 149 |
| 221 | iso_pu_bacteria | 2838048938 | 2838049201 | 149 |
| 222 | iso_pu_bacteria | 2838068647 | 2838074186 | 149 |
| 223 | iso_pu_bacteria | 2838661181 | 2838662755 | 149 |
| 224 | iso_pu_bacteria | 2838668709 | 2838670876 | 149 |
| 225 | iso_pu_bacteria | 2838680041 | 2838681370 | 149 |
| 226 | iso_pu_bacteria | 2838686498 | 2838688579 | 149 |
| 227 | iso_pu_bacteria | 2838694306 | 2838694595 | 149 |
| 228 | iso_pu_bacteria | 2838701080 | 2838703247 | 149 |
| 229 | iso_pu_bacteria | 2838707686 | 2838707973 | 149 |
| 230 | iso_pu_bacteria | 2838729681 | 2838730874 | 149 |
| 231 | iso_pu_bacteria | 2838742623 | 2838744232 | 149 |
| 232 | iso_pu_bacteria | 2841864319 | 2841865445 | 149 |
| 233 | iso_pu_bacteria | 2842077413 | 2842080796 | 149 |
| 234 | iso_pu_bacteria | 2842110456 | 2842115005 | 149 |
| 235 | iso_pu_bacteria | 2842118031 | 2842121415 | 149 |
| 236 | iso_pu_bacteria | 2842146304 | 2842147529 | 149 |
| 237 | iso_pu_bacteria | 2842156927 | 2842160083 | 149 |
| 238 | iso_pu_bacteria | 2842163707 | 2842168326 | 149 |
| 239 | iso_pu_bacteria | 2842180545 | 2842183300 | 149 |
| 240 | iso_pu_bacteria | 2842192696 | 2842197978 | 149 |
| 241 | iso_pu_bacteria | 2842198810 | 2842199542 | 149 |
| 242 | iso_pu_bacteria | 2842205361 | 2842207669 | 149 |
| 243 | iso_pu_bacteria | 2842217011 | 2842221232 | 149 |
| 244 | iso_pu_bacteria | 2842229732 | 2842235099 | 149 |
| 245 | iso_pu_bacteria | 2842237096 | 2842237384 | 149 |
| 246 | iso_pu_bacteria | 2842243621 | 2842245696 | 149 |
| 247 | iso_pu_bacteria | 2842250916 | 2842252595 | 149 |
| 248 | iso_pu_bacteria | 2842257432 | 2842259654 | 149 |
| 249 | iso_pu_bacteria | 2842264693 | 2842266893 | 149 |
| 250 | iso_pu_bacteria | 2842271015 | 2842274493 | 149 |
| 251 | iso_pu_bacteria | 2842278818 | 2842281536 | 149 |
| 252 | iso_pu_bacteria | 2842285085 | 2842287089 | 149 |
| 253 | iso_pu_bacteria | 2842291075 | 2842294452 | 149 |
| 254 | iso_pu_bacteria | 2842304105 | 2842306736 | 149 |
| 255 | iso_pu_bacteria | 2842311132 | 2842314774 | 149 |
| 256 | iso_pu_bacteria | 2842317721 | 2842318623 | 149 |
| 257 | iso_pu_bacteria | 2842341865 | 2842343564 | 149 |
| 258 | iso_pu_bacteria | 2842363717 | 2842365279 | 149 |
| 259 | iso_pu_bacteria | 2842370503 | 2842371833 | 149 |
| 260 | iso_pu_bacteria | 2842377471 | 2842380850 | 149 |
| 261 | iso_pu_bacteria | 2842384541 | 2842387921 | 149 |
| 262 | iso_pu_bacteria | 2842395702 | 2842398228 | 149 |
| 263 | iso_pu_bacteria | 2842402390 | 2842404357 | 149 |
| 264 | iso_pu_bacteria | 2842409023 | 2842410958 | 149 |
| 265 | iso_pu_bacteria | 2842415677 | 2842417586 | 149 |
| 266 | iso_pu_bacteria | 2842422224 | 2842427391 | 149 |
| 267 | iso_pu_bacteria | 2842428310 | 2842431024 | 149 |
| 268 | iso_pu_bacteria | 2842434925 | 2842436978 | 149 |
| 269 | iso_pu_bacteria | 2842441272 | 2842443056 | 149 |
| 270 | iso_pu_bacteria | 2842447887 | 2842453278 | 149 |
| 271 | iso_pu_bacteria | 2842462802 | 2842465067 | 149 |
| 272 | iso_pu_bacteria | 2842469257 | 2842471707 | 149 |
| 273 | iso_pu_bacteria | 2842489311 | 2842493786 | 149 |
| 274 | iso_pu_bacteria | 2842495871 | 2842497258 | 149 |
| 275 | iso_pu_bacteria | 2844454524 | 2844455095 | 149 |
| 276 | iso_pu_bacteria | 2919100787 | 2919103860 | 149 |
| 277 | iso_pu_bacteria | 2929138655 | 2929139553 | 149 |
| 278 | iso_pu_bacteria | 2933570622 | 2933573150 | 149 |
| 279 | iso_pu_bacteria | 2933586486 | 2933591404 | 149 |
| 280 | iso_pu_bacteria | 2935894831 | 2935895117 | 149 |
| 281 | iso_pu_bacteria | 2935901341 | 2935904101 | 149 |
| 282 | iso_pu_bacteria | 2936367885 | 2936368093 | 149 |
| 283 | iso_pu_bacteria | 2936375103 | 2936381513 | 149 |
| 284 | iso_pu_bacteria | 2936381700 | 2936384915 | 149 |
| 285 | iso_pu_bacteria | 2996893221 | 2996895116 | 149 |
| 286 | iso_pu_bacteria | 3005445848 | 3005446788 | 149 |
| 287 | iso_pu_bacteria | 3005452660 | 3005453477 | 149 |
| 288 | iso_pu_bacteria | 639633055 | 639647461 | 149 |
| 289 | iso_pu_bacteria | 8005289223 | 8005292821 | 149 |
| 290 | iso_pu_bacteria | 8005307578 | 8005311123 | 149 |
| 291 | iso_pu_bacteria | 8005376324 | 8005376580 | 149 |
| 292 | iso_pu_bacteria | 8005382845 | 8005385969 | 149 |
| 293 | iso_pu_bacteria | 8005395548 | 8005400248 | 149 |
| 294 | iso_pu_bacteria | 8005430974 | 8005432297 | 149 |
| 295 | iso_pu_bacteria | 8005460587 | 8005461957 | 149 |
| 296 | iso_pu_bacteria | 8005556819 | 8005558898 | 149 |
| 297 | iso_pu_bacteria | 8005563573 | 8005570465 | 149 |
| 298 | iso_pu_bacteria | 8005570704 | 8005572719 | 149 |
| 299 | iso_pu_bacteria | 8005695170 | 8005698751 | 149 |
| 300 | iso_pu_bacteria | 8018163183 | 8018169187 | 149 |
| 301 | iso_pu_bacteria | 8023680758 | 8023686918 | 149 |
| 302 | iso_pu_bacteria | 8024479707 | 8024481133 | 149 |
| 303 | iso_pu_bacteria | 8056382006 | 8056384717 | 149 |
| 304 | iso_pu_bacteria | 8057874678 | 8057879926 | 149 |
| 305 | 3300005539 | Ga0068853_101583866 | Ga0068853_1015838661 | 150 |
| 306 | 3300006173 | Ga0070716_100115964 | Ga0070716_1001159643 | 150 |
| 307 | 3300031711 | Ga0265314_10014456 | Ga0265314_100144562 | 150 |
| 308 | 3300035113 | Ga0373936_0050391 | Ga0373936_0050391_94_558 | 150 |
| 309 | 3300035725 | Ga0373947_0999520 | Ga0373947_0999520_105_560 | 150 |
| 310 | 3300037068 | Ga0373925_0972714 | Ga0373925_0972714_126_608 | 150 |
| 311 | 3300041413 | Ga0439465_0384304 | Ga0439465_0384304_50_505 | 150 |
| 312 | 3300042006 | Ga0439432_223602 | Ga0439432_223602_32_490 | 150 |
| 313 | 3300044765 | Ga0466970_0590770 | Ga0466970_0590770_14_469 | 150 |
| 314 | 3300046524 | Ga0495648_0172602 | Ga0495648_0172602_507_962 | 150 |
| 315 | 3300049581 | Ga0501047_0538013 | Ga0501047_0538013_339_797 | 150 |
| 316 | 3300049744 | Ga0501083_0453250 | Ga0501083_0453250_159_719 | 150 |
| 317 | 3300053135 | Ga0500659_0328656 | Ga0500659_0328656_190_645 | 150 |
| 318 | 3300053153 | Ga0500616_0059686 | Ga0500616_0059686_62_517 | 150 |
| 319 | 3300060353 | Ga0501082_0526819 | Ga0501082_0526819_495_959 | 150 |
| 320 | iso_pu_bacteria | 2510917026 | 2511168608 | 150 |
| 321 | iso_pu_bacteria | 2582581294 | 2585203110 | 150 |
| 322 | iso_pu_bacteria | 2582581304 | 2585256582 | 150 |
| 323 | iso_pu_bacteria | 2599185236 | 2599722045 | 150 |
| 324 | iso_pu_bacteria | 2643221618 | 2644108952 | 150 |
| 325 | iso_pu_bacteria | 2643221626 | 2644151474 | 150 |
| 326 | iso_pu_bacteria | 2643221655 | 2644311608 | 150 |
| 327 | iso_pu_bacteria | 2643221659 | 2644329866 | 150 |
| 328 | iso_pu_bacteria | 2643221698 | 2644546540 | 150 |
| 329 | iso_pu_bacteria | 2643221712 | 2644617407 | 150 |
| 330 | iso_pu_bacteria | 2690316117 | 2692316787 | 150 |
| 331 | iso_pu_bacteria | 2718218232 | 2720612434 | 150 |
| 332 | iso_pu_bacteria | 2718218233 | 2720619273 | 150 |
| 333 | iso_pu_bacteria | 2718218235 | 2720630673 | 150 |
| 334 | iso_pu_bacteria | 2718218269 | 2720774366 | 150 |
| 335 | iso_pu_bacteria | 2721755556 | 2723026093 | 150 |
| 336 | iso_pu_bacteria | 2721755684 | 2723559638 | 150 |
| 337 | iso_pu_bacteria | 2721755685 | 2723566254 | 150 |
| 338 | iso_pu_bacteria | 2721755819 | 2724088973 | 150 |
| 339 | iso_pu_bacteria | 2721755822 | 2724103519 | 150 |
| 340 | iso_pu_bacteria | 2728369352 | 2730107029 | 150 |
| 341 | iso_pu_bacteria | 2738541317 | 2738946510 | 150 |
| 342 | iso_pu_bacteria | 2751185821 | 2753460845 | 150 |
| 343 | iso_pu_bacteria | 2791355082 | 2792584202 | 150 |
| 344 | iso_pu_bacteria | 2791355091 | 2792622647 | 150 |
| 345 | iso_pu_bacteria | 2791355092 | 2792628432 | 150 |
| 346 | iso_pu_bacteria | 2791355256 | 2793296229 | 150 |
| 347 | iso_pu_bacteria | 2791355262 | 2793333646 | 150 |
| 348 | iso_pu_bacteria | 2791355267 | 2793367879 | 150 |
| 349 | iso_pu_bacteria | 2802429605 | 2805926549 | 150 |
| 350 | iso_pu_bacteria | 2802429606 | 2805933348 | 150 |
| 351 | iso_pu_bacteria | 2818991272 | 2819242506 | 150 |
| 352 | iso_pu_bacteria | 2847417321 | 2847418147 | 150 |
| 353 | iso_pu_bacteria | 2848992105 | 2848993122 | 150 |
| 354 | iso_pu_bacteria | 2855872281 | 2855878899 | 150 |
| 355 | iso_pu_bacteria | 2857531043 | 2857531895 | 150 |
| 356 | iso_pu_bacteria | 2899803654 | 2899803809 | 150 |
| 357 | iso_pu_bacteria | 2913308742 | 2913310925 | 150 |
| 358 | iso_pu_bacteria | 2919171160 | 2919171384 | 150 |
| 359 | iso_pu_bacteria | 2933016740 | 2933018967 | 150 |
| 360 | iso_pu_bacteria | 2933599457 | 2933604640 | 150 |
| 361 | iso_pu_bacteria | 2989349275 | 2989354120 | 150 |
| 362 | iso_pu_bacteria | 643692032 | 643825122 | 150 |
| 363 | iso_pu_bacteria | 8005282627 | 8005284747 | 150 |
| 364 | iso_pu_bacteria | 8005484373 | 8005485596 | 150 |
| 365 | iso_pu_bacteria | 8005497431 | 8005499367 | 150 |
| 366 | iso_pu_bacteria | 8005626139 | 8005627480 | 150 |
| 367 | iso_pu_bacteria | 8005668836 | 8005670783 | 150 |
| 368 | iso_pu_bacteria | 8018150411 | 8018152522 | 150 |
| 369 | iso_pu_bacteria | 8024501048 | 8024503223 | 150 |
| 370 | iso_pu_bacteria | 8049293176 | 8049293960 | 150 |
| 371 | iso_pu_bacteria | 8056375014 | 8056380759 | 150 |
| 372 | 3300003187 | JGI25151J46595_10012339 | JGI25151J46595_100123396 | 151 |
| 373 | 3300005289 | Ga0065704_10479362 | Ga0065704_104793621 | 151 |
| 374 | 3300005335 | Ga0070666_10002410 | Ga0070666_100024103 | 151 |
| 375 | 3300005353 | Ga0070669_100070984 | Ga0070669_1000709844 | 151 |
| 376 | 3300005364 | Ga0070673_100006321 | Ga0070673_1000063215 | 151 |
| 377 | 3300005366 | Ga0070659_100582170 | Ga0070659_1005821701 | 151 |
| 378 | 3300005436 | Ga0070713_100714982 | Ga0070713_1007149821 | 151 |
| 379 | 3300005437 | Ga0070710_10049739 | Ga0070710_100497392 | 151 |
| 380 | 3300005937 | Ga0081455_10013647 | Ga0081455_100136475 | 151 |
| 381 | 3300005937 | Ga0081455_10111115 | Ga0081455_101111152 | 151 |
| 382 | 3300005983 | Ga0081540_1000508 | Ga0081540_100050836 | 151 |
| 383 | 3300005985 | Ga0081539_10057281 | Ga0081539_100572813 | 151 |
| 384 | 3300006028 | Ga0070717_10471537 | Ga0070717_104715372 | 151 |
| 385 | 3300006038 | Ga0075365_10011590 | Ga0075365_100115905 | 151 |
| 386 | 3300006042 | Ga0075368_10296925 | Ga0075368_102969252 | 151 |
| 387 | 3300006048 | Ga0075363_100457570 | Ga0075363_1004575702 | 151 |
| 388 | 3300006051 | Ga0075364_10056208 | Ga0075364_100562083 | 151 |
| 389 | 3300006163 | Ga0070715_10240494 | Ga0070715_102404942 | 151 |
| 390 | 3300006177 | Ga0075362_10033044 | Ga0075362_100330443 | 151 |
| 391 | 3300006195 | Ga0075366_10061087 | Ga0075366_100610873 | 151 |
| 392 | 3300006844 | Ga0075428_100079844 | Ga0075428_1000798442 | 151 |
| 393 | 3300006844 | Ga0075428_101667206 | Ga0075428_1016672062 | 151 |
| 394 | 3300006846 | Ga0075430_100150852 | Ga0075430_1001508522 | 151 |
| 395 | 3300006847 | Ga0075431_100320676 | Ga0075431_1003206762 | 151 |
| 396 | 3300007788 | Ga0099795_10002608 | Ga0099795_100026081 | 151 |
| 397 | 3300009147 | Ga0114129_10836149 | Ga0114129_108361492 | 151 |
| 398 | 3300009148 | Ga0105243_10008523 | Ga0105243_100085239 | 151 |
| 399 | 3300010159 | Ga0099796_10004809 | Ga0099796_100048093 | 151 |
| 400 | 3300011119 | Ga0105246_10382362 | Ga0105246_103823622 | 151 |
| 401 | 3300012502 | Ga0157347_1013101 | Ga0157347_10131012 | 151 |
| 402 | 3300013100 | Ga0157373_10123458 | Ga0157373_101234581 | 151 |
| 403 | 3300013102 | Ga0157371_10000073 | Ga0157371_1000007330 | 151 |
| 404 | 3300013104 | Ga0157370_10001154 | Ga0157370_1000115412 | 151 |
| 405 | 3300013105 | Ga0157369_10185520 | Ga0157369_101855204 | 151 |
| 406 | 3300017792 | Ga0163161_10316219 | Ga0163161_103162193 | 151 |
| 407 | 3300025245 | Ga0207425_1031518 | Ga0207425_10315182 | 151 |
| 408 | 3300025294 | Ga0209025_1000074 | Ga0209025_1000074289 | 151 |
| 409 | 3300025294 | Ga0209025_1000080 | Ga0209025_10000804 | 151 |
| 410 | 3300025294 | Ga0209025_1001440 | Ga0209025_10014404 | 151 |
| 411 | 3300025294 | Ga0209025_1001600 | Ga0209025_10016004 | 151 |
| 412 | 3300025304 | Ga0209257_1028296 | Ga0209257_10282961 | 151 |
| 413 | 3300025935 | Ga0207709_10011235 | Ga0207709_100112353 | 151 |
| 414 | 3300025942 | Ga0207689_10208958 | Ga0207689_102089583 | 151 |
| 415 | 3300027866 | Ga0209813_10014272 | Ga0209813_100142723 | 151 |
| 416 | 3300028794 | Ga0307515_10267812 | Ga0307515_102678121 | 151 |
| 417 | 3300031241 | Ga0265325_10000030 | Ga0265325_1000003042 | 151 |
| 418 | 3300031249 | Ga0265339_10283907 | Ga0265339_102839072 | 151 |
| 419 | 3300031733 | Ga0316577_10349912 | Ga0316577_103499123 | 151 |
| 420 | 3300035089 | Ga0373944_0000529 | Ga0373944_0000529_3301_3786 | 151 |
| 421 | 3300035089 | Ga0373944_0058964 | Ga0373944_0058964_302_787 | 151 |
| 422 | 3300035111 | Ga0373923_0003265 | Ga0373923_0003265_480_965 | 151 |
| 423 | 3300035111 | Ga0373923_0035541 | Ga0373923_0035541_1256_1741 | 151 |
| 424 | 3300035113 | Ga0373936_0012172 | Ga0373936_0012172_1226_1711 | 151 |
| 425 | 3300035116 | Ga0373945_0007229 | Ga0373945_0007229_3030_3515 | 151 |
| 426 | 3300035117 | Ga0373953_0018712 | Ga0373953_0018712_464_949 | 151 |
| 427 | 3300035118 | Ga0373954_0136734 | Ga0373954_0136734_552_1037 | 151 |
| 428 | 3300035119 | Ga0373956_0020733 | Ga0373956_0020733_1492_1977 | 151 |
| 429 | 3300035119 | Ga0373956_0073404 | Ga0373956_0073404_419_904 | 151 |
| 430 | 3300035170 | Ga0373943_0011141 | Ga0373943_0011141_646_1131 | 151 |
| 431 | 3300035170 | Ga0373943_0036951 | Ga0373943_0036951_1539_2024 | 151 |
| 432 | 3300035171 | Ga0373946_0004260 | Ga0373946_0004260_4514_4999 | 151 |
| 433 | 3300035172 | Ga0373955_0003253 | Ga0373955_0003253_1957_2442 | 151 |
| 434 | 3300035172 | Ga0373955_0007509 | Ga0373955_0007509_3332_3817 | 151 |
| 435 | 3300035242 | Ga0373962_0212680 | Ga0373962_0212680_68_553 | 151 |
| 436 | 3300035410 | Ga0373924_0012335 | Ga0373924_0012335_2370_2855 | 151 |
| 437 | 3300035692 | Ga0373935_0009847 | Ga0373935_0009847_267_752 | 151 |
| 438 | 3300035692 | Ga0373935_0029599 | Ga0373935_0029599_2196_2681 | 151 |
| 439 | 3300035695 | Ga0373927_0120840 | Ga0373927_0120840_878_1363 | 151 |
| 440 | 3300035724 | Ga0373933_0016565 | Ga0373933_0016565_3368_3853 | 151 |
| 441 | 3300035724 | Ga0373933_0307132 | Ga0373933_0307132_422_907 | 151 |
| 442 | 3300036401 | Ga0373937_0004072 | Ga0373937_0004072_3701_4186 | 151 |
| 443 | 3300036401 | Ga0373937_0077705 | Ga0373937_0077705_1187_1672 | 151 |
| 444 | 3300036712 | Ga0316584_0214959 | Ga0316584_0214959_835_1296 | 151 |
| 445 | 3300037068 | Ga0373925_0037474 | Ga0373925_0037474_2409_2894 | 151 |
| 446 | 3300042993 | Ga0439440_0108126 | Ga0439440_0108126_181_666 | 151 |
| 447 | 3300046452 | Ga0495617_021608 | Ga0495617_021608_1519_2004 | 151 |
| 448 | 3300046454 | Ga0495592_0004354 | Ga0495592_0004354_2343_2828 | 151 |
| 449 | 3300046454 | Ga0495592_0013017 | Ga0495592_0013017_2741_3226 | 151 |
| 450 | 3300046455 | Ga0495603_0054603 | Ga0495603_0054603_315_800 | 151 |
| 451 | 3300046459 | Ga0495629_0015781 | Ga0495629_0015781_3224_3709 | 151 |
| 452 | 3300046461 | Ga0495641_0017376 | Ga0495641_0017376_1016_1501 | 151 |
| 453 | 3300046462 | Ga0495651_0013614 | Ga0495651_0013614_1187_1672 | 151 |
| 454 | 3300046463 | Ga0495653_0275834 | Ga0495653_0275834_483_968 | 151 |
| 455 | 3300046463 | Ga0495653_0664333 | Ga0495653_0664333_52_537 | 151 |
| 456 | 3300046472 | Ga0495580_0006887 | Ga0495580_0006887_2449_2934 | 151 |
| 457 | 3300046473 | Ga0495582_0028805 | Ga0495582_0028805_1465_1950 | 151 |
| 458 | 3300046475 | Ga0495639_0049882 | Ga0495639_0049882_317_802 | 151 |
| 459 | 3300046476 | Ga0495662_0165504 | Ga0495662_0165504_581_1066 | 151 |
| 460 | 3300046477 | Ga0495664_0007402 | Ga0495664_0007402_897_1382 | 151 |
| 461 | 3300046492 | Ga0495585_0003052 | Ga0495585_0003052_48_533 | 151 |
| 462 | 3300046499 | Ga0495594_0012401 | Ga0495594_0012401_1194_1679 | 151 |
| 463 | 3300046501 | Ga0495607_0010403 | Ga0495607_0010403_42_527 | 151 |
| 464 | 3300046511 | Ga0495608_0024299 | Ga0495608_0024299_2266_2751 | 151 |
| 465 | 3300046514 | Ga0495618_0210941 | Ga0495618_0210941_709_1194 | 151 |
| 466 | 3300046516 | Ga0495628_0004416 | Ga0495628_0004416_10790_11275 | 151 |
| 467 | 3300046516 | Ga0495628_0064395 | Ga0495628_0064395_558_1043 | 151 |
| 468 | 3300046522 | Ga0495643_0120084 | Ga0495643_0120084_214_669 | 151 |
| 469 | 3300046523 | Ga0495644_0000312 | Ga0495644_0000312_5897_6382 | 151 |
| 470 | 3300046526 | Ga0495666_0009011 | Ga0495666_0009011_2007_2492 | 151 |
| 471 | 3300046529 | Ga0495652_0019039 | Ga0495652_0019039_194_679 | 151 |
| 472 | 3300046529 | Ga0495652_0077529 | Ga0495652_0077529_1593_2078 | 151 |
| 473 | 3300046531 | Ga0495665_0008576 | Ga0495665_0008576_151_636 | 151 |
| 474 | 3300046533 | Ga0495640_0051842 | Ga0495640_0051842_2196_2681 | 151 |
| 475 | 3300046533 | Ga0495640_0129488 | Ga0495640_0129488_1087_1572 | 151 |
| 476 | 3300046535 | Ga0495586_0029905 | Ga0495586_0029905_1945_2430 | 151 |
| 477 | 3300046536 | Ga0495587_0124187 | Ga0495587_0124187_347_832 | 151 |
| 478 | 3300046537 | Ga0495598_0004060 | Ga0495598_0004060_1784_2269 | 151 |
| 479 | 3300046538 | Ga0495609_0154328 | Ga0495609_0154328_59_544 | 151 |
| 480 | 3300046543 | Ga0495645_0001254 | Ga0495645_0001254_11171_11656 | 151 |
| 481 | 3300046543 | Ga0495645_0021226 | Ga0495645_0021226_905_1390 | 151 |
| 482 | 3300046557 | Ga0495622_0140544 | Ga0495622_0140544_251_736 | 151 |
| 483 | 3300046558 | Ga0495633_0001295 | Ga0495633_0001295_14353_14838 | 151 |
| 484 | 3300046559 | Ga0495667_0002953 | Ga0495667_0002953_8268_8753 | 151 |
| 485 | 3300046559 | Ga0495667_0010839 | Ga0495667_0010839_2480_2965 | 151 |
| 486 | 3300046648 | Ga0495611_0013926 | Ga0495611_0013926_2446_2931 | 151 |
| 487 | 3300046663 | Ga0495635_0011422 | Ga0495635_0011422_1465_1950 | 151 |
| 488 | 3300046674 | Ga0495588_0020199 | Ga0495588_0020199_2275_2760 | 151 |
| 489 | 3300046675 | Ga0495657_0096886 | Ga0495657_0096886_863_1348 | 151 |
| 490 | 3300046675 | Ga0495657_0303578 | Ga0495657_0303578_351_836 | 151 |
| 491 | 3300046678 | Ga0495599_0028256 | Ga0495599_0028256_2403_2888 | 151 |
| 492 | 3300046678 | Ga0495599_0045818 | Ga0495599_0045818_1801_2286 | 151 |
| 493 | 3300046679 | Ga0495623_0001432 | Ga0495623_0001432_12350_12835 | 151 |
| 494 | 3300046680 | Ga0495646_0022616 | Ga0495646_0022616_3351_3836 | 151 |
| 495 | 3300046680 | Ga0495646_0055996 | Ga0495646_0055996_419_904 | 151 |
| 496 | 3300046683 | Ga0495658_0031443 | Ga0495658_0031443_461_946 | 151 |
| 497 | 3300046689 | Ga0495613_0205294 | Ga0495613_0205294_373_858 | 151 |
| 498 | 3300046690 | Ga0495624_0016426 | Ga0495624_0016426_1718_2203 | 151 |
| 499 | 3300046690 | Ga0495624_0250687 | Ga0495624_0250687_526_1011 | 151 |
| 500 | 3300046794 | Ga0495589_0115222 | Ga0495589_0115222_621_1106 | 151 |
| 501 | 3300046809 | Ga0495600_0016229 | Ga0495600_0016229_4205_4690 | 151 |
| 502 | 3300046809 | Ga0495600_0017641 | Ga0495600_0017641_3487_3972 | 151 |
| 503 | 3300047315 | Ga0495581_0003328 | Ga0495581_0003328_3044_3529 | 151 |
| 504 | 3300047317 | Ga0495604_0026381 | Ga0495604_0026381_347_832 | 151 |
| 505 | 3300047317 | Ga0495604_0068329 | Ga0495604_0068329_416_901 | 151 |
| 506 | 3300047319 | Ga0495674_0168369 | Ga0495674_0168369_1099_1584 | 151 |
| 507 | 3300047321 | Ga0495676_0122884 | Ga0495676_0122884_470_955 | 151 |
| 508 | 3300047322 | Ga0495680_0005660 | Ga0495680_0005660_1099_1584 | 151 |
| 509 | 3300047322 | Ga0495680_0011455 | Ga0495680_0011455_1987_2472 | 151 |
| 510 | 3300047444 | Ga0495675_0138086 | Ga0495675_0138086_733_1218 | 151 |
| 511 | 3300047444 | Ga0495675_0228898 | Ga0495675_0228898_151_636 | 151 |
| 512 | 3300047446 | Ga0495679_021031 | Ga0495679_021031_1694_2179 | 151 |
| 513 | 3300047471 | Ga0495684_0005490 | Ga0495684_0005490_7500_7985 | 151 |
| 514 | 3300047471 | Ga0495684_0977660 | Ga0495684_0977660_29_514 | 151 |
| 515 | 3300047673 | Ga0495593_0026639 | Ga0495593_0026639_985_1470 | 151 |
| 516 | 3300048088 | Ga0495602_0016985 | Ga0495602_0016985_239_724 | 151 |
| 517 | 3300048091 | Ga0495626_0025458 | Ga0495626_0025458_1938_2399 | 151 |
| 518 | 3300048907 | Ga0496104_0000065 | Ga0496104_0000065_79619_80104 | 151 |
| 519 | 3300048908 | Ga0496105_0002520 | Ga0496105_0002520_7762_8247 | 151 |
| 520 | 3300048909 | Ga0496106_0231570 | Ga0496106_0231570_693_1151 | 151 |
| 521 | 3300048913 | Ga0496110_0549658 | Ga0496110_0549658_143_601 | 151 |
| 522 | 3300048914 | Ga0496111_0002285 | Ga0496111_0002285_4044_4502 | 151 |
| 523 | 3300048916 | Ga0496113_0067946 | Ga0496113_0067946_2123_2578 | 151 |
| 524 | 3300048918 | Ga0496115_0091630 | Ga0496115_0091630_1415_1900 | 151 |
| 525 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_1458355_1458810 | 151 |
| 526 | 3300048921 | Ga0496118_0000214 | Ga0496118_0000214_90180_90635 | 151 |
| 527 | 3300048922 | Ga0496119_0212972 | Ga0496119_0212972_191_649 | 151 |
| 528 | 3300048923 | Ga0496120_0000125 | Ga0496120_0000125_27002_27457 | 151 |
| 529 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_829144_829599 | 151 |
| 530 | 3300048925 | Ga0496122_0053638 | Ga0496122_0053638_2262_2720 | 151 |
| 531 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_832875_833330 | 151 |
| 532 | 3300048926 | Ga0496123_0019336 | Ga0496123_0019336_3179_3637 | 151 |
| 533 | 3300048927 | Ga0496124_0076226 | Ga0496124_0076226_1965_2423 | 151 |
| 534 | 3300048927 | Ga0496124_0208982 | Ga0496124_0208982_293_751 | 151 |
| 535 | 3300048928 | Ga0496125_0053493 | Ga0496125_0053493_2395_2850 | 151 |
| 536 | 3300048928 | Ga0496125_0422569 | Ga0496125_0422569_246_704 | 151 |
| 537 | 3300048929 | Ga0496126_0341959 | Ga0496126_0341959_513_968 | 151 |
| 538 | 3300048929 | Ga0496126_0709665 | Ga0496126_0709665_258_713 | 151 |
| 539 | 3300049572 | Ga0501036_0110480 | Ga0501036_0110480_540_1022 | 151 |
| 540 | 3300049572 | Ga0501036_0843996 | Ga0501036_0843996_261_728 | 151 |
| 541 | 3300049574 | Ga0501038_0221631 | Ga0501038_0221631_734_1216 | 151 |
| 542 | 3300049574 | Ga0501038_0785534 | Ga0501038_0785534_234_695 | 151 |
| 543 | 3300049577 | Ga0501041_0080393 | Ga0501041_0080393_1122_1604 | 151 |
| 544 | 3300049582 | Ga0501048_0152009 | Ga0501048_0152009_533_1015 | 151 |
| 545 | 3300049584 | Ga0501068_0243769 | Ga0501068_0243769_387_869 | 151 |
| 546 | 3300049585 | Ga0501069_0287303 | Ga0501069_0287303_291_755 | 151 |
| 547 | 3300049587 | Ga0501071_0129028 | Ga0501071_0129028_505_987 | 151 |
| 548 | 3300049588 | Ga0501072_0069722 | Ga0501072_0069722_315_776 | 151 |
| 549 | 3300049591 | Ga0501075_0023581 | Ga0501075_0023581_160_621 | 151 |
| 550 | 3300049591 | Ga0501075_0182805 | Ga0501075_0182805_836_1318 | 151 |
| 551 | 3300049592 | Ga0501076_0058305 | Ga0501076_0058305_460_921 | 151 |
| 552 | 3300049592 | Ga0501076_0140447 | Ga0501076_0140447_944_1426 | 151 |
| 553 | 3300049592 | Ga0501076_0145684 | Ga0501076_0145684_1077_1550 | 151 |
| 554 | 3300049593 | Ga0501077_0145195 | Ga0501077_0145195_375_836 | 151 |
| 555 | 3300049741 | Ga0501079_0131347 | Ga0501079_0131347_1068_1550 | 151 |
| 556 | 3300049742 | Ga0501080_0466425 | Ga0501080_0466425_384_866 | 151 |
| 557 | 3300049743 | Ga0501081_0060560 | Ga0501081_0060560_1044_1526 | 151 |
| 558 | 3300049743 | Ga0501081_1519851 | Ga0501081_1519851_13_498 | 151 |
| 559 | 3300050489 | nmdc:mga03683_46187_c1 | nmdc:mga03683_46187_c1_226_681 | 151 |
| 560 | 3300050490 | nmdc:mga03n38_169285_c1 | nmdc:mga03n38_169285_c1_289_744 | 151 |
| 561 | 3300050491 | nmdc:mga00v17_1990_c1 | nmdc:mga00v17_1990_c1_2457_2912 | 151 |
| 562 | 3300050491 | nmdc:mga00v17_221916_c1 | nmdc:mga00v17_221916_c1_711_1196 | 151 |
| 563 | 3300050491 | nmdc:mga00v17_458236_c1 | nmdc:mga00v17_458236_c1_265_720 | 151 |
| 564 | 3300050492 | nmdc:mga0yw44_1016101_c1 | nmdc:mga0yw44_1016101_c1_42_527 | 151 |
| 565 | 3300050492 | nmdc:mga0yw44_30251_c1 | nmdc:mga0yw44_30251_c1_2180_2665 | 151 |
| 566 | 3300050493 | nmdc:mga0k408_25230_c1 | nmdc:mga0k408_25230_c1_2713_3168 | 151 |
| 567 | 3300050494 | nmdc:mga06z11_145556_c1 | nmdc:mga06z11_145556_c1_662_1117 | 151 |
| 568 | 3300050495 | nmdc:mga04h51_2806_c1 | nmdc:mga04h51_2806_c1_1791_2246 | 151 |
| 569 | 3300050507 | nmdc:mga05p37_717116_c1 | nmdc:mga05p37_717116_c1_498_983 | 151 |
| 570 | 3300050508 | nmdc:mga09592_388423_c1 | nmdc:mga09592_388423_c1_235_720 | 151 |
| 571 | 3300050510 | nmdc:mga06r32_457974_c1 | nmdc:mga06r32_457974_c1_531_1016 | 151 |
| 572 | 3300050516 | nmdc:mga0sz30_3703_c1 | nmdc:mga0sz30_3703_c1_1125_1580 | 151 |
| 573 | 3300053077 | Ga0495601_0000225 | Ga0495601_0000225_14577_15062 | 151 |
| 574 | 3300053078 | Ga0495612_0007085 | Ga0495612_0007085_941_1426 | 151 |
| 575 | 3300053078 | Ga0495612_0032470 | Ga0495612_0032470_514_999 | 151 |
| 576 | 3300053084 | Ga0495595_0005154 | Ga0495595_0005154_4603_5088 | 151 |
| 577 | 3300053084 | Ga0495595_0124223 | Ga0495595_0124223_645_1130 | 151 |
| 578 | 3300053085 | Ga0495619_0001284 | Ga0495619_0001284_417_902 | 151 |
| 579 | 3300053085 | Ga0495619_0443229 | Ga0495619_0443229_260_745 | 151 |
| 580 | 3300053087 | Ga0500643_040126 | Ga0500643_040126_725_1183 | 151 |
| 581 | 3300053088 | Ga0500644_0014616 | Ga0500644_0014616_719_1180 | 151 |
| 582 | 3300053096 | Ga0500641_0030707 | Ga0500641_0030707_1512_2045 | 151 |
| 583 | 3300053107 | Ga0500560_001526 | Ga0500560_001526_333_788 | 151 |
| 584 | 3300053137 | Ga0500561_0001954 | Ga0500561_0001954_2231_2686 | 151 |
| 585 | 3300053142 | Ga0500577_0280617 | Ga0500577_0280617_161_622 | 151 |
| 586 | 3300053151 | Ga0500604_0098761 | Ga0500604_0098761_97_552 | 151 |
| 587 | 3300053153 | Ga0500616_0001190 | Ga0500616_0001190_8718_9176 | 151 |
| 588 | 3300053156 | Ga0500622_0000364 | Ga0500622_0000364_33307_33768 | 151 |
| 589 | 3300053157 | Ga0500624_000577 | Ga0500624_000577_641_1096 | 151 |
| 590 | 3300053158 | Ga0500627_0127639 | Ga0500627_0127639_318_779 | 151 |
| 591 | 3300053161 | Ga0500634_0046216 | Ga0500634_0046216_142_597 | 151 |
| 592 | 3300053177 | Ga0500636_0008368 | Ga0500636_0008368_775_1236 | 151 |
| 593 | 3300054114 | Ga0501084_0134150 | Ga0501084_0134150_355_837 | 151 |
| 594 | 3300060353 | Ga0501082_0086058 | Ga0501082_0086058_1652_2113 | 151 |
| 595 | 3300060353 | Ga0501082_0136418 | Ga0501082_0136418_1631_2113 | 151 |
| 596 | 3300061734 | Ga0530510_0314327 | Ga0530510_0314327_350_811 | 151 |
| 597 | iso_pu_bacteria | 2510917022 | 2511137064 | 151 |
| 598 | iso_pu_bacteria | 2510917028 | 2511186394 | 151 |
| 599 | iso_pu_bacteria | 2512875026 | 2512972197 | 151 |
| 600 | iso_pu_bacteria | 2513237088 | 2513596280 | 151 |
| 601 | iso_pu_bacteria | 2513237089 | 2513603276 | 151 |
| 602 | iso_pu_bacteria | 2513237138 | 2513868801 | 151 |
| 603 | iso_pu_bacteria | 2513237156 | 2513983882 | 151 |
| 604 | iso_pu_bacteria | 2513237160 | 2514004731 | 151 |
| 605 | iso_pu_bacteria | 2515154107 | 2515608166 | 151 |
| 606 | iso_pu_bacteria | 2524023209 | 2524460614 | 151 |
| 607 | iso_pu_bacteria | 2534681796 | 2535515750 | 151 |
| 608 | iso_pu_bacteria | 2582581307 | 2585273226 | 151 |
| 609 | iso_pu_bacteria | 2582581315 | 2585325446 | 151 |
| 610 | iso_pu_bacteria | 2582581316 | 2585329606 | 151 |
| 611 | iso_pu_bacteria | 2582581867 | 2585400092 | 151 |
| 612 | iso_pu_bacteria | 2585427531 | 2585559474 | 151 |
| 613 | iso_pu_bacteria | 2585427590 | 2585822651 | 151 |
| 614 | iso_pu_bacteria | 2585427609 | 2585905150 | 151 |
| 615 | iso_pu_bacteria | 2585428125 | 2587979735 | 151 |
| 616 | iso_pu_bacteria | 2599185352 | 2600191973 | 151 |
| 617 | iso_pu_bacteria | 2643221599 | 2644007957 | 151 |
| 618 | iso_pu_bacteria | 2643221637 | 2644206163 | 151 |
| 619 | iso_pu_bacteria | 2643221643 | 2644242914 | 151 |
| 620 | iso_pu_bacteria | 2643221688 | 2644493360 | 151 |
| 621 | iso_pu_bacteria | 2643221718 | 2644649810 | 151 |
| 622 | iso_pu_bacteria | 2643221723 | 2644675609 | 151 |
| 623 | iso_pu_bacteria | 2802428858 | 2802717781 | 151 |
| 624 | iso_pu_bacteria | 2802428859 | 2802723290 | 151 |
| 625 | iso_pu_bacteria | 2802428862 | 2802743525 | 151 |
| 626 | iso_pu_bacteria | 2802428863 | 2802750762 | 151 |
| 627 | iso_pu_bacteria | 2838029111 | 2838031461 | 151 |
| 628 | iso_pu_bacteria | 2839993093 | 2839995866 | 151 |
| 629 | iso_pu_bacteria | 2842298080 | 2842302418 | 151 |
| 630 | iso_pu_bacteria | 2842357229 | 2842360849 | 151 |
| 631 | iso_pu_bacteria | 2842475841 | 2842477943 | 151 |
| 632 | iso_pu_bacteria | 2842482326 | 2842482883 | 151 |
| 633 | iso_pu_bacteria | 2842502639 | 2842504752 | 151 |
| 634 | iso_pu_bacteria | 2842509118 | 2842509757 | 151 |
| 635 | iso_pu_bacteria | 2852387548 | 2852389110 | 151 |
| 636 | iso_pu_bacteria | 2921250672 | 2921251042 | 151 |
| 637 | iso_pu_bacteria | 2923556063 | 2923557539 | 151 |
| 638 | iso_pu_bacteria | 2936996657 | 2937001016 | 151 |
| 639 | iso_pu_bacteria | 2937009748 | 2937011055 | 151 |
| 640 | iso_pu_bacteria | 2937029754 | 2937029778 | 151 |
| 641 | iso_pu_bacteria | 2937036028 | 2937036804 | 151 |
| 642 | iso_pu_bacteria | 2937078374 | 2937082884 | 151 |
| 643 | iso_pu_bacteria | 2937084907 | 2937090512 | 151 |
| 644 | iso_pu_bacteria | 2957437181 | 2957438784 | 151 |
| 645 | iso_pu_bacteria | 2960591022 | 2960595661 | 151 |
| 646 | iso_pu_bacteria | 2960603979 | 2960608576 | 151 |
| 647 | iso_pu_bacteria | 2960667422 | 2960668678 | 151 |
| 648 | iso_pu_bacteria | 2960693952 | 2960696778 | 151 |
| 649 | iso_pu_bacteria | 2964643177 | 2964646939 | 151 |
| 650 | iso_pu_bacteria | 2967728569 | 2967734646 | 151 |
| 651 | iso_pu_bacteria | 2970026789 | 2970032667 | 151 |
| 652 | iso_pu_bacteria | 2970122695 | 2970124370 | 151 |
| 653 | iso_pu_bacteria | 2970143518 | 2970144461 | 151 |
| 654 | iso_pu_bacteria | 2977530762 | 2977531987 | 151 |
| 655 | iso_pu_bacteria | 2996887358 | 2996891576 | 151 |
| 656 | iso_pu_bacteria | 3005416602 | 3005417173 | 151 |
| 657 | iso_pu_bacteria | 8003570095 | 8003570613 | 151 |
| 658 | iso_pu_bacteria | 8003999396 | 8004000271 | 151 |
| 659 | iso_pu_bacteria | 8005258706 | 8005262910 | 151 |
| 660 | iso_pu_bacteria | 8005314921 | 8005315234 | 151 |
| 661 | iso_pu_bacteria | 8005321885 | 8005326103 | 151 |
| 662 | iso_pu_bacteria | 8005542996 | 8005544384 | 151 |
| 663 | iso_pu_bacteria | 8054460903 | 8054461932 | 151 |
| 664 | 3300002739 | JGI25158J39367_1000210 | JGI25158J39367_10002107 | 152 |
| 665 | 3300002773 | JGI25152J39213_1000438 | JGI25152J39213_100043825 | 152 |
| 666 | 3300002773 | JGI25152J39213_1001642 | JGI25152J39213_10016429 | 152 |
| 667 | 3300002773 | JGI25152J39213_1003410 | JGI25152J39213_10034107 | 152 |
| 668 | 3300002774 | JGI25150J39212_1000033 | JGI25150J39212_100003359 | 152 |
| 669 | 3300002774 | JGI25150J39212_1017949 | JGI25150J39212_10179492 | 152 |
| 670 | 3300002987 | JGI25159J45721_1000544 | JGI25159J45721_100054416 | 152 |
| 671 | 3300003187 | JGI25151J46595_10000108 | JGI25151J46595_1000010833 | 152 |
| 672 | 3300003187 | JGI25151J46595_10000591 | JGI25151J46595_1000059113 | 152 |
| 673 | 3300003187 | JGI25151J46595_10025237 | JGI25151J46595_100252373 | 152 |
| 674 | 3300003187 | JGI25151J46595_10025400 | JGI25151J46595_100254002 | 152 |
| 675 | 3300003215 | JGI25153J46596_10009089 | JGI25153J46596_100090896 | 152 |
| 676 | 3300003215 | JGI25153J46596_10010252 | JGI25153J46596_100102525 | 152 |
| 677 | 3300003354 | JGI25160J50197_1005784 | JGI25160J50197_10057845 | 152 |
| 678 | 3300003374 | JGI25161J50226_1000051 | JGI25161J50226_10000516 | 152 |
| 679 | 3300003771 | Ga0055526_1001653 | Ga0055526_100165310 | 152 |
| 680 | 3300003771 | Ga0055526_1021859 | Ga0055526_10218593 | 152 |
| 681 | 3300003781 | Ga0055536_1067949 | Ga0055536_10679491 | 152 |
| 682 | 3300003790 | Ga0055528_1000201 | Ga0055528_100020145 | 152 |
| 683 | 3300003790 | Ga0055528_1001727 | Ga0055528_10017272 | 152 |
| 684 | 3300003792 | Ga0055540_1003756 | Ga0055540_10037563 | 152 |
| 685 | 3300004625 | Ga0055543_1000258 | Ga0055543_100025818 | 152 |
| 686 | 3300005262 | Ga0065165_1058493 | Ga0065165_10584932 | 152 |
| 687 | 3300005354 | Ga0070675_100384468 | Ga0070675_1003844683 | 152 |
| 688 | 3300005364 | Ga0070673_100869340 | Ga0070673_1008693402 | 152 |
| 689 | 3300005434 | Ga0070709_10088941 | Ga0070709_100889412 | 152 |
| 690 | 3300005435 | Ga0070714_100003030 | Ga0070714_1000030307 | 152 |
| 691 | 3300005437 | Ga0070710_10010191 | Ga0070710_100101912 | 152 |
| 692 | 3300005456 | Ga0070678_100430520 | Ga0070678_1004305202 | 152 |
| 693 | 3300005548 | Ga0070665_100165027 | Ga0070665_1001650273 | 152 |
| 694 | 3300006038 | Ga0075365_10045727 | Ga0075365_100457275 | 152 |
| 695 | 3300006038 | Ga0075365_10196597 | Ga0075365_101965972 | 152 |
| 696 | 3300006051 | Ga0075364_10012041 | Ga0075364_100120414 | 152 |
| 697 | 3300006051 | Ga0075364_10027201 | Ga0075364_100272014 | 152 |
| 698 | 3300006051 | Ga0075364_10442295 | Ga0075364_104422952 | 152 |
| 699 | 3300006051 | Ga0075364_10498885 | Ga0075364_104988851 | 152 |
| 700 | 3300006846 | Ga0075430_100199560 | Ga0075430_1001995603 | 152 |
| 701 | 3300006871 | Ga0075434_101093193 | Ga0075434_1010931931 | 152 |
| 702 | 3300021377 | Ga0213874_10038285 | Ga0213874_100382852 | 152 |
| 703 | 3300021384 | Ga0213876_10001897 | Ga0213876_1000189710 | 152 |
| 704 | 3300021384 | Ga0213876_10003588 | Ga0213876_100035884 | 152 |
| 705 | 3300021388 | Ga0213875_10004740 | Ga0213875_1000474012 | 152 |
| 706 | 3300025208 | Ga0209436_100173 | Ga0209436_10017311 | 152 |
| 707 | 3300025245 | Ga0207425_1000031 | Ga0207425_100003183 | 152 |
| 708 | 3300025245 | Ga0207425_1001353 | Ga0207425_10013533 | 152 |
| 709 | 3300025245 | Ga0207425_1004550 | Ga0207425_10045505 | 152 |
| 710 | 3300025245 | Ga0207425_1058915 | Ga0207425_10589152 | 152 |
| 711 | 3300025258 | Ga0209129_1000053 | Ga0209129_100005384 | 152 |
| 712 | 3300025258 | Ga0209129_1000137 | Ga0209129_100013711 | 152 |
| 713 | 3300025258 | Ga0209129_1000932 | Ga0209129_100093214 | 152 |
| 714 | 3300025258 | Ga0209129_1001774 | Ga0209129_10017742 | 152 |
| 715 | 3300025258 | Ga0209129_1002015 | Ga0209129_10020152 | 152 |
| 716 | 3300025258 | Ga0209129_1002041 | Ga0209129_10020411 | 152 |
| 717 | 3300025273 | Ga0209673_1000041 | Ga0209673_1000041100 | 152 |
| 718 | 3300025273 | Ga0209673_1000603 | Ga0209673_100060330 | 152 |
| 719 | 3300025273 | Ga0209673_1005348 | Ga0209673_10053486 | 152 |
| 720 | 3300025284 | Ga0209130_1000006 | Ga0209130_1000006506 | 152 |
| 721 | 3300025291 | Ga0209675_1036412 | Ga0209675_10364123 | 152 |
| 722 | 3300025292 | Ga0209676_1014196 | Ga0209676_10141962 | 152 |
| 723 | 3300025294 | Ga0209025_1000087 | Ga0209025_100008783 | 152 |
| 724 | 3300025294 | Ga0209025_1000199 | Ga0209025_100019940 | 152 |
| 725 | 3300025294 | Ga0209025_1002011 | Ga0209025_10020117 | 152 |
| 726 | 3300025294 | Ga0209025_1010350 | Ga0209025_10103504 | 152 |
| 727 | 3300025295 | Ga0209564_1000425 | Ga0209564_100042526 | 152 |
| 728 | 3300025295 | Ga0209564_1012875 | Ga0209564_10128754 | 152 |
| 729 | 3300025297 | Ga0209758_1000081 | Ga0209758_100008183 | 152 |
| 730 | 3300025297 | Ga0209758_1002000 | Ga0209758_100200013 | 152 |
| 731 | 3300025297 | Ga0209758_1003116 | Ga0209758_10031166 | 152 |
| 732 | 3300025297 | Ga0209758_1003638 | Ga0209758_100363813 | 152 |
| 733 | 3300025297 | Ga0209758_1008032 | Ga0209758_10080325 | 152 |
| 734 | 3300025299 | Ga0209256_1001698 | Ga0209256_10016987 | 152 |
| 735 | 3300025299 | Ga0209256_1005451 | Ga0209256_10054518 | 152 |
| 736 | 3300025299 | Ga0209256_1031272 | Ga0209256_10312722 | 152 |
| 737 | 3300025299 | Ga0209256_1051441 | Ga0209256_10514413 | 152 |
| 738 | 3300025299 | Ga0209256_1070692 | Ga0209256_10706922 | 152 |
| 739 | 3300025302 | Ga0207426_1000106 | Ga0207426_100010682 | 152 |
| 740 | 3300025303 | Ga0209051_1011758 | Ga0209051_10117587 | 152 |
| 741 | 3300025303 | Ga0209051_1021615 | Ga0209051_10216153 | 152 |
| 742 | 3300025926 | Ga0207659_10674789 | Ga0207659_106747891 | 152 |
| 743 | 3300026121 | Ga0207683_10177284 | Ga0207683_101772842 | 152 |
| 744 | 3300028379 | Ga0268266_10025861 | Ga0268266_100258614 | 152 |
| 745 | 3300028379 | Ga0268266_10763304 | Ga0268266_107633042 | 152 |
| 746 | 3300031731 | Ga0307405_10001577 | Ga0307405_1000157710 | 152 |
| 747 | 3300031911 | Ga0307412_10000728 | Ga0307412_1000072814 | 152 |
| 748 | 3300032002 | Ga0307416_100957728 | Ga0307416_1009577282 | 152 |
| 749 | 3300037471 | Ga0395905_0070011 | Ga0395905_0070011_2401_2865 | 152 |
| 750 | 3300039437 | Ga0436365_0747759 | Ga0436365_0747759_7046_7504 | 152 |
| 751 | 3300039437 | Ga0436365_1182852 | Ga0436365_1182852_2792_3250 | 152 |
| 752 | 3300039450 | Ga0436363_0671159 | Ga0436363_0671159_1738_2196 | 152 |
| 753 | 3300039453 | Ga0436362_1228876 | Ga0436362_1228876_1968_2429 | 152 |
| 754 | 3300041411 | Ga0439466_0046568 | Ga0439466_0046568_245_706 | 152 |
| 755 | 3300041411 | Ga0439466_0080570 | Ga0439466_0080570_385_849 | 152 |
| 756 | 3300041413 | Ga0439465_0006038 | Ga0439465_0006038_1136_1597 | 152 |
| 757 | 3300041413 | Ga0439465_0044117 | Ga0439465_0044117_120_584 | 152 |
| 758 | 3300041451 | Ga0451791_1486979 | Ga0451791_1486979_77_538 | 152 |
| 759 | 3300041458 | Ga0451798_0628856 | Ga0451798_0628856_155_616 | 152 |
| 760 | 3300041492 | Ga0451835_0004513 | Ga0451835_0004513_2300_2761 | 152 |
| 761 | 3300041496 | Ga0451839_1200455 | Ga0451839_1200455_1734_2195 | 152 |
| 762 | 3300041503 | Ga0451847_0585144 | Ga0451847_0585144_2295_2756 | 152 |
| 763 | 3300041507 | Ga0451851_0586227 | Ga0451851_0586227_431_892 | 152 |
| 764 | 3300041507 | Ga0451851_1332789 | Ga0451851_1332789_240_701 | 152 |
| 765 | 3300041511 | Ga0451855_0014339 | Ga0451855_0014339_90_551 | 152 |
| 766 | 3300042006 | Ga0439432_009466 | Ga0439432_009466_232_693 | 152 |
| 767 | 3300044735 | Ga0466968_0101681 | Ga0466968_0101681_767_1231 | 152 |
| 768 | 3300046492 | Ga0495585_0031255 | Ga0495585_0031255_165_638 | 152 |
| 769 | 3300046506 | Ga0495583_0038523 | Ga0495583_0038523_1350_1832 | 152 |
| 770 | 3300046507 | Ga0495606_0039845 | Ga0495606_0039845_2152_2625 | 152 |
| 771 | 3300046507 | Ga0495606_0184012 | Ga0495606_0184012_155_616 | 152 |
| 772 | 3300046512 | Ga0495610_0006212 | Ga0495610_0006212_5290_5751 | 152 |
| 773 | 3300046518 | Ga0495631_0266792 | Ga0495631_0266792_209_682 | 152 |
| 774 | 3300046519 | Ga0495632_0023614 | Ga0495632_0023614_2228_2692 | 152 |
| 775 | 3300046522 | Ga0495643_0037538 | Ga0495643_0037538_719_1222 | 152 |
| 776 | 3300046522 | Ga0495643_0099346 | Ga0495643_0099346_175_636 | 152 |
| 777 | 3300046558 | Ga0495633_0035017 | Ga0495633_0035017_1883_2344 | 152 |
| 778 | 3300046660 | Ga0495625_0067416 | Ga0495625_0067416_1712_2173 | 152 |
| 779 | 3300046660 | Ga0495625_0229256 | Ga0495625_0229256_131_613 | 152 |
| 780 | 3300046665 | Ga0495661_0204431 | Ga0495661_0204431_497_970 | 152 |
| 781 | 3300046694 | Ga0495649_0033921 | Ga0495649_0033921_93_596 | 152 |
| 782 | 3300047472 | Ga0495686_0011672 | Ga0495686_0011672_4950_5411 | 152 |
| 783 | 3300047472 | Ga0495686_0127810 | Ga0495686_0127810_506_970 | 152 |
| 784 | 3300048909 | Ga0496106_0016430 | Ga0496106_0016430_2605_3066 | 152 |
| 785 | 3300048910 | Ga0496107_0560046 | Ga0496107_0560046_268_729 | 152 |
| 786 | 3300048919 | Ga0496116_0002740 | Ga0496116_0002740_13707_14168 | 152 |
| 787 | 3300048919 | Ga0496116_0042204 | Ga0496116_0042204_621_1082 | 152 |
| 788 | 3300048919 | Ga0496116_0047842 | Ga0496116_0047842_2360_2821 | 152 |
| 789 | 3300048919 | Ga0496116_0076480 | Ga0496116_0076480_664_1125 | 152 |
| 790 | 3300048920 | Ga0496117_0011444 | Ga0496117_0011444_2640_3101 | 152 |
| 791 | 3300048920 | Ga0496117_0024779 | Ga0496117_0024779_2181_2642 | 152 |
| 792 | 3300048920 | Ga0496117_0078547 | Ga0496117_0078547_1089_1550 | 152 |
| 793 | 3300048921 | Ga0496118_0154472 | Ga0496118_0154472_79_540 | 152 |
| 794 | 3300048921 | Ga0496118_0156127 | Ga0496118_0156127_930_1391 | 152 |
| 795 | 3300048921 | Ga0496118_0184052 | Ga0496118_0184052_393_854 | 152 |
| 796 | 3300048922 | Ga0496119_0064344 | Ga0496119_0064344_832_1293 | 152 |
| 797 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_921593_922054 | 152 |
| 798 | 3300048924 | Ga0496121_0001948 | Ga0496121_0001948_32240_32704 | 152 |
| 799 | 3300048924 | Ga0496121_0033723 | Ga0496121_0033723_2036_2497 | 152 |
| 800 | 3300048924 | Ga0496121_0045342 | Ga0496121_0045342_809_1270 | 152 |
| 801 | 3300048924 | Ga0496121_0058860 | Ga0496121_0058860_55_516 | 152 |
| 802 | 3300048924 | Ga0496121_0123848 | Ga0496121_0123848_481_942 | 152 |
| 803 | 3300048924 | Ga0496121_0203937 | Ga0496121_0203937_208_669 | 152 |
| 804 | 3300048924 | Ga0496121_0257917 | Ga0496121_0257917_563_1024 | 152 |
| 805 | 3300048924 | Ga0496121_0262482 | Ga0496121_0262482_333_794 | 152 |
| 806 | 3300048924 | Ga0496121_0636799 | Ga0496121_0636799_13_477 | 152 |
| 807 | 3300048925 | Ga0496122_0023327 | Ga0496122_0023327_2343_2804 | 152 |
| 808 | 3300048925 | Ga0496122_0048526 | Ga0496122_0048526_2055_2516 | 152 |
| 809 | 3300048925 | Ga0496122_0049230 | Ga0496122_0049230_2157_2618 | 152 |
| 810 | 3300048925 | Ga0496122_0078819 | Ga0496122_0078819_992_1453 | 152 |
| 811 | 3300048925 | Ga0496122_0092237 | Ga0496122_0092237_1103_1564 | 152 |
| 812 | 3300048926 | Ga0496123_0007779 | Ga0496123_0007779_6530_6991 | 152 |
| 813 | 3300048926 | Ga0496123_0011987 | Ga0496123_0011987_1720_2181 | 152 |
| 814 | 3300048926 | Ga0496123_0035527 | Ga0496123_0035527_2143_2604 | 152 |
| 815 | 3300048926 | Ga0496123_0045367 | Ga0496123_0045367_95_556 | 152 |
| 816 | 3300048926 | Ga0496123_0050675 | Ga0496123_0050675_2241_2702 | 152 |
| 817 | 3300048926 | Ga0496123_0074486 | Ga0496123_0074486_1499_1960 | 152 |
| 818 | 3300048926 | Ga0496123_0115970 | Ga0496123_0115970_925_1386 | 152 |
| 819 | 3300048926 | Ga0496123_0128494 | Ga0496123_0128494_675_1136 | 152 |
| 820 | 3300048927 | Ga0496124_0000349 | Ga0496124_0000349_12110_12580 | 152 |
| 821 | 3300048927 | Ga0496124_0015423 | Ga0496124_0015423_2281_2742 | 152 |
| 822 | 3300048927 | Ga0496124_0043901 | Ga0496124_0043901_801_1262 | 152 |
| 823 | 3300048927 | Ga0496124_0071748 | Ga0496124_0071748_2182_2643 | 152 |
| 824 | 3300048927 | Ga0496124_0105943 | Ga0496124_0105943_1120_1581 | 152 |
| 825 | 3300048927 | Ga0496124_0169581 | Ga0496124_0169581_348_815 | 152 |
| 826 | 3300048927 | Ga0496124_0210530 | Ga0496124_0210530_745_1212 | 152 |
| 827 | 3300048927 | Ga0496124_0594332 | Ga0496124_0594332_199_666 | 152 |
| 828 | 3300048927 | Ga0496124_0680278 | Ga0496124_0680278_50_529 | 152 |
| 829 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_1035474_1035935 | 152 |
| 830 | 3300048928 | Ga0496125_0004855 | Ga0496125_0004855_875_1336 | 152 |
| 831 | 3300048928 | Ga0496125_0039868 | Ga0496125_0039868_847_1308 | 152 |
| 832 | 3300048928 | Ga0496125_0069516 | Ga0496125_0069516_1937_2398 | 152 |
| 833 | 3300048928 | Ga0496125_0167661 | Ga0496125_0167661_998_1459 | 152 |
| 834 | 3300048928 | Ga0496125_0332290 | Ga0496125_0332290_395_856 | 152 |
| 835 | 3300048928 | Ga0496125_0468510 | Ga0496125_0468510_224_685 | 152 |
| 836 | 3300048929 | Ga0496126_0000069 | Ga0496126_0000069_71704_72165 | 152 |
| 837 | 3300048929 | Ga0496126_0084495 | Ga0496126_0084495_2083_2544 | 152 |
| 838 | 3300048929 | Ga0496126_0099712 | Ga0496126_0099712_1429_1890 | 152 |
| 839 | 3300048929 | Ga0496126_0108899 | Ga0496126_0108899_1541_2002 | 152 |
| 840 | 3300048929 | Ga0496126_0122274 | Ga0496126_0122274_413_874 | 152 |
| 841 | 3300048929 | Ga0496126_0123340 | Ga0496126_0123340_1088_1549 | 152 |
| 842 | 3300048929 | Ga0496126_0151182 | Ga0496126_0151182_457_921 | 152 |
| 843 | 3300048929 | Ga0496126_0205952 | Ga0496126_0205952_74_535 | 152 |
| 844 | 3300048929 | Ga0496126_0502536 | Ga0496126_0502536_67_534 | 152 |
| 845 | 3300049459 | Ga0495678_013134 | Ga0495678_013134_3356_3817 | 152 |
| 846 | 3300049571 | Ga0501034_0118094 | Ga0501034_0118094_476_937 | 152 |
| 847 | 3300049572 | Ga0501036_0949517 | Ga0501036_0949517_183_644 | 152 |
| 848 | 3300049574 | Ga0501038_0556034 | Ga0501038_0556034_380_841 | 152 |
| 849 | 3300049579 | Ga0501043_0311036 | Ga0501043_0311036_360_821 | 152 |
| 850 | 3300049580 | Ga0501046_0180697 | Ga0501046_0180697_1085_1546 | 152 |
| 851 | 3300049581 | Ga0501047_0057902 | Ga0501047_0057902_1206_1667 | 152 |
| 852 | 3300049589 | Ga0501073_0468436 | Ga0501073_0468436_228_689 | 152 |
| 853 | 3300049744 | Ga0501083_0404206 | Ga0501083_0404206_183_644 | 152 |
| 854 | 3300050491 | nmdc:mga00v17_107251_c1 | nmdc:mga00v17_107251_c1_1007_1468 | 152 |
| 855 | 3300050491 | nmdc:mga00v17_115_c2 | nmdc:mga00v17_115_c2_45272_45736 | 152 |
| 856 | 3300050492 | nmdc:mga0yw44_37408_c1 | nmdc:mga0yw44_37408_c1_759_1223 | 152 |
| 857 | 3300050516 | nmdc:mga0sz30_172683_c1 | nmdc:mga0sz30_172683_c1_187_648 | 152 |
| 858 | 3300053111 | Ga0500572_012167 | Ga0500572_012167_1268_1729 | 152 |
| 859 | 3300053125 | Ga0500618_000227 | Ga0500618_000227_3558_4022 | 152 |
| 860 | 3300053125 | Ga0500618_002042 | Ga0500618_002042_2223_2687 | 152 |
| 861 | 3300053125 | Ga0500618_031503 | Ga0500618_031503_477_941 | 152 |
| 862 | 3300053134 | Ga0500658_0103484 | Ga0500658_0103484_328_789 | 152 |
| 863 | 3300053139 | Ga0500568_0003084 | Ga0500568_0003084_1579_2040 | 152 |
| 864 | 3300053153 | Ga0500616_0047030 | Ga0500616_0047030_82_546 | 152 |
| 865 | 3300053153 | Ga0500616_0341745 | Ga0500616_0341745_112_573 | 152 |
| 866 | 3300053156 | Ga0500622_0000757 | Ga0500622_0000757_2286_2789 | 152 |
| 867 | 3300053160 | Ga0500633_0005625 | Ga0500633_0005625_499_960 | 152 |
| 868 | 3300053177 | Ga0500636_0000070 | Ga0500636_0000070_35893_36354 | 152 |
| 869 | 3300053177 | Ga0500636_0007711 | Ga0500636_0007711_5303_5764 | 152 |
| 870 | 3300060353 | Ga0501082_0359398 | Ga0501082_0359398_735_1196 | 152 |
| 871 | iso_pu_bacteria | 2509276019 | 2509374418 | 152 |
| 872 | iso_pu_bacteria | 2516143018 | 2516208917 | 152 |
| 873 | iso_pu_bacteria | 2558860100 | 2558863445 | 152 |
| 874 | iso_pu_bacteria | 2582581299 | 2585231461 | 152 |
| 875 | iso_pu_bacteria | 2582581308 | 2585278939 | 152 |
| 876 | iso_pu_bacteria | 2585427527 | 2585530736 | 152 |
| 877 | iso_pu_bacteria | 2585427530 | 2585554916 | 152 |
| 878 | iso_pu_bacteria | 2585427608 | 2585902145 | 152 |
| 879 | iso_pu_bacteria | 2615840626 | 2616305788 | 152 |
| 880 | iso_pu_bacteria | 2615840698 | 2616553972 | 152 |
| 881 | iso_pu_bacteria | 2617270742 | 2617386741 | 152 |
| 882 | iso_pu_bacteria | 2643221550 | 2643773587 | 152 |
| 883 | iso_pu_bacteria | 2643221558 | 2643809973 | 152 |
| 884 | iso_pu_bacteria | 2643221623 | 2644132946 | 152 |
| 885 | iso_pu_bacteria | 2657244999 | 2657683225 | 152 |
| 886 | iso_pu_bacteria | 2667528174 | 2671115274 | 152 |
| 887 | iso_pu_bacteria | 2765235802 | 2765465229 | 152 |
| 888 | iso_pu_bacteria | 2775506902 | 2776271916 | 152 |
| 889 | iso_pu_bacteria | 2775506904 | 2776279567 | 152 |
| 890 | iso_pu_bacteria | 2775507266 | 2778177517 | 152 |
| 891 | iso_pu_bacteria | 2802429268 | 2804751386 | 152 |
| 892 | iso_pu_bacteria | 2818991453 | 2819639217 | 152 |
| 893 | iso_pu_bacteria | 2844163670 | 2844168476 | 152 |
| 894 | iso_pu_bacteria | 2850079185 | 2850080516 | 152 |
| 895 | iso_pu_bacteria | 2881861095 | 2881867329 | 152 |
| 896 | iso_pu_bacteria | 2885318864 | 2885324955 | 152 |
| 897 | iso_pu_bacteria | 2894652903 | 2894654847 | 152 |
| 898 | iso_pu_bacteria | 2904578770 | 2904581399 | 152 |
| 899 | iso_pu_bacteria | 2919119836 | 2919122635 | 152 |
| 900 | iso_pu_bacteria | 2919408235 | 2919409343 | 152 |
| 901 | iso_pu_bacteria | 2920760137 | 2920762836 | 152 |
| 902 | iso_pu_bacteria | 2924784321 | 2924788035 | 152 |
| 903 | iso_pu_bacteria | 2937822353 | 2937829325 | 152 |
| 904 | iso_pu_bacteria | 3005409236 | 3005412476 | 152 |
| 905 | iso_pu_bacteria | 8005246636 | 8005251280 | 152 |
| 906 | iso_pu_bacteria | 8005688590 | 8005691051 | 152 |
| 907 | iso_pu_bacteria | 8046767195 | 8046767709 | 152 |
| 908 | iso_pu_bacteria | 8054558443 | 8054562079 | 152 |
| 909 | 3300003187 | JGI25151J46595_10034315 | JGI25151J46595_100343154 | 153 |
| 910 | 3300003354 | JGI25160J50197_1000008 | JGI25160J50197_1000008192 | 153 |
| 911 | 3300003374 | JGI25161J50226_1000489 | JGI25161J50226_100048912 | 153 |
| 912 | 3300003775 | Ga0055524_1035421 | Ga0055524_10354212 | 153 |
| 913 | 3300003781 | Ga0055536_1000984 | Ga0055536_10009849 | 153 |
| 914 | 3300003791 | Ga0055530_10011768 | Ga0055530_100117685 | 153 |
| 915 | 3300003794 | Ga0055531_10017167 | Ga0055531_100171674 | 153 |
| 916 | 3300004625 | Ga0055543_1000040 | Ga0055543_100004052 | 153 |
| 917 | 3300005262 | Ga0065165_1000015 | Ga0065165_1000015193 | 153 |
| 918 | 3300005564 | Ga0070664_100558241 | Ga0070664_1005582411 | 153 |
| 919 | 3300005617 | Ga0068859_101235347 | Ga0068859_1012353472 | 153 |
| 920 | 3300005983 | Ga0081540_1047720 | Ga0081540_10477202 | 153 |
| 921 | 3300006931 | Ga0097620_101235450 | Ga0097620_1012354501 | 153 |
| 922 | 3300025208 | Ga0209436_101739 | Ga0209436_1017394 | 153 |
| 923 | 3300025245 | Ga0207425_1025968 | Ga0207425_10259681 | 153 |
| 924 | 3300025284 | Ga0209130_1000007 | Ga0209130_1000007110 | 153 |
| 925 | 3300025292 | Ga0209676_1000694 | Ga0209676_100069429 | 153 |
| 926 | 3300025294 | Ga0209025_1000580 | Ga0209025_100058019 | 153 |
| 927 | 3300025295 | Ga0209564_1001342 | Ga0209564_100134219 | 153 |
| 928 | 3300025297 | Ga0209758_1060745 | Ga0209758_10607453 | 153 |
| 929 | 3300025298 | Ga0209050_1002170 | Ga0209050_100217012 | 153 |
| 930 | 3300025299 | Ga0209256_1001781 | Ga0209256_10017816 | 153 |
| 931 | 3300025302 | Ga0207426_1000064 | Ga0207426_1000064110 | 153 |
| 932 | 3300025303 | Ga0209051_1015125 | Ga0209051_10151254 | 153 |
| 933 | 3300025304 | Ga0209257_1005277 | Ga0209257_100527710 | 153 |
| 934 | 3300025304 | Ga0209257_1038965 | Ga0209257_10389653 | 153 |
| 935 | 3300025937 | Ga0207669_10243384 | Ga0207669_102433843 | 153 |
| 936 | 3300027512 | Ga0209179_1005563 | Ga0209179_10055634 | 153 |
| 937 | 3300031824 | Ga0307413_11086396 | Ga0307413_110863962 | 153 |
| 938 | 3300031852 | Ga0307410_10108694 | Ga0307410_101086943 | 153 |
| 939 | 3300035695 | Ga0373927_0000423 | Ga0373927_0000423_21317_21787 | 153 |
| 940 | 3300037068 | Ga0373925_0004073 | Ga0373925_0004073_6545_7015 | 153 |
| 941 | 3300041413 | Ga0439465_0222994 | Ga0439465_0222994_113_580 | 153 |
| 942 | 3300041512 | Ga0451853_3777698 | Ga0451853_3777698_303_806 | 153 |
| 943 | 3300042007 | Ga0439449_0001047 | Ga0439449_0001047_5375_5842 | 153 |
| 944 | 3300046507 | Ga0495606_0010031 | Ga0495606_0010031_3890_4351 | 153 |
| 945 | 3300046515 | Ga0495620_0215919 | Ga0495620_0215919_39_503 | 153 |
| 946 | 3300047472 | Ga0495686_0002844 | Ga0495686_0002844_13418_13882 | 153 |
| 947 | 3300047472 | Ga0495686_0028624 | Ga0495686_0028624_1228_1689 | 153 |
| 948 | 3300048914 | Ga0496111_1229960 | Ga0496111_1229960_18_482 | 153 |
| 949 | 3300048924 | Ga0496121_0065852 | Ga0496121_0065852_502_963 | 153 |
| 950 | 3300048924 | Ga0496121_0619162 | Ga0496121_0619162_109_570 | 153 |
| 951 | 3300048927 | Ga0496124_0140818 | Ga0496124_0140818_780_1241 | 153 |
| 952 | 3300049569 | Ga0501032_1035752 | Ga0501032_1035752_34_498 | 153 |
| 953 | 3300049570 | Ga0501033_0002091 | Ga0501033_0002091_4068_4535 | 153 |
| 954 | 3300049570 | Ga0501033_0408738 | Ga0501033_0408738_116_580 | 153 |
| 955 | 3300049574 | Ga0501038_0164765 | Ga0501038_0164765_877_1341 | 153 |
| 956 | 3300049575 | Ga0501039_0189852 | Ga0501039_0189852_1137_1601 | 153 |
| 957 | 3300049576 | Ga0501040_0134996 | Ga0501040_0134996_468_932 | 153 |
| 958 | 3300049578 | Ga0501042_0548906 | Ga0501042_0548906_189_653 | 153 |
| 959 | 3300049591 | Ga0501075_0092368 | Ga0501075_0092368_38_502 | 153 |
| 960 | 3300049743 | Ga0501081_0306285 | Ga0501081_0306285_231_695 | 153 |
| 961 | 3300049822 | Ga0501035_0003184 | Ga0501035_0003184_12700_13167 | 153 |
| 962 | 3300049824 | Ga0501045_0048465 | Ga0501045_0048465_2517_2981 | 153 |
| 963 | 3300060353 | Ga0501082_0321173 | Ga0501082_0321173_58_522 | 153 |
| 964 | iso_pu_bacteria | 2513237351 | 2514588155 | 153 |
| 965 | iso_pu_bacteria | 2757320392 | 2757571747 | 153 |
| 966 | iso_pu_bacteria | 2871488783 | 2871493881 | 153 |
| 967 | iso_pu_bacteria | 2878753008 | 2878756457 | 153 |
| 968 | iso_pu_bacteria | 2881845957 | 2881848015 | 153 |
| 969 | iso_pu_bacteria | 2882912400 | 2882917471 | 153 |
| 970 | iso_pu_bacteria | 2903492973 | 2903502615 | 153 |
| 971 | iso_pu_bacteria | 2961170736 | 2961172746 | 153 |
| 972 | iso_pu_bacteria | 2967996073 | 2967997958 | 153 |
| 973 | iso_pu_bacteria | 2968003550 | 2968008609 | 153 |
| 974 | iso_pu_bacteria | 2970503327 | 2970505340 | 153 |
| 975 | iso_pu_bacteria | 2977821940 | 2977825638 | 153 |
| 976 | iso_pu_bacteria | 2979808191 | 2979810061 | 153 |
| 977 | iso_pu_bacteria | 8004374579 | 8004378046 | 153 |
| 978 | 3300005548 | Ga0070665_100584620 | Ga0070665_1005846202 | 154 |
| 979 | 3300006038 | Ga0075365_10053431 | Ga0075365_100534312 | 154 |
| 980 | 3300021321 | Ga0214542_1021608 | Ga0214542_10216085 | 154 |
| 981 | 3300021327 | Ga0214543_1000003 | Ga0214543_1000003517 | 154 |
| 982 | 3300025932 | Ga0207690_10147147 | Ga0207690_101471472 | 154 |
| 983 | 3300025937 | Ga0207669_10367659 | Ga0207669_103676592 | 154 |
| 984 | 3300025986 | Ga0207658_10313549 | Ga0207658_103135493 | 154 |
| 985 | 3300028379 | Ga0268266_10823368 | Ga0268266_108233683 | 154 |
| 986 | 3300028794 | Ga0307515_10000070 | Ga0307515_10000070145 | 154 |
| 987 | 3300028794 | Ga0307515_10586595 | Ga0307515_105865952 | 154 |
| 988 | 3300031456 | Ga0307513_10006330 | Ga0307513_100063305 | 154 |
| 989 | 3300032004 | Ga0307414_10391314 | Ga0307414_103913143 | 154 |
| 990 | 3300032004 | Ga0307414_10582248 | Ga0307414_105822482 | 154 |
| 991 | 3300046460 | Ga0495638_0046065 | Ga0495638_0046065_329_808 | 154 |
| 992 | 3300046507 | Ga0495606_0088887 | Ga0495606_0088887_629_1123 | 154 |
| 993 | 3300046794 | Ga0495589_0108077 | Ga0495589_0108077_377_853 | 154 |
| 994 | 3300047472 | Ga0495686_0549215 | Ga0495686_0549215_57_527 | 154 |
| 995 | 3300048917 | Ga0496114_0130392 | Ga0496114_0130392_394_888 | 154 |
| 996 | 3300049568 | Ga0501031_0258179 | Ga0501031_0258179_494_967 | 154 |
| 997 | 3300049569 | Ga0501032_0317906 | Ga0501032_0317906_454_927 | 154 |
| 998 | 3300049570 | Ga0501033_0001969 | Ga0501033_0001969_8951_9424 | 154 |
| 999 | 3300049570 | Ga0501033_0026545 | Ga0501033_0026545_945_1418 | 154 |
| 1000 | 3300049571 | Ga0501034_0285789 | Ga0501034_0285789_856_1332 | 154 |
| 1001 | 3300049571 | Ga0501034_0389914 | Ga0501034_0389914_218_691 | 154 |
| 1002 | 3300049572 | Ga0501036_1008746 | Ga0501036_1008746_55_528 | 154 |
| 1003 | 3300049573 | Ga0501037_0248906 | Ga0501037_0248906_439_912 | 154 |
| 1004 | 3300049574 | Ga0501038_0028485 | Ga0501038_0028485_258_731 | 154 |
| 1005 | 3300049574 | Ga0501038_0772873 | Ga0501038_0772873_202_675 | 154 |
| 1006 | 3300049579 | Ga0501043_0316072 | Ga0501043_0316072_702_1175 | 154 |
| 1007 | 3300049580 | Ga0501046_0110885 | Ga0501046_0110885_111_584 | 154 |
| 1008 | 3300049581 | Ga0501047_0037480 | Ga0501047_0037480_2855_3328 | 154 |
| 1009 | 3300049581 | Ga0501047_0135061 | Ga0501047_0135061_528_1001 | 154 |
| 1010 | 3300049584 | Ga0501068_0118313 | Ga0501068_0118313_976_1449 | 154 |
| 1011 | 3300049585 | Ga0501069_0405145 | Ga0501069_0405145_297_770 | 154 |
| 1012 | 3300049586 | Ga0501070_0000931 | Ga0501070_0000931_8678_9151 | 154 |
| 1013 | 3300049589 | Ga0501073_0092940 | Ga0501073_0092940_449_922 | 154 |
| 1014 | 3300049741 | Ga0501079_1136870 | Ga0501079_1136870_108_581 | 154 |
| 1015 | 3300049742 | Ga0501080_0001450 | Ga0501080_0001450_18533_19006 | 154 |
| 1016 | 3300049742 | Ga0501080_0629858 | Ga0501080_0629858_129_602 | 154 |
| 1017 | 3300049742 | Ga0501080_0854079 | Ga0501080_0854079_170_643 | 154 |
| 1018 | 3300049822 | Ga0501035_0000690 | Ga0501035_0000690_33412_33885 | 154 |
| 1019 | 3300049822 | Ga0501035_0000752 | Ga0501035_0000752_13910_14383 | 154 |
| 1020 | 3300049822 | Ga0501035_0012136 | Ga0501035_0012136_4956_5429 | 154 |
| 1021 | 3300049823 | Ga0501044_0002922 | Ga0501044_0002922_4269_4742 | 154 |
| 1022 | 3300049823 | Ga0501044_0021665 | Ga0501044_0021665_2333_2806 | 154 |
| 1023 | 3300049823 | Ga0501044_0098827 | Ga0501044_0098827_1786_2259 | 154 |
| 1024 | 3300049823 | Ga0501044_0131509 | Ga0501044_0131509_152_625 | 154 |
| 1025 | 3300050491 | nmdc:mga00v17_300630_c1 | nmdc:mga00v17_300630_c1_369_845 | 154 |
| 1026 | 3300053083 | Ga0495655_0111615 | Ga0495655_0111615_58_534 | 154 |
| 1027 | 3300053136 | Ga0500559_0003764 | Ga0500559_0003764_2796_3266 | 154 |
| 1028 | 3300053140 | Ga0500573_0027095 | Ga0500573_0027095_1818_2285 | 154 |
| 1029 | 3300053151 | Ga0500604_0093981 | Ga0500604_0093981_421_894 | 154 |
| 1030 | 3300053158 | Ga0500627_0228484 | Ga0500627_0228484_337_813 | 154 |
| 1031 | 3300060353 | Ga0501082_0476446 | Ga0501082_0476446_307_780 | 154 |
| 1032 | iso_pu_bacteria | 8057575449 | 8057582165 | 154 |
| 1033 | 3300002704 | JGI25155J39150_1000032 | JGI25155J39150_100003225 | 155 |
| 1034 | 3300002705 | JGI25156J39149_1000129 | JGI25156J39149_100012925 | 155 |
| 1035 | 3300002737 | JGI25162J39368_1001169 | JGI25162J39368_100116917 | 155 |
| 1036 | 3300002737 | JGI25162J39368_1001727 | JGI25162J39368_100172710 | 155 |
| 1037 | 3300002737 | JGI25162J39368_1003463 | JGI25162J39368_10034635 | 155 |
| 1038 | 3300002738 | JGI25154J39366_1000324 | JGI25154J39366_10003245 | 155 |
| 1039 | 3300002741 | JGI25157J39369_1000061 | JGI25157J39369_100006125 | 155 |
| 1040 | 3300002741 | JGI25157J39369_1000624 | JGI25157J39369_100062419 | 155 |
| 1041 | 3300002987 | JGI25159J45721_1000136 | JGI25159J45721_100013627 | 155 |
| 1042 | 3300003214 | JGI25165J46597_1000630 | JGI25165J46597_100063020 | 155 |
| 1043 | 3300003214 | JGI25165J46597_1000944 | JGI25165J46597_100094417 | 155 |
| 1044 | 3300003214 | JGI25165J46597_1020336 | JGI25165J46597_10203362 | 155 |
| 1045 | 3300003323 | rootH1_10117786 | rootH1_101177864 | 155 |
| 1046 | 3300003354 | JGI25160J50197_1000015 | JGI25160J50197_100001536 | 155 |
| 1047 | 3300003374 | JGI25161J50226_1000005 | JGI25161J50226_1000005205 | 155 |
| 1048 | 3300004625 | Ga0055543_1000012 | Ga0055543_100001237 | 155 |
| 1049 | 3300005262 | Ga0065165_1000125 | Ga0065165_1000125104 | 155 |
| 1050 | 3300005331 | Ga0070670_100009220 | Ga0070670_1000092202 | 155 |
| 1051 | 3300005341 | Ga0070691_10442712 | Ga0070691_104427122 | 155 |
| 1052 | 3300005539 | Ga0068853_101286883 | Ga0068853_1012868831 | 155 |
| 1053 | 3300005578 | Ga0068854_100244926 | Ga0068854_1002449262 | 155 |
| 1054 | 3300005616 | Ga0068852_100682644 | Ga0068852_1006826442 | 155 |
| 1055 | 3300005834 | Ga0068851_10039881 | Ga0068851_100398814 | 155 |
| 1056 | 3300005844 | Ga0068862_101206625 | Ga0068862_1012066252 | 155 |
| 1057 | 3300006048 | Ga0075363_100251247 | Ga0075363_1002512472 | 155 |
| 1058 | 3300006353 | Ga0075370_10023755 | Ga0075370_100237554 | 155 |
| 1059 | 3300009036 | Ga0105244_10382877 | Ga0105244_103828772 | 155 |
| 1060 | 3300009093 | Ga0105240_10000032 | Ga0105240_10000032183 | 155 |
| 1061 | 3300009545 | Ga0105237_10002365 | Ga0105237_100023658 | 155 |
| 1062 | 3300009551 | Ga0105238_10742544 | Ga0105238_107425441 | 155 |
| 1063 | 3300010375 | Ga0105239_10013157 | Ga0105239_100131579 | 155 |
| 1064 | 3300013104 | Ga0157370_10003636 | Ga0157370_1000363611 | 155 |
| 1065 | 3300014497 | Ga0182008_10075376 | Ga0182008_100753763 | 155 |
| 1066 | 3300015262 | Ga0182007_10000460 | Ga0182007_1000046020 | 155 |
| 1067 | 3300025206 | Ga0209435_100042 | Ga0209435_10004226 | 155 |
| 1068 | 3300025233 | Ga0209437_100033 | Ga0209437_100033310 | 155 |
| 1069 | 3300025233 | Ga0209437_100075 | Ga0209437_100075196 | 155 |
| 1070 | 3300025246 | Ga0209646_1000145 | Ga0209646_100014526 | 155 |
| 1071 | 3300025246 | Ga0209646_1005325 | Ga0209646_10053252 | 155 |
| 1072 | 3300025250 | Ga0209026_1000120 | Ga0209026_100012054 | 155 |
| 1073 | 3300025250 | Ga0209026_1000160 | Ga0209026_100016026 | 155 |
| 1074 | 3300025253 | Ga0209677_100845 | Ga0209677_1008459 | 155 |
| 1075 | 3300025256 | Ga0209759_1000177 | Ga0209759_100017726 | 155 |
| 1076 | 3300025256 | Ga0209759_1000288 | Ga0209759_100028849 | 155 |
| 1077 | 3300025261 | Ga0209233_1000056 | Ga0209233_100005622 | 155 |
| 1078 | 3300025261 | Ga0209233_1000064 | Ga0209233_1000064112 | 155 |
| 1079 | 3300025261 | Ga0209233_1000209 | Ga0209233_100020996 | 155 |
| 1080 | 3300025272 | Ga0209455_1021938 | Ga0209455_10219383 | 155 |
| 1081 | 3300025284 | Ga0209130_1000018 | Ga0209130_1000018234 | 155 |
| 1082 | 3300025302 | Ga0207426_1000044 | Ga0207426_1000044155 | 155 |
| 1083 | 3300025913 | Ga0207695_10000024 | Ga0207695_10000024184 | 155 |
| 1084 | 3300025914 | Ga0207671_10000718 | Ga0207671_1000071819 | 155 |
| 1085 | 3300025924 | Ga0207694_10869492 | Ga0207694_108694922 | 155 |
| 1086 | 3300025925 | Ga0207650_10005961 | Ga0207650_100059612 | 155 |
| 1087 | 3300025981 | Ga0207640_10155131 | Ga0207640_101551312 | 155 |
| 1088 | 3300026041 | Ga0207639_10137030 | Ga0207639_101370301 | 155 |
| 1089 | 3300027312 | Ga0209371_1001249 | Ga0209371_100124912 | 155 |
| 1090 | 3300028794 | Ga0307515_10003909 | Ga0307515_100039092 | 155 |
| 1091 | 3300030500 | Ga0268256_1000660 | Ga0268256_10006609 | 155 |
| 1092 | 3300041498 | Ga0451841_0820092 | Ga0451841_0820092_249_731 | 155 |
| 1093 | 3300044694 | Ga0466963_0020949 | Ga0466963_0020949_1439_1966 | 155 |
| 1094 | 3300044765 | Ga0466970_0107199 | Ga0466970_0107199_503_1030 | 155 |
| 1095 | 3300044842 | Ga0466957_0092513 | Ga0466957_0092513_517_1044 | 155 |
| 1096 | 3300045049 | Ga0466959_0307358 | Ga0466959_0307358_589_1056 | 155 |
| 1097 | 3300045836 | Ga0466958_0033441 | Ga0466958_0033441_2287_2814 | 155 |
| 1098 | 3300046459 | Ga0495629_0026890 | Ga0495629_0026890_310_795 | 155 |
| 1099 | 3300046460 | Ga0495638_0016460 | Ga0495638_0016460_2230_2703 | 155 |
| 1100 | 3300046476 | Ga0495662_0031142 | Ga0495662_0031142_419_904 | 155 |
| 1101 | 3300046477 | Ga0495664_0183156 | Ga0495664_0183156_570_1055 | 155 |
| 1102 | 3300046501 | Ga0495607_0273420 | Ga0495607_0273420_219_689 | 155 |
| 1103 | 3300046507 | Ga0495606_0425488 | Ga0495606_0425488_43_513 | 155 |
| 1104 | 3300046538 | Ga0495609_0219341 | Ga0495609_0219341_104_574 | 155 |
| 1105 | 3300046557 | Ga0495622_0106271 | Ga0495622_0106271_284_769 | 155 |
| 1106 | 3300046660 | Ga0495625_0399071 | Ga0495625_0399071_99_569 | 155 |
| 1107 | 3300046663 | Ga0495635_0582818 | Ga0495635_0582818_219_704 | 155 |
| 1108 | 3300046674 | Ga0495588_0048206 | Ga0495588_0048206_1085_1570 | 155 |
| 1109 | 3300046675 | Ga0495657_0072858 | Ga0495657_0072858_1319_1804 | 155 |
| 1110 | 3300046679 | Ga0495623_0257965 | Ga0495623_0257965_348_833 | 155 |
| 1111 | 3300046690 | Ga0495624_0185559 | Ga0495624_0185559_405_890 | 155 |
| 1112 | 3300046809 | Ga0495600_0123827 | Ga0495600_0123827_1099_1584 | 155 |
| 1113 | 3300047317 | Ga0495604_0028877 | Ga0495604_0028877_3056_3541 | 155 |
| 1114 | 3300047317 | Ga0495604_0609226 | Ga0495604_0609226_105_590 | 155 |
| 1115 | 3300047443 | Ga0495687_095090 | Ga0495687_095090_358_828 | 155 |
| 1116 | 3300048088 | Ga0495602_0358943 | Ga0495602_0358943_472_957 | 155 |
| 1117 | 3300048904 | Ga0496101_0421716 | Ga0496101_0421716_95_565 | 155 |
| 1118 | 3300048906 | Ga0496103_0043920 | Ga0496103_0043920_287_757 | 155 |
| 1119 | 3300048908 | Ga0496105_0555077 | Ga0496105_0555077_302_772 | 155 |
| 1120 | 3300048910 | Ga0496107_0358993 | Ga0496107_0358993_103_573 | 155 |
| 1121 | 3300048919 | Ga0496116_0061983 | Ga0496116_0061983_901_1371 | 155 |
| 1122 | 3300048920 | Ga0496117_0080253 | Ga0496117_0080253_532_1002 | 155 |
| 1123 | 3300048921 | Ga0496118_0010030 | Ga0496118_0010030_7611_8081 | 155 |
| 1124 | 3300048922 | Ga0496119_0036191 | Ga0496119_0036191_467_937 | 155 |
| 1125 | 3300048922 | Ga0496119_0039161 | Ga0496119_0039161_2496_2975 | 155 |
| 1126 | 3300048922 | Ga0496119_0042057 | Ga0496119_0042057_2278_2748 | 155 |
| 1127 | 3300048923 | Ga0496120_0117948 | Ga0496120_0117948_95_565 | 155 |
| 1128 | 3300048924 | Ga0496121_0018097 | Ga0496121_0018097_2685_3155 | 155 |
| 1129 | 3300048924 | Ga0496121_0265597 | Ga0496121_0265597_317_793 | 155 |
| 1130 | 3300048925 | Ga0496122_0031570 | Ga0496122_0031570_1710_2180 | 155 |
| 1131 | 3300048925 | Ga0496122_0050641 | Ga0496122_0050641_265_735 | 155 |
| 1132 | 3300048926 | Ga0496123_0052247 | Ga0496123_0052247_338_808 | 155 |
| 1133 | 3300048926 | Ga0496123_0124906 | Ga0496123_0124906_585_1055 | 155 |
| 1134 | 3300048927 | Ga0496124_0054556 | Ga0496124_0054556_583_1053 | 155 |
| 1135 | 3300048927 | Ga0496124_0109569 | Ga0496124_0109569_1564_2034 | 155 |
| 1136 | 3300048928 | Ga0496125_0083675 | Ga0496125_0083675_508_978 | 155 |
| 1137 | 3300048929 | Ga0496126_0167746 | Ga0496126_0167746_1010_1480 | 155 |
| 1138 | 3300048929 | Ga0496126_0335600 | Ga0496126_0335600_636_1112 | 155 |
| 1139 | 3300050491 | nmdc:mga00v17_651025_c1 | nmdc:mga00v17_651025_c1_154_627 | 155 |
| 1140 | 3300050492 | nmdc:mga0yw44_332942_c1 | nmdc:mga0yw44_332942_c1_51_524 | 155 |
| 1141 | 3300053085 | Ga0495619_0308281 | Ga0495619_0308281_37_522 | 155 |
| 1142 | 3300053119 | Ga0500595_037747 | Ga0500595_037747_397_876 | 155 |
| 1143 | 3300053125 | Ga0500618_012633 | Ga0500618_012633_381_851 | 155 |
| 1144 | 3300053125 | Ga0500618_066038 | Ga0500618_066038_166_636 | 155 |
| 1145 | 3300053148 | Ga0500590_001637 | Ga0500590_001637_1609_2094 | 155 |
| 1146 | 3300053177 | Ga0500636_0139974 | Ga0500636_0139974_725_1210 | 155 |
| 1147 | 3300053177 | Ga0500636_0290197 | Ga0500636_0290197_153_626 | 155 |
| 1148 | iso_pu_bacteria | 2510461069 | 2510839661 | 155 |
| 1149 | iso_pu_bacteria | 2818991448 | 2819611564 | 155 |
| 1150 | iso_pu_bacteria | 8005645114 | 8005649880 | 155 |
| 1151 | iso_pu_bacteria | 8005682033 | 8005684535 | 155 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nvj-assembly1.cif.gz_A | deletion mutant (delta 141) of molybdopterin synthase | 0.9649 | 4 | 125 |
| 1nvj-assembly3.cif.gz_E | deletion mutant (delta 141) of molybdopterin synthase | 0.9613 | 4 | 124 |
| 1nvj-assembly1.cif.gz_B | deletion mutant (delta 141) of molybdopterin synthase | 0.9497 | 4 | 125 |
| 1nvj-assembly2.cif.gz_C | deletion mutant (delta 141) of molybdopterin synthase | 0.9477 | 4 | 125 |
| 1nvj-assembly1.cif.gz_A | deletion mutant (delta 141) of molybdopterin synthase | 0.9332 | 4 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nvjC00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9477 | 4 | 125 | 3.90.1170.40 |
| af_Q86HF4_1_145_3.90.1170.40 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9218 | 3 | 139 | 3.90.1170.40 |
| 1fmaE00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9206 | 3 | 151 | 3.90.1170.40 |
| af_Q6AY59_40_191_3.90.1170.40 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9151 | 4 | 139 | 3.90.1170.40 |
| 1nvjC00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9122 | 4 | 125 | 3.90.1170.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353G046-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9813 | 1 | 152 |
GO:0006777
GO:0030366 |
| AF-A0A7W6G3Q2-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9693 | 2 | 151 |
GO:0006777
GO:0030366 |
| AF-A0A1H5BDV4-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.967 | 4 | 152 |
GO:0006777
GO:0030366 |
| AF-A0A530A852-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9665 | 14 | 118 |
GO:0006777
GO:0030366 |
| AF-Q92QX5-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9648 | 1 | 152 |
GO:0006777
GO:0030366 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar