F490744

General Info

Members Datasets Scaffolds Average Seq Length
1143 423 1074 188

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0570193|Ga0466960_0570193_29_649
Length 206
Sequence VLFCVLPSKCKMVWTGRFDMLLMIDNYDSFTYNLVQYFGELGEEVRTYRNDEITLDEIAAMNPDRICISPGPCTPHEAGISVPLLQHFAGKTPILGVCLGHQSIGAAFGGKVIRAKQVMHGKTSVIAHTGVGVFKDLPSPYTVIRYHSLAIERASLPDCLEVTAWTDDGEIMGVRHKEFNIQGVQFHPESILSEHGHALLKNFLSA

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
6 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
7 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
8 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
9 2643221556 Massilia sp. Root1485 Isolate Unclassified
10 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
11 2643221638 Duganella sp. Root336D2 Isolate Unclassified
12 2643221645 Massilia sp. Root351 Isolate Unclassified
13 2643221664 Massilia sp. Root418 Isolate Unclassified
14 2643221684 Massilia sp. Root133 Isolate Unclassified
15 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
16 2738541280 Massilia sp. GV090 Isolate Unclassified
17 2738541297 Duganella sp. GV083 Isolate Unclassified
18 2738541300 Massilia sp. GV016 Isolate Unclassified
19 2738541357 Duganella sp. GV053 Isolate Unclassified
20 2738543003 Duganella sp. GV066 Isolate Unclassified
21 2738543018 Massilia sp. GV045 Isolate Unclassified
22 2738543026 Duganella sp. GV089 Isolate Unclassified
23 2738543029 Duganella sp. GV039 Isolate Unclassified
24 2738543030 Massilia sp. GV097 Isolate Unclassified
25 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
26 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
27 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
28 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
29 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
30 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
31 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
32 2818991436 Collimonas arenae 515 Isolate Unclassified
33 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
34 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
35 2821131069 Duganella sp. 1224 Isolate Unclassified
36 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
37 2842711865 Duganella sp. R-73148 Isolate Unclassified
38 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
39 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
40 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
41 2857553236 Duganella sp. R-74557 Isolate Unclassified
42 2857558681 Duganella sp. R-74565 Isolate Unclassified
43 2857564685 Duganella sp. R-74599 Isolate Unclassified
44 2858950400 Achromobacter sp. K91 Isolate Unclassified
45 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
46 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
47 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
48 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
49 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
50 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
51 2904424332 Duganella sp. 1411 Isolate Rhizosphere
52 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
53 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
54 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
55 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
56 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
57 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
58 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
59 2919476304 Duganella sp. 3397 Isolate Unclassified
60 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
61 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
62 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
63 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
64 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
65 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
66 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
67 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
68 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
69 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
70 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
71 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
72 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
73 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
74 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
75 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
76 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
77 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
78 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
79 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
81 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
82 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
83 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
84 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
85 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
86 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
87 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
88 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
89 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
90 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
91 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
92 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
93 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
94 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
95 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
96 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
97 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
98 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
99 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
100 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
101 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
102 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
103 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
104 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
105 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
106 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
107 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
108 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
109 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
110 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
111 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
112 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
113 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
122 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
144 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
145 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
146 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
153 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
155 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
156 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
157 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
160 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
161 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
162 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
200 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
205 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
206 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
207 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
208 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
209 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
210 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
220 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
230 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
237 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
238 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
239 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
240 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
241 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
242 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
243 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
246 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
247 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
248 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
249 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
252 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
255 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
256 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
257 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
263 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
269 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
270 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
273 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
290 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
291 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
292 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
293 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
294 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
295 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
296 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
297 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
298 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
299 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
303 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
304 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
305 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
306 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
314 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
315 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
316 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
323 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
327 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
328 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
329 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
330 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
334 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
335 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
338 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
339 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
340 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
341 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
342 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
343 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
344 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
345 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
346 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
349 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
350 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
351 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
352 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
353 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
356 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
357 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
358 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
359 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
360 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
361 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
362 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
363 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
364 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
365 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
366 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
369 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
370 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
371 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
372 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
373 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
374 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
375 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
376 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
377 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
378 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
383 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
384 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
385 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
386 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
387 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
388 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
389 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
390 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
391 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
392 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
393 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
394 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
395 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
396 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
399 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
400 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
403 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
404 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
405 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
406 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
407 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
408 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
409 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
410 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
411 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
412 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
413 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
418 639633007 Azoarcus olearius BH72 Isolate Unclassified
419 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
420 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
421 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
422 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
423 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.83
Metatranscriptomes 1.14
Isolates 6.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.92
Nodule 0.7
Rhizoplane 2.8
Rhizosphere 79.09
Stem 0
Stem Tuber 0
Unclassified 8.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000336 3300002704 Bacteria 15086
2 JGI25155J39150_1000485 3300002704 Bacteria 9807
3 JGI25156J39149_1000267 3300002705 Bacteria 35297
4 JGI25156J39149_1013381 3300002705 Bacteria 1744
5 JGI25154J39366_1000739 3300002738 Bacteria 14651
6 JGI25154J39366_1001209 3300002738 Bacteria 9784
7 JGI25154J39366_1002200 3300002738 Bacteria 5398
8 JGI25158J39367_1003079 3300002739 Bacteria 2624
9 JGI25157J39369_1000372 3300002741 Bacteria 30863
10 JGI25157J39369_1000495 3300002741 Bacteria 24307
11 JGI25164J39214_1003913 3300002772 Bacteria 1791
12 JGI25150J39212_1000910 3300002774 Bacteria 9622
13 JGI25150J39212_1003626 3300002774 Bacteria 3583
14 JGI25159J45721_1002200 3300002987 Bacteria 7576
15 JGI25159J45721_1005724 3300002987 Bacteria 3849
16 JGI25165J46597_1000713 3300003214 Bacteria 26161
17 JGI25153J46596_10018531 3300003215 Bacteria 2700
18 JGI25160J50197_1003453 3300003354 Bacteria 7072
19 JGI25161J50226_1006300 3300003374 Bacteria 2165
20 Ga0007410J51695_1015624 3300003574 Bacteria 2390
21 Ga0007410J51695_1044871 3300003574 Bacteria 2302
22 Ga0007409J51694_1007308 3300003575 Bacteria 2829
23 Ga0007409J51694_1023914 3300003575 Bacteria 3351
24 Ga0007416J51690_1029024 3300003577 Bacteria 2453
25 Ga0032354_1058597 3300003693 Bacteria 1089
26 Ga0055538_1000062 3300003751 Bacteria 105260
27 Ga0055538_1000281 3300003751 Bacteria 26161
28 Ga0055539_1000093 3300003752 Bacteria 105260
29 Ga0055539_1000305 3300003752 Bacteria 26161
30 Ga0055533_1000105 3300003756 Bacteria 105260
31 Ga0055533_1000286 3300003756 Bacteria 26161
32 Ga0055532_1000034 3300003758 Bacteria 210984
33 Ga0055525_1000018 3300003759 Bacteria 393974
34 Ga0055525_1000137 3300003759 Bacteria 105260
35 Ga0055525_1000405 3300003759 Bacteria 26891
36 Ga0055526_1001033 3300003771 Bacteria 20365
37 Ga0055526_1005708 3300003771 Bacteria 7051
38 Ga0055537_1000580 3300003773 Bacteria 20336
39 Ga0055537_1009165 3300003773 Bacteria 2210
40 Ga0055524_1002755 3300003775 Bacteria 8837
41 Ga0055524_1010041 3300003775 Bacteria 3798
42 Ga0055534_1000283 3300003784 Bacteria 34520
43 Ga0055528_1000495 3300003790 Bacteria 31111
44 Ga0055530_10050684 3300003791 Bacteria 966
45 Ga0055541_1000063 3300003841 Bacteria 105260
46 Ga0055541_1000198 3300003841 Bacteria 26161
47 Ga0055543_1003826 3300004625 Bacteria 4273
48 Ga0065165_1002857 3300005262 Bacteria 13394
49 Ga0065165_1004075 3300005262 Bacteria 9468
50 Ga0065714_10171696 3300005288 Bacteria 999
51 Ga0065715_10042333 3300005293 Bacteria 959
52 Ga0070658_10710717 3300005327 Bacteria 872
53 Ga0070670_100086718 3300005331 Bacteria 2690
54 Ga0070682_100098361 3300005337 Bacteria 1927
55 Ga0070682_100577228 3300005337 Bacteria 884
56 Ga0070660_100016657 3300005339 Bacteria 5341
57 Ga0070660_100044451 3300005339 Bacteria 3398
58 Ga0070661_100051855 3300005344 Bacteria 3003
59 Ga0070659_100001752 3300005366 Bacteria 15587
60 Ga0070659_100082019 3300005366 Bacteria 2576
61 Ga0070659_100216063 3300005366 Bacteria 1581
62 Ga0070662_100057197 3300005457 Bacteria 2833
63 Ga0070662_100692878 3300005457 Bacteria 861
64 Ga0068867_100056392 3300005459 Bacteria 2907
65 Ga0070706_100007456 3300005467 Bacteria 10255
66 Ga0070707_100111118 3300005468 Bacteria 2658
67 Ga0070699_100042824 3300005518 Bacteria 3918
68 Ga0070679_100691385 3300005530 Bacteria 963
69 Ga0070697_100618561 3300005536 Bacteria 953
70 Ga0068855_100016570 3300005563 Bacteria 8864
71 Ga0068855_100035272 3300005563 Bacteria 5958
72 Ga0068855_101052987 3300005563 Bacteria 852
73 Ga0068855_101571899 3300005563 Bacteria 673
74 Ga0070664_100003553 3300005564 Bacteria 12597
75 Ga0070664_100298359 3300005564 Bacteria 1456
76 Ga0068857_100326958 3300005577 Bacteria 1417
77 Ga0068854_100017165 3300005578 Bacteria 4840
78 Ga0068856_100163375 3300005614 Bacteria 2238
79 Ga0068852_100004237 3300005616 Bacteria 10127
80 Ga0068852_100004430 3300005616 Bacteria 9925
81 Ga0068863_100298029 3300005841 Bacteria 1564
82 Ga0070717_10473844 3300006028 Bacteria 1130
83 Ga0075366_10002981 3300006195 Bacteria 8821
84 Ga0075428_100377519 3300006844 Bacteria 1520
85 Ga0075430_100258757 3300006846 Bacteria 1442
86 Ga0075431_100002888 3300006847 Bacteria 16633
87 Ga0079104_1005592 3300006946 Bacteria 4978
88 Ga0079104_1008552 3300006946 Bacteria 3567
89 Ga0099826_10000010 3300006948 Bacteria 314346
90 Ga0105244_10002041 3300009036 Bacteria 15556
91 Ga0105244_10003441 3300009036 Bacteria 11284
92 Ga0105244_10035827 3300009036 Bacteria 2604
93 Ga0105244_10110311 3300009036 Bacteria 1339
94 Ga0105244_10174679 3300009036 Bacteria 1021
95 Ga0105250_10120377 3300009092 Bacteria 1079
96 Ga0105240_10001608 3300009093 Bacteria 38292
97 Ga0105240_10016336 3300009093 Bacteria 10052
98 Ga0105240_10190542 3300009093 Bacteria 2412
99 Ga0105241_10120376 3300009174 Bacteria 2113
100 Ga0105242_10037198 3300009176 Bacteria 3909
101 Ga0105242_10180899 3300009176 Bacteria 1860
102 Ga0105237_10010944 3300009545 Bacteria 9627
103 Ga0105238_10000763 3300009551 Bacteria 33477
104 Ga0105239_10010387 3300010375 Bacteria 10421
105 Ga0105239_10368622 3300010375 Bacteria 1623
106 Ga0105239_10961472 3300010375 Bacteria 981
107 Ga0157373_10711950 3300013100 Bacteria 736
108 Ga0157371_10039633 3300013102 Bacteria 3369
109 Ga0157370_11246340 3300013104 Bacteria 671
110 Ga0157369_10000804 3300013105 Bacteria 40126
111 Ga0157369_10574078 3300013105 Bacteria 1165
112 Ga0157374_10000924 3300013296 Bacteria 25554
113 Ga0157374_11006092 3300013296 Bacteria 853
114 Ga0157378_10091922 3300013297 Bacteria 2760
115 Ga0157378_11144502 3300013297 Bacteria 816
116 Ga0163162_10379875 3300013306 Bacteria 1546
117 Ga0182008_10003605 3300014497 Bacteria 9271
118 Ga0182008_10056599 3300014497 Bacteria 1937
119 Ga0182006_1000033 3300015261 Bacteria 238180
120 Ga0182006_1000080 3300015261 Bacteria 122163
121 Ga0182006_1058779 3300015261 Bacteria 1457
122 Ga0182007_10000042 3300015262 Bacteria 111840
123 Ga0182007_10030574 3300015262 Bacteria 1839
124 Ga0182005_1000016 3300015265 Bacteria 346889
125 Ga0182005_1000024 3300015265 Bacteria 238256
126 Ga0182005_1001434 3300015265 Bacteria 9601
127 Ga0163161_10012023 3300017792 Bacteria 6004
128 Ga0163161_10012229 3300017792 Bacteria 5953
129 Ga0163161_10087249 3300017792 Bacteria 2304
130 Ga0213872_10000430 3300021361 Bacteria 34377
131 Ga0213872_10001856 3300021361 Bacteria 13064
132 Ga0213872_10002336 3300021361 Bacteria 11273
133 Ga0213872_10004434 3300021361 Bacteria 7457
134 Ga0213872_10024411 3300021361 Bacteria 2781
135 Ga0213872_10115807 3300021361 Bacteria 1187
136 Ga0209435_100007 3300025206 Bacteria 516857
137 Ga0209435_100176 3300025206 Bacteria 19214
138 Ga0209436_100769 3300025208 Bacteria 13300
139 Ga0209784_100010 3300025224 Bacteria 683664
140 Ga0209784_100021 3300025224 Bacteria 408534
141 Ga0209566_100008 3300025225 Bacteria 683664
142 Ga0209566_100119 3300025225 Bacteria 105312
143 Ga0209674_100019 3300025226 Bacteria 683664
144 Ga0209674_100036 3300025226 Bacteria 408534
145 Ga0209147_100017 3300025229 Bacteria 516857
146 Ga0209563_100011 3300025230 Bacteria 1187808
147 Ga0209563_100021 3300025230 Bacteria 683764
148 Ga0209563_100040 3300025230 Bacteria 408534
149 Ga0207427_100759 3300025231 Bacteria 14690
150 Ga0209437_100019 3300025233 Bacteria 683764
151 Ga0209437_100332 3300025233 Bacteria 58796
152 Ga0209437_105938 3300025233 Bacteria 2056
153 Ga0209437_107841 3300025233 Bacteria 1720
154 Ga0209258_101277 3300025242 Bacteria 9457
155 Ga0207425_1000021 3300025245 Bacteria 367537
156 Ga0207425_1000829 3300025245 Bacteria 15420
157 Ga0209646_1000044 3300025246 Bacteria 334596
158 Ga0209646_1000107 3300025246 Bacteria 163112
159 Ga0209646_1000190 3300025246 Bacteria 75772
160 Ga0209026_1000063 3300025250 Bacteria 211324
161 Ga0209026_1005858 3300025250 Bacteria 3170
162 Ga0209026_1012017 3300025250 Bacteria 1527
163 Ga0209677_100011 3300025253 Bacteria 683664
164 Ga0209677_100023 3300025253 Bacteria 408534
165 Ga0209677_101699 3300025253 Bacteria 9186
166 Ga0209148_1000237 3300025254 Bacteria 88748
167 Ga0209759_1000048 3300025256 Bacteria 224817
168 Ga0209759_1000198 3300025256 Bacteria 95052
169 Ga0209129_1000020 3300025258 Bacteria 457053
170 Ga0209233_1000025 3300025261 Bacteria 683764
171 Ga0209565_1000055 3300025263 Bacteria 201184
172 Ga0209565_1000677 3300025263 Bacteria 21295
173 Ga0209565_1002957 3300025263 Bacteria 5775
174 Ga0209565_1003264 3300025263 Bacteria 5342
175 Ga0209455_1000070 3300025272 Bacteria 307867
176 Ga0209455_1029838 3300025272 Bacteria 936
177 Ga0209673_1000040 3300025273 Bacteria 312633
178 Ga0209673_1003338 3300025273 Bacteria 9600
179 Ga0209130_1000169 3300025284 Bacteria 95167
180 Ga0209130_1002260 3300025284 Bacteria 9942
181 Ga0209675_1000052 3300025291 Bacteria 201332
182 Ga0209675_1001299 3300025291 Bacteria 14837
183 Ga0209025_1000473 3300025294 Bacteria 78078
184 Ga0209025_1001876 3300025294 Bacteria 24626
185 Ga0209564_1000027 3300025295 Bacteria 518458
186 Ga0209564_1000047 3300025295 Bacteria 368031
187 Ga0209564_1000063 3300025295 Bacteria 318515
188 Ga0209564_1000271 3300025295 Bacteria 108422
189 Ga0209564_1001666 3300025295 Bacteria 21297
190 Ga0209564_1028858 3300025295 Bacteria 1761
191 Ga0209758_1000288 3300025297 Bacteria 99096
192 Ga0209758_1000436 3300025297 Bacteria 70342
193 Ga0209050_1000050 3300025298 Bacteria 362578
194 Ga0209256_1000054 3300025299 Bacteria 298431
195 Ga0209256_1000100 3300025299 Bacteria 201246
196 Ga0209256_1000754 3300025299 Bacteria 42096
197 Ga0207426_1003112 3300025302 Bacteria 9466
198 Ga0209051_1028245 3300025303 Bacteria 2219
199 Ga0207656_10071281 3300025321 Bacteria 1544
200 Ga0207655_1001651 3300025728 Bacteria 19767
201 Ga0207655_1016701 3300025728 Bacteria 3999
202 Ga0207655_1064734 3300025728 Bacteria 1392
203 Ga0207705_10034051 3300025909 Bacteria 3641
204 Ga0207684_10008262 3300025910 Bacteria 9268
205 Ga0207654_10022625 3300025911 Bacteria 3356
206 Ga0207695_10008939 3300025913 Bacteria 12470
207 Ga0207695_10012318 3300025913 Bacteria 10275
208 Ga0207695_10136114 3300025913 Bacteria 2409
209 Ga0207671_10004652 3300025914 Bacteria 12996
210 Ga0207671_10309446 3300025914 Bacteria 1249
211 Ga0207657_10012688 3300025919 Bacteria 8304
212 Ga0207657_10231476 3300025919 Bacteria 1478
213 Ga0207657_10525715 3300025919 Bacteria 926
214 Ga0207649_10024118 3300025920 Bacteria 3532
215 Ga0207649_10493530 3300025920 Bacteria 930
216 Ga0207652_10464901 3300025921 Bacteria 1140
217 Ga0207694_10000343 3300025924 Bacteria 44142
218 Ga0207694_10858659 3300025924 Bacteria 767
219 Ga0207650_10063319 3300025925 Bacteria 2765
220 Ga0207690_10000951 3300025932 Bacteria 18563
221 Ga0207690_10323880 3300025932 Bacteria 1212
222 Ga0207690_10330334 3300025932 Bacteria 1201
223 Ga0207686_10036176 3300025934 Bacteria 2970
224 Ga0207709_10388720 3300025935 Bacteria 1063
225 Ga0207679_10004406 3300025945 Bacteria 8766
226 Ga0207667_10000912 3300025949 Bacteria 37632
227 Ga0207667_10007366 3300025949 Bacteria 13242
228 Ga0207667_10317294 3300025949 Bacteria 1592
229 Ga0207667_10550318 3300025949 Bacteria 1167
230 Ga0207640_10041316 3300025981 Bacteria 2932
231 Ga0207639_10170095 3300026041 Bacteria 1844
232 Ga0207678_10439887 3300026067 Bacteria 1132
233 Ga0207702_10168886 3300026078 Bacteria 2004
234 Ga0207641_10366349 3300026088 Bacteria 1377
235 Ga0207648_10086029 3300026089 Bacteria 2742
236 Ga0207674_10182190 3300026116 Bacteria 2052
237 Ga0207674_10281988 3300026116 Bacteria 1609
238 Ga0207698_10044764 3300026142 Bacteria 3329
239 Ga0207698_10095163 3300026142 Bacteria 2451
240 Ga0207698_10385474 3300026142 Bacteria 1335
241 Ga0209281_1005374 3300027111 Bacteria 3569
242 Ga0209282_1000009 3300027666 Bacteria 233366
243 Ga0209974_10027183 3300027876 Bacteria 1892
244 Ga0265336_10006403 3300028666 Bacteria 4244
245 Ga0265336_10048575 3300028666 Bacteria 1286
246 Ga0265338_10066959 3300028800 Bacteria 3105
247 Ga0265324_10000002 3300029957 Bacteria 382754
248 Ga0265324_10000616 3300029957 Bacteria 24232
249 Ga0268256_1004381 3300030500 Bacteria 5881
250 Ga0316177_1075487 3300030731 Bacteria 5574
251 Ga0316178_1172473 3300030735 Bacteria 1017
252 Ga0316180_1064742 3300030736 Bacteria 1510
253 Ga0316181_1137224 3300030744 Bacteria 4539
254 Ga0316182_1021746 3300030745 Bacteria 1163
255 Ga0316182_1361262 3300030745 Bacteria 1173
256 Ga0265332_10000030 3300031238 Bacteria 175141
257 Ga0265332_10001445 3300031238 Bacteria 13313
258 Ga0265328_10000016 3300031239 Bacteria 132959
259 Ga0265325_10002841 3300031241 Bacteria 11549
260 Ga0265325_10007848 3300031241 Bacteria 6354
261 Ga0265331_10009812 3300031250 Bacteria 5340
262 Ga0265331_10013920 3300031250 Bacteria 4303
263 Ga0265331_10054133 3300031250 Bacteria 1911
264 Ga0265331_10089997 3300031250 Bacteria 1419
265 Ga0265331_10158693 3300031250 Bacteria 1025
266 Ga0265327_10000528 3300031251 Bacteria 65837
267 Ga0265327_10000674 3300031251 Bacteria 54882
268 Ga0265327_10001509 3300031251 Bacteria 28791
269 Ga0265327_10015618 3300031251 Bacteria 4886
270 Ga0265327_10018721 3300031251 Bacteria 4281
271 Ga0265327_10059966 3300031251 Bacteria 1947
272 Ga0265327_10123875 3300031251 Bacteria 1222
273 Ga0265327_10216212 3300031251 Bacteria 863
274 Ga0265316_10090702 3300031344 Bacteria 2332
275 Ga0265316_10158523 3300031344 Bacteria 1693
276 Ga0265316_10376779 3300031344 Bacteria 1024
277 Ga0307509_10000076 3300031507 Bacteria 138855
278 Ga0307408_100000432 3300031548 Bacteria 37289
279 Ga0307408_100002407 3300031548 Bacteria 13173
280 Ga0307408_100010617 3300031548 Bacteria 6076
281 Ga0265313_10040874 3300031595 Bacteria 2289
282 Ga0316575_10003832 3300031665 Bacteria 5243
283 Ga0265314_10001144 3300031711 Bacteria 30747
284 Ga0265314_10008929 3300031711 Bacteria 8538
285 Ga0265314_10118654 3300031711 Bacteria 1669
286 Ga0307405_10084076 3300031731 Bacteria 2088
287 Ga0307405_10270046 3300031731 Bacteria 1275
288 Ga0307413_10141496 3300031824 Bacteria 1663
289 Ga0307518_10057653 3300031838 Bacteria 2821
290 Ga0307412_10000169 3300031911 Bacteria 46494
291 Ga0307416_100000975 3300032002 Bacteria 15137
292 Ga0307416_100104940 3300032002 Bacteria 2472
293 Ga0307414_10174903 3300032004 Bacteria 1720
294 Ga0307414_10285519 3300032004 Bacteria 1389
295 Ga0307411_10541983 3300032005 Bacteria 991
296 Ga0316583_10021200 3300032133 Bacteria 2330
297 Ga0316583_10069475 3300032133 Bacteria 1232
298 Ga0316582_0049684 3300036647 Bacteria 2654
299 Ga0395899_0000521 3300037312 Bacteria 42304
300 Ga0395899_0002474 3300037312 Bacteria 14991
301 Ga0395899_0002806 3300037312 Bacteria 14038
302 Ga0395899_0003830 3300037312 Bacteria 11871
303 Ga0395899_0018674 3300037312 Bacteria 5269
304 Ga0395899_0125972 3300037312 Bacteria 1832
305 Ga0395899_0126723 3300037312 Bacteria 1825
306 Ga0395900_0006506 3300037418 Bacteria 12173
307 Ga0395900_0010081 3300037418 Bacteria 9664
308 Ga0395900_0014022 3300037418 Bacteria 8184
309 Ga0395900_0031672 3300037418 Bacteria 5435
310 Ga0395900_0035466 3300037418 Bacteria 5137
311 Ga0395900_0113125 3300037418 Bacteria 2786
312 Ga0395900_0181240 3300037418 Bacteria 2140
313 Ga0395900_0285610 3300037418 Bacteria 1640
314 Ga0395900_0289530 3300037418 Bacteria 1627
315 Ga0395900_0622000 3300037418 Bacteria 1018
316 Ga0395898_0000559 3300037466 Bacteria 69751
317 Ga0395898_0089880 3300037466 Bacteria 2955
318 Ga0395898_0478763 3300037466 Bacteria 1184
319 Ga0395898_0508579 3300037466 Bacteria 1145
320 Ga0395898_0690689 3300037466 Bacteria 962
321 Ga0395898_0892151 3300037466 Bacteria 827
322 Ga0395905_0010442 3300037471 Bacteria 9034
323 Ga0395905_0013127 3300037471 Bacteria 7952
324 Ga0395905_0036632 3300037471 Bacteria 4608
325 Ga0395905_0036694 3300037471 Bacteria 4604
326 Ga0395905_0055914 3300037471 Bacteria 3693
327 Ga0395905_0093364 3300037471 Bacteria 2822
328 Ga0395901_0000328 3300038443 Bacteria 58470
329 Ga0395901_0000824 3300038443 Bacteria 34332
330 Ga0395901_0002710 3300038443 Bacteria 17843
331 Ga0395901_0002897 3300038443 Bacteria 17321
332 Ga0395901_0020765 3300038443 Bacteria 6723
333 Ga0395901_0066242 3300038443 Bacteria 3762
334 Ga0395901_0117619 3300038443 Bacteria 2793
335 Ga0400483_005643 3300039062 Bacteria 2692
336 Ga0400483_266454 3300039062 Bacteria 3843
337 Ga0436361_0013073 3300039447 Bacteria 17617
338 Ga0436361_0303014 3300039447 Bacteria 21994
339 Ga0436361_0314274 3300039447 Bacteria 1808
340 Ga0436361_0512442 3300039447 Bacteria 20430
341 Ga0436361_0544664 3300039447 Bacteria 11764
342 Ga0436361_0930389 3300039447 Bacteria 10390
343 Ga0436361_1012850 3300039447 Bacteria 830
344 Ga0436361_1027676 3300039447 Bacteria 838
345 Ga0436361_1072133 3300039447 Bacteria 3944
346 Ga0436361_1091442 3300039447 Bacteria 27914
347 Ga0436361_1097952 3300039447 Bacteria 1349
348 Ga0436361_1206124 3300039447 Bacteria 9470
349 Ga0439436_0086795 3300041404 Bacteria 871
350 Ga0451837_0319601 3300041494 Bacteria 1101
351 Ga0439448_0000161 3300042005 Bacteria 13290
352 Ga0439449_0009520 3300042007 Bacteria 3681
353 Ga0439450_017711 3300042008 Bacteria 1489
354 Ga0439450_042434 3300042008 Bacteria 1060
355 Ga0439450_053924 3300042008 Bacteria 960
356 Ga0450904_007543 3300042139 Bacteria 1079
357 Ga0451577_0000002 3300042876 Bacteria 1731375
358 Ga0451577_0000345 3300042876 Bacteria 87020
359 Ga0451577_0071284 3300042876 Bacteria 3099
360 Ga0451577_0219478 3300042876 Bacteria 1718
361 Ga0451577_0407278 3300042876 Bacteria 1234
362 Ga0451577_0689600 3300042876 Bacteria 925
363 Ga0451577_0743976 3300042876 Bacteria 887
364 Ga0451577_0944695 3300042876 Bacteria 775
365 Ga0466969_0250847 3300044656 Bacteria 802
366 Ga0466972_0000420 3300044658 Bacteria 22023
367 Ga0466972_0003973 3300044658 Bacteria 7370
368 Ga0466972_0011040 3300044658 Bacteria 4535
369 Ga0466977_0107028 3300044666 Bacteria 1834
370 Ga0453683_0000013 3300044673 Bacteria 371932
371 Ga0466965_0002121 3300044683 Bacteria 8329
372 Ga0466965_0028860 3300044683 Bacteria 2697
373 Ga0466965_0029552 3300044683 Bacteria 2667
374 Ga0466965_0031596 3300044683 Bacteria 2582
375 Ga0466965_0036795 3300044683 Bacteria 2402
376 Ga0466965_0073626 3300044683 Bacteria 1720
377 Ga0466966_0001854 3300044684 Bacteria 13710
378 Ga0466966_0006887 3300044684 Bacteria 7530
379 Ga0466966_0029262 3300044684 Bacteria 3584
380 Ga0466966_0082568 3300044684 Bacteria 1999
381 Ga0466961_0068851 3300044693 Bacteria 2247
382 Ga0466964_0007888 3300044706 Bacteria 3987
383 Ga0466964_0018884 3300044706 Bacteria 2647
384 Ga0466964_0260780 3300044706 Bacteria 858
385 Ga0453684_0000002 3300044712 Bacteria 1731375
386 Ga0453684_0000040 3300044712 Bacteria 690210
387 Ga0453684_0000065 3300044712 Bacteria 468481
388 Ga0453684_0000694 3300044712 Bacteria 119688
389 Ga0453684_0010268 3300044712 Bacteria 16038
390 Ga0453684_0109392 3300044712 Bacteria 3362
391 Ga0453684_1610308 3300044712 Bacteria 666
392 Ga0466971_0002015 3300044719 Bacteria 8591
393 Ga0466971_0162361 3300044719 Bacteria 1046
394 Ga0466968_0009040 3300044735 Bacteria 3831
395 Ga0466968_0210388 3300044735 Bacteria 913
396 Ga0466957_0001920 3300044842 Bacteria 11037
397 Ga0466957_0018243 3300044842 Bacteria 4119
398 Ga0466957_0076144 3300044842 Bacteria 2083
399 Ga0466960_0257561 3300044901 Bacteria 971
400 Ga0466960_0570193 3300044901 Bacteria 669
401 Ga0466959_0002185 3300045049 Bacteria 12440
402 Ga0466959_0025858 3300045049 Bacteria 4353
403 Ga0466959_0155315 3300045049 Bacteria 1611
404 Ga0451576_0000006 3300045051 Bacteria 949698
405 Ga0451576_0000037 3300045051 Bacteria 372173
406 Ga0451576_0002868 3300045051 Bacteria 24693
407 Ga0451576_0005999 3300045051 Bacteria 15024
408 Ga0451576_0199277 3300045051 Bacteria 2091
409 Ga0451576_0359886 3300045051 Bacteria 1524
410 Ga0466958_0000123 3300045836 Bacteria 25381
411 Ga0466967_0652134 3300045976 Bacteria 1041
412 Ga0495617_000022 3300046452 Bacteria 185975
413 Ga0495617_000075 3300046452 Bacteria 78250
414 Ga0495617_001209 3300046452 Bacteria 11631
415 Ga0495617_018396 3300046452 Bacteria 2362
416 Ga0495617_101153 3300046452 Bacteria 936
417 Ga0495627_000011 3300046453 Bacteria 354522
418 Ga0495627_000398 3300046453 Bacteria 38966
419 Ga0495627_028660 3300046453 Bacteria 1777
420 Ga0495627_030153 3300046453 Bacteria 1720
421 Ga0495592_0002825 3300046454 Bacteria 12317
422 Ga0495603_0219775 3300046455 Bacteria 1096
423 Ga0495603_0333361 3300046455 Bacteria 870
424 Ga0495590_0000057 3300046457 Bacteria 93720
425 Ga0495590_0000143 3300046457 Bacteria 43197
426 Ga0495590_0003098 3300046457 Bacteria 6801
427 Ga0495590_0005737 3300046457 Bacteria 4877
428 Ga0495629_0020396 3300046459 Bacteria 4733
429 Ga0495629_0041378 3300046459 Bacteria 3242
430 Ga0495638_0001680 3300046460 Bacteria 19581
431 Ga0495638_0005569 3300046460 Bacteria 9312
432 Ga0495638_0029512 3300046460 Bacteria 3537
433 Ga0495638_0142822 3300046460 Bacteria 1395
434 Ga0495638_0279409 3300046460 Bacteria 908
435 Ga0495638_0294735 3300046460 Bacteria 876
436 Ga0495638_0350140 3300046460 Bacteria 780
437 Ga0495638_0469701 3300046460 Bacteria 639
438 Ga0495653_0000044 3300046463 Bacteria 115591
439 Ga0495653_0003313 3300046463 Bacteria 12931
440 Ga0495653_0028893 3300046463 Bacteria 4432
441 Ga0495653_0030963 3300046463 Bacteria 4256
442 Ga0495653_0062600 3300046463 Bacteria 2810
443 Ga0495653_0142416 3300046463 Bacteria 1684
444 Ga0495653_0220831 3300046463 Bacteria 1274
445 Ga0495650_0000082 3300046471 Bacteria 239477
446 Ga0495650_0000254 3300046471 Bacteria 103512
447 Ga0495650_0001173 3300046471 Bacteria 27987
448 Ga0495650_0001749 3300046471 Bacteria 19780
449 Ga0495650_0003298 3300046471 Bacteria 11915
450 Ga0495650_0005094 3300046471 Bacteria 8689
451 Ga0495650_0012103 3300046471 Bacteria 4666
452 Ga0495580_0291017 3300046472 Bacteria 1113
453 Ga0495582_0027191 3300046473 Bacteria 3134
454 Ga0495582_0317982 3300046473 Bacteria 896
455 Ga0495605_0000098 3300046474 Bacteria 109816
456 Ga0495605_0000102 3300046474 Bacteria 107430
457 Ga0495605_0000153 3300046474 Bacteria 88955
458 Ga0495605_0002046 3300046474 Bacteria 12721
459 Ga0495605_0020353 3300046474 Bacteria 3526
460 Ga0495605_0037236 3300046474 Bacteria 2448
461 Ga0495605_0051571 3300046474 Bacteria 2003
462 Ga0495605_0118230 3300046474 Bacteria 1203
463 Ga0495605_0119063 3300046474 Bacteria 1198
464 Ga0495605_0127029 3300046474 Bacteria 1152
465 Ga0495605_0176519 3300046474 Bacteria 941
466 Ga0495605_0185627 3300046474 Bacteria 912
467 Ga0495639_0099019 3300046475 Bacteria 1375
468 Ga0495584_0000005 3300046491 Bacteria 306957
469 Ga0495584_0000232 3300046491 Bacteria 40218
470 Ga0495584_0000729 3300046491 Bacteria 21708
471 Ga0495584_0002317 3300046491 Bacteria 10849
472 Ga0495584_0008319 3300046491 Bacteria 5372
473 Ga0495584_0009911 3300046491 Bacteria 4896
474 Ga0495584_0016425 3300046491 Bacteria 3774
475 Ga0495584_0050942 3300046491 Bacteria 2085
476 Ga0495584_0072746 3300046491 Bacteria 1727
477 Ga0495584_0142839 3300046491 Bacteria 1215
478 Ga0495584_0263303 3300046491 Bacteria 876
479 Ga0495584_0480564 3300046491 Bacteria 632
480 Ga0495585_0000023 3300046492 Bacteria 149218
481 Ga0495585_0000152 3300046492 Bacteria 74325
482 Ga0495585_0000444 3300046492 Bacteria 39574
483 Ga0495585_0004011 3300046492 Bacteria 9694
484 Ga0495585_0022356 3300046492 Bacteria 3630
485 Ga0495585_0036679 3300046492 Bacteria 2763
486 Ga0495585_0063062 3300046492 Bacteria 2034
487 Ga0495585_0065031 3300046492 Bacteria 1998
488 Ga0495585_0081256 3300046492 Bacteria 1755
489 Ga0495585_0086044 3300046492 Bacteria 1698
490 Ga0495585_0093181 3300046492 Bacteria 1620
491 Ga0495585_0110487 3300046492 Bacteria 1462
492 Ga0495585_0120150 3300046492 Bacteria 1390
493 Ga0495585_0124453 3300046492 Bacteria 1361
494 Ga0495585_0127601 3300046492 Bacteria 1341
495 Ga0495585_0130882 3300046492 Bacteria 1320
496 Ga0495585_0198599 3300046492 Bacteria 1022
497 Ga0495594_0014891 3300046499 Bacteria 4081
498 Ga0495594_0067330 3300046499 Bacteria 1987
499 Ga0495594_0068128 3300046499 Bacteria 1976
500 Ga0495594_0111098 3300046499 Bacteria 1545
501 Ga0495594_0203838 3300046499 Bacteria 1127
502 Ga0495596_0000032 3300046500 Bacteria 102282
503 Ga0495596_0001270 3300046500 Bacteria 14619
504 Ga0495596_0004904 3300046500 Bacteria 6418
505 Ga0495596_0019014 3300046500 Bacteria 2826
506 Ga0495596_0019824 3300046500 Bacteria 2758
507 Ga0495596_0064880 3300046500 Bacteria 1420
508 Ga0495596_0104091 3300046500 Bacteria 1102
509 Ga0495596_0140228 3300046500 Bacteria 938
510 Ga0495596_0215517 3300046500 Bacteria 745
511 Ga0495596_0219493 3300046500 Bacteria 738
512 Ga0495607_0018756 3300046501 Bacteria 4400
513 Ga0495607_0021757 3300046501 Bacteria 4032
514 Ga0495607_0034462 3300046501 Bacteria 3071
515 Ga0495607_0053231 3300046501 Bacteria 2340
516 Ga0495607_0071833 3300046501 Bacteria 1928
517 Ga0495607_0075941 3300046501 Bacteria 1860
518 Ga0495607_0082535 3300046501 Bacteria 1763
519 Ga0495607_0094427 3300046501 Bacteria 1613
520 Ga0495607_0142834 3300046501 Bacteria 1233
521 Ga0495607_0156528 3300046501 Bacteria 1161
522 Ga0495607_0170248 3300046501 Bacteria 1100
523 Ga0495607_0201691 3300046501 Bacteria 984
524 Ga0495607_0304687 3300046501 Bacteria 749
525 Ga0495583_0000106 3300046506 Bacteria 140932
526 Ga0495583_0000150 3300046506 Bacteria 117772
527 Ga0495583_0000597 3300046506 Bacteria 49120
528 Ga0495583_0001383 3300046506 Bacteria 24824
529 Ga0495583_0001918 3300046506 Bacteria 19228
530 Ga0495583_0002413 3300046506 Bacteria 16045
531 Ga0495583_0016522 3300046506 Bacteria 3962
532 Ga0495583_0019473 3300046506 Bacteria 3541
533 Ga0495583_0032678 3300046506 Bacteria 2509
534 Ga0495583_0055535 3300046506 Bacteria 1789
535 Ga0495583_0153492 3300046506 Bacteria 953
536 Ga0495583_0208027 3300046506 Bacteria 793
537 Ga0495606_0000080 3300046507 Bacteria 161866
538 Ga0495606_0000090 3300046507 Bacteria 154737
539 Ga0495606_0000099 3300046507 Bacteria 150950
540 Ga0495606_0000524 3300046507 Bacteria 62049
541 Ga0495606_0001629 3300046507 Bacteria 29255
542 Ga0495606_0002603 3300046507 Bacteria 20634
543 Ga0495606_0002891 3300046507 Bacteria 18970
544 Ga0495606_0003267 3300046507 Bacteria 17378
545 Ga0495606_0086803 3300046507 Bacteria 1932
546 Ga0495606_0156832 3300046507 Bacteria 1331
547 Ga0495606_0167075 3300046507 Bacteria 1279
548 Ga0495606_0167282 3300046507 Bacteria 1278
549 Ga0495606_0177366 3300046507 Bacteria 1231
550 Ga0495606_0273276 3300046507 Bacteria 927
551 Ga0495606_0287086 3300046507 Bacteria 897
552 Ga0495606_0360638 3300046507 Bacteria 768
553 Ga0495606_0482262 3300046507 Bacteria 629
554 Ga0495608_0026533 3300046511 Bacteria 3948
555 Ga0495610_0000017 3300046512 Bacteria 365675
556 Ga0495610_0000668 3300046512 Bacteria 33359
557 Ga0495610_0051728 3300046512 Bacteria 1997
558 Ga0495610_0056760 3300046512 Bacteria 1881
559 Ga0495610_0094937 3300046512 Bacteria 1345
560 Ga0495610_0149659 3300046512 Bacteria 997
561 Ga0495616_0000490 3300046513 Bacteria 30167
562 Ga0495616_0002388 3300046513 Bacteria 12495
563 Ga0495616_0004647 3300046513 Bacteria 8621
564 Ga0495616_0006823 3300046513 Bacteria 6878
565 Ga0495616_0016924 3300046513 Bacteria 4026
566 Ga0495616_0018127 3300046513 Bacteria 3872
567 Ga0495616_0018885 3300046513 Bacteria 3769
568 Ga0495616_0027167 3300046513 Bacteria 3039
569 Ga0495616_0029168 3300046513 Bacteria 2915
570 Ga0495616_0052218 3300046513 Bacteria 2035
571 Ga0495616_0140557 3300046513 Bacteria 1099
572 Ga0495616_0166939 3300046513 Bacteria 986
573 Ga0495616_0209388 3300046513 Bacteria 853
574 Ga0495620_0025372 3300046515 Bacteria 2805
575 Ga0495628_0000382 3300046516 Bacteria 40502
576 Ga0495630_0290113 3300046517 Bacteria 1250
577 Ga0495631_0001332 3300046518 Bacteria 15128
578 Ga0495631_0001436 3300046518 Bacteria 14479
579 Ga0495631_0017621 3300046518 Bacteria 3374
580 Ga0495631_0021527 3300046518 Bacteria 3002
581 Ga0495631_0089877 3300046518 Bacteria 1322
582 Ga0495631_0108701 3300046518 Bacteria 1192
583 Ga0495631_0132606 3300046518 Bacteria 1070
584 Ga0495631_0178075 3300046518 Bacteria 911
585 Ga0495631_0256240 3300046518 Bacteria 745
586 Ga0495631_0264638 3300046518 Bacteria 732
587 Ga0495631_0348127 3300046518 Bacteria 630
588 Ga0495632_0000052 3300046519 Bacteria 132992
589 Ga0495632_0000396 3300046519 Bacteria 40964
590 Ga0495632_0001555 3300046519 Bacteria 18930
591 Ga0495632_0003734 3300046519 Bacteria 10656
592 Ga0495632_0012494 3300046519 Bacteria 4897
593 Ga0495632_0077299 3300046519 Bacteria 1591
594 Ga0495632_0229594 3300046519 Bacteria 837
595 Ga0495637_0000018 3300046520 Bacteria 186671
596 Ga0495637_0000195 3300046520 Bacteria 47191
597 Ga0495637_0025136 3300046520 Bacteria 2686
598 Ga0495637_0157208 3300046520 Bacteria 854
599 Ga0495643_0000109 3300046522 Bacteria 135859
600 Ga0495643_0000250 3300046522 Bacteria 78905
601 Ga0495643_0000914 3300046522 Bacteria 31057
602 Ga0495643_0001163 3300046522 Bacteria 25714
603 Ga0495643_0014484 3300046522 Bacteria 4691
604 Ga0495643_0020420 3300046522 Bacteria 3817
605 Ga0495643_0074658 3300046522 Bacteria 1775
606 Ga0495643_0167799 3300046522 Bacteria 1075
607 Ga0495643_0169250 3300046522 Bacteria 1069
608 Ga0495643_0173777 3300046522 Bacteria 1051
609 Ga0495643_0288040 3300046522 Bacteria 753
610 Ga0495644_0001124 3300046523 Bacteria 10982
611 Ga0495644_0003935 3300046523 Bacteria 5846
612 Ga0495644_0012464 3300046523 Bacteria 3269
613 Ga0495644_0033210 3300046523 Bacteria 1949
614 Ga0495644_0036962 3300046523 Bacteria 1842
615 Ga0495644_0049248 3300046523 Bacteria 1581
616 Ga0495644_0105342 3300046523 Bacteria 1068
617 Ga0495644_0131017 3300046523 Bacteria 955
618 Ga0495644_0138769 3300046523 Bacteria 928
619 Ga0495644_0161425 3300046523 Bacteria 859
620 Ga0495648_0001108 3300046524 Bacteria 27307
621 Ga0495648_0001296 3300046524 Bacteria 24870
622 Ga0495648_0001297 3300046524 Bacteria 24870
623 Ga0495648_0001425 3300046524 Bacteria 23386
624 Ga0495648_0003753 3300046524 Bacteria 13223
625 Ga0495648_0012427 3300046524 Bacteria 6353
626 Ga0495648_0015868 3300046524 Bacteria 5445
627 Ga0495648_0030615 3300046524 Bacteria 3555
628 Ga0495648_0049127 3300046524 Bacteria 2589
629 Ga0495648_0081899 3300046524 Bacteria 1834
630 Ga0495648_0103442 3300046524 Bacteria 1566
631 Ga0495648_0120682 3300046524 Bacteria 1409
632 Ga0495648_0124831 3300046524 Bacteria 1377
633 Ga0495648_0169639 3300046524 Bacteria 1120
634 Ga0495648_0221552 3300046524 Bacteria 932
635 Ga0495663_0018991 3300046525 Bacteria 1961
636 Ga0495663_0027435 3300046525 Bacteria 1671
637 Ga0495663_0080205 3300046525 Bacteria 1050
638 Ga0495663_0097680 3300046525 Bacteria 964
639 Ga0495666_0006871 3300046526 Bacteria 5714
640 Ga0495666_0007557 3300046526 Bacteria 5437
641 Ga0495666_0089356 3300046526 Bacteria 1454
642 Ga0495666_0136337 3300046526 Bacteria 1145
643 Ga0495642_0000529 3300046528 Bacteria 19421
644 Ga0495642_0003891 3300046528 Bacteria 5852
645 Ga0495642_0004563 3300046528 Bacteria 5366
646 Ga0495642_0022005 3300046528 Bacteria 2509
647 Ga0495642_0049932 3300046528 Bacteria 1719
648 Ga0495642_0055624 3300046528 Bacteria 1633
649 Ga0495642_0091444 3300046528 Bacteria 1288
650 Ga0495642_0095315 3300046528 Bacteria 1262
651 Ga0495642_0097224 3300046528 Bacteria 1250
652 Ga0495642_0128850 3300046528 Bacteria 1088
653 Ga0495642_0135331 3300046528 Bacteria 1062
654 Ga0495652_0195423 3300046529 Bacteria 1540
655 Ga0495652_0225042 3300046529 Bacteria 1407
656 Ga0495654_0000030 3300046530 Bacteria 216715
657 Ga0495654_0018430 3300046530 Bacteria 3658
658 Ga0495654_0021405 3300046530 Bacteria 3363
659 Ga0495654_0154397 3300046530 Bacteria 1012
660 Ga0495665_0001301 3300046531 Bacteria 13308
661 Ga0495665_0034596 3300046531 Bacteria 2701
662 Ga0495640_0244079 3300046533 Bacteria 1126
663 Ga0495586_0003956 3300046535 Bacteria 7954
664 Ga0495586_0348397 3300046535 Bacteria 850
665 Ga0495587_0106740 3300046536 Bacteria 1610
666 Ga0495587_0212022 3300046536 Bacteria 1093
667 Ga0495598_0015527 3300046537 Bacteria 1925
668 Ga0495609_0000007 3300046538 Bacteria 398812
669 Ga0495609_0001531 3300046538 Bacteria 15203
670 Ga0495609_0002820 3300046538 Bacteria 10412
671 Ga0495609_0005405 3300046538 Bacteria 6723
672 Ga0495609_0006790 3300046538 Bacteria 5791
673 Ga0495609_0053145 3300046538 Bacteria 1801
674 Ga0495609_0087078 3300046538 Bacteria 1361
675 Ga0495609_0090129 3300046538 Bacteria 1333
676 Ga0495609_0094483 3300046538 Bacteria 1298
677 Ga0495609_0112477 3300046538 Bacteria 1174
678 Ga0495609_0167361 3300046538 Bacteria 929
679 Ga0495621_0167216 3300046539 Bacteria 872
680 Ga0495597_0001115 3300046542 Bacteria 20308
681 Ga0495597_0001285 3300046542 Bacteria 18457
682 Ga0495597_0001411 3300046542 Bacteria 17326
683 Ga0495597_0002378 3300046542 Bacteria 12035
684 Ga0495597_0004502 3300046542 Bacteria 7634
685 Ga0495597_0018041 3300046542 Bacteria 3315
686 Ga0495597_0018630 3300046542 Bacteria 3255
687 Ga0495597_0059212 3300046542 Bacteria 1672
688 Ga0495597_0176075 3300046542 Bacteria 866
689 Ga0495597_0217646 3300046542 Bacteria 759
690 Ga0495645_0068890 3300046543 Bacteria 2554
691 Ga0495622_0000044 3300046557 Bacteria 115528
692 Ga0495622_0002393 3300046557 Bacteria 9126
693 Ga0495622_0004973 3300046557 Bacteria 6157
694 Ga0495622_0031549 3300046557 Bacteria 2476
695 Ga0495622_0031647 3300046557 Bacteria 2471
696 Ga0495622_0185930 3300046557 Bacteria 930
697 Ga0495622_0271346 3300046557 Bacteria 743
698 Ga0495633_0000917 3300046558 Bacteria 24985
699 Ga0495633_0003343 3300046558 Bacteria 10770
700 Ga0495633_0006937 3300046558 Bacteria 6622
701 Ga0495633_0008903 3300046558 Bacteria 5597
702 Ga0495633_0018586 3300046558 Bacteria 3527
703 Ga0495633_0023285 3300046558 Bacteria 3069
704 Ga0495633_0059388 3300046558 Bacteria 1793
705 Ga0495633_0097204 3300046558 Bacteria 1367
706 Ga0495633_0195396 3300046558 Bacteria 929
707 Ga0495633_0237567 3300046558 Bacteria 832
708 Ga0495633_0349354 3300046558 Bacteria 670
709 Ga0495656_0052339 3300046615 Bacteria 1750
710 Ga0495656_0090382 3300046615 Bacteria 1399
711 Ga0495656_0176549 3300046615 Bacteria 1047
712 Ga0495668_0000035 3300046616 Bacteria 240241
713 Ga0495668_0000211 3300046616 Bacteria 84615
714 Ga0495668_0000286 3300046616 Bacteria 69771
715 Ga0495668_0000939 3300046616 Bacteria 32535
716 Ga0495668_0001545 3300046616 Bacteria 21835
717 Ga0495668_0004452 3300046616 Bacteria 9939
718 Ga0495668_0007872 3300046616 Bacteria 6738
719 Ga0495668_0066663 3300046616 Bacteria 1980
720 Ga0495668_0069634 3300046616 Bacteria 1934
721 Ga0495668_0110644 3300046616 Bacteria 1502
722 Ga0495668_0111339 3300046616 Bacteria 1497
723 Ga0495668_0124532 3300046616 Bacteria 1410
724 Ga0495668_0157375 3300046616 Bacteria 1244
725 Ga0495668_0251588 3300046616 Bacteria 967
726 Ga0495634_0029850 3300046642 Bacteria 3771
727 Ga0495634_0185328 3300046642 Bacteria 1301
728 Ga0495611_0001030 3300046648 Bacteria 14761
729 Ga0495611_0003988 3300046648 Bacteria 6425
730 Ga0495611_0006487 3300046648 Bacteria 4986
731 Ga0495611_0012387 3300046648 Bacteria 3626
732 Ga0495611_0019917 3300046648 Bacteria 2884
733 Ga0495611_0024927 3300046648 Bacteria 2603
734 Ga0495611_0030738 3300046648 Bacteria 2362
735 Ga0495611_0058343 3300046648 Bacteria 1750
736 Ga0495611_0184440 3300046648 Bacteria 974
737 Ga0495611_0245871 3300046648 Bacteria 830
738 Ga0495625_0000338 3300046660 Bacteria 71524
739 Ga0495625_0001765 3300046660 Bacteria 25007
740 Ga0495625_0016076 3300046660 Bacteria 5897
741 Ga0495625_0032153 3300046660 Bacteria 3895
742 Ga0495625_0032657 3300046660 Bacteria 3857
743 Ga0495625_0159609 3300046660 Bacteria 1511
744 Ga0495625_0229305 3300046660 Bacteria 1213
745 Ga0495625_0244011 3300046660 Bacteria 1168
746 Ga0495625_0464422 3300046660 Bacteria 780
747 Ga0495635_0008609 3300046663 Bacteria 7123
748 Ga0495635_0117569 3300046663 Bacteria 1814
749 Ga0495659_0000139 3300046664 Bacteria 32158
750 Ga0495659_0006513 3300046664 Bacteria 3687
751 Ga0495659_0012720 3300046664 Bacteria 2731
752 Ga0495659_0021812 3300046664 Bacteria 2161
753 Ga0495661_0000074 3300046665 Bacteria 120402
754 Ga0495661_0014026 3300046665 Bacteria 5371
755 Ga0495661_0024464 3300046665 Bacteria 3908
756 Ga0495661_0024989 3300046665 Bacteria 3865
757 Ga0495661_0050895 3300046665 Bacteria 2504
758 Ga0495661_0056989 3300046665 Bacteria 2334
759 Ga0495661_0081170 3300046665 Bacteria 1869
760 Ga0495661_0090282 3300046665 Bacteria 1744
761 Ga0495661_0095657 3300046665 Bacteria 1681
762 Ga0495661_0097206 3300046665 Bacteria 1663
763 Ga0495661_0170266 3300046665 Bacteria 1162
764 Ga0495661_0170462 3300046665 Bacteria 1161
765 Ga0495661_0178616 3300046665 Bacteria 1126
766 Ga0495661_0194602 3300046665 Bacteria 1065
767 Ga0495661_0218634 3300046665 Bacteria 988
768 Ga0495661_0276444 3300046665 Bacteria 848
769 Ga0495661_0465967 3300046665 Bacteria 606
770 Ga0495588_0000451 3300046674 Bacteria 20713
771 Ga0495588_0012930 3300046674 Bacteria 3961
772 Ga0495588_0037807 3300046674 Bacteria 2453
773 Ga0495588_0056552 3300046674 Bacteria 2025
774 Ga0495588_0124955 3300046674 Bacteria 1356
775 Ga0495588_0136992 3300046674 Bacteria 1292
776 Ga0495588_0183519 3300046674 Bacteria 1106
777 Ga0495588_0209771 3300046674 Bacteria 1028
778 Ga0495599_0009879 3300046678 Bacteria 5840
779 Ga0495599_0302397 3300046678 Bacteria 965
780 Ga0495623_0010353 3300046679 Bacteria 6037
781 Ga0495623_0089894 3300046679 Bacteria 1886
782 Ga0495623_0186117 3300046679 Bacteria 1203
783 Ga0495623_0264807 3300046679 Bacteria 961
784 Ga0495646_0315081 3300046680 Bacteria 825
785 Ga0495669_0000101 3300046684 Bacteria 53876
786 Ga0495669_0000495 3300046684 Bacteria 18130
787 Ga0495669_0001145 3300046684 Bacteria 10993
788 Ga0495669_0081917 3300046684 Bacteria 1482
789 Ga0495669_0093504 3300046684 Bacteria 1390
790 Ga0495669_0174437 3300046684 Bacteria 1023
791 Ga0495613_0026824 3300046689 Bacteria 4290
792 Ga0495613_0392189 3300046689 Bacteria 948
793 Ga0495624_0004359 3300046690 Bacteria 10375
794 Ga0495624_0020490 3300046690 Bacteria 4400
795 Ga0495624_0124437 3300046690 Bacteria 1583
796 Ga0495670_0000859 3300046691 Bacteria 14714
797 Ga0495670_0013263 3300046691 Bacteria 4053
798 Ga0495670_0044778 3300046691 Bacteria 2209
799 Ga0495670_0087076 3300046691 Bacteria 1596
800 Ga0495670_0155332 3300046691 Bacteria 1200
801 Ga0495670_0158563 3300046691 Bacteria 1188
802 Ga0495670_0238538 3300046691 Bacteria 968
803 Ga0495671_0000087 3300046692 Bacteria 87327
804 Ga0495671_0000605 3300046692 Bacteria 26398
805 Ga0495671_0003550 3300046692 Bacteria 9532
806 Ga0495671_0212145 3300046692 Bacteria 938
807 Ga0495671_0219143 3300046692 Bacteria 921
808 Ga0495671_0249224 3300046692 Bacteria 857
809 Ga0495649_0000194 3300046694 Bacteria 53689
810 Ga0495649_0008705 3300046694 Bacteria 6087
811 Ga0495649_0016852 3300046694 Bacteria 4136
812 Ga0495649_0082460 3300046694 Bacteria 1718
813 Ga0495649_0148011 3300046694 Bacteria 1234
814 Ga0495649_0183663 3300046694 Bacteria 1090
815 Ga0495649_0243124 3300046694 Bacteria 926
816 Ga0495649_0280284 3300046694 Bacteria 852
817 Ga0495649_0331277 3300046694 Bacteria 771
818 Ga0495649_0408167 3300046694 Bacteria 681
819 Ga0495589_0000086 3300046794 Bacteria 86130
820 Ga0495589_0000132 3300046794 Bacteria 68363
821 Ga0495589_0018768 3300046794 Bacteria 3545
822 Ga0495589_0051939 3300046794 Bacteria 2025
823 Ga0495589_0075941 3300046794 Bacteria 1638
824 Ga0495589_0081465 3300046794 Bacteria 1574
825 Ga0495589_0106770 3300046794 Bacteria 1352
826 Ga0495589_0139767 3300046794 Bacteria 1160
827 Ga0495589_0182429 3300046794 Bacteria 995
828 Ga0495589_0253560 3300046794 Bacteria 821
829 Ga0495600_0002033 3300046809 Bacteria 11394
830 Ga0495600_0161897 3300046809 Bacteria 1446
831 Ga0495600_0388825 3300046809 Bacteria 869
832 Ga0495660_0001930 3300046810 Bacteria 13528
833 Ga0495660_0003563 3300046810 Bacteria 9601
834 Ga0495660_0007681 3300046810 Bacteria 6335
835 Ga0495660_0028271 3300046810 Bacteria 3169
836 Ga0495660_0097121 3300046810 Bacteria 1521
837 Ga0495660_0102255 3300046810 Bacteria 1473
838 Ga0495660_0204625 3300046810 Bacteria 940
839 Ga0495660_0207146 3300046810 Bacteria 932
840 Ga0495660_0216121 3300046810 Bacteria 906
841 Ga0495660_0216966 3300046810 Bacteria 904
842 Ga0495660_0232356 3300046810 Bacteria 863
843 Ga0495660_0262214 3300046810 Bacteria 797
844 Ga0495581_0197328 3300047315 Bacteria 1177
845 Ga0495581_0387533 3300047315 Bacteria 815
846 Ga0495604_0032878 3300047317 Bacteria 4108
847 Ga0495604_0053804 3300047317 Bacteria 3109
848 Ga0495604_0108518 3300047317 Bacteria 2027
849 Ga0495636_0003424 3300047318 Bacteria 6152
850 Ga0495636_0004254 3300047318 Bacteria 5617
851 Ga0495636_0011954 3300047318 Bacteria 3439
852 Ga0495636_0093780 3300047318 Bacteria 1306
853 Ga0495636_0182706 3300047318 Bacteria 952
854 Ga0495674_0011663 3300047319 Bacteria 8289
855 Ga0495672_0000013 3300047320 Bacteria 511827
856 Ga0495672_0000278 3300047320 Bacteria 71017
857 Ga0495672_0000512 3300047320 Bacteria 44570
858 Ga0495672_0001189 3300047320 Bacteria 26357
859 Ga0495672_0033064 3300047320 Bacteria 3208
860 Ga0495672_0110608 3300047320 Bacteria 1475
861 Ga0495672_0149142 3300047320 Bacteria 1214
862 Ga0495672_0192288 3300047320 Bacteria 1025
863 Ga0495672_0270825 3300047320 Bacteria 815
864 Ga0495676_0000015 3300047321 Bacteria 199492
865 Ga0495676_0068178 3300047321 Bacteria 2750
866 Ga0495676_0478428 3300047321 Bacteria 819
867 Ga0495680_0663530 3300047322 Bacteria 692
868 Ga0495683_0000036 3300047323 Bacteria 144974
869 Ga0495683_0005881 3300047323 Bacteria 6742
870 Ga0495683_0006168 3300047323 Bacteria 6571
871 Ga0495683_0015050 3300047323 Bacteria 4029
872 Ga0495683_0043476 3300047323 Bacteria 2261
873 Ga0495683_0069970 3300047323 Bacteria 1724
874 Ga0495683_0085180 3300047323 Bacteria 1537
875 Ga0495683_0118925 3300047323 Bacteria 1255
876 Ga0495683_0287733 3300047323 Bacteria 709
877 Ga0495687_000038 3300047443 Bacteria 251616
878 Ga0495687_000057 3300047443 Bacteria 186224
879 Ga0495687_000165 3300047443 Bacteria 99031
880 Ga0495687_001055 3300047443 Bacteria 27247
881 Ga0495687_001122 3300047443 Bacteria 26027
882 Ga0495687_001809 3300047443 Bacteria 18804
883 Ga0495687_007401 3300047443 Bacteria 6469
884 Ga0495687_070205 3300047443 Bacteria 1407
885 Ga0495675_0296286 3300047444 Bacteria 961
886 Ga0495677_0000004 3300047445 Bacteria 248210
887 Ga0495677_0000948 3300047445 Bacteria 11680
888 Ga0495677_0005204 3300047445 Bacteria 4948
889 Ga0495677_0005995 3300047445 Bacteria 4600
890 Ga0495677_0030645 3300047445 Bacteria 1957
891 Ga0495677_0069528 3300047445 Bacteria 1311
892 Ga0495677_0074959 3300047445 Bacteria 1263
893 Ga0495677_0086085 3300047445 Bacteria 1181
894 Ga0495677_0149704 3300047445 Bacteria 898
895 Ga0495677_0170223 3300047445 Bacteria 842
896 Ga0495677_0178619 3300047445 Bacteria 822
897 Ga0495679_001332 3300047446 Bacteria 14284
898 Ga0495679_063648 3300047446 Bacteria 1076
899 Ga0495685_000299 3300047447 Bacteria 16305
900 Ga0495685_021233 3300047447 Bacteria 2234
901 Ga0495685_023768 3300047447 Bacteria 2110
902 Ga0495685_039572 3300047447 Bacteria 1613
903 Ga0495685_082816 3300047447 Bacteria 1067
904 Ga0495673_0000069 3300047469 Bacteria 218170
905 Ga0495673_0000203 3300047469 Bacteria 89918
906 Ga0495673_0000236 3300047469 Bacteria 79618
907 Ga0495673_0046695 3300047469 Bacteria 1918
908 Ga0495673_0185264 3300047469 Bacteria 786
909 Ga0495681_0001009 3300047470 Bacteria 21583
910 Ga0495681_0015607 3300047470 Bacteria 4291
911 Ga0495681_0051862 3300047470 Bacteria 1927
912 Ga0495681_0074195 3300047470 Bacteria 1534
913 Ga0495681_0076968 3300047470 Bacteria 1498
914 Ga0495681_0120190 3300047470 Bacteria 1128
915 Ga0495686_0000620 3300047472 Bacteria 48981
916 Ga0495686_0001028 3300047472 Bacteria 33622
917 Ga0495686_0006069 3300047472 Bacteria 9368
918 Ga0495686_0048133 3300047472 Bacteria 2689
919 Ga0495686_0053203 3300047472 Bacteria 2537
920 Ga0495686_0132978 3300047472 Bacteria 1473
921 Ga0495686_0264985 3300047472 Bacteria 960
922 Ga0495593_0041261 3300047673 Bacteria 2482
923 Ga0495602_0123252 3300048088 Bacteria 2081
924 Ga0495602_0124621 3300048088 Bacteria 2066
925 Ga0495602_0236664 3300048088 Bacteria 1368
926 Ga0495614_0037921 3300048089 Bacteria 2068
927 Ga0495614_0106892 3300048089 Bacteria 1227
928 Ga0495615_0004412 3300048090 Bacteria 2456
929 Ga0495615_0108744 3300048090 Bacteria 791
930 Ga0495615_0130685 3300048090 Bacteria 734
931 Ga0495626_0000048 3300048091 Bacteria 161634
932 Ga0495626_0000279 3300048091 Bacteria 56185
933 Ga0495626_0000998 3300048091 Bacteria 24336
934 Ga0495626_0001757 3300048091 Bacteria 16497
935 Ga0495626_0002805 3300048091 Bacteria 11678
936 Ga0495626_0005031 3300048091 Bacteria 7893
937 Ga0495626_0010181 3300048091 Bacteria 5042
938 Ga0495626_0021084 3300048091 Bacteria 3239
939 Ga0495626_0049285 3300048091 Bacteria 1950
940 Ga0495626_0052127 3300048091 Bacteria 1886
941 Ga0495626_0057384 3300048091 Bacteria 1781
942 Ga0495626_0065425 3300048091 Bacteria 1645
943 Ga0495626_0111765 3300048091 Bacteria 1182
944 Ga0495626_0156595 3300048091 Bacteria 957
945 Ga0495626_0173292 3300048091 Bacteria 898
946 Ga0495626_0180387 3300048091 Bacteria 875
947 Ga0495626_0192718 3300048091 Bacteria 839
948 Ga0495626_0223047 3300048091 Bacteria 765
949 Ga0496100_0037867 3300048903 Bacteria 3053
950 Ga0496100_0154562 3300048903 Bacteria 1639
951 Ga0496101_0070873 3300048904 Bacteria 2553
952 Ga0496101_0088835 3300048904 Bacteria 2296
953 Ga0496101_0344823 3300048904 Bacteria 1170
954 Ga0496102_0000478 3300048905 Bacteria 44372
955 Ga0496102_0008640 3300048905 Bacteria 8741
956 Ga0496102_0017344 3300048905 Bacteria 6306
957 Ga0496102_0060082 3300048905 Bacteria 3477
958 Ga0496102_0215355 3300048905 Bacteria 1810
959 Ga0496102_0844309 3300048905 Bacteria 838
960 Ga0496103_0039346 3300048906 Bacteria 2905
961 Ga0496103_0066485 3300048906 Bacteria 2250
962 Ga0496103_0146237 3300048906 Bacteria 1513
963 Ga0496104_0443679 3300048907 Bacteria 1210
964 Ga0496105_0674294 3300048908 Bacteria 796
965 Ga0496106_0335160 3300048909 Bacteria 1215
966 Ga0496106_0830783 3300048909 Bacteria 732
967 Ga0496107_0131596 3300048910 Bacteria 1847
968 Ga0496107_0227084 3300048910 Bacteria 1389
969 Ga0496109_0233913 3300048912 Bacteria 1729
970 Ga0496110_0000092 3300048913 Bacteria 48035
971 Ga0496110_0223501 3300048913 Bacteria 1712
972 Ga0496111_0104260 3300048914 Bacteria 2086
973 Ga0496113_0097164 3300048916 Bacteria 2278
974 Ga0496113_1025587 3300048916 Bacteria 649
975 Ga0496114_0117903 3300048917 Bacteria 2280
976 Ga0496115_0186034 3300048918 Bacteria 1716
977 Ga0496115_0530364 3300048918 Bacteria 943
978 Ga0496115_0702750 3300048918 Bacteria 795
979 Ga0496115_0713328 3300048918 Bacteria 787
980 Ga0496116_0010336 3300048919 Bacteria 7838
981 Ga0496116_0044055 3300048919 Bacteria 3034
982 Ga0496116_0201000 3300048919 Bacteria 1043
983 Ga0496117_0000005 3300048920 Bacteria 777468
984 Ga0496118_0000031 3300048921 Bacteria 339329
985 Ga0496121_0002018 3300048924 Bacteria 32204
986 Ga0496121_0057712 3300048924 Bacteria 3215
987 Ga0496121_0236502 3300048924 Bacteria 1276
988 Ga0496121_0333285 3300048924 Bacteria 1017
989 Ga0496121_0439019 3300048924 Bacteria 844
990 Ga0496122_0003525 3300048925 Bacteria 20479
991 Ga0496122_0020064 3300048925 Bacteria 6067
992 Ga0496122_0042085 3300048925 Bacteria 3598
993 Ga0496123_0000084 3300048926 Bacteria 187479
994 Ga0496123_0001425 3300048926 Bacteria 33435
995 Ga0496123_0003683 3300048926 Bacteria 16896
996 Ga0496123_0004216 3300048926 Bacteria 15340
997 Ga0496124_0010436 3300048927 Bacteria 9401
998 Ga0496124_0134060 3300048927 Bacteria 1964
999 Ga0496124_0233802 3300048927 Bacteria 1372
1000 Ga0496124_0258140 3300048927 Bacteria 1284
1001 Ga0496124_0468886 3300048927 Bacteria 853
1002 Ga0496124_0521428 3300048927 Bacteria 791
1003 Ga0496125_0000368 3300048928 Bacteria 84924
1004 Ga0496125_0089020 3300048928 Bacteria 2323
1005 Ga0496125_0204119 3300048928 Bacteria 1290
1006 Ga0496126_0027941 3300048929 Bacteria 5380
1007 Ga0496126_0114487 3300048929 Bacteria 2346
1008 Ga0496126_0287297 3300048929 Bacteria 1361
1009 Ga0495678_000010 3300049459 Bacteria 357896
1010 Ga0495678_000034 3300049459 Bacteria 207827
1011 Ga0495678_000095 3300049459 Bacteria 109532
1012 Ga0495678_000383 3300049459 Bacteria 44894
1013 Ga0495678_001376 3300049459 Bacteria 19384
1014 Ga0495678_001441 3300049459 Bacteria 18715
1015 Ga0495678_009739 3300049459 Bacteria 4722
1016 Ga0495678_056982 3300049459 Bacteria 1482
1017 Ga0495678_083062 3300049459 Bacteria 1145
1018 Ga0495682_0000089 3300049460 Bacteria 80020
1019 Ga0495682_0000432 3300049460 Bacteria 29176
1020 Ga0495682_0022370 3300049460 Bacteria 2364
1021 Ga0495682_0058762 3300049460 Bacteria 1390
1022 Ga0495682_0078158 3300049460 Bacteria 1190
1023 Ga0495682_0084149 3300049460 Bacteria 1143
1024 Ga0495682_0093822 3300049460 Bacteria 1078
1025 Ga0495682_0208689 3300049460 Bacteria 692
1026 Ga0501295_001090 3300049518 Bacteria 2671
1027 Ga0501315_008783 3300049531 Bacteria 1182
1028 Ga0501316_007461 3300049532 Bacteria 1188
1029 Ga0501323_018249 3300049539 Bacteria 907
1030 Ga0501034_0000134 3300049571 Bacteria 137745
1031 Ga0501034_1031688 3300049571 Bacteria 705
1032 Ga0501075_0111296 3300049591 Bacteria 2082
1033 Ga0501202_066870 3300049652 Bacteria 822
1034 Ga0501211_003557 3300049658 Bacteria 1603
1035 Ga0501211_012123 3300049658 Bacteria 851
1036 Ga0501216_079505 3300049660 Bacteria 691
1037 Ga0501227_184370 3300049665 Bacteria 587
1038 Ga0501230_014418 3300049667 Bacteria 1297
1039 Ga0501238_001560 3300049671 Bacteria 2659
1040 Ga0501240_041629 3300049673 Bacteria 765
1041 Ga0501249_036722 3300049679 Bacteria 1104
1042 Ga0501081_0134001 3300049743 Bacteria 1772
1043 Ga0501083_0049975 3300049744 Bacteria 2816
1044 Ga0501269_000473 3300049766 Bacteria 8609
1045 Ga0501269_038157 3300049766 Bacteria 633
1046 Ga0501280_000153 3300049776 Bacteria 17816
1047 Ga0501283_049195 3300049779 Bacteria 744
1048 Ga0501035_0006010 3300049822 Bacteria 11433
1049 Ga0501044_0252781 3300049823 Bacteria 1703
1050 Ga0501045_0552537 3300049824 Bacteria 854
1051 nmdc:mga0k408_2236_c1 3300050493 Bacteria 10354
1052 nmdc:mga0qj67_246743_c1 3300050509 Bacteria 1449
1053 nmdc:mga0qj67_484271_c1 3300050509 Bacteria 995
1054 Ga0495601_0011317 3300053077 Bacteria 5332
1055 Ga0500572_034944 3300053111 Bacteria 1427
1056 Ga0500594_0114301 3300053118 Bacteria 842
1057 Ga0500595_022717 3300053119 Bacteria 2214
1058 Ga0500618_000653 3300053125 Bacteria 20633
1059 Ga0500618_062749 3300053125 Bacteria 835
1060 Ga0500618_071845 3300053125 Bacteria 776
1061 Ga0500574_000047 3300053141 Bacteria 14143
1062 Ga0500586_000912 3300053145 Bacteria 6084
1063 Ga0500619_003631 3300053154 Bacteria 3193
1064 Ga0500622_0204456 3300053156 Bacteria 896
1065 Ga0500636_0000203 3300053177 Bacteria 32197
1066 Ga0500637_0148477 3300053178 Bacteria 1355
1067 Ga0500625_005119 3300053729 Bacteria 5443
1068 Ga0587082_018912 3300059504 Bacteria 1101
1069 Ga0587083_0076817 3300059505 Bacteria 787
1070 Ga0587106_019270 3300059605 Bacteria 994
1071 Ga0587068_008109 3300059641 Bacteria 1514
1072 Ga0466962_0000755 3300061719 Bacteria 14519
1073 Ga0466962_0015221 3300061719 Bacteria 3709
1074 Ga0466962_0085214 3300061719 Bacteria 1512

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048090 Ga0495615_0108744 Ga0495615_0108744_10_528 172
2 3300048918 Ga0496115_0713328 Ga0496115_0713328_258_776 172
3 3300049660 Ga0501216_079505 Ga0501216_079505_147_665 172
4 3300049665 Ga0501227_184370 Ga0501227_184370_58_576 172
5 3300046679 Ga0495623_0186117 Ga0495623_0186117_561_1082 173
6 3300048903 Ga0496100_0037867 Ga0496100_0037867_1534_2085 183
7 3300048904 Ga0496101_0088835 Ga0496101_0088835_1236_1787 183
8 iso_pu_bacteria 2600255292 2601672277 183
9 iso_pu_bacteria 2643221603 2644027059 183
10 iso_pu_bacteria 2643221645 2644254523 183
11 iso_pu_bacteria 2643221664 2644360070 183
12 iso_pu_bacteria 2738541280 2738742905 183
13 iso_pu_bacteria 2738541297 2738827056 183
14 iso_pu_bacteria 2738541300 2738845993 183
15 iso_pu_bacteria 2738541357 2739150853 183
16 iso_pu_bacteria 2738543003 2739192772 183
17 iso_pu_bacteria 2738543018 2739276901 183
18 iso_pu_bacteria 2738543026 2739319249 183
19 iso_pu_bacteria 2738543029 2739337490 183
20 iso_pu_bacteria 2738543030 2739345945 183
21 iso_pu_bacteria 2808606418 2809145549 183
22 iso_pu_bacteria 2821131069 2821136476 183
23 iso_pu_bacteria 2842711865 2842713691 183
24 iso_pu_bacteria 2857547612 2857549308 183
25 iso_pu_bacteria 2857553236 2857558525 183
26 iso_pu_bacteria 2857558681 2857562340 183
27 iso_pu_bacteria 2857564685 2857568293 183
28 iso_pu_bacteria 2885080285 2885081346 183
29 iso_pu_bacteria 2904424332 2904428566 183
30 iso_pu_bacteria 2919476304 2919477225 183
31 3300009036 Ga0105244_10002041 Ga0105244_1000204116 184
32 3300015261 Ga0182006_1000033 Ga0182006_100003311 184
33 3300015262 Ga0182007_10000042 Ga0182007_1000004211 184
34 3300015265 Ga0182005_1000024 Ga0182005_1000024211 184
35 3300037312 Ga0395899_0000521 Ga0395899_0000521_35608_36162 184
36 3300039447 Ga0436361_1097952 Ga0436361_1097952_133_687 184
37 3300046452 Ga0495617_001209 Ga0495617_001209_5067_5621 184
38 3300046453 Ga0495627_000011 Ga0495627_000011_14356_14910 184
39 3300046453 Ga0495627_030153 Ga0495627_030153_495_1049 184
40 3300046459 Ga0495629_0020396 Ga0495629_0020396_1909_2463 184
41 3300046460 Ga0495638_0005569 Ga0495638_0005569_7942_8496 184
42 3300046460 Ga0495638_0294735 Ga0495638_0294735_272_826 184
43 3300046463 Ga0495653_0142416 Ga0495653_0142416_1036_1590 184
44 3300046471 Ga0495650_0000254 Ga0495650_0000254_94765_95319 184
45 3300046473 Ga0495582_0317982 Ga0495582_0317982_234_788 184
46 3300046474 Ga0495605_0020353 Ga0495605_0020353_886_1440 184
47 3300046474 Ga0495605_0185627 Ga0495605_0185627_276_830 184
48 3300046491 Ga0495584_0002317 Ga0495584_0002317_10045_10599 184
49 3300046491 Ga0495584_0142839 Ga0495584_0142839_43_597 184
50 3300046492 Ga0495585_0000023 Ga0495585_0000023_137113_137667 184
51 3300046492 Ga0495585_0000152 Ga0495585_0000152_230_784 184
52 3300046492 Ga0495585_0000444 Ga0495585_0000444_2962_3516 184
53 3300046492 Ga0495585_0004011 Ga0495585_0004011_320_874 184
54 3300046492 Ga0495585_0063062 Ga0495585_0063062_216_770 184
55 3300046492 Ga0495585_0086044 Ga0495585_0086044_1055_1609 184
56 3300046492 Ga0495585_0093181 Ga0495585_0093181_870_1424 184
57 3300046492 Ga0495585_0124453 Ga0495585_0124453_369_923 184
58 3300046492 Ga0495585_0127601 Ga0495585_0127601_287_841 184
59 3300046492 Ga0495585_0130882 Ga0495585_0130882_397_951 184
60 3300046499 Ga0495594_0014891 Ga0495594_0014891_2850_3404 184
61 3300046500 Ga0495596_0000032 Ga0495596_0000032_101639_102193 184
62 3300046500 Ga0495596_0004904 Ga0495596_0004904_2981_3535 184
63 3300046500 Ga0495596_0019824 Ga0495596_0019824_2122_2676 184
64 3300046500 Ga0495596_0104091 Ga0495596_0104091_137_691 184
65 3300046501 Ga0495607_0075941 Ga0495607_0075941_828_1382 184
66 3300046501 Ga0495607_0094427 Ga0495607_0094427_826_1380 184
67 3300046506 Ga0495583_0001918 Ga0495583_0001918_9099_9653 184
68 3300046507 Ga0495606_0000080 Ga0495606_0000080_80_634 184
69 3300046507 Ga0495606_0000090 Ga0495606_0000090_147226_147780 184
70 3300046507 Ga0495606_0001629 Ga0495606_0001629_28649_29203 184
71 3300046507 Ga0495606_0002891 Ga0495606_0002891_4396_4950 184
72 3300046507 Ga0495606_0273276 Ga0495606_0273276_236_790 184
73 3300046507 Ga0495606_0482262 Ga0495606_0482262_21_575 184
74 3300046512 Ga0495610_0056760 Ga0495610_0056760_1111_1665 184
75 3300046513 Ga0495616_0018127 Ga0495616_0018127_2904_3458 184
76 3300046513 Ga0495616_0027167 Ga0495616_0027167_384_938 184
77 3300046513 Ga0495616_0140557 Ga0495616_0140557_83_637 184
78 3300046515 Ga0495620_0025372 Ga0495620_0025372_1995_2549 184
79 3300046518 Ga0495631_0089877 Ga0495631_0089877_480_1034 184
80 3300046518 Ga0495631_0108701 Ga0495631_0108701_98_652 184
81 3300046518 Ga0495631_0178075 Ga0495631_0178075_212_766 184
82 3300046518 Ga0495631_0348127 Ga0495631_0348127_18_572 184
83 3300046520 Ga0495637_0000195 Ga0495637_0000195_38857_39411 184
84 3300046522 Ga0495643_0001163 Ga0495643_0001163_17015_17569 184
85 3300046522 Ga0495643_0167799 Ga0495643_0167799_184_738 184
86 3300046522 Ga0495643_0169250 Ga0495643_0169250_433_987 184
87 3300046522 Ga0495643_0173777 Ga0495643_0173777_83_637 184
88 3300046523 Ga0495644_0012464 Ga0495644_0012464_2520_3074 184
89 3300046523 Ga0495644_0036962 Ga0495644_0036962_66_620 184
90 3300046523 Ga0495644_0105342 Ga0495644_0105342_471_1025 184
91 3300046523 Ga0495644_0138769 Ga0495644_0138769_295_849 184
92 3300046523 Ga0495644_0161425 Ga0495644_0161425_97_651 184
93 3300046524 Ga0495648_0001425 Ga0495648_0001425_11431_11985 184
94 3300046524 Ga0495648_0169639 Ga0495648_0169639_68_622 184
95 3300046525 Ga0495663_0080205 Ga0495663_0080205_54_608 184
96 3300046526 Ga0495666_0006871 Ga0495666_0006871_117_671 184
97 3300046526 Ga0495666_0136337 Ga0495666_0136337_546_1100 184
98 3300046528 Ga0495642_0003891 Ga0495642_0003891_1852_2406 184
99 3300046528 Ga0495642_0097224 Ga0495642_0097224_181_735 184
100 3300046528 Ga0495642_0128850 Ga0495642_0128850_416_970 184
101 3300046529 Ga0495652_0225042 Ga0495652_0225042_551_1105 184
102 3300046530 Ga0495654_0000030 Ga0495654_0000030_7781_8335 184
103 3300046531 Ga0495665_0001301 Ga0495665_0001301_11_565 184
104 3300046531 Ga0495665_0034596 Ga0495665_0034596_119_673 184
105 3300046535 Ga0495586_0003956 Ga0495586_0003956_1212_1766 184
106 3300046536 Ga0495587_0106740 Ga0495587_0106740_303_857 184
107 3300046538 Ga0495609_0001531 Ga0495609_0001531_656_1210 184
108 3300046538 Ga0495609_0005405 Ga0495609_0005405_2266_2820 184
109 3300046538 Ga0495609_0087078 Ga0495609_0087078_83_637 184
110 3300046542 Ga0495597_0001115 Ga0495597_0001115_17194_17748 184
111 3300046542 Ga0495597_0004502 Ga0495597_0004502_938_1492 184
112 3300046542 Ga0495597_0018630 Ga0495597_0018630_2331_2885 184
113 3300046557 Ga0495622_0004973 Ga0495622_0004973_5533_6087 184
114 3300046557 Ga0495622_0185930 Ga0495622_0185930_233_787 184
115 3300046558 Ga0495633_0097204 Ga0495633_0097204_409_963 184
116 3300046558 Ga0495633_0349354 Ga0495633_0349354_93_647 184
117 3300046615 Ga0495656_0052339 Ga0495656_0052339_404_958 184
118 3300046616 Ga0495668_0007872 Ga0495668_0007872_227_781 184
119 3300046616 Ga0495668_0124532 Ga0495668_0124532_465_1019 184
120 3300046642 Ga0495634_0029850 Ga0495634_0029850_333_887 184
121 3300046648 Ga0495611_0012387 Ga0495611_0012387_2972_3526 184
122 3300046648 Ga0495611_0019917 Ga0495611_0019917_1370_1924 184
123 3300046648 Ga0495611_0030738 Ga0495611_0030738_1533_2087 184
124 3300046648 Ga0495611_0245871 Ga0495611_0245871_202_756 184
125 3300046660 Ga0495625_0229305 Ga0495625_0229305_188_742 184
126 3300046665 Ga0495661_0050895 Ga0495661_0050895_1114_1668 184
127 3300046665 Ga0495661_0081170 Ga0495661_0081170_230_784 184
128 3300046665 Ga0495661_0170266 Ga0495661_0170266_367_921 184
129 3300046665 Ga0495661_0218634 Ga0495661_0218634_92_646 184
130 3300046674 Ga0495588_0124955 Ga0495588_0124955_236_790 184
131 3300046674 Ga0495588_0136992 Ga0495588_0136992_216_770 184
132 3300046674 Ga0495588_0183519 Ga0495588_0183519_92_646 184
133 3300046674 Ga0495588_0209771 Ga0495588_0209771_176_730 184
134 3300046679 Ga0495623_0264807 Ga0495623_0264807_48_602 184
135 3300046680 Ga0495646_0315081 Ga0495646_0315081_231_785 184
136 3300046684 Ga0495669_0174437 Ga0495669_0174437_404_958 184
137 3300046689 Ga0495613_0392189 Ga0495613_0392189_64_618 184
138 3300046690 Ga0495624_0004359 Ga0495624_0004359_3794_4348 184
139 3300046691 Ga0495670_0044778 Ga0495670_0044778_1342_1896 184
140 3300046691 Ga0495670_0155332 Ga0495670_0155332_357_911 184
141 3300046794 Ga0495589_0018768 Ga0495589_0018768_2834_3388 184
142 3300046794 Ga0495589_0139767 Ga0495589_0139767_298_852 184
143 3300046809 Ga0495600_0161897 Ga0495600_0161897_356_910 184
144 3300046810 Ga0495660_0003563 Ga0495660_0003563_1612_2166 184
145 3300046810 Ga0495660_0102255 Ga0495660_0102255_56_610 184
146 3300046810 Ga0495660_0207146 Ga0495660_0207146_105_659 184
147 3300047315 Ga0495581_0387533 Ga0495581_0387533_214_768 184
148 3300047317 Ga0495604_0108518 Ga0495604_0108518_1048_1602 184
149 3300047318 Ga0495636_0182706 Ga0495636_0182706_164_718 184
150 3300047319 Ga0495674_0011663 Ga0495674_0011663_257_811 184
151 3300047321 Ga0495676_0068178 Ga0495676_0068178_857_1411 184
152 3300047323 Ga0495683_0000036 Ga0495683_0000036_8956_9510 184
153 3300047323 Ga0495683_0118925 Ga0495683_0118925_634_1188 184
154 3300047443 Ga0495687_007401 Ga0495687_007401_4590_5144 184
155 3300047444 Ga0495675_0296286 Ga0495675_0296286_310_864 184
156 3300047445 Ga0495677_0005995 Ga0495677_0005995_2579_3133 184
157 3300047445 Ga0495677_0069528 Ga0495677_0069528_63_617 184
158 3300047445 Ga0495677_0149704 Ga0495677_0149704_156_710 184
159 3300047445 Ga0495677_0178619 Ga0495677_0178619_188_742 184
160 3300047469 Ga0495673_0046695 Ga0495673_0046695_411_965 184
161 3300047470 Ga0495681_0074195 Ga0495681_0074195_684_1238 184
162 3300047470 Ga0495681_0120190 Ga0495681_0120190_187_741 184
163 3300047673 Ga0495593_0041261 Ga0495593_0041261_868_1422 184
164 3300048088 Ga0495602_0236664 Ga0495602_0236664_250_804 184
165 3300048091 Ga0495626_0002805 Ga0495626_0002805_2316_2870 184
166 3300048091 Ga0495626_0005031 Ga0495626_0005031_7142_7696 184
167 3300048091 Ga0495626_0173292 Ga0495626_0173292_262_816 184
168 3300048091 Ga0495626_0180387 Ga0495626_0180387_258_812 184
169 3300048906 Ga0496103_0066485 Ga0496103_0066485_188_742 184
170 3300048919 Ga0496116_0010336 Ga0496116_0010336_3012_3566 184
171 3300048920 Ga0496117_0000005 Ga0496117_0000005_768592_769146 184
172 3300048921 Ga0496118_0000031 Ga0496118_0000031_8323_8877 184
173 3300048925 Ga0496122_0020064 Ga0496122_0020064_2762_3316 184
174 3300048926 Ga0496123_0001425 Ga0496123_0001425_2739_3293 184
175 3300048927 Ga0496124_0010436 Ga0496124_0010436_1205_1759 184
176 3300048927 Ga0496124_0233802 Ga0496124_0233802_473_1027 184
177 3300048928 Ga0496125_0089020 Ga0496125_0089020_570_1124 184
178 3300049459 Ga0495678_000010 Ga0495678_000010_15330_15884 184
179 3300049460 Ga0495682_0022370 Ga0495682_0022370_1472_2026 184
180 3300049460 Ga0495682_0058762 Ga0495682_0058762_36_590 184
181 3300049460 Ga0495682_0093822 Ga0495682_0093822_109_663 184
182 3300049539 Ga0501323_018249 Ga0501323_018249_171_725 184
183 3300049679 Ga0501249_036722 Ga0501249_036722_327_881 184
184 3300049766 Ga0501269_000473 Ga0501269_000473_529_1083 184
185 iso_pu_bacteria 2643221554 2643791754 184
186 iso_pu_bacteria 2643221638 2644216767 184
187 iso_pu_bacteria 2734482258 2735816544 184
188 iso_pu_bacteria 2857537821 2857541724 184
189 iso_pu_bacteria 2858950400 2858953932 184
190 3300042876 Ga0451577_0071284 Ga0451577_0071284_1236_1793 185
191 3300046491 Ga0495584_0000005 Ga0495584_0000005_297346_297903 185
192 3300046492 Ga0495585_0036679 Ga0495585_0036679_957_1514 185
193 3300046507 Ga0495606_0003267 Ga0495606_0003267_13138_13695 185
194 3300046507 Ga0495606_0177366 Ga0495606_0177366_149_706 185
195 3300046518 Ga0495631_0021527 Ga0495631_0021527_2378_2935 185
196 3300046616 Ga0495668_0251588 Ga0495668_0251588_107_664 185
197 3300046665 Ga0495661_0194602 Ga0495661_0194602_254_811 185
198 3300046665 Ga0495661_0276444 Ga0495661_0276444_237_794 185
199 3300046665 Ga0495661_0465967 Ga0495661_0465967_12_569 185
200 3300046691 Ga0495670_0238538 Ga0495670_0238538_216_773 185
201 3300046809 Ga0495600_0388825 Ga0495600_0388825_29_586 185
202 3300048089 Ga0495614_0106892 Ga0495614_0106892_220_777 185
203 3300048918 Ga0496115_0186034 Ga0496115_0186034_63_620 185
204 iso_pu_bacteria 2643221556 2643796623 185
205 iso_pu_bacteria 2643221684 2644472745 185
206 iso_pu_bacteria 2818991436 2819544567 185
207 iso_pu_bacteria 8047673197 8047675702 185
208 3300013306 Ga0163162_10379875 Ga0163162_103798752 186
209 3300015265 Ga0182005_1001434 Ga0182005_10014343 186
210 3300037418 Ga0395900_0622000 Ga0395900_0622000_231_791 186
211 3300037466 Ga0395898_0892151 Ga0395898_0892151_231_791 186
212 3300042876 Ga0451577_0689600 Ga0451577_0689600_22_582 186
213 3300044712 Ga0453684_0109392 Ga0453684_0109392_1849_2409 186
214 3300044842 Ga0466957_0076144 Ga0466957_0076144_66_626 186
215 3300045976 Ga0466967_0652134 Ga0466967_0652134_130_690 186
216 3300046454 Ga0495592_0002825 Ga0495592_0002825_1721_2281 186
217 3300046463 Ga0495653_0003313 Ga0495653_0003313_1215_1775 186
218 3300046511 Ga0495608_0026533 Ga0495608_0026533_2052_2612 186
219 3300046516 Ga0495628_0000382 Ga0495628_0000382_32104_32664 186
220 3300046519 Ga0495632_0229594 Ga0495632_0229594_77_637 186
221 3300046543 Ga0495645_0068890 Ga0495645_0068890_1575_2135 186
222 3300046663 Ga0495635_0117569 Ga0495635_0117569_647_1207 186
223 3300046678 Ga0495599_0009879 Ga0495599_0009879_1840_2400 186
224 3300046679 Ga0495623_0010353 Ga0495623_0010353_3852_4412 186
225 3300046690 Ga0495624_0020490 Ga0495624_0020490_2211_2771 186
226 3300046809 Ga0495600_0002033 Ga0495600_0002033_8033_8593 186
227 3300048924 Ga0496121_0439019 Ga0496121_0439019_183_743 186
228 3300053077 Ga0495601_0011317 Ga0495601_0011317_1783_2343 186
229 3300053111 Ga0500572_034944 Ga0500572_034944_554_1114 186
230 3300053119 Ga0500595_022717 Ga0500595_022717_605_1165 186
231 3300053141 Ga0500574_000047 Ga0500574_000047_5056_5616 186
232 3300053154 Ga0500619_003631 Ga0500619_003631_1222_1782 186
233 3300002774 JGI25150J39212_1000910 JGI25150J39212_10009106 187
234 3300002987 JGI25159J45721_1002200 JGI25159J45721_10022003 187
235 3300003574 Ga0007410J51695_1044871 Ga0007410J51695_10448713 187
236 3300003575 Ga0007409J51694_1023914 Ga0007409J51694_10239143 187
237 3300003577 Ga0007416J51690_1029024 Ga0007416J51690_10290243 187
238 3300003693 Ga0032354_1058597 Ga0032354_10585972 187
239 3300003771 Ga0055526_1001033 Ga0055526_10010339 187
240 3300003773 Ga0055537_1000580 Ga0055537_10005809 187
241 3300003784 Ga0055534_1000283 Ga0055534_10002839 187
242 3300003790 Ga0055528_1000495 Ga0055528_100049524 187
243 3300004625 Ga0055543_1003826 Ga0055543_10038262 187
244 3300005262 Ga0065165_1002857 Ga0065165_10028576 187
245 3300005262 Ga0065165_1004075 Ga0065165_10040753 187
246 3300005288 Ga0065714_10171696 Ga0065714_101716962 187
247 3300005293 Ga0065715_10042333 Ga0065715_100423332 187
248 3300005337 Ga0070682_100098361 Ga0070682_1000983612 187
249 3300005339 Ga0070660_100044451 Ga0070660_1000444512 187
250 3300005344 Ga0070661_100051855 Ga0070661_1000518551 187
251 3300005366 Ga0070659_100001752 Ga0070659_10000175211 187
252 3300005457 Ga0070662_100057197 Ga0070662_1000571972 187
253 3300005467 Ga0070706_100007456 Ga0070706_1000074568 187
254 3300005518 Ga0070699_100042824 Ga0070699_1000428243 187
255 3300005564 Ga0070664_100003553 Ga0070664_10000355314 187
256 3300005564 Ga0070664_100298359 Ga0070664_1002983592 187
257 3300006028 Ga0070717_10473844 Ga0070717_104738442 187
258 3300006195 Ga0075366_10002981 Ga0075366_100029819 187
259 3300006946 Ga0079104_1005592 Ga0079104_10055925 187
260 3300006948 Ga0099826_10000010 Ga0099826_1000001010 187
261 3300009036 Ga0105244_10003441 Ga0105244_1000344111 187
262 3300009036 Ga0105244_10174679 Ga0105244_101746792 187
263 3300009092 Ga0105250_10120377 Ga0105250_101203772 187
264 3300010375 Ga0105239_10368622 Ga0105239_103686222 187
265 3300013104 Ga0157370_11246340 Ga0157370_112463401 187
266 3300013105 Ga0157369_10574078 Ga0157369_105740782 187
267 3300014497 Ga0182008_10003605 Ga0182008_100036052 187
268 3300015261 Ga0182006_1000080 Ga0182006_100008017 187
269 3300015262 Ga0182007_10030574 Ga0182007_100305742 187
270 3300015265 Ga0182005_1000016 Ga0182005_100001616 187
271 3300017792 Ga0163161_10012023 Ga0163161_100120233 187
272 3300017792 Ga0163161_10012229 Ga0163161_100122292 187
273 3300017792 Ga0163161_10087249 Ga0163161_100872492 187
274 3300021361 Ga0213872_10000430 Ga0213872_1000043030 187
275 3300021361 Ga0213872_10002336 Ga0213872_100023362 187
276 3300021361 Ga0213872_10004434 Ga0213872_100044342 187
277 3300021361 Ga0213872_10115807 Ga0213872_101158072 187
278 3300025233 Ga0209437_105938 Ga0209437_1059382 187
279 3300025233 Ga0209437_107841 Ga0209437_1078412 187
280 3300025245 Ga0207425_1000829 Ga0207425_10008298 187
281 3300025246 Ga0209646_1000190 Ga0209646_100019053 187
282 3300025250 Ga0209026_1005858 Ga0209026_10058583 187
283 3300025254 Ga0209148_1000237 Ga0209148_10002378 187
284 3300025263 Ga0209565_1000055 Ga0209565_100005510 187
285 3300025263 Ga0209565_1002957 Ga0209565_10029577 187
286 3300025272 Ga0209455_1000070 Ga0209455_100007011 187
287 3300025273 Ga0209673_1000040 Ga0209673_100004010 187
288 3300025284 Ga0209130_1000169 Ga0209130_100016983 187
289 3300025291 Ga0209675_1000052 Ga0209675_1000052179 187
290 3300025294 Ga0209025_1001876 Ga0209025_100187618 187
291 3300025295 Ga0209564_1000027 Ga0209564_100002712 187
292 3300025295 Ga0209564_1000047 Ga0209564_1000047317 187
293 3300025295 Ga0209564_1000271 Ga0209564_100027111 187
294 3300025295 Ga0209564_1028858 Ga0209564_10288582 187
295 3300025297 Ga0209758_1000436 Ga0209758_10004369 187
296 3300025299 Ga0209256_1000054 Ga0209256_100005411 187
297 3300025299 Ga0209256_1000100 Ga0209256_1000100179 187
298 3300025728 Ga0207655_1001651 Ga0207655_100165113 187
299 3300025728 Ga0207655_1016701 Ga0207655_10167012 187
300 3300025910 Ga0207684_10008262 Ga0207684_100082624 187
301 3300025919 Ga0207657_10012688 Ga0207657_100126889 187
302 3300025920 Ga0207649_10024118 Ga0207649_100241183 187
303 3300025932 Ga0207690_10000951 Ga0207690_1000095114 187
304 3300025945 Ga0207679_10004406 Ga0207679_100044063 187
305 3300027666 Ga0209282_1000009 Ga0209282_100000910 187
306 3300030731 Ga0316177_1075487 Ga0316177_10754872 187
307 3300030735 Ga0316178_1172473 Ga0316178_11724732 187
308 3300030736 Ga0316180_1064742 Ga0316180_10647422 187
309 3300030744 Ga0316181_1137224 Ga0316181_11372242 187
310 3300031251 Ga0265327_10000674 Ga0265327_1000067419 187
311 3300031251 Ga0265327_10059966 Ga0265327_100599661 187
312 3300031711 Ga0265314_10008929 Ga0265314_100089299 187
313 3300031838 Ga0307518_10057653 Ga0307518_100576532 187
314 3300032004 Ga0307414_10174903 Ga0307414_101749032 187
315 3300032005 Ga0307411_10541983 Ga0307411_105419832 187
316 3300037312 Ga0395899_0002806 Ga0395899_0002806_6808_7371 187
317 3300037312 Ga0395899_0003830 Ga0395899_0003830_4621_5184 187
318 3300037312 Ga0395899_0018674 Ga0395899_0018674_1075_1638 187
319 3300037418 Ga0395900_0014022 Ga0395900_0014022_913_1476 187
320 3300037418 Ga0395900_0031672 Ga0395900_0031672_1174_1737 187
321 3300037466 Ga0395898_0478763 Ga0395898_0478763_485_1048 187
322 3300037471 Ga0395905_0010442 Ga0395905_0010442_1325_1888 187
323 3300037471 Ga0395905_0013127 Ga0395905_0013127_27_590 187
324 3300037471 Ga0395905_0036632 Ga0395905_0036632_1915_2490 187
325 3300037471 Ga0395905_0036694 Ga0395905_0036694_1165_1728 187
326 3300037471 Ga0395905_0055914 Ga0395905_0055914_1222_1785 187
327 3300037471 Ga0395905_0093364 Ga0395905_0093364_2179_2742 187
328 3300038443 Ga0395901_0002710 Ga0395901_0002710_11341_11904 187
329 3300038443 Ga0395901_0066242 Ga0395901_0066242_1231_1794 187
330 3300038443 Ga0395901_0117619 Ga0395901_0117619_862_1425 187
331 3300039447 Ga0436361_0013073 Ga0436361_0013073_10517_11080 187
332 3300039447 Ga0436361_0314274 Ga0436361_0314274_24_587 187
333 3300039447 Ga0436361_0930389 Ga0436361_0930389_3193_3756 187
334 3300039447 Ga0436361_1012850 Ga0436361_1012850_62_649 187
335 3300039447 Ga0436361_1027676 Ga0436361_1027676_35_622 187
336 3300039447 Ga0436361_1091442 Ga0436361_1091442_25774_26361 187
337 3300042139 Ga0450904_007543 Ga0450904_007543_304_867 187
338 3300044658 Ga0466972_0000420 Ga0466972_0000420_7378_7941 187
339 3300044658 Ga0466972_0011040 Ga0466972_0011040_1137_1700 187
340 3300044683 Ga0466965_0002121 Ga0466965_0002121_2754_3317 187
341 3300044683 Ga0466965_0036795 Ga0466965_0036795_576_1139 187
342 3300044684 Ga0466966_0001854 Ga0466966_0001854_1643_2206 187
343 3300044706 Ga0466964_0260780 Ga0466964_0260780_94_657 187
344 3300044719 Ga0466971_0162361 Ga0466971_0162361_274_837 187
345 3300044735 Ga0466968_0009040 Ga0466968_0009040_269_832 187
346 3300044901 Ga0466960_0570193 Ga0466960_0570193_29_649 187
347 3300045049 Ga0466959_0025858 Ga0466959_0025858_134_697 187
348 3300045049 Ga0466959_0155315 Ga0466959_0155315_170_733 187
349 3300046452 Ga0495617_000022 Ga0495617_000022_10044_10607 187
350 3300046452 Ga0495617_000075 Ga0495617_000075_2794_3357 187
351 3300046452 Ga0495617_018396 Ga0495617_018396_57_644 187
352 3300046452 Ga0495617_101153 Ga0495617_101153_12_575 187
353 3300046453 Ga0495627_000398 Ga0495627_000398_28663_29226 187
354 3300046453 Ga0495627_028660 Ga0495627_028660_692_1255 187
355 3300046455 Ga0495603_0219775 Ga0495603_0219775_71_634 187
356 3300046455 Ga0495603_0333361 Ga0495603_0333361_111_674 187
357 3300046457 Ga0495590_0000057 Ga0495590_0000057_84273_84836 187
358 3300046457 Ga0495590_0000143 Ga0495590_0000143_27772_28335 187
359 3300046457 Ga0495590_0003098 Ga0495590_0003098_2788_3351 187
360 3300046457 Ga0495590_0005737 Ga0495590_0005737_236_799 187
361 3300046459 Ga0495629_0041378 Ga0495629_0041378_1367_1930 187
362 3300046460 Ga0495638_0001680 Ga0495638_0001680_16434_16997 187
363 3300046460 Ga0495638_0029512 Ga0495638_0029512_2537_3100 187
364 3300046460 Ga0495638_0350140 Ga0495638_0350140_176_739 187
365 3300046460 Ga0495638_0469701 Ga0495638_0469701_51_614 187
366 3300046463 Ga0495653_0000044 Ga0495653_0000044_7740_8303 187
367 3300046463 Ga0495653_0028893 Ga0495653_0028893_2057_2620 187
368 3300046463 Ga0495653_0030963 Ga0495653_0030963_202_789 187
369 3300046463 Ga0495653_0062600 Ga0495653_0062600_264_827 187
370 3300046463 Ga0495653_0220831 Ga0495653_0220831_303_866 187
371 3300046471 Ga0495650_0000082 Ga0495650_0000082_27658_28221 187
372 3300046471 Ga0495650_0001173 Ga0495650_0001173_19687_20250 187
373 3300046471 Ga0495650_0001749 Ga0495650_0001749_11391_11954 187
374 3300046471 Ga0495650_0003298 Ga0495650_0003298_10804_11367 187
375 3300046471 Ga0495650_0005094 Ga0495650_0005094_729_1292 187
376 3300046471 Ga0495650_0012103 Ga0495650_0012103_93_656 187
377 3300046472 Ga0495580_0291017 Ga0495580_0291017_366_929 187
378 3300046473 Ga0495582_0027191 Ga0495582_0027191_1611_2174 187
379 3300046474 Ga0495605_0000098 Ga0495605_0000098_7804_8367 187
380 3300046474 Ga0495605_0000153 Ga0495605_0000153_78349_78912 187
381 3300046474 Ga0495605_0002046 Ga0495605_0002046_2163_2726 187
382 3300046474 Ga0495605_0037236 Ga0495605_0037236_172_735 187
383 3300046474 Ga0495605_0119063 Ga0495605_0119063_79_642 187
384 3300046474 Ga0495605_0127029 Ga0495605_0127029_169_732 187
385 3300046474 Ga0495605_0176519 Ga0495605_0176519_66_629 187
386 3300046475 Ga0495639_0099019 Ga0495639_0099019_527_1090 187
387 3300046491 Ga0495584_0000232 Ga0495584_0000232_36227_36790 187
388 3300046491 Ga0495584_0000729 Ga0495584_0000729_8630_9193 187
389 3300046491 Ga0495584_0009911 Ga0495584_0009911_2008_2571 187
390 3300046491 Ga0495584_0016425 Ga0495584_0016425_2825_3388 187
391 3300046491 Ga0495584_0050942 Ga0495584_0050942_1335_1898 187
392 3300046491 Ga0495584_0072746 Ga0495584_0072746_1151_1714 187
393 3300046491 Ga0495584_0263303 Ga0495584_0263303_48_611 187
394 3300046491 Ga0495584_0480564 Ga0495584_0480564_56_619 187
395 3300046492 Ga0495585_0022356 Ga0495585_0022356_2597_3184 187
396 3300046492 Ga0495585_0065031 Ga0495585_0065031_349_912 187
397 3300046492 Ga0495585_0081256 Ga0495585_0081256_172_735 187
398 3300046492 Ga0495585_0120150 Ga0495585_0120150_646_1209 187
399 3300046499 Ga0495594_0067330 Ga0495594_0067330_612_1175 187
400 3300046499 Ga0495594_0068128 Ga0495594_0068128_58_621 187
401 3300046499 Ga0495594_0111098 Ga0495594_0111098_252_815 187
402 3300046499 Ga0495594_0203838 Ga0495594_0203838_205_768 187
403 3300046500 Ga0495596_0001270 Ga0495596_0001270_185_748 187
404 3300046500 Ga0495596_0019014 Ga0495596_0019014_1581_2144 187
405 3300046500 Ga0495596_0064880 Ga0495596_0064880_124_687 187
406 3300046500 Ga0495596_0140228 Ga0495596_0140228_172_735 187
407 3300046500 Ga0495596_0215517 Ga0495596_0215517_11_574 187
408 3300046500 Ga0495596_0219493 Ga0495596_0219493_47_610 187
409 3300046501 Ga0495607_0018756 Ga0495607_0018756_318_881 187
410 3300046501 Ga0495607_0034462 Ga0495607_0034462_644_1207 187
411 3300046501 Ga0495607_0053231 Ga0495607_0053231_572_1135 187
412 3300046501 Ga0495607_0071833 Ga0495607_0071833_128_691 187
413 3300046501 Ga0495607_0082535 Ga0495607_0082535_395_958 187
414 3300046501 Ga0495607_0142834 Ga0495607_0142834_444_1007 187
415 3300046501 Ga0495607_0156528 Ga0495607_0156528_160_723 187
416 3300046501 Ga0495607_0170248 Ga0495607_0170248_399_962 187
417 3300046501 Ga0495607_0304687 Ga0495607_0304687_54_617 187
418 3300046506 Ga0495583_0000106 Ga0495583_0000106_7667_8230 187
419 3300046506 Ga0495583_0000150 Ga0495583_0000150_110637_111200 187
420 3300046506 Ga0495583_0000597 Ga0495583_0000597_34617_35180 187
421 3300046506 Ga0495583_0001383 Ga0495583_0001383_16370_16933 187
422 3300046506 Ga0495583_0016522 Ga0495583_0016522_820_1383 187
423 3300046506 Ga0495583_0153492 Ga0495583_0153492_71_634 187
424 3300046506 Ga0495583_0208027 Ga0495583_0208027_86_649 187
425 3300046507 Ga0495606_0000099 Ga0495606_0000099_7798_8361 187
426 3300046507 Ga0495606_0000524 Ga0495606_0000524_53370_53933 187
427 3300046507 Ga0495606_0002603 Ga0495606_0002603_12296_12859 187
428 3300046507 Ga0495606_0156832 Ga0495606_0156832_491_1054 187
429 3300046507 Ga0495606_0167282 Ga0495606_0167282_318_905 187
430 3300046507 Ga0495606_0287086 Ga0495606_0287086_280_843 187
431 3300046507 Ga0495606_0360638 Ga0495606_0360638_64_651 187
432 3300046512 Ga0495610_0000017 Ga0495610_0000017_7788_8351 187
433 3300046512 Ga0495610_0000668 Ga0495610_0000668_25012_25575 187
434 3300046512 Ga0495610_0051728 Ga0495610_0051728_710_1297 187
435 3300046512 Ga0495610_0094937 Ga0495610_0094937_445_1008 187
436 3300046513 Ga0495616_0002388 Ga0495616_0002388_1689_2252 187
437 3300046513 Ga0495616_0004647 Ga0495616_0004647_6241_6804 187
438 3300046513 Ga0495616_0006823 Ga0495616_0006823_5147_5734 187
439 3300046513 Ga0495616_0016924 Ga0495616_0016924_1688_2251 187
440 3300046513 Ga0495616_0018885 Ga0495616_0018885_1838_2401 187
441 3300046513 Ga0495616_0029168 Ga0495616_0029168_1498_2061 187
442 3300046513 Ga0495616_0052218 Ga0495616_0052218_1038_1601 187
443 3300046513 Ga0495616_0166939 Ga0495616_0166939_26_589 187
444 3300046513 Ga0495616_0209388 Ga0495616_0209388_120_683 187
445 3300046517 Ga0495630_0290113 Ga0495630_0290113_338_901 187
446 3300046518 Ga0495631_0001332 Ga0495631_0001332_8844_9407 187
447 3300046518 Ga0495631_0001436 Ga0495631_0001436_6359_6922 187
448 3300046518 Ga0495631_0017621 Ga0495631_0017621_276_839 187
449 3300046518 Ga0495631_0132606 Ga0495631_0132606_154_717 187
450 3300046518 Ga0495631_0256240 Ga0495631_0256240_169_732 187
451 3300046518 Ga0495631_0264638 Ga0495631_0264638_29_592 187
452 3300046519 Ga0495632_0000052 Ga0495632_0000052_124630_125193 187
453 3300046519 Ga0495632_0000396 Ga0495632_0000396_39887_40450 187
454 3300046519 Ga0495632_0001555 Ga0495632_0001555_8519_9082 187
455 3300046519 Ga0495632_0003734 Ga0495632_0003734_7532_8095 187
456 3300046519 Ga0495632_0077299 Ga0495632_0077299_209_772 187
457 3300046520 Ga0495637_0025136 Ga0495637_0025136_1785_2348 187
458 3300046520 Ga0495637_0157208 Ga0495637_0157208_131_694 187
459 3300046522 Ga0495643_0000250 Ga0495643_0000250_7945_8508 187
460 3300046522 Ga0495643_0020420 Ga0495643_0020420_528_1091 187
461 3300046522 Ga0495643_0074658 Ga0495643_0074658_1163_1726 187
462 3300046522 Ga0495643_0288040 Ga0495643_0288040_179_742 187
463 3300046523 Ga0495644_0001124 Ga0495644_0001124_424_987 187
464 3300046523 Ga0495644_0003935 Ga0495644_0003935_5213_5776 187
465 3300046523 Ga0495644_0033210 Ga0495644_0033210_731_1294 187
466 3300046523 Ga0495644_0049248 Ga0495644_0049248_371_934 187
467 3300046524 Ga0495648_0001108 Ga0495648_0001108_24280_24843 187
468 3300046524 Ga0495648_0001296 Ga0495648_0001296_16402_16965 187
469 3300046524 Ga0495648_0001297 Ga0495648_0001297_7906_8469 187
470 3300046524 Ga0495648_0003753 Ga0495648_0003753_8023_8586 187
471 3300046524 Ga0495648_0012427 Ga0495648_0012427_4218_4781 187
472 3300046524 Ga0495648_0015868 Ga0495648_0015868_4711_5274 187
473 3300046524 Ga0495648_0030615 Ga0495648_0030615_2706_3269 187
474 3300046524 Ga0495648_0049127 Ga0495648_0049127_1749_2312 187
475 3300046524 Ga0495648_0081899 Ga0495648_0081899_396_959 187
476 3300046524 Ga0495648_0103442 Ga0495648_0103442_334_897 187
477 3300046524 Ga0495648_0120682 Ga0495648_0120682_675_1238 187
478 3300046524 Ga0495648_0124831 Ga0495648_0124831_131_694 187
479 3300046525 Ga0495663_0018991 Ga0495663_0018991_749_1312 187
480 3300046525 Ga0495663_0027435 Ga0495663_0027435_1010_1573 187
481 3300046525 Ga0495663_0097680 Ga0495663_0097680_249_812 187
482 3300046526 Ga0495666_0007557 Ga0495666_0007557_3052_3615 187
483 3300046526 Ga0495666_0089356 Ga0495666_0089356_214_777 187
484 3300046528 Ga0495642_0000529 Ga0495642_0000529_10031_10594 187
485 3300046528 Ga0495642_0004563 Ga0495642_0004563_831_1394 187
486 3300046528 Ga0495642_0022005 Ga0495642_0022005_233_796 187
487 3300046528 Ga0495642_0055624 Ga0495642_0055624_248_811 187
488 3300046528 Ga0495642_0091444 Ga0495642_0091444_343_906 187
489 3300046528 Ga0495642_0095315 Ga0495642_0095315_245_808 187
490 3300046528 Ga0495642_0135331 Ga0495642_0135331_467_1030 187
491 3300046529 Ga0495652_0195423 Ga0495652_0195423_277_864 187
492 3300046530 Ga0495654_0018430 Ga0495654_0018430_210_773 187
493 3300046530 Ga0495654_0021405 Ga0495654_0021405_32_595 187
494 3300046530 Ga0495654_0154397 Ga0495654_0154397_377_964 187
495 3300046533 Ga0495640_0244079 Ga0495640_0244079_178_741 187
496 3300046535 Ga0495586_0348397 Ga0495586_0348397_81_644 187
497 3300046536 Ga0495587_0212022 Ga0495587_0212022_379_942 187
498 3300046537 Ga0495598_0015527 Ga0495598_0015527_1285_1848 187
499 3300046538 Ga0495609_0000007 Ga0495609_0000007_7753_8316 187
500 3300046538 Ga0495609_0002820 Ga0495609_0002820_6202_6765 187
501 3300046538 Ga0495609_0006790 Ga0495609_0006790_382_945 187
502 3300046538 Ga0495609_0090129 Ga0495609_0090129_31_594 187
503 3300046538 Ga0495609_0094483 Ga0495609_0094483_438_1001 187
504 3300046538 Ga0495609_0112477 Ga0495609_0112477_281_844 187
505 3300046538 Ga0495609_0167361 Ga0495609_0167361_43_606 187
506 3300046539 Ga0495621_0167216 Ga0495621_0167216_15_578 187
507 3300046542 Ga0495597_0001285 Ga0495597_0001285_8319_8906 187
508 3300046542 Ga0495597_0001411 Ga0495597_0001411_9264_9827 187
509 3300046542 Ga0495597_0002378 Ga0495597_0002378_8657_9220 187
510 3300046542 Ga0495597_0018041 Ga0495597_0018041_429_992 187
511 3300046542 Ga0495597_0059212 Ga0495597_0059212_347_910 187
512 3300046542 Ga0495597_0176075 Ga0495597_0176075_195_758 187
513 3300046542 Ga0495597_0217646 Ga0495597_0217646_38_601 187
514 3300046557 Ga0495622_0000044 Ga0495622_0000044_112200_112763 187
515 3300046557 Ga0495622_0002393 Ga0495622_0002393_7961_8524 187
516 3300046557 Ga0495622_0031549 Ga0495622_0031549_861_1448 187
517 3300046557 Ga0495622_0031647 Ga0495622_0031647_804_1367 187
518 3300046557 Ga0495622_0271346 Ga0495622_0271346_139_726 187
519 3300046558 Ga0495633_0000917 Ga0495633_0000917_7989_8552 187
520 3300046558 Ga0495633_0006937 Ga0495633_0006937_4699_5286 187
521 3300046558 Ga0495633_0008903 Ga0495633_0008903_314_877 187
522 3300046558 Ga0495633_0018586 Ga0495633_0018586_2629_3192 187
523 3300046558 Ga0495633_0023285 Ga0495633_0023285_2249_2812 187
524 3300046558 Ga0495633_0059388 Ga0495633_0059388_135_698 187
525 3300046558 Ga0495633_0195396 Ga0495633_0195396_309_872 187
526 3300046558 Ga0495633_0237567 Ga0495633_0237567_129_692 187
527 3300046615 Ga0495656_0176549 Ga0495656_0176549_402_965 187
528 3300046616 Ga0495668_0000035 Ga0495668_0000035_231619_232182 187
529 3300046616 Ga0495668_0000211 Ga0495668_0000211_4280_4843 187
530 3300046616 Ga0495668_0000286 Ga0495668_0000286_61485_62048 187
531 3300046616 Ga0495668_0000939 Ga0495668_0000939_16713_17276 187
532 3300046616 Ga0495668_0001545 Ga0495668_0001545_20819_21382 187
533 3300046616 Ga0495668_0004452 Ga0495668_0004452_3536_4099 187
534 3300046616 Ga0495668_0069634 Ga0495668_0069634_561_1124 187
535 3300046616 Ga0495668_0110644 Ga0495668_0110644_369_932 187
536 3300046616 Ga0495668_0111339 Ga0495668_0111339_591_1154 187
537 3300046616 Ga0495668_0157375 Ga0495668_0157375_650_1213 187
538 3300046642 Ga0495634_0185328 Ga0495634_0185328_350_913 187
539 3300046648 Ga0495611_0001030 Ga0495611_0001030_9473_10036 187
540 3300046648 Ga0495611_0003988 Ga0495611_0003988_2980_3543 187
541 3300046648 Ga0495611_0006487 Ga0495611_0006487_3061_3624 187
542 3300046648 Ga0495611_0024927 Ga0495611_0024927_72_635 187
543 3300046648 Ga0495611_0184440 Ga0495611_0184440_358_921 187
544 3300046660 Ga0495625_0000338 Ga0495625_0000338_70376_70939 187
545 3300046660 Ga0495625_0001765 Ga0495625_0001765_8047_8610 187
546 3300046660 Ga0495625_0016076 Ga0495625_0016076_5147_5710 187
547 3300046660 Ga0495625_0032153 Ga0495625_0032153_2245_2808 187
548 3300046660 Ga0495625_0032657 Ga0495625_0032657_2746_3309 187
549 3300046660 Ga0495625_0159609 Ga0495625_0159609_315_878 187
550 3300046660 Ga0495625_0244011 Ga0495625_0244011_372_959 187
551 3300046663 Ga0495635_0008609 Ga0495635_0008609_6420_6983 187
552 3300046664 Ga0495659_0000139 Ga0495659_0000139_2316_2879 187
553 3300046664 Ga0495659_0006513 Ga0495659_0006513_284_847 187
554 3300046664 Ga0495659_0012720 Ga0495659_0012720_172_735 187
555 3300046664 Ga0495659_0021812 Ga0495659_0021812_1344_1907 187
556 3300046665 Ga0495661_0000074 Ga0495661_0000074_7779_8342 187
557 3300046665 Ga0495661_0014026 Ga0495661_0014026_4073_4636 187
558 3300046665 Ga0495661_0024464 Ga0495661_0024464_467_1030 187
559 3300046665 Ga0495661_0056989 Ga0495661_0056989_1707_2270 187
560 3300046665 Ga0495661_0090282 Ga0495661_0090282_755_1318 187
561 3300046665 Ga0495661_0095657 Ga0495661_0095657_627_1190 187
562 3300046665 Ga0495661_0097206 Ga0495661_0097206_932_1495 187
563 3300046665 Ga0495661_0170462 Ga0495661_0170462_333_896 187
564 3300046665 Ga0495661_0178616 Ga0495661_0178616_259_822 187
565 3300046674 Ga0495588_0012930 Ga0495588_0012930_931_1494 187
566 3300046674 Ga0495588_0037807 Ga0495588_0037807_53_616 187
567 3300046674 Ga0495588_0056552 Ga0495588_0056552_1178_1741 187
568 3300046678 Ga0495599_0302397 Ga0495599_0302397_309_872 187
569 3300046679 Ga0495623_0089894 Ga0495623_0089894_1301_1864 187
570 3300046684 Ga0495669_0000101 Ga0495669_0000101_44243_44806 187
571 3300046684 Ga0495669_0000495 Ga0495669_0000495_10778_11341 187
572 3300046684 Ga0495669_0001145 Ga0495669_0001145_1635_2198 187
573 3300046684 Ga0495669_0081917 Ga0495669_0081917_65_628 187
574 3300046689 Ga0495613_0026824 Ga0495613_0026824_3474_4037 187
575 3300046690 Ga0495624_0124437 Ga0495624_0124437_55_618 187
576 3300046691 Ga0495670_0000859 Ga0495670_0000859_7542_8129 187
577 3300046691 Ga0495670_0013263 Ga0495670_0013263_2957_3520 187
578 3300046691 Ga0495670_0087076 Ga0495670_0087076_411_974 187
579 3300046691 Ga0495670_0158563 Ga0495670_0158563_382_945 187
580 3300046692 Ga0495671_0000087 Ga0495671_0000087_84467_85030 187
581 3300046692 Ga0495671_0000605 Ga0495671_0000605_17906_18469 187
582 3300046692 Ga0495671_0003550 Ga0495671_0003550_1929_2492 187
583 3300046692 Ga0495671_0212145 Ga0495671_0212145_276_839 187
584 3300046692 Ga0495671_0219143 Ga0495671_0219143_215_778 187
585 3300046692 Ga0495671_0249224 Ga0495671_0249224_105_668 187
586 3300046694 Ga0495649_0000194 Ga0495649_0000194_44241_44804 187
587 3300046694 Ga0495649_0008705 Ga0495649_0008705_4847_5410 187
588 3300046694 Ga0495649_0016852 Ga0495649_0016852_608_1171 187
589 3300046694 Ga0495649_0082460 Ga0495649_0082460_862_1425 187
590 3300046694 Ga0495649_0148011 Ga0495649_0148011_10_573 187
591 3300046694 Ga0495649_0183663 Ga0495649_0183663_324_887 187
592 3300046694 Ga0495649_0243124 Ga0495649_0243124_117_680 187
593 3300046694 Ga0495649_0280284 Ga0495649_0280284_246_809 187
594 3300046694 Ga0495649_0331277 Ga0495649_0331277_121_684 187
595 3300046694 Ga0495649_0408167 Ga0495649_0408167_14_577 187
596 3300046794 Ga0495589_0000132 Ga0495589_0000132_60043_60606 187
597 3300046794 Ga0495589_0075941 Ga0495589_0075941_299_862 187
598 3300046794 Ga0495589_0106770 Ga0495589_0106770_422_985 187
599 3300046794 Ga0495589_0182429 Ga0495589_0182429_303_866 187
600 3300046794 Ga0495589_0253560 Ga0495589_0253560_127_690 187
601 3300046810 Ga0495660_0028271 Ga0495660_0028271_135_722 187
602 3300046810 Ga0495660_0097121 Ga0495660_0097121_455_1018 187
603 3300046810 Ga0495660_0204625 Ga0495660_0204625_260_823 187
604 3300046810 Ga0495660_0216966 Ga0495660_0216966_79_642 187
605 3300046810 Ga0495660_0232356 Ga0495660_0232356_152_715 187
606 3300046810 Ga0495660_0262214 Ga0495660_0262214_14_577 187
607 3300047315 Ga0495581_0197328 Ga0495581_0197328_463_1026 187
608 3300047317 Ga0495604_0032878 Ga0495604_0032878_393_956 187
609 3300047317 Ga0495604_0053804 Ga0495604_0053804_90_653 187
610 3300047318 Ga0495636_0003424 Ga0495636_0003424_276_839 187
611 3300047318 Ga0495636_0004254 Ga0495636_0004254_2577_3140 187
612 3300047318 Ga0495636_0011954 Ga0495636_0011954_1680_2243 187
613 3300047318 Ga0495636_0093780 Ga0495636_0093780_507_1070 187
614 3300047320 Ga0495672_0000013 Ga0495672_0000013_501674_502237 187
615 3300047320 Ga0495672_0000512 Ga0495672_0000512_1707_2270 187
616 3300047320 Ga0495672_0001189 Ga0495672_0001189_15021_15584 187
617 3300047320 Ga0495672_0033064 Ga0495672_0033064_1987_2550 187
618 3300047320 Ga0495672_0110608 Ga0495672_0110608_215_778 187
619 3300047320 Ga0495672_0149142 Ga0495672_0149142_557_1120 187
620 3300047320 Ga0495672_0192288 Ga0495672_0192288_168_731 187
621 3300047321 Ga0495676_0000015 Ga0495676_0000015_9041_9604 187
622 3300047321 Ga0495676_0478428 Ga0495676_0478428_100_663 187
623 3300047322 Ga0495680_0663530 Ga0495680_0663530_74_637 187
624 3300047323 Ga0495683_0005881 Ga0495683_0005881_3181_3744 187
625 3300047323 Ga0495683_0006168 Ga0495683_0006168_3254_3817 187
626 3300047323 Ga0495683_0015050 Ga0495683_0015050_85_648 187
627 3300047323 Ga0495683_0069970 Ga0495683_0069970_726_1289 187
628 3300047323 Ga0495683_0085180 Ga0495683_0085180_563_1126 187
629 3300047443 Ga0495687_000038 Ga0495687_000038_7753_8316 187
630 3300047443 Ga0495687_000057 Ga0495687_000057_179089_179652 187
631 3300047443 Ga0495687_000165 Ga0495687_000165_1826_2389 187
632 3300047443 Ga0495687_001055 Ga0495687_001055_7391_7954 187
633 3300047443 Ga0495687_001122 Ga0495687_001122_8876_9439 187
634 3300047443 Ga0495687_070205 Ga0495687_070205_45_608 187
635 3300047445 Ga0495677_0000004 Ga0495677_0000004_240045_240608 187
636 3300047445 Ga0495677_0005204 Ga0495677_0005204_2667_3230 187
637 3300047445 Ga0495677_0030645 Ga0495677_0030645_489_1052 187
638 3300047445 Ga0495677_0074959 Ga0495677_0074959_281_844 187
639 3300047445 Ga0495677_0086085 Ga0495677_0086085_292_855 187
640 3300047445 Ga0495677_0170223 Ga0495677_0170223_115_678 187
641 3300047446 Ga0495679_001332 Ga0495679_001332_4876_5439 187
642 3300047446 Ga0495679_063648 Ga0495679_063648_222_785 187
643 3300047447 Ga0495685_000299 Ga0495685_000299_9208_9771 187
644 3300047447 Ga0495685_021233 Ga0495685_021233_1530_2093 187
645 3300047447 Ga0495685_039572 Ga0495685_039572_96_659 187
646 3300047447 Ga0495685_082816 Ga0495685_082816_187_750 187
647 3300047469 Ga0495673_0000069 Ga0495673_0000069_209837_210400 187
648 3300047469 Ga0495673_0000203 Ga0495673_0000203_7928_8491 187
649 3300047469 Ga0495673_0000236 Ga0495673_0000236_70981_71544 187
650 3300047470 Ga0495681_0001009 Ga0495681_0001009_18723_19286 187
651 3300047470 Ga0495681_0015607 Ga0495681_0015607_843_1406 187
652 3300047470 Ga0495681_0051862 Ga0495681_0051862_410_973 187
653 3300047470 Ga0495681_0076968 Ga0495681_0076968_801_1364 187
654 3300047472 Ga0495686_0000620 Ga0495686_0000620_1658_2221 187
655 3300047472 Ga0495686_0001028 Ga0495686_0001028_969_1532 187
656 3300047472 Ga0495686_0006069 Ga0495686_0006069_2716_3279 187
657 3300047472 Ga0495686_0053203 Ga0495686_0053203_270_833 187
658 3300047472 Ga0495686_0132978 Ga0495686_0132978_209_787 187
659 3300047472 Ga0495686_0264985 Ga0495686_0264985_336_899 187
660 3300048088 Ga0495602_0123252 Ga0495602_0123252_428_1015 187
661 3300048088 Ga0495602_0124621 Ga0495602_0124621_1304_1867 187
662 3300048089 Ga0495614_0037921 Ga0495614_0037921_1144_1707 187
663 3300048090 Ga0495615_0004412 Ga0495615_0004412_406_969 187
664 3300048090 Ga0495615_0130685 Ga0495615_0130685_115_678 187
665 3300048091 Ga0495626_0000048 Ga0495626_0000048_7468_8031 187
666 3300048091 Ga0495626_0000998 Ga0495626_0000998_16166_16729 187
667 3300048091 Ga0495626_0010181 Ga0495626_0010181_250_813 187
668 3300048091 Ga0495626_0049285 Ga0495626_0049285_757_1320 187
669 3300048091 Ga0495626_0052127 Ga0495626_0052127_203_766 187
670 3300048091 Ga0495626_0057384 Ga0495626_0057384_390_953 187
671 3300048091 Ga0495626_0111765 Ga0495626_0111765_544_1107 187
672 3300048091 Ga0495626_0156595 Ga0495626_0156595_153_716 187
673 3300048091 Ga0495626_0192718 Ga0495626_0192718_250_813 187
674 3300048903 Ga0496100_0154562 Ga0496100_0154562_420_983 187
675 3300048904 Ga0496101_0070873 Ga0496101_0070873_362_925 187
676 3300048904 Ga0496101_0344823 Ga0496101_0344823_376_939 187
677 3300048905 Ga0496102_0000478 Ga0496102_0000478_35875_36438 187
678 3300048905 Ga0496102_0008640 Ga0496102_0008640_6538_7101 187
679 3300048905 Ga0496102_0215355 Ga0496102_0215355_671_1234 187
680 3300048905 Ga0496102_0844309 Ga0496102_0844309_121_684 187
681 3300048906 Ga0496103_0039346 Ga0496103_0039346_865_1428 187
682 3300048906 Ga0496103_0146237 Ga0496103_0146237_935_1498 187
683 3300048908 Ga0496105_0674294 Ga0496105_0674294_215_778 187
684 3300048909 Ga0496106_0335160 Ga0496106_0335160_386_949 187
685 3300048910 Ga0496107_0131596 Ga0496107_0131596_1112_1675 187
686 3300048912 Ga0496109_0233913 Ga0496109_0233913_276_839 187
687 3300048913 Ga0496110_0223501 Ga0496110_0223501_213_776 187
688 3300048914 Ga0496111_0104260 Ga0496111_0104260_162_725 187
689 3300048916 Ga0496113_0097164 Ga0496113_0097164_507_1070 187
690 3300048917 Ga0496114_0117903 Ga0496114_0117903_1345_1908 187
691 3300048918 Ga0496115_0530364 Ga0496115_0530364_31_594 187
692 3300048919 Ga0496116_0201000 Ga0496116_0201000_349_912 187
693 3300048924 Ga0496121_0236502 Ga0496121_0236502_279_842 187
694 3300048924 Ga0496121_0333285 Ga0496121_0333285_53_616 187
695 3300048925 Ga0496122_0042085 Ga0496122_0042085_356_919 187
696 3300048926 Ga0496123_0000084 Ga0496123_0000084_177976_178539 187
697 3300048926 Ga0496123_0004216 Ga0496123_0004216_2827_3390 187
698 3300048927 Ga0496124_0134060 Ga0496124_0134060_859_1422 187
699 3300048927 Ga0496124_0468886 Ga0496124_0468886_24_587 187
700 3300048927 Ga0496124_0521428 Ga0496124_0521428_198_761 187
701 3300048928 Ga0496125_0000368 Ga0496125_0000368_77667_78230 187
702 3300048929 Ga0496126_0027941 Ga0496126_0027941_2546_3109 187
703 3300048929 Ga0496126_0114487 Ga0496126_0114487_199_762 187
704 3300048929 Ga0496126_0287297 Ga0496126_0287297_527_1090 187
705 3300049459 Ga0495678_000095 Ga0495678_000095_108867_109430 187
706 3300049459 Ga0495678_000383 Ga0495678_000383_7613_8176 187
707 3300049459 Ga0495678_001441 Ga0495678_001441_3953_4516 187
708 3300049459 Ga0495678_009739 Ga0495678_009739_1108_1671 187
709 3300049459 Ga0495678_056982 Ga0495678_056982_295_858 187
710 3300049460 Ga0495682_0000089 Ga0495682_0000089_2641_3204 187
711 3300049460 Ga0495682_0000432 Ga0495682_0000432_727_1290 187
712 3300049460 Ga0495682_0084149 Ga0495682_0084149_346_909 187
713 3300049460 Ga0495682_0208689 Ga0495682_0208689_72_635 187
714 3300049518 Ga0501295_001090 Ga0501295_001090_1249_1812 187
715 3300049571 Ga0501034_1031688 Ga0501034_1031688_69_635 187
716 3300049671 Ga0501238_001560 Ga0501238_001560_1659_2246 187
717 3300049673 Ga0501240_041629 Ga0501240_041629_135_698 187
718 3300049744 Ga0501083_0049975 Ga0501083_0049975_2056_2619 187
719 3300049766 Ga0501269_038157 Ga0501269_038157_29_616 187
720 3300050493 nmdc:mga0k408_2236_c1 nmdc:mga0k408_2236_c1_3446_4009 187
721 3300053118 Ga0500594_0114301 Ga0500594_0114301_94_657 187
722 3300053125 Ga0500618_000653 Ga0500618_000653_7760_8323 187
723 3300053145 Ga0500586_000912 Ga0500586_000912_2675_3238 187
724 3300053156 Ga0500622_0204456 Ga0500622_0204456_154_717 187
725 3300061719 Ga0466962_0015221 Ga0466962_0015221_1547_2110 187
726 iso_pu_bacteria 2511231003 2511250316 187
727 iso_pu_bacteria 2511231026 2511387578 187
728 iso_pu_bacteria 2521172590 2521559828 187
729 iso_pu_bacteria 2548876994 2550693195 187
730 iso_pu_bacteria 2551306416 2553007038 187
731 iso_pu_bacteria 2582581311 2585294009 187
732 iso_pu_bacteria 2765235838 2765571084 187
733 iso_pu_bacteria 2808606386 2808984992 187
734 iso_pu_bacteria 2808606415 2809130124 187
735 iso_pu_bacteria 2808606419 2809150399 187
736 iso_pu_bacteria 2816332253 2817259865 187
737 iso_pu_bacteria 2816332286 2817456660 187
738 iso_pu_bacteria 2818991445 2819594069 187
739 iso_pu_bacteria 2818991449 2819618263 187
740 iso_pu_bacteria 2839094727 2839096680 187
741 iso_pu_bacteria 2852618963 2852621377 187
742 iso_pu_bacteria 2884811622 2884815180 187
743 iso_pu_bacteria 2884836552 2884839896 187
744 iso_pu_bacteria 2884852848 2884856293 187
745 iso_pu_bacteria 2891633521 2891635436 187
746 iso_pu_bacteria 2896154374 2896158658 187
747 iso_pu_bacteria 2904439833 2904444394 187
748 iso_pu_bacteria 2904530477 2904535547 187
749 iso_pu_bacteria 2904584206 2904588119 187
750 iso_pu_bacteria 2904589729 2904595155 187
751 iso_pu_bacteria 2904601388 2904606068 187
752 iso_pu_bacteria 2919046199 2919051306 187
753 iso_pu_bacteria 2919079590 2919084266 187
754 iso_pu_bacteria 2923510766 2923513595 187
755 iso_pu_bacteria 2928130867 2928135288 187
756 iso_pu_bacteria 2932410948 2932416362 187
757 iso_pu_bacteria 2932416698 2932422245 187
758 iso_pu_bacteria 639633007 639788486 187
759 iso_pu_bacteria 8020807995 8020810836 187
760 iso_pu_bacteria 8040167225 8040172684 187
761 iso_pu_bacteria 8040173305 8040176359 187
762 iso_pu_bacteria 8055225921 8055225935 187
763 3300002739 JGI25158J39367_1003079 JGI25158J39367_10030793 188
764 3300002774 JGI25150J39212_1003626 JGI25150J39212_10036263 188
765 3300002987 JGI25159J45721_1005724 JGI25159J45721_10057244 188
766 3300003215 JGI25153J46596_10018531 JGI25153J46596_100185313 188
767 3300003354 JGI25160J50197_1003453 JGI25160J50197_10034532 188
768 3300003374 JGI25161J50226_1006300 JGI25161J50226_10063002 188
769 3300003771 Ga0055526_1005708 Ga0055526_10057081 188
770 3300003773 Ga0055537_1009165 Ga0055537_10091652 188
771 3300003775 Ga0055524_1002755 Ga0055524_10027552 188
772 3300003775 Ga0055524_1010041 Ga0055524_10100411 188
773 3300003791 Ga0055530_10050684 Ga0055530_100506842 188
774 3300005468 Ga0070707_100111118 Ga0070707_1001111182 188
775 3300005536 Ga0070697_100618561 Ga0070697_1006185611 188
776 3300025208 Ga0209436_100769 Ga0209436_10076914 188
777 3300025245 Ga0207425_1000021 Ga0207425_1000021348 188
778 3300025258 Ga0209129_1000020 Ga0209129_1000020419 188
779 3300025263 Ga0209565_1000677 Ga0209565_100067714 188
780 3300025263 Ga0209565_1003264 Ga0209565_10032647 188
781 3300025273 Ga0209673_1003338 Ga0209673_10033387 188
782 3300025284 Ga0209130_1002260 Ga0209130_100226012 188
783 3300025291 Ga0209675_1001299 Ga0209675_10012992 188
784 3300025295 Ga0209564_1000063 Ga0209564_10000639 188
785 3300025295 Ga0209564_1001666 Ga0209564_100166614 188
786 3300025297 Ga0209758_1000288 Ga0209758_100028886 188
787 3300025298 Ga0209050_1000050 Ga0209050_1000050349 188
788 3300025299 Ga0209256_1000754 Ga0209256_100075411 188
789 3300025302 Ga0207426_1003112 Ga0207426_10031123 188
790 3300025303 Ga0209051_1028245 Ga0209051_10282452 188
791 3300030500 Ga0268256_1004381 Ga0268256_10043812 188
792 3300030745 Ga0316182_1021746 Ga0316182_10217462 188
793 3300030745 Ga0316182_1361262 Ga0316182_13612622 188
794 3300031239 Ga0265328_10000016 Ga0265328_1000001687 188
795 3300031250 Ga0265331_10054133 Ga0265331_100541332 188
796 3300031251 Ga0265327_10000528 Ga0265327_1000052831 188
797 3300031251 Ga0265327_10018721 Ga0265327_100187213 188
798 3300031344 Ga0265316_10376779 Ga0265316_103767792 188
799 3300031548 Ga0307408_100000432 Ga0307408_10000043229 188
800 3300031548 Ga0307408_100002407 Ga0307408_1000024075 188
801 3300031548 Ga0307408_100010617 Ga0307408_1000106172 188
802 3300031911 Ga0307412_10000169 Ga0307412_1000016939 188
803 3300032002 Ga0307416_100000975 Ga0307416_1000009759 188
804 3300032133 Ga0316583_10069475 Ga0316583_100694752 188
805 3300039062 Ga0400483_005643 Ga0400483_005643_446_1012 188
806 3300039062 Ga0400483_266454 Ga0400483_266454_1150_1716 188
807 3300041494 Ga0451837_0319601 Ga0451837_0319601_375_956 188
808 3300042008 Ga0439450_042434 Ga0439450_042434_119_709 188
809 3300044712 Ga0453684_1610308 Ga0453684_1610308_72_638 188
810 3300046460 Ga0495638_0142822 Ga0495638_0142822_482_1048 188
811 3300046460 Ga0495638_0279409 Ga0495638_0279409_181_747 188
812 3300046474 Ga0495605_0051571 Ga0495605_0051571_987_1553 188
813 3300046474 Ga0495605_0118230 Ga0495605_0118230_356_922 188
814 3300046491 Ga0495584_0008319 Ga0495584_0008319_297_863 188
815 3300046492 Ga0495585_0110487 Ga0495585_0110487_662_1228 188
816 3300046492 Ga0495585_0198599 Ga0495585_0198599_68_634 188
817 3300046501 Ga0495607_0201691 Ga0495607_0201691_53_619 188
818 3300046506 Ga0495583_0002413 Ga0495583_0002413_15165_15731 188
819 3300046506 Ga0495583_0019473 Ga0495583_0019473_2645_3211 188
820 3300046506 Ga0495583_0032678 Ga0495583_0032678_1843_2409 188
821 3300046506 Ga0495583_0055535 Ga0495583_0055535_1005_1571 188
822 3300046507 Ga0495606_0086803 Ga0495606_0086803_1158_1724 188
823 3300046507 Ga0495606_0167075 Ga0495606_0167075_584_1150 188
824 3300046512 Ga0495610_0149659 Ga0495610_0149659_216_782 188
825 3300046513 Ga0495616_0000490 Ga0495616_0000490_26741_27307 188
826 3300046519 Ga0495632_0012494 Ga0495632_0012494_1102_1668 188
827 3300046520 Ga0495637_0000018 Ga0495637_0000018_8698_9264 188
828 3300046522 Ga0495643_0000109 Ga0495643_0000109_7459_8025 188
829 3300046523 Ga0495644_0131017 Ga0495644_0131017_115_681 188
830 3300046524 Ga0495648_0221552 Ga0495648_0221552_206_772 188
831 3300046528 Ga0495642_0049932 Ga0495642_0049932_1136_1702 188
832 3300046538 Ga0495609_0053145 Ga0495609_0053145_869_1435 188
833 3300046558 Ga0495633_0003343 Ga0495633_0003343_8698_9264 188
834 3300046616 Ga0495668_0066663 Ga0495668_0066663_604_1170 188
835 3300046648 Ga0495611_0058343 Ga0495611_0058343_365_931 188
836 3300046684 Ga0495669_0093504 Ga0495669_0093504_220_786 188
837 3300046794 Ga0495589_0051939 Ga0495589_0051939_1352_1918 188
838 3300046794 Ga0495589_0081465 Ga0495589_0081465_156_722 188
839 3300046810 Ga0495660_0007681 Ga0495660_0007681_5377_5943 188
840 3300046810 Ga0495660_0216121 Ga0495660_0216121_118_684 188
841 3300047320 Ga0495672_0270825 Ga0495672_0270825_88_654 188
842 3300047323 Ga0495683_0043476 Ga0495683_0043476_892_1458 188
843 3300047323 Ga0495683_0287733 Ga0495683_0287733_41_607 188
844 3300047445 Ga0495677_0000948 Ga0495677_0000948_8885_9451 188
845 3300047447 Ga0495685_023768 Ga0495685_023768_548_1114 188
846 3300047469 Ga0495673_0185264 Ga0495673_0185264_72_638 188
847 3300047472 Ga0495686_0048133 Ga0495686_0048133_473_1039 188
848 3300048091 Ga0495626_0001757 Ga0495626_0001757_8322_8888 188
849 3300048091 Ga0495626_0021084 Ga0495626_0021084_1505_2071 188
850 3300048091 Ga0495626_0065425 Ga0495626_0065425_67_633 188
851 3300048091 Ga0495626_0223047 Ga0495626_0223047_66_632 188
852 3300048905 Ga0496102_0017344 Ga0496102_0017344_1582_2148 188
853 3300048913 Ga0496110_0000092 Ga0496110_0000092_38211_38777 188
854 3300048924 Ga0496121_0002018 Ga0496121_0002018_2567_3133 188
855 3300049459 Ga0495678_000034 Ga0495678_000034_8673_9239 188
856 3300049459 Ga0495678_001376 Ga0495678_001376_8959_9525 188
857 3300049460 Ga0495682_0078158 Ga0495682_0078158_311_877 188
858 3300049531 Ga0501315_008783 Ga0501315_008783_353_943 188
859 3300049532 Ga0501316_007461 Ga0501316_007461_204_794 188
860 3300049652 Ga0501202_066870 Ga0501202_066870_154_720 188
861 3300049658 Ga0501211_003557 Ga0501211_003557_500_1090 188
862 3300049658 Ga0501211_012123 Ga0501211_012123_29_619 188
863 3300049667 Ga0501230_014418 Ga0501230_014418_317_907 188
864 3300050509 nmdc:mga0qj67_484271_c1 nmdc:mga0qj67_484271_c1_73_639 188
865 3300002772 JGI25164J39214_1003913 JGI25164J39214_10039131 189
866 3300003214 JGI25165J46597_1000713 JGI25165J46597_100071315 189
867 3300003574 Ga0007410J51695_1015624 Ga0007410J51695_10156242 189
868 3300003575 Ga0007409J51694_1007308 Ga0007409J51694_10073083 189
869 3300003751 Ga0055538_1000281 Ga0055538_100028115 189
870 3300003752 Ga0055539_1000305 Ga0055539_100030515 189
871 3300003756 Ga0055533_1000286 Ga0055533_100028615 189
872 3300003759 Ga0055525_1000018 Ga0055525_10000189 189
873 3300003759 Ga0055525_1000405 Ga0055525_100040512 189
874 3300003841 Ga0055541_1000198 Ga0055541_100019815 189
875 3300005327 Ga0070658_10710717 Ga0070658_107107171 189
876 3300005339 Ga0070660_100016657 Ga0070660_1000166576 189
877 3300005366 Ga0070659_100082019 Ga0070659_1000820192 189
878 3300005366 Ga0070659_100216063 Ga0070659_1002160632 189
879 3300005457 Ga0070662_100692878 Ga0070662_1006928782 189
880 3300005459 Ga0068867_100056392 Ga0068867_1000563922 189
881 3300005530 Ga0070679_100691385 Ga0070679_1006913851 189
882 3300005563 Ga0068855_100016570 Ga0068855_1000165708 189
883 3300005563 Ga0068855_101052987 Ga0068855_1010529871 189
884 3300005616 Ga0068852_100004237 Ga0068852_1000042375 189
885 3300009036 Ga0105244_10110311 Ga0105244_101103112 189
886 3300009174 Ga0105241_10120376 Ga0105241_101203763 189
887 3300009176 Ga0105242_10037198 Ga0105242_100371984 189
888 3300010375 Ga0105239_10961472 Ga0105239_109614722 189
889 3300013296 Ga0157374_11006092 Ga0157374_110060922 189
890 3300013297 Ga0157378_10091922 Ga0157378_100919222 189
891 3300021361 Ga0213872_10001856 Ga0213872_100018563 189
892 3300021361 Ga0213872_10024411 Ga0213872_100244112 189
893 3300025224 Ga0209784_100010 Ga0209784_100010626 189
894 3300025225 Ga0209566_100008 Ga0209566_100008626 189
895 3300025226 Ga0209674_100019 Ga0209674_100019626 189
896 3300025230 Ga0209563_100011 Ga0209563_1000111086 189
897 3300025230 Ga0209563_100021 Ga0209563_100021626 189
898 3300025231 Ga0207427_100759 Ga0207427_1007597 189
899 3300025233 Ga0209437_100019 Ga0209437_100019626 189
900 3300025253 Ga0209677_100011 Ga0209677_100011626 189
901 3300025253 Ga0209677_101699 Ga0209677_10169910 189
902 3300025261 Ga0209233_1000025 Ga0209233_1000025626 189
903 3300025294 Ga0209025_1000473 Ga0209025_100047315 189
904 3300025321 Ga0207656_10071281 Ga0207656_100712812 189
905 3300025728 Ga0207655_1064734 Ga0207655_10647342 189
906 3300025909 Ga0207705_10034051 Ga0207705_100340514 189
907 3300025911 Ga0207654_10022625 Ga0207654_100226252 189
908 3300025914 Ga0207671_10309446 Ga0207671_103094461 189
909 3300025919 Ga0207657_10231476 Ga0207657_102314762 189
910 3300025919 Ga0207657_10525715 Ga0207657_105257152 189
911 3300025920 Ga0207649_10493530 Ga0207649_104935302 189
912 3300025921 Ga0207652_10464901 Ga0207652_104649012 189
913 3300025924 Ga0207694_10858659 Ga0207694_108586591 189
914 3300025932 Ga0207690_10323880 Ga0207690_103238802 189
915 3300025934 Ga0207686_10036176 Ga0207686_100361761 189
916 3300025935 Ga0207709_10388720 Ga0207709_103887202 189
917 3300025949 Ga0207667_10550318 Ga0207667_105503182 189
918 3300026067 Ga0207678_10439887 Ga0207678_104398872 189
919 3300026089 Ga0207648_10086029 Ga0207648_100860293 189
920 3300026116 Ga0207674_10281988 Ga0207674_102819882 189
921 3300026142 Ga0207698_10095163 Ga0207698_100951633 189
922 3300028666 Ga0265336_10006403 Ga0265336_100064034 189
923 3300028666 Ga0265336_10048575 Ga0265336_100485751 189
924 3300028800 Ga0265338_10066959 Ga0265338_100669593 189
925 3300029957 Ga0265324_10000002 Ga0265324_10000002121 189
926 3300029957 Ga0265324_10000616 Ga0265324_100006164 189
927 3300031241 Ga0265325_10002841 Ga0265325_100028417 189
928 3300031241 Ga0265325_10007848 Ga0265325_100078484 189
929 3300031250 Ga0265331_10009812 Ga0265331_100098121 189
930 3300031250 Ga0265331_10158693 Ga0265331_101586932 189
931 3300031251 Ga0265327_10015618 Ga0265327_100156184 189
932 3300031251 Ga0265327_10123875 Ga0265327_101238752 189
933 3300031251 Ga0265327_10216212 Ga0265327_102162122 189
934 3300031344 Ga0265316_10090702 Ga0265316_100907022 189
935 3300031344 Ga0265316_10158523 Ga0265316_101585232 189
936 3300031665 Ga0316575_10003832 Ga0316575_100038325 189
937 3300031711 Ga0265314_10001144 Ga0265314_100011444 189
938 3300031711 Ga0265314_10118654 Ga0265314_101186542 189
939 3300032133 Ga0316583_10021200 Ga0316583_100212002 189
940 3300036647 Ga0316582_0049684 Ga0316582_0049684_1111_1680 189
941 3300037312 Ga0395899_0002474 Ga0395899_0002474_1441_2010 189
942 3300037312 Ga0395899_0126723 Ga0395899_0126723_773_1342 189
943 3300037418 Ga0395900_0006506 Ga0395900_0006506_10134_10703 189
944 3300037418 Ga0395900_0010081 Ga0395900_0010081_1776_2345 189
945 3300037418 Ga0395900_0035466 Ga0395900_0035466_3794_4363 189
946 3300037418 Ga0395900_0285610 Ga0395900_0285610_841_1410 189
947 3300037466 Ga0395898_0508579 Ga0395898_0508579_121_690 189
948 3300037466 Ga0395898_0690689 Ga0395898_0690689_340_909 189
949 3300038443 Ga0395901_0000824 Ga0395901_0000824_821_1390 189
950 3300038443 Ga0395901_0002897 Ga0395901_0002897_10628_11197 189
951 3300039447 Ga0436361_0512442 Ga0436361_0512442_11982_12551 189
952 3300039447 Ga0436361_1072133 Ga0436361_1072133_1609_2178 189
953 3300039447 Ga0436361_1206124 Ga0436361_1206124_8629_9198 189
954 3300041404 Ga0439436_0086795 Ga0439436_0086795_63_632 189
955 3300042005 Ga0439448_0000161 Ga0439448_0000161_65_634 189
956 3300042007 Ga0439449_0009520 Ga0439449_0009520_3040_3609 189
957 3300042008 Ga0439450_017711 Ga0439450_017711_562_1131 189
958 3300042008 Ga0439450_053924 Ga0439450_053924_186_755 189
959 3300042876 Ga0451577_0000002 Ga0451577_0000002_1442278_1442847 189
960 3300042876 Ga0451577_0000345 Ga0451577_0000345_64958_65527 189
961 3300042876 Ga0451577_0219478 Ga0451577_0219478_233_802 189
962 3300042876 Ga0451577_0407278 Ga0451577_0407278_79_648 189
963 3300042876 Ga0451577_0743976 Ga0451577_0743976_11_580 189
964 3300042876 Ga0451577_0944695 Ga0451577_0944695_94_663 189
965 3300044656 Ga0466969_0250847 Ga0466969_0250847_193_762 189
966 3300044658 Ga0466972_0003973 Ga0466972_0003973_1456_2025 189
967 3300044673 Ga0453683_0000013 Ga0453683_0000013_82835_83404 189
968 3300044683 Ga0466965_0028860 Ga0466965_0028860_555_1124 189
969 3300044683 Ga0466965_0029552 Ga0466965_0029552_562_1131 189
970 3300044683 Ga0466965_0031596 Ga0466965_0031596_1081_1650 189
971 3300044683 Ga0466965_0073626 Ga0466965_0073626_103_672 189
972 3300044684 Ga0466966_0029262 Ga0466966_0029262_1413_1982 189
973 3300044684 Ga0466966_0082568 Ga0466966_0082568_1420_1989 189
974 3300044706 Ga0466964_0007888 Ga0466964_0007888_2707_3276 189
975 3300044706 Ga0466964_0018884 Ga0466964_0018884_626_1195 189
976 3300044712 Ga0453684_0000002 Ga0453684_0000002_288529_289098 189
977 3300044712 Ga0453684_0000040 Ga0453684_0000040_414332_414901 189
978 3300044712 Ga0453684_0000065 Ga0453684_0000065_294697_295266 189
979 3300044712 Ga0453684_0000694 Ga0453684_0000694_33710_34279 189
980 3300044712 Ga0453684_0010268 Ga0453684_0010268_12224_12793 189
981 3300044735 Ga0466968_0210388 Ga0466968_0210388_189_758 189
982 3300044842 Ga0466957_0001920 Ga0466957_0001920_3689_4258 189
983 3300044901 Ga0466960_0257561 Ga0466960_0257561_294_863 189
984 3300045049 Ga0466959_0002185 Ga0466959_0002185_4179_4748 189
985 3300045051 Ga0451576_0000006 Ga0451576_0000006_896137_896706 189
986 3300045051 Ga0451576_0000037 Ga0451576_0000037_83076_83645 189
987 3300045051 Ga0451576_0002868 Ga0451576_0002868_13970_14539 189
988 3300045051 Ga0451576_0005999 Ga0451576_0005999_3925_4494 189
989 3300045051 Ga0451576_0199277 Ga0451576_0199277_866_1435 189
990 3300045051 Ga0451576_0359886 Ga0451576_0359886_422_991 189
991 3300046474 Ga0495605_0000102 Ga0495605_0000102_7550_8119 189
992 3300046501 Ga0495607_0021757 Ga0495607_0021757_2422_2991 189
993 3300046522 Ga0495643_0000914 Ga0495643_0000914_29447_30016 189
994 3300046522 Ga0495643_0014484 Ga0495643_0014484_1042_1611 189
995 3300046615 Ga0495656_0090382 Ga0495656_0090382_100_669 189
996 3300046665 Ga0495661_0024989 Ga0495661_0024989_860_1429 189
997 3300046674 Ga0495588_0000451 Ga0495588_0000451_7386_7955 189
998 3300046794 Ga0495589_0000086 Ga0495589_0000086_78162_78731 189
999 3300046810 Ga0495660_0001930 Ga0495660_0001930_11516_12085 189
1000 3300047320 Ga0495672_0000278 Ga0495672_0000278_62896_63465 189
1001 3300047443 Ga0495687_001809 Ga0495687_001809_16791_17360 189
1002 3300048091 Ga0495626_0000279 Ga0495626_0000279_48217_48786 189
1003 3300048905 Ga0496102_0060082 Ga0496102_0060082_638_1207 189
1004 3300048907 Ga0496104_0443679 Ga0496104_0443679_413_982 189
1005 3300048909 Ga0496106_0830783 Ga0496106_0830783_44_613 189
1006 3300048910 Ga0496107_0227084 Ga0496107_0227084_94_663 189
1007 3300048916 Ga0496113_1025587 Ga0496113_1025587_26_595 189
1008 3300048918 Ga0496115_0702750 Ga0496115_0702750_172_741 189
1009 3300048927 Ga0496124_0258140 Ga0496124_0258140_69_638 189
1010 3300049571 Ga0501034_0000134 Ga0501034_0000134_124898_125467 189
1011 3300049822 Ga0501035_0006010 Ga0501035_0006010_6120_6689 189
1012 3300049823 Ga0501044_0252781 Ga0501044_0252781_440_1009 189
1013 3300049824 Ga0501045_0552537 Ga0501045_0552537_162_731 189
1014 3300053177 Ga0500636_0000203 Ga0500636_0000203_31054_31623 189
1015 3300053178 Ga0500637_0148477 Ga0500637_0148477_419_988 189
1016 3300053729 Ga0500625_005119 Ga0500625_005119_971_1540 189
1017 3300059504 Ga0587082_018912 Ga0587082_018912_43_612 189
1018 3300059505 Ga0587083_0076817 Ga0587083_0076817_119_688 189
1019 3300059605 Ga0587106_019270 Ga0587106_019270_70_639 189
1020 3300059641 Ga0587068_008109 Ga0587068_008109_349_918 189
1021 3300061719 Ga0466962_0085214 Ga0466962_0085214_860_1429 189
1022 3300005841 Ga0068863_100298029 Ga0068863_1002980291 190
1023 3300009176 Ga0105242_10180899 Ga0105242_101808991 190
1024 3300026088 Ga0207641_10366349 Ga0207641_103663492 190
1025 3300027876 Ga0209974_10027183 Ga0209974_100271831 190
1026 3300031238 Ga0265332_10000030 Ga0265332_10000030162 190
1027 3300031238 Ga0265332_10001445 Ga0265332_100014454 190
1028 3300031250 Ga0265331_10089997 Ga0265331_100899972 190
1029 3300031507 Ga0307509_10000076 Ga0307509_1000007658 190
1030 3300031595 Ga0265313_10040874 Ga0265313_100408741 190
1031 3300049779 Ga0501283_049195 Ga0501283_049195_138_710 190
1032 3300002704 JGI25155J39150_1000336 JGI25155J39150_10003361 191
1033 3300002704 JGI25155J39150_1000485 JGI25155J39150_10004851 191
1034 3300002705 JGI25156J39149_1000267 JGI25156J39149_10002672 191
1035 3300002705 JGI25156J39149_1013381 JGI25156J39149_10133812 191
1036 3300002738 JGI25154J39366_1000739 JGI25154J39366_100073914 191
1037 3300002738 JGI25154J39366_1001209 JGI25154J39366_100120910 191
1038 3300002738 JGI25154J39366_1002200 JGI25154J39366_10022001 191
1039 3300002741 JGI25157J39369_1000372 JGI25157J39369_10003729 191
1040 3300002741 JGI25157J39369_1000495 JGI25157J39369_100049523 191
1041 3300003751 Ga0055538_1000062 Ga0055538_100006284 191
1042 3300003752 Ga0055539_1000093 Ga0055539_100009384 191
1043 3300003756 Ga0055533_1000105 Ga0055533_100010584 191
1044 3300003758 Ga0055532_1000034 Ga0055532_10000349 191
1045 3300003759 Ga0055525_1000137 Ga0055525_100013784 191
1046 3300003841 Ga0055541_1000063 Ga0055541_100006384 191
1047 3300005331 Ga0070670_100086718 Ga0070670_1000867182 191
1048 3300005337 Ga0070682_100577228 Ga0070682_1005772282 191
1049 3300005563 Ga0068855_100035272 Ga0068855_1000352726 191
1050 3300005563 Ga0068855_101571899 Ga0068855_1015718991 191
1051 3300005577 Ga0068857_100326958 Ga0068857_1003269582 191
1052 3300005578 Ga0068854_100017165 Ga0068854_1000171652 191
1053 3300005614 Ga0068856_100163375 Ga0068856_1001633752 191
1054 3300005616 Ga0068852_100004430 Ga0068852_1000044304 191
1055 3300006844 Ga0075428_100377519 Ga0075428_1003775192 191
1056 3300006846 Ga0075430_100258757 Ga0075430_1002587572 191
1057 3300006847 Ga0075431_100002888 Ga0075431_10000288818 191
1058 3300006946 Ga0079104_1008552 Ga0079104_10085524 191
1059 3300009036 Ga0105244_10035827 Ga0105244_100358272 191
1060 3300009093 Ga0105240_10001608 Ga0105240_1000160831 191
1061 3300009093 Ga0105240_10016336 Ga0105240_100163364 191
1062 3300009093 Ga0105240_10190542 Ga0105240_101905421 191
1063 3300009545 Ga0105237_10010944 Ga0105237_100109442 191
1064 3300009551 Ga0105238_10000763 Ga0105238_100007639 191
1065 3300010375 Ga0105239_10010387 Ga0105239_100103879 191
1066 3300013100 Ga0157373_10711950 Ga0157373_107119501 191
1067 3300013102 Ga0157371_10039633 Ga0157371_100396332 191
1068 3300013105 Ga0157369_10000804 Ga0157369_1000080413 191
1069 3300013296 Ga0157374_10000924 Ga0157374_1000092418 191
1070 3300013297 Ga0157378_11144502 Ga0157378_111445021 191
1071 3300014497 Ga0182008_10056599 Ga0182008_100565993 191
1072 3300015261 Ga0182006_1058779 Ga0182006_10587792 191
1073 3300025206 Ga0209435_100007 Ga0209435_1000079 191
1074 3300025206 Ga0209435_100176 Ga0209435_1001761 191
1075 3300025224 Ga0209784_100021 Ga0209784_100021374 191
1076 3300025225 Ga0209566_100119 Ga0209566_1001198 191
1077 3300025226 Ga0209674_100036 Ga0209674_100036374 191
1078 3300025229 Ga0209147_100017 Ga0209147_100017463 191
1079 3300025230 Ga0209563_100040 Ga0209563_100040374 191
1080 3300025233 Ga0209437_100332 Ga0209437_1003329 191
1081 3300025242 Ga0209258_101277 Ga0209258_10127710 191
1082 3300025246 Ga0209646_1000044 Ga0209646_1000044304 191
1083 3300025246 Ga0209646_1000107 Ga0209646_1000107139 191
1084 3300025250 Ga0209026_1000063 Ga0209026_10000639 191
1085 3300025250 Ga0209026_1012017 Ga0209026_10120172 191
1086 3300025253 Ga0209677_100023 Ga0209677_100023374 191
1087 3300025256 Ga0209759_1000048 Ga0209759_10000489 191
1088 3300025256 Ga0209759_1000198 Ga0209759_100019883 191
1089 3300025272 Ga0209455_1029838 Ga0209455_10298382 191
1090 3300025913 Ga0207695_10008939 Ga0207695_100089398 191
1091 3300025913 Ga0207695_10012318 Ga0207695_100123183 191
1092 3300025913 Ga0207695_10136114 Ga0207695_101361143 191
1093 3300025914 Ga0207671_10004652 Ga0207671_100046528 191
1094 3300025924 Ga0207694_10000343 Ga0207694_100003432 191
1095 3300025925 Ga0207650_10063319 Ga0207650_100633192 191
1096 3300025932 Ga0207690_10330334 Ga0207690_103303342 191
1097 3300025949 Ga0207667_10000912 Ga0207667_100009129 191
1098 3300025949 Ga0207667_10007366 Ga0207667_100073661 191
1099 3300025949 Ga0207667_10317294 Ga0207667_103172942 191
1100 3300025981 Ga0207640_10041316 Ga0207640_100413162 191
1101 3300026041 Ga0207639_10170095 Ga0207639_101700953 191
1102 3300026078 Ga0207702_10168886 Ga0207702_101688862 191
1103 3300026116 Ga0207674_10182190 Ga0207674_101821902 191
1104 3300026142 Ga0207698_10044764 Ga0207698_100447642 191
1105 3300026142 Ga0207698_10385474 Ga0207698_103854742 191
1106 3300027111 Ga0209281_1005374 Ga0209281_10053742 191
1107 3300031250 Ga0265331_10013920 Ga0265331_100139201 191
1108 3300031251 Ga0265327_10001509 Ga0265327_1000150911 191
1109 3300031731 Ga0307405_10084076 Ga0307405_100840762 191
1110 3300031731 Ga0307405_10270046 Ga0307405_102700462 191
1111 3300031824 Ga0307413_10141496 Ga0307413_101414962 191
1112 3300032002 Ga0307416_100104940 Ga0307416_1001049402 191
1113 3300032004 Ga0307414_10285519 Ga0307414_102855192 191
1114 3300037312 Ga0395899_0125972 Ga0395899_0125972_830_1432 191
1115 3300037418 Ga0395900_0113125 Ga0395900_0113125_2044_2646 191
1116 3300037418 Ga0395900_0181240 Ga0395900_0181240_1283_1885 191
1117 3300037418 Ga0395900_0289530 Ga0395900_0289530_946_1530 191
1118 3300037466 Ga0395898_0000559 Ga0395898_0000559_58632_59234 191
1119 3300037466 Ga0395898_0089880 Ga0395898_0089880_289_891 191
1120 3300038443 Ga0395901_0000328 Ga0395901_0000328_12689_13291 191
1121 3300038443 Ga0395901_0020765 Ga0395901_0020765_3391_3993 191
1122 3300039447 Ga0436361_0303014 Ga0436361_0303014_2986_3561 191
1123 3300039447 Ga0436361_0544664 Ga0436361_0544664_9985_10563 191
1124 3300044666 Ga0466977_0107028 Ga0466977_0107028_662_1249 191
1125 3300044684 Ga0466966_0006887 Ga0466966_0006887_6624_7226 191
1126 3300044693 Ga0466961_0068851 Ga0466961_0068851_340_927 191
1127 3300044719 Ga0466971_0002015 Ga0466971_0002015_2342_2944 191
1128 3300044842 Ga0466957_0018243 Ga0466957_0018243_2806_3408 191
1129 3300045836 Ga0466958_0000123 Ga0466958_0000123_4800_5384 191
1130 3300046660 Ga0495625_0464422 Ga0495625_0464422_144_719 191
1131 3300048919 Ga0496116_0044055 Ga0496116_0044055_243_818 191
1132 3300048924 Ga0496121_0057712 Ga0496121_0057712_2354_2929 191
1133 3300048925 Ga0496122_0003525 Ga0496122_0003525_11602_12177 191
1134 3300048926 Ga0496123_0003683 Ga0496123_0003683_4803_5378 191
1135 3300048928 Ga0496125_0204119 Ga0496125_0204119_256_831 191
1136 3300049459 Ga0495678_083062 Ga0495678_083062_57_632 191
1137 3300049591 Ga0501075_0111296 Ga0501075_0111296_104_712 191
1138 3300049743 Ga0501081_0134001 Ga0501081_0134001_140_748 191
1139 3300049776 Ga0501280_000153 Ga0501280_000153_7853_8431 191
1140 3300050509 nmdc:mga0qj67_246743_c1 nmdc:mga0qj67_246743_c1_300_875 191
1141 3300053125 Ga0500618_062749 Ga0500618_062749_230_805 191
1142 3300053125 Ga0500618_071845 Ga0500618_071845_121_696 191
1143 3300061719 Ga0466962_0000755 Ga0466962_0000755_166_768 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

22

206

0.96

PF07722

Peptidase_C26

Peptidase C26

69

189

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9641 2 186
8hx6-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9477 2 184
8hx7-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9466 2 185
8hx7-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9454 2 184
1wl8-assembly1.cif.gz_A crystal structure of ph1346 protein from pyrococcus horikoshii 0.9417 1 185
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9981 1 185 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9852 2 185 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9822 1 185 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9797 1 186 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9693 2 186 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A5C7X5A9-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 1 1 185 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A2N2T822-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 1 1 169 GO:0000162
GO:0004049
GO:0005829
AF-A0A516WDN0-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 1 1 186 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A231HJD2-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 1 1 186 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A259CX94-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II 0.9996 1 185 GO:0000162
GO:0004049
GO:0005829
GO:0006541

Feature Viewer

pLDDT pTM Quality
94.87 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map