F490551
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1131 | 761 | 682 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300044765|Ga0466970_0016669|Ga0466970_0016669_2051_3124 |
| Length | 357 |
| Sequence | MAFPLPWPDRPPNAPQHKIRAVACDRFDHAKQERIMSQTETKPHTIAQQETNMSLENNSRVGRTGADELVPSRYAVQIGDIEVLVISDGVLPLPTKMLGYNANPADHAAWLKDMFLPQDAFDWALNVVVVRSGKQTILIDAGLGLDPELNLPRAGQLIKRLEAAGIDLGSVTDVVLTHMHMDHVGGLLVDGVKARLRPDLKIHVAAAEVKFWEAPDFSHVSMPPGFPDALRAAAKQFRKEYDSHLRLFADEHEVAPGVVVSRTGGHTPGHSVVRVASGKDRLMFAGDAVFAVGFDHPDWFNGFEHDPEEAARVRVRLLRELAETGELLVATHMPFPSVGHVAADGDRFRWVPVFWDY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 2 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 3 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 4 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 5 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 6 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 7 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 8 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 9 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 10 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 11 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 12 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 13 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 16 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 17 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 20 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 21 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 22 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 23 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 24 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 25 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 26 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 27 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 28 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 29 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 30 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 31 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 32 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 33 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 34 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 35 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 36 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 37 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 38 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 39 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 40 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 41 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 42 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 43 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 44 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 45 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 46 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 47 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 48 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 49 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 50 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 51 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 52 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 53 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 54 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 55 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 56 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 57 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 58 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 59 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 60 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 61 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 62 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 63 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 64 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 65 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 66 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 67 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 68 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 69 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 70 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 71 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 72 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 73 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 74 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 75 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 76 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 77 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 78 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 79 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 80 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 81 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 82 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 83 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 84 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 85 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 86 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 87 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 88 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 89 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 90 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 91 | 2791355199 | |||
| 92 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 93 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 94 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 95 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 96 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 97 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 98 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 99 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 100 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 101 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 102 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 103 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 104 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 105 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 106 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 107 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 108 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 109 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 110 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 111 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 112 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 113 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 114 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 115 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 116 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 117 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 118 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 119 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 120 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 121 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 122 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 123 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 124 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 125 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 126 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 127 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 128 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 129 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 130 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 131 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 132 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 133 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 134 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 135 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 136 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 137 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 138 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 139 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 140 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 141 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 142 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 143 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 144 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 145 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 146 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 147 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 148 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 149 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 150 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 151 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 152 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 153 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 154 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 155 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 156 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 157 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 158 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 159 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 160 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 161 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 162 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 163 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 164 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 165 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 166 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 167 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 168 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 169 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 170 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 171 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 172 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 173 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 174 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 175 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 176 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 177 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 178 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 179 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 180 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 181 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 182 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 183 | 2904699407 | |||
| 184 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 185 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 186 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 187 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 188 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 189 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 190 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 191 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 192 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 193 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 194 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 195 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 196 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 197 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 198 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 199 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 200 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 201 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 202 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 203 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 204 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 205 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 206 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 207 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 208 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 209 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 210 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 211 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 212 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 213 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 214 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 215 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 216 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 217 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 218 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 219 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 220 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 221 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 222 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 223 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 224 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 225 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 226 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 227 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 228 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 229 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 230 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 231 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 232 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 233 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 234 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 235 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 236 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 237 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 238 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 239 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 240 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 241 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 242 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 243 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 244 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 245 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 246 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 247 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 248 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 249 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 250 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 251 | 2941479691 | |||
| 252 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 253 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 254 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 255 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 256 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 257 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 258 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 259 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 260 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 261 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 262 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 263 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 264 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 265 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 266 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 267 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 268 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 269 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 270 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 271 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 272 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 273 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 274 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 275 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 276 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 277 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 278 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 279 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 280 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 281 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 282 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 283 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 284 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 285 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 286 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 287 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 288 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 289 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 290 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 291 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 292 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 293 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 294 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 295 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 296 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 297 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 298 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 299 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 300 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 301 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 302 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 303 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 304 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 305 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 306 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 307 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 308 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 309 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 310 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 311 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 312 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 313 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 314 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 315 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 316 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 317 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 318 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 319 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 320 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 321 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 322 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 323 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 324 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 325 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 326 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 327 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 328 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 329 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 330 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 331 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 332 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 333 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 334 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 335 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 336 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 337 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 338 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 339 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 340 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 341 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 342 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 343 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 344 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 345 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 346 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 347 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 348 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 349 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 350 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 351 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 352 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 353 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 354 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 355 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 356 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 357 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 358 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 359 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 360 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 361 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 362 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 363 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 364 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 365 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 366 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 367 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 368 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 369 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 370 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 371 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 372 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 373 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 374 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 375 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 376 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 377 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 378 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 379 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 380 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 381 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 382 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 383 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 384 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 385 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 386 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 387 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 388 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 389 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 390 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 391 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 392 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 393 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 394 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 395 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 396 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 397 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 398 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 399 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 400 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 401 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 402 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 403 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 404 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 405 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 406 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 407 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 408 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 409 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 410 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 411 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 412 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 413 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 414 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 415 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 416 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 417 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 418 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 419 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 420 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 421 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 422 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 423 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 424 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 425 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 426 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 427 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 428 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 429 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 430 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 431 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 432 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 433 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 434 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 435 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 436 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 437 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 438 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 439 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 440 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 441 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 442 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 443 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 444 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 445 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 446 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 447 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 448 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 449 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 450 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 451 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 452 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 453 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 455 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 456 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 457 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 458 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 459 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 460 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 461 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 462 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 463 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 464 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 465 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 466 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 467 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 468 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 469 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 470 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 471 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 472 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 473 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 474 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 475 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 476 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 477 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 478 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 479 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 480 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 481 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 482 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 483 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 484 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 485 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 486 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 487 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 488 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 489 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 490 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 491 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 492 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 493 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 494 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 495 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 496 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 497 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 498 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 499 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 500 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 501 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 502 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 503 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 504 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 506 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 507 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 508 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 509 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 510 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 511 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 512 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 514 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 515 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 516 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 517 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 518 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 519 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 520 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 521 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 522 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 523 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 524 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 525 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 526 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 527 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 528 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 529 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 530 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 531 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 532 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 533 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 534 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 535 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 536 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 537 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 538 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 539 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 540 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 541 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 542 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 543 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 544 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 545 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 546 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 547 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 548 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 549 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 550 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 551 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 552 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 553 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 554 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 555 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 556 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 557 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 558 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 559 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 560 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 561 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 562 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 563 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 564 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 565 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 566 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 567 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 568 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 569 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 570 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 571 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 572 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 573 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 574 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 575 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 576 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 577 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 578 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 579 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 580 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 581 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 582 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 583 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 584 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 585 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 586 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 587 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 588 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 589 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 590 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 591 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 592 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 593 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 594 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 595 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 596 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 597 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 598 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 599 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 600 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 601 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 602 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 603 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 604 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 605 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 606 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 607 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 608 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 609 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 610 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 648 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 649 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 650 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 651 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 652 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 653 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 654 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 655 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 656 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 657 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 658 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 659 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 660 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 661 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 662 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 663 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 664 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 665 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 666 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 667 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 668 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 669 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 670 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 671 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 672 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 673 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 674 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 676 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 677 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 678 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 679 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 680 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 681 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 682 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 683 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 684 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 685 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 686 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 687 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 688 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 689 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 690 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 691 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 692 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 693 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 694 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 695 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 696 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 697 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 698 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 699 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 700 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 701 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 702 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 703 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 704 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 705 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 706 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 707 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 708 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 709 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 710 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 711 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 712 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 713 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 714 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 715 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 716 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 717 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 718 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 719 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 720 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 721 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 722 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 723 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 724 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 725 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 726 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 727 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 728 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 729 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 730 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 731 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 732 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 733 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 734 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 735 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 736 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 737 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 738 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 739 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 740 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 741 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 742 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 743 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 744 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 745 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 746 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 747 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 748 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 749 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 750 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 751 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 752 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 753 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 754 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 755 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 756 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 757 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 758 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 759 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 760 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 761 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 60.76 |
| Metatranscriptomes | 0 |
| Isolates | 39.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0 |
| Endosphere | 13.7 |
| Nodule | 29 |
| Rhizoplane | 4.24 |
| Rhizosphere | 38.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000063 | 3300002459 | Bacteria | 60668 |
| 2 | JGI25162J39368_1000125 | 3300002737 | Bacteria | 84782 |
| 3 | JGI25152J39213_1000145 | 3300002773 | Bacteria | 48531 |
| 4 | JGI25152J39213_1000768 | 3300002773 | Bacteria | 16180 |
| 5 | JGI25152J39213_1004660 | 3300002773 | Bacteria | 4248 |
| 6 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 7 | JGI25159J45721_1003064 | 3300002987 | Bacteria | 6045 |
| 8 | JGI25159J45721_1011989 | 3300002987 | Bacteria | 2091 |
| 9 | JGI25151J46595_10000005 | 3300003187 | Bacteria | 431598 |
| 10 | JGI25151J46595_10065796 | 3300003187 | Bacteria | 1127 |
| 11 | JGI25165J46597_1000495 | 3300003214 | Bacteria | 37949 |
| 12 | JGI25165J46597_1000571 | 3300003214 | Bacteria | 32965 |
| 13 | JGI25165J46597_1004592 | 3300003214 | Bacteria | 2910 |
| 14 | JGI25153J46596_10000040 | 3300003215 | Bacteria | 165523 |
| 15 | JGI25153J46596_10000532 | 3300003215 | Bacteria | 23955 |
| 16 | JGI25153J46596_10002446 | 3300003215 | Bacteria | 10708 |
| 17 | JGI25153J46596_10009846 | 3300003215 | Bacteria | 4387 |
| 18 | JGI25153J46596_10015269 | 3300003215 | Bacteria | 3139 |
| 19 | rootL2_10022068 | 3300003322 | Bacteria | 32667 |
| 20 | JGI25161J50226_1000150 | 3300003374 | Bacteria | 48475 |
| 21 | Ga0055535_1000677 | 3300003761 | Bacteria | 26506 |
| 22 | Ga0055535_1001086 | 3300003761 | Bacteria | 16659 |
| 23 | Ga0055542_1000162 | 3300003762 | Bacteria | 84417 |
| 24 | Ga0055542_1001080 | 3300003762 | Bacteria | 16618 |
| 25 | Ga0055529_1000566 | 3300003763 | Bacteria | 30480 |
| 26 | Ga0055526_1000056 | 3300003771 | Bacteria | 110574 |
| 27 | Ga0055526_1000704 | 3300003771 | Bacteria | 25324 |
| 28 | Ga0055526_1006243 | 3300003771 | Bacteria | 6534 |
| 29 | Ga0055526_1007064 | 3300003771 | Bacteria | 5936 |
| 30 | Ga0055526_1009227 | 3300003771 | Bacteria | 4786 |
| 31 | Ga0055524_1000817 | 3300003775 | Bacteria | 20599 |
| 32 | Ga0055524_1000949 | 3300003775 | Bacteria | 18409 |
| 33 | Ga0055524_1004394 | 3300003775 | Bacteria | 6505 |
| 34 | Ga0055528_1000106 | 3300003790 | Bacteria | 67208 |
| 35 | Ga0055528_1008582 | 3300003790 | Bacteria | 4354 |
| 36 | Ga0055528_1009430 | 3300003790 | Bacteria | 4077 |
| 37 | Ga0055540_1003098 | 3300003792 | Bacteria | 8261 |
| 38 | Ga0055540_1006682 | 3300003792 | Bacteria | 4524 |
| 39 | Ga0055540_1015468 | 3300003792 | Bacteria | 2219 |
| 40 | Ga0055540_1028337 | 3300003792 | Bacteria | 1326 |
| 41 | Ga0055531_10001921 | 3300003794 | Bacteria | 14537 |
| 42 | Ga0058692_1004221 | 3300003856 | Bacteria | 4286 |
| 43 | Ga0055543_1000074 | 3300004625 | Bacteria | 88424 |
| 44 | Ga0065165_1000062 | 3300005262 | Bacteria | 178885 |
| 45 | Ga0065165_1022312 | 3300005262 | Bacteria | 2174 |
| 46 | Ga0070676_10072247 | 3300005328 | Bacteria | 2074 |
| 47 | Ga0070683_100026394 | 3300005329 | Bacteria | 5229 |
| 48 | Ga0070690_100213159 | 3300005330 | Bacteria | 1350 |
| 49 | Ga0070670_100000245 | 3300005331 | Bacteria | 48841 |
| 50 | Ga0068869_100137818 | 3300005334 | Bacteria | 1882 |
| 51 | Ga0070666_10019019 | 3300005335 | Bacteria | 4428 |
| 52 | Ga0070682_100060393 | 3300005337 | Bacteria | 2397 |
| 53 | Ga0070687_100032140 | 3300005343 | Bacteria | 2580 |
| 54 | Ga0070661_100247863 | 3300005344 | Bacteria | 1374 |
| 55 | Ga0070668_100019835 | 3300005347 | Bacteria | 5065 |
| 56 | Ga0070668_100115010 | 3300005347 | Bacteria | 2144 |
| 57 | Ga0070675_100375499 | 3300005354 | Bacteria | 1265 |
| 58 | Ga0070671_100054363 | 3300005355 | Bacteria | 3329 |
| 59 | Ga0070673_100108867 | 3300005364 | Bacteria | 2295 |
| 60 | Ga0070688_100059687 | 3300005365 | Bacteria | 2406 |
| 61 | Ga0070667_100180094 | 3300005367 | Bacteria | 1869 |
| 62 | Ga0070709_10000609 | 3300005434 | Bacteria | 20716 |
| 63 | Ga0070709_10197010 | 3300005434 | Bacteria | 1424 |
| 64 | Ga0070714_100010925 | 3300005435 | Bacteria | 7190 |
| 65 | Ga0070714_100145955 | 3300005435 | Bacteria | 2128 |
| 66 | Ga0070714_100533503 | 3300005435 | Bacteria | 1122 |
| 67 | Ga0070714_100564012 | 3300005435 | Bacteria | 1091 |
| 68 | Ga0070713_100015089 | 3300005436 | Bacteria | 5757 |
| 69 | Ga0070713_100029260 | 3300005436 | Bacteria | 4360 |
| 70 | Ga0070710_10000144 | 3300005437 | Bacteria | 32895 |
| 71 | Ga0070710_10029235 | 3300005437 | Bacteria | 2955 |
| 72 | Ga0070710_10038207 | 3300005437 | Bacteria | 2635 |
| 73 | Ga0070710_10117997 | 3300005437 | Bacteria | 1602 |
| 74 | Ga0070701_10249131 | 3300005438 | Bacteria | 1072 |
| 75 | Ga0070705_100023565 | 3300005440 | Bacteria | 3308 |
| 76 | Ga0070694_100144956 | 3300005444 | Bacteria | 1729 |
| 77 | Ga0070663_100181343 | 3300005455 | Bacteria | 1634 |
| 78 | Ga0070678_100045836 | 3300005456 | Bacteria | 3130 |
| 79 | Ga0070678_100342775 | 3300005456 | Bacteria | 1282 |
| 80 | Ga0070662_100068288 | 3300005457 | Bacteria | 2613 |
| 81 | Ga0070662_100381323 | 3300005457 | Bacteria | 1160 |
| 82 | Ga0070681_10032776 | 3300005458 | Bacteria | 5216 |
| 83 | Ga0068867_100026525 | 3300005459 | Bacteria | 4161 |
| 84 | Ga0070685_10017071 | 3300005466 | Bacteria | 3878 |
| 85 | Ga0070706_100399483 | 3300005467 | Bacteria | 1279 |
| 86 | Ga0070707_100215857 | 3300005468 | Bacteria | 1869 |
| 87 | Ga0070679_100269901 | 3300005530 | Bacteria | 1655 |
| 88 | Ga0070684_100365265 | 3300005535 | Bacteria | 1329 |
| 89 | Ga0068853_100015579 | 3300005539 | Bacteria | 6246 |
| 90 | Ga0070693_100196711 | 3300005547 | Bacteria | 1307 |
| 91 | Ga0070693_100235464 | 3300005547 | Bacteria | 1207 |
| 92 | Ga0070665_100003591 | 3300005548 | Bacteria | 16425 |
| 93 | Ga0070665_100016020 | 3300005548 | Bacteria | 7525 |
| 94 | Ga0070665_100019552 | 3300005548 | Bacteria | 6799 |
| 95 | Ga0070665_100054826 | 3300005548 | Bacteria | 3998 |
| 96 | Ga0070665_100087733 | 3300005548 | Bacteria | 3117 |
| 97 | Ga0070665_100320289 | 3300005548 | Bacteria | 1555 |
| 98 | Ga0070665_100337121 | 3300005548 | Bacteria | 1512 |
| 99 | Ga0070664_100210880 | 3300005564 | Bacteria | 1736 |
| 100 | Ga0070664_100360118 | 3300005564 | Bacteria | 1325 |
| 101 | Ga0068854_100020459 | 3300005578 | Bacteria | 4478 |
| 102 | Ga0068854_100207482 | 3300005578 | Bacteria | 1544 |
| 103 | Ga0068856_100035527 | 3300005614 | Bacteria | 4885 |
| 104 | Ga0068856_100422580 | 3300005614 | Bacteria | 1353 |
| 105 | Ga0068856_100739364 | 3300005614 | Bacteria | 1004 |
| 106 | Ga0068852_100107981 | 3300005616 | Bacteria | 2526 |
| 107 | Ga0068864_100000109 | 3300005618 | Bacteria | 80156 |
| 108 | Ga0068864_100040828 | 3300005618 | Bacteria | 3967 |
| 109 | Ga0068864_100094523 | 3300005618 | Bacteria | 2642 |
| 110 | Ga0068861_100008392 | 3300005719 | Bacteria | 7109 |
| 111 | Ga0068863_100009504 | 3300005841 | Bacteria | 9484 |
| 112 | Ga0068858_100020755 | 3300005842 | Bacteria | 6138 |
| 113 | Ga0068858_100026065 | 3300005842 | Bacteria | 5435 |
| 114 | Ga0068858_100033639 | 3300005842 | Bacteria | 4755 |
| 115 | Ga0068860_100004221 | 3300005843 | Bacteria | 14730 |
| 116 | Ga0068860_100016692 | 3300005843 | Bacteria | 7160 |
| 117 | Ga0068860_100273722 | 3300005843 | Bacteria | 1648 |
| 118 | Ga0068862_100000022 | 3300005844 | Bacteria | 214075 |
| 119 | Ga0081455_10002274 | 3300005937 | Bacteria | 22913 |
| 120 | Ga0081455_10096945 | 3300005937 | Bacteria | 2377 |
| 121 | Ga0081455_10119834 | 3300005937 | Bacteria | 2075 |
| 122 | Ga0081455_10126149 | 3300005937 | Bacteria | 2008 |
| 123 | Ga0081538_10021013 | 3300005981 | Bacteria | 4785 |
| 124 | Ga0081540_1000466 | 3300005983 | Bacteria | 40082 |
| 125 | Ga0081540_1004934 | 3300005983 | Bacteria | 10037 |
| 126 | Ga0081540_1006682 | 3300005983 | Bacteria | 8343 |
| 127 | Ga0081540_1010590 | 3300005983 | Bacteria | 6230 |
| 128 | Ga0081540_1014129 | 3300005983 | Bacteria | 5139 |
| 129 | Ga0081540_1021891 | 3300005983 | Bacteria | 3788 |
| 130 | Ga0081540_1034132 | 3300005983 | Bacteria | 2750 |
| 131 | Ga0081540_1096278 | 3300005983 | Bacteria | 1288 |
| 132 | Ga0081539_10030585 | 3300005985 | Bacteria | 3338 |
| 133 | Ga0075365_10071338 | 3300006038 | Bacteria | 2338 |
| 134 | Ga0075365_10188639 | 3300006038 | Bacteria | 1442 |
| 135 | Ga0075368_10028302 | 3300006042 | Bacteria | 2165 |
| 136 | Ga0075363_100015464 | 3300006048 | Bacteria | 3752 |
| 137 | Ga0075363_100044594 | 3300006048 | Bacteria | 2350 |
| 138 | Ga0075364_10003895 | 3300006051 | Bacteria | 8556 |
| 139 | Ga0070715_10026998 | 3300006163 | Bacteria | 2290 |
| 140 | Ga0070715_10039642 | 3300006163 | Bacteria | 1963 |
| 141 | Ga0070716_100025095 | 3300006173 | Bacteria | 3177 |
| 142 | Ga0070712_100002030 | 3300006175 | Bacteria | 12405 |
| 143 | Ga0070712_100004935 | 3300006175 | Bacteria | 8253 |
| 144 | Ga0070712_100028568 | 3300006175 | Bacteria | 3732 |
| 145 | Ga0070712_100070714 | 3300006175 | Bacteria | 2494 |
| 146 | Ga0070712_100095798 | 3300006175 | Bacteria | 2184 |
| 147 | Ga0075362_10004855 | 3300006177 | Bacteria | 4860 |
| 148 | Ga0075362_10024312 | 3300006177 | Bacteria | 2569 |
| 149 | Ga0075369_10000419 | 3300006186 | Bacteria | 12857 |
| 150 | Ga0075369_10152887 | 3300006186 | Bacteria | 1055 |
| 151 | Ga0075366_10073587 | 3300006195 | Bacteria | 2037 |
| 152 | Ga0075366_10079295 | 3300006195 | Bacteria | 1960 |
| 153 | Ga0075370_10122257 | 3300006353 | Bacteria | 1516 |
| 154 | Ga0068871_100067601 | 3300006358 | Bacteria | 2933 |
| 155 | Ga0068871_100079177 | 3300006358 | Bacteria | 2718 |
| 156 | Ga0068871_100449309 | 3300006358 | Bacteria | 1155 |
| 157 | Ga0075431_100004254 | 3300006847 | Bacteria | 14024 |
| 158 | Ga0068865_100029277 | 3300006881 | Bacteria | 3652 |
| 159 | Ga0068865_100034127 | 3300006881 | Bacteria | 3412 |
| 160 | Ga0099825_1044464 | 3300006941 | Bacteria | 1152 |
| 161 | Ga0099822_1000686 | 3300006943 | Bacteria | 34261 |
| 162 | Ga0099823_1043708 | 3300006944 | Bacteria | 3077 |
| 163 | Ga0079104_1005204 | 3300006946 | Bacteria | 5266 |
| 164 | Ga0079104_1008261 | 3300006946 | Bacteria | 3667 |
| 165 | Ga0099826_10000010 | 3300006948 | Bacteria | 314346 |
| 166 | Ga0099794_10078861 | 3300007265 | Bacteria | 1622 |
| 167 | Ga0099795_10022137 | 3300007788 | Bacteria | 2094 |
| 168 | Ga0105244_10013012 | 3300009036 | Bacteria | 4886 |
| 169 | Ga0105240_10000201 | 3300009093 | Bacteria | 121112 |
| 170 | Ga0105240_10237212 | 3300009093 | Bacteria | 2116 |
| 171 | Ga0111539_10002098 | 3300009094 | Bacteria | 26633 |
| 172 | Ga0105245_10020119 | 3300009098 | Bacteria | 5850 |
| 173 | Ga0105245_10442189 | 3300009098 | Bacteria | 1307 |
| 174 | Ga0105243_10152113 | 3300009148 | Bacteria | 1986 |
| 175 | Ga0105241_10110362 | 3300009174 | Bacteria | 2200 |
| 176 | Ga0105248_10032169 | 3300009177 | Bacteria | 5863 |
| 177 | Ga0105248_10159725 | 3300009177 | Bacteria | 2543 |
| 178 | Ga0105248_10196755 | 3300009177 | Bacteria | 2271 |
| 179 | Ga0105237_10002871 | 3300009545 | Bacteria | 20954 |
| 180 | Ga0105237_10003330 | 3300009545 | Bacteria | 19134 |
| 181 | Ga0105237_10038704 | 3300009545 | Bacteria | 4816 |
| 182 | Ga0105237_10173152 | 3300009545 | Bacteria | 2159 |
| 183 | Ga0105249_10478291 | 3300009553 | Bacteria | 1288 |
| 184 | Ga0099796_10014960 | 3300010159 | Bacteria | 2255 |
| 185 | Ga0105239_10049987 | 3300010375 | Bacteria | 4585 |
| 186 | Ga0105239_10188875 | 3300010375 | Bacteria | 2306 |
| 187 | Ga0105239_10319437 | 3300010375 | Bacteria | 1751 |
| 188 | Ga0105239_10327427 | 3300010375 | Bacteria | 1728 |
| 189 | Ga0105239_10495397 | 3300010375 | Bacteria | 1389 |
| 190 | Ga0105246_10019264 | 3300011119 | Bacteria | 4358 |
| 191 | Ga0157370_10001402 | 3300013104 | Bacteria | 29902 |
| 192 | Ga0171463_1005 | 3300013249 | Bacteria | 358236 |
| 193 | Ga0157375_10015743 | 3300013308 | Bacteria | 6776 |
| 194 | Ga0157375_10067698 | 3300013308 | Bacteria | 3569 |
| 195 | Ga0163163_10022921 | 3300014325 | Bacteria | 5919 |
| 196 | Ga0157380_10155714 | 3300014326 | Bacteria | 1980 |
| 197 | Ga0157380_10170236 | 3300014326 | Bacteria | 1902 |
| 198 | Ga0157380_10447846 | 3300014326 | Bacteria | 1239 |
| 199 | Ga0182008_10002242 | 3300014497 | Bacteria | 12231 |
| 200 | Ga0157379_10048312 | 3300014968 | Bacteria | 3798 |
| 201 | Ga0157379_10053775 | 3300014968 | Bacteria | 3598 |
| 202 | Ga0157379_10148352 | 3300014968 | Bacteria | 2115 |
| 203 | Ga0157376_10191779 | 3300014969 | Bacteria | 1874 |
| 204 | Ga0182007_10012038 | 3300015262 | Bacteria | 3342 |
| 205 | Ga0182005_1025912 | 3300015265 | Bacteria | 1600 |
| 206 | Ga0183363_1022 | 3300015690 | Bacteria | 57453 |
| 207 | Ga0163161_10007287 | 3300017792 | Bacteria | 7632 |
| 208 | Ga0214544_1000013 | 3300021320 | Bacteria | 228947 |
| 209 | Ga0214542_1000013 | 3300021321 | Bacteria | 234019 |
| 210 | Ga0214545_1000012 | 3300021324 | Bacteria | 187898 |
| 211 | Ga0214545_1032757 | 3300021324 | Bacteria | 1959 |
| 212 | Ga0209436_100011 | 3300025208 | Bacteria | 139405 |
| 213 | Ga0209436_111532 | 3300025208 | Bacteria | 1548 |
| 214 | Ga0209672_100129 | 3300025228 | Bacteria | 76300 |
| 215 | Ga0209672_100829 | 3300025228 | Bacteria | 14408 |
| 216 | Ga0209437_100022 | 3300025233 | Bacteria | 625694 |
| 217 | Ga0209258_100088 | 3300025242 | Bacteria | 237738 |
| 218 | Ga0209258_100236 | 3300025242 | Bacteria | 103319 |
| 219 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 220 | Ga0207425_1001067 | 3300025245 | Bacteria | 12520 |
| 221 | Ga0207425_1008952 | 3300025245 | Bacteria | 2522 |
| 222 | Ga0209646_1000916 | 3300025246 | Bacteria | 9486 |
| 223 | Ga0209026_1006750 | 3300025250 | Bacteria | 2736 |
| 224 | Ga0209677_100174 | 3300025253 | Bacteria | 55175 |
| 225 | Ga0209148_1000024 | 3300025254 | Bacteria | 669890 |
| 226 | Ga0209148_1000209 | 3300025254 | Bacteria | 103316 |
| 227 | Ga0209759_1001537 | 3300025256 | Bacteria | 12656 |
| 228 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 229 | Ga0209129_1000615 | 3300025258 | Bacteria | 24007 |
| 230 | Ga0209129_1001256 | 3300025258 | Bacteria | 14547 |
| 231 | Ga0209129_1019262 | 3300025258 | Bacteria | 1293 |
| 232 | Ga0209233_1000031 | 3300025261 | Bacteria | 624646 |
| 233 | Ga0209233_1000217 | 3300025261 | Bacteria | 106187 |
| 234 | Ga0209565_1017141 | 3300025263 | Bacteria | 1594 |
| 235 | Ga0209455_1000025 | 3300025272 | Bacteria | 670673 |
| 236 | Ga0209673_1000139 | 3300025273 | Bacteria | 157765 |
| 237 | Ga0209673_1001266 | 3300025273 | Bacteria | 25980 |
| 238 | Ga0209673_1003378 | 3300025273 | Bacteria | 9495 |
| 239 | Ga0209673_1003445 | 3300025273 | Bacteria | 9322 |
| 240 | Ga0209673_1004658 | 3300025273 | Bacteria | 7249 |
| 241 | Ga0209673_1007214 | 3300025273 | Bacteria | 5178 |
| 242 | Ga0209130_1000066 | 3300025284 | Bacteria | 192626 |
| 243 | Ga0209130_1000174 | 3300025284 | Bacteria | 91725 |
| 244 | Ga0209130_1008246 | 3300025284 | Bacteria | 3097 |
| 245 | Ga0209676_1001350 | 3300025292 | Bacteria | 24409 |
| 246 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 247 | Ga0209025_1007680 | 3300025294 | Bacteria | 7964 |
| 248 | Ga0209025_1016628 | 3300025294 | Bacteria | 4318 |
| 249 | Ga0209564_1000117 | 3300025295 | Bacteria | 207096 |
| 250 | Ga0209564_1000225 | 3300025295 | Bacteria | 126209 |
| 251 | Ga0209564_1000255 | 3300025295 | Bacteria | 113017 |
| 252 | Ga0209564_1000331 | 3300025295 | Bacteria | 91919 |
| 253 | Ga0209564_1019349 | 3300025295 | Bacteria | 2548 |
| 254 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 255 | Ga0209758_1000861 | 3300025297 | Bacteria | 42010 |
| 256 | Ga0209758_1001171 | 3300025297 | Bacteria | 33282 |
| 257 | Ga0209758_1005160 | 3300025297 | Bacteria | 10281 |
| 258 | Ga0209758_1013710 | 3300025297 | Bacteria | 4390 |
| 259 | Ga0209758_1018751 | 3300025297 | Bacteria | 3374 |
| 260 | Ga0209758_1032067 | 3300025297 | Bacteria | 2142 |
| 261 | Ga0209050_1009349 | 3300025298 | Bacteria | 5032 |
| 262 | Ga0209256_1000131 | 3300025299 | Bacteria | 162368 |
| 263 | Ga0209256_1000299 | 3300025299 | Bacteria | 86909 |
| 264 | Ga0209256_1000622 | 3300025299 | Bacteria | 48813 |
| 265 | Ga0209256_1001834 | 3300025299 | Bacteria | 19799 |
| 266 | Ga0209256_1003652 | 3300025299 | Bacteria | 10524 |
| 267 | Ga0209256_1008343 | 3300025299 | Bacteria | 4828 |
| 268 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 269 | Ga0207426_1001743 | 3300025302 | Bacteria | 16555 |
| 270 | Ga0207426_1006027 | 3300025302 | Bacteria | 5356 |
| 271 | Ga0209051_1000643 | 3300025303 | Bacteria | 39847 |
| 272 | Ga0209051_1002199 | 3300025303 | Bacteria | 14416 |
| 273 | Ga0209051_1008982 | 3300025303 | Bacteria | 5209 |
| 274 | Ga0209051_1023723 | 3300025303 | Bacteria | 2543 |
| 275 | Ga0209051_1028555 | 3300025303 | Bacteria | 2201 |
| 276 | Ga0209051_1050454 | 3300025303 | Bacteria | 1393 |
| 277 | Ga0209257_1002248 | 3300025304 | Bacteria | 19802 |
| 278 | Ga0209257_1029512 | 3300025304 | Bacteria | 1785 |
| 279 | Ga0207655_1016122 | 3300025728 | Bacteria | 4109 |
| 280 | Ga0207692_10000215 | 3300025898 | Bacteria | 19463 |
| 281 | Ga0207692_10062403 | 3300025898 | Bacteria | 1934 |
| 282 | Ga0207692_10239169 | 3300025898 | Bacteria | 1084 |
| 283 | Ga0207692_10250894 | 3300025898 | Bacteria | 1060 |
| 284 | Ga0207642_10045282 | 3300025899 | Bacteria | 1952 |
| 285 | Ga0207642_10102604 | 3300025899 | Bacteria | 1439 |
| 286 | Ga0207699_10001468 | 3300025906 | Bacteria | 11197 |
| 287 | Ga0207699_10213023 | 3300025906 | Bacteria | 1315 |
| 288 | Ga0207684_10294367 | 3300025910 | Bacteria | 1399 |
| 289 | Ga0207654_10072265 | 3300025911 | Bacteria | 2053 |
| 290 | Ga0207654_10197679 | 3300025911 | Bacteria | 1322 |
| 291 | Ga0207707_10017493 | 3300025912 | Bacteria | 6249 |
| 292 | Ga0207695_10000118 | 3300025913 | Bacteria | 237085 |
| 293 | Ga0207671_10000175 | 3300025914 | Bacteria | 98920 |
| 294 | Ga0207693_10009787 | 3300025915 | Bacteria | 7805 |
| 295 | Ga0207693_10059070 | 3300025915 | Bacteria | 3004 |
| 296 | Ga0207693_10081544 | 3300025915 | Bacteria | 2533 |
| 297 | Ga0207693_10108286 | 3300025915 | Bacteria | 2180 |
| 298 | Ga0207693_10138364 | 3300025915 | Bacteria | 1915 |
| 299 | Ga0207662_10069500 | 3300025918 | Bacteria | 2128 |
| 300 | Ga0207652_10226328 | 3300025921 | Bacteria | 1686 |
| 301 | Ga0207650_10000039 | 3300025925 | Bacteria | 204737 |
| 302 | Ga0207650_10074550 | 3300025925 | Bacteria | 2558 |
| 303 | Ga0207659_10177955 | 3300025926 | Bacteria | 1683 |
| 304 | Ga0207687_10039904 | 3300025927 | Bacteria | 3216 |
| 305 | Ga0207687_10096057 | 3300025927 | Bacteria | 2171 |
| 306 | Ga0207700_10005756 | 3300025928 | Bacteria | 7443 |
| 307 | Ga0207664_10031599 | 3300025929 | Bacteria | 4052 |
| 308 | Ga0207664_10059460 | 3300025929 | Bacteria | 3043 |
| 309 | Ga0207664_10449485 | 3300025929 | Bacteria | 1150 |
| 310 | Ga0207644_10246474 | 3300025931 | Bacteria | 1424 |
| 311 | Ga0207644_10461318 | 3300025931 | Bacteria | 1044 |
| 312 | Ga0207690_10137278 | 3300025932 | Bacteria | 1797 |
| 313 | Ga0207686_10080169 | 3300025934 | Bacteria | 2127 |
| 314 | Ga0207709_10064340 | 3300025935 | Bacteria | 2302 |
| 315 | Ga0207669_10100007 | 3300025937 | Bacteria | 1914 |
| 316 | Ga0207669_10373675 | 3300025937 | Bacteria | 1108 |
| 317 | Ga0207704_10311565 | 3300025938 | Bacteria | 1210 |
| 318 | Ga0207665_10007952 | 3300025939 | Bacteria | 7001 |
| 319 | Ga0207665_10008176 | 3300025939 | Bacteria | 6906 |
| 320 | Ga0207691_10150971 | 3300025940 | Bacteria | 2043 |
| 321 | Ga0207711_10049244 | 3300025941 | Bacteria | 3607 |
| 322 | Ga0207711_10137788 | 3300025941 | Bacteria | 2193 |
| 323 | Ga0207711_10349814 | 3300025941 | Bacteria | 1368 |
| 324 | Ga0207711_10599579 | 3300025941 | Bacteria | 1028 |
| 325 | Ga0207689_10058238 | 3300025942 | Bacteria | 3178 |
| 326 | Ga0207689_10070860 | 3300025942 | Bacteria | 2863 |
| 327 | Ga0207689_10087113 | 3300025942 | Bacteria | 2566 |
| 328 | Ga0207661_10018471 | 3300025944 | Bacteria | 5179 |
| 329 | Ga0207679_10381462 | 3300025945 | Bacteria | 1236 |
| 330 | Ga0207651_10047261 | 3300025960 | Bacteria | 2901 |
| 331 | Ga0207651_10155936 | 3300025960 | Bacteria | 1784 |
| 332 | Ga0207712_10179060 | 3300025961 | Bacteria | 1664 |
| 333 | Ga0207668_10135775 | 3300025972 | Bacteria | 1884 |
| 334 | Ga0207668_10150973 | 3300025972 | Bacteria | 1798 |
| 335 | Ga0207668_10230983 | 3300025972 | Bacteria | 1491 |
| 336 | Ga0207668_10287993 | 3300025972 | Bacteria | 1350 |
| 337 | Ga0207640_10014501 | 3300025981 | Bacteria | 4540 |
| 338 | Ga0207640_10084049 | 3300025981 | Bacteria | 2184 |
| 339 | Ga0207703_10020070 | 3300026035 | Bacteria | 5223 |
| 340 | Ga0207703_10033168 | 3300026035 | Bacteria | 4091 |
| 341 | Ga0207639_10025696 | 3300026041 | Bacteria | 4273 |
| 342 | Ga0207678_10089522 | 3300026067 | Bacteria | 2630 |
| 343 | Ga0207678_10162826 | 3300026067 | Bacteria | 1905 |
| 344 | Ga0207702_10085572 | 3300026078 | Bacteria | 2748 |
| 345 | Ga0207641_10084948 | 3300026088 | Bacteria | 2756 |
| 346 | Ga0207648_10310003 | 3300026089 | Bacteria | 1417 |
| 347 | Ga0207676_10000035 | 3300026095 | Bacteria | 204737 |
| 348 | Ga0207675_100000029 | 3300026118 | Bacteria | 109352 |
| 349 | Ga0207675_100033572 | 3300026118 | Bacteria | 4781 |
| 350 | Ga0207675_100089926 | 3300026118 | Bacteria | 2886 |
| 351 | Ga0207675_100234025 | 3300026118 | Bacteria | 1773 |
| 352 | Ga0207683_10045034 | 3300026121 | Bacteria | 3858 |
| 353 | Ga0207683_10049809 | 3300026121 | Bacteria | 3668 |
| 354 | Ga0207683_10206149 | 3300026121 | Bacteria | 1788 |
| 355 | Ga0207698_10007770 | 3300026142 | Bacteria | 6736 |
| 356 | Ga0207698_10210856 | 3300026142 | Bacteria | 1748 |
| 357 | Ga0209281_1001051 | 3300027111 | Bacteria | 20858 |
| 358 | Ga0209389_1000163 | 3300027296 | Bacteria | 55041 |
| 359 | Ga0209371_1001722 | 3300027312 | Bacteria | 13838 |
| 360 | Ga0209371_1003088 | 3300027312 | Bacteria | 8494 |
| 361 | Ga0209589_1000002 | 3300027357 | Bacteria | 708598 |
| 362 | Ga0209489_100002 | 3300027361 | Bacteria | 708609 |
| 363 | Ga0209489_101100 | 3300027361 | Bacteria | 55041 |
| 364 | Ga0209700_100002 | 3300027363 | Bacteria | 708598 |
| 365 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 366 | Ga0209282_1000009 | 3300027666 | Bacteria | 233366 |
| 367 | Ga0209588_1004478 | 3300027671 | Bacteria | 3944 |
| 368 | Ga0207428_10000560 | 3300027907 | Bacteria | 43937 |
| 369 | Ga0207428_10002329 | 3300027907 | Bacteria | 19020 |
| 370 | Ga0268266_10022307 | 3300028379 | Bacteria | 5395 |
| 371 | Ga0268266_10066111 | 3300028379 | Bacteria | 3126 |
| 372 | Ga0268266_10072134 | 3300028379 | Bacteria | 2993 |
| 373 | Ga0268266_10072159 | 3300028379 | Bacteria | 2993 |
| 374 | Ga0268266_10074416 | 3300028379 | Bacteria | 2949 |
| 375 | Ga0268266_10099972 | 3300028379 | Bacteria | 2554 |
| 376 | Ga0268265_10000006 | 3300028380 | Bacteria | 466482 |
| 377 | Ga0268265_10011076 | 3300028380 | Bacteria | 6093 |
| 378 | Ga0268265_10163153 | 3300028380 | Bacteria | 1896 |
| 379 | Ga0268265_10250613 | 3300028380 | Bacteria | 1568 |
| 380 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 381 | Ga0268264_10341015 | 3300028381 | Bacteria | 1423 |
| 382 | Ga0265334_10049386 | 3300028573 | Bacteria | 1618 |
| 383 | Ga0265336_10000816 | 3300028666 | Bacteria | 16369 |
| 384 | Ga0307517_10092154 | 3300028786 | Bacteria | 2468 |
| 385 | Ga0307517_10168772 | 3300028786 | Bacteria | 1445 |
| 386 | Ga0307515_10138045 | 3300028794 | Bacteria | 2635 |
| 387 | Ga0307515_10194014 | 3300028794 | Bacteria | 1930 |
| 388 | Ga0265338_10000572 | 3300028800 | Bacteria | 64902 |
| 389 | Ga0268256_1000785 | 3300030500 | Bacteria | 22910 |
| 390 | Ga0268256_1003493 | 3300030500 | Bacteria | 7057 |
| 391 | Ga0307511_10030724 | 3300030521 | Bacteria | 4819 |
| 392 | Ga0265331_10075526 | 3300031250 | Bacteria | 1571 |
| 393 | Ga0307513_10041634 | 3300031456 | Bacteria | 5067 |
| 394 | Ga0307513_10069169 | 3300031456 | Bacteria | 3695 |
| 395 | Ga0307509_10019301 | 3300031507 | Bacteria | 7781 |
| 396 | Ga0307509_10046512 | 3300031507 | Bacteria | 4671 |
| 397 | Ga0307408_100003016 | 3300031548 | Bacteria | 11633 |
| 398 | Ga0307508_10085997 | 3300031616 | Bacteria | 2727 |
| 399 | Ga0265314_10002700 | 3300031711 | Bacteria | 17767 |
| 400 | Ga0265342_10021476 | 3300031712 | Bacteria | 4120 |
| 401 | Ga0307516_10002464 | 3300031730 | Bacteria | 24733 |
| 402 | Ga0307516_10260437 | 3300031730 | Bacteria | 1425 |
| 403 | Ga0307405_10254827 | 3300031731 | Bacteria | 1308 |
| 404 | Ga0307410_10012481 | 3300031852 | Bacteria | 4917 |
| 405 | Ga0307406_10000771 | 3300031901 | Bacteria | 17969 |
| 406 | Ga0307406_10044488 | 3300031901 | Bacteria | 2783 |
| 407 | Ga0307406_10122943 | 3300031901 | Bacteria | 1808 |
| 408 | Ga0307412_10025137 | 3300031911 | Bacteria | 3685 |
| 409 | Ga0307409_100105236 | 3300031995 | Bacteria | 2352 |
| 410 | Ga0307409_100134590 | 3300031995 | Bacteria | 2118 |
| 411 | Ga0307416_100108681 | 3300032002 | Bacteria | 2437 |
| 412 | Ga0307416_100394017 | 3300032002 | Bacteria | 1420 |
| 413 | Ga0307414_10000018 | 3300032004 | Bacteria | 237060 |
| 414 | Ga0307415_100255748 | 3300032126 | Bacteria | 1426 |
| 415 | Ga0307510_10016774 | 3300033180 | Bacteria | 8640 |
| 416 | Ga0307510_10122315 | 3300033180 | Bacteria | 2303 |
| 417 | Ga0307510_10256375 | 3300033180 | Bacteria | 1233 |
| 418 | Ga0373926_0112063 | 3300035083 | Bacteria | 1025 |
| 419 | Ga0373923_0087281 | 3300035111 | Bacteria | 1360 |
| 420 | Ga0373923_0161312 | 3300035111 | Bacteria | 1023 |
| 421 | Ga0373943_0038999 | 3300035170 | Bacteria | 2286 |
| 422 | Ga0373943_0111585 | 3300035170 | Bacteria | 1443 |
| 423 | Ga0373942_0027848 | 3300035207 | Bacteria | 1473 |
| 424 | Ga0373931_0055602 | 3300035691 | Bacteria | 2118 |
| 425 | Ga0373931_0071495 | 3300035691 | Bacteria | 1895 |
| 426 | Ga0373931_0262479 | 3300035691 | Bacteria | 1054 |
| 427 | Ga0373935_0171166 | 3300035692 | Bacteria | 1486 |
| 428 | Ga0373927_0003977 | 3300035695 | Bacteria | 10453 |
| 429 | Ga0373927_0071556 | 3300035695 | Bacteria | 2244 |
| 430 | Ga0373933_0051988 | 3300035724 | Bacteria | 2450 |
| 431 | Ga0373947_0020723 | 3300035725 | Bacteria | 3799 |
| 432 | Ga0373937_0131839 | 3300036401 | Bacteria | 2334 |
| 433 | Ga0373925_0006499 | 3300037068 | Bacteria | 8594 |
| 434 | Ga0373925_0043778 | 3300037068 | Bacteria | 3323 |
| 435 | Ga0373925_0077902 | 3300037068 | Bacteria | 2517 |
| 436 | Ga0395901_0187072 | 3300038443 | Bacteria | 2172 |
| 437 | Ga0439447_000286 | 3300041407 | Bacteria | 18000 |
| 438 | Ga0439461_0002294 | 3300041410 | Bacteria | 3037 |
| 439 | Ga0439466_0008235 | 3300041411 | Bacteria | 3930 |
| 440 | Ga0439466_0011134 | 3300041411 | Bacteria | 3331 |
| 441 | Ga0439465_0002144 | 3300041413 | Bacteria | 6481 |
| 442 | Ga0451807_1369558 | 3300041486 | Bacteria | 1776 |
| 443 | Ga0451833_0055069 | 3300041491 | Bacteria | 1503 |
| 444 | Ga0451847_0770903 | 3300041503 | Bacteria | 1845 |
| 445 | Ga0451851_0373797 | 3300041507 | Bacteria | 3921 |
| 446 | Ga0439431_0002340 | 3300041997 | Bacteria | 4187 |
| 447 | Ga0439445_0036348 | 3300042004 | Bacteria | 1296 |
| 448 | Ga0439432_063961 | 3300042006 | Bacteria | 1130 |
| 449 | Ga0439449_0001954 | 3300042007 | Bacteria | 8096 |
| 450 | Ga0439434_0016395 | 3300042435 | Bacteria | 2214 |
| 451 | Ga0466966_0034962 | 3300044684 | Bacteria | 3248 |
| 452 | Ga0466968_0040719 | 3300044735 | Bacteria | 1960 |
| 453 | Ga0466970_0016669 | 3300044765 | Bacteria | 3791 |
| 454 | Ga0495603_0008522 | 3300046455 | Bacteria | 6195 |
| 455 | Ga0495603_0095992 | 3300046455 | Bacteria | 1732 |
| 456 | Ga0495629_0001177 | 3300046459 | Bacteria | 20634 |
| 457 | Ga0495629_0059347 | 3300046459 | Bacteria | 2674 |
| 458 | Ga0495638_0024226 | 3300046460 | Bacteria | 3960 |
| 459 | Ga0495638_0192148 | 3300046460 | Bacteria | 1158 |
| 460 | Ga0495641_0031217 | 3300046461 | Bacteria | 2547 |
| 461 | Ga0495653_0061296 | 3300046463 | Bacteria | 2847 |
| 462 | Ga0495605_0134187 | 3300046474 | Bacteria | 1114 |
| 463 | Ga0495662_0051243 | 3300046476 | Bacteria | 1993 |
| 464 | Ga0495594_0072393 | 3300046499 | Bacteria | 1917 |
| 465 | Ga0495607_0012359 | 3300046501 | Bacteria | 5642 |
| 466 | Ga0495583_0001798 | 3300046506 | Bacteria | 20297 |
| 467 | Ga0495606_0000161 | 3300046507 | Bacteria | 117607 |
| 468 | Ga0495610_0015862 | 3300046512 | Bacteria | 4360 |
| 469 | Ga0495610_0021278 | 3300046512 | Bacteria | 3571 |
| 470 | Ga0495610_0051177 | 3300046512 | Bacteria | 2012 |
| 471 | Ga0495610_0057426 | 3300046512 | Bacteria | 1866 |
| 472 | Ga0495610_0071632 | 3300046512 | Bacteria | 1615 |
| 473 | Ga0495631_0077962 | 3300046518 | Bacteria | 1430 |
| 474 | Ga0495643_0013947 | 3300046522 | Bacteria | 4790 |
| 475 | Ga0495643_0017843 | 3300046522 | Bacteria | 4139 |
| 476 | Ga0495643_0025587 | 3300046522 | Bacteria | 3338 |
| 477 | Ga0495663_0026086 | 3300046525 | Bacteria | 1709 |
| 478 | Ga0495666_0046736 | 3300046526 | Bacteria | 2086 |
| 479 | Ga0495645_0046993 | 3300046543 | Bacteria | 3146 |
| 480 | Ga0495622_0025843 | 3300046557 | Bacteria | 2743 |
| 481 | Ga0495667_0155243 | 3300046559 | Bacteria | 1473 |
| 482 | Ga0495668_0000002 | 3300046616 | Bacteria | 763179 |
| 483 | Ga0495668_0177931 | 3300046616 | Bacteria | 1165 |
| 484 | Ga0495634_0028166 | 3300046642 | Bacteria | 3902 |
| 485 | Ga0495625_0003303 | 3300046660 | Bacteria | 16271 |
| 486 | Ga0495625_0018451 | 3300046660 | Bacteria | 5446 |
| 487 | Ga0495625_0149748 | 3300046660 | Bacteria | 1569 |
| 488 | Ga0495635_0000978 | 3300046663 | Bacteria | 18814 |
| 489 | Ga0495588_0003105 | 3300046674 | Bacteria | 7192 |
| 490 | Ga0495669_0015704 | 3300046684 | Bacteria | 3242 |
| 491 | Ga0495613_0301926 | 3300046689 | Bacteria | 1108 |
| 492 | Ga0495624_0045881 | 3300046690 | Bacteria | 2780 |
| 493 | Ga0495589_0171585 | 3300046794 | Bacteria | 1031 |
| 494 | Ga0495660_0021283 | 3300046810 | Bacteria | 3714 |
| 495 | Ga0495660_0090367 | 3300046810 | Bacteria | 1592 |
| 496 | Ga0495604_0000626 | 3300047317 | Bacteria | 30413 |
| 497 | Ga0495674_0092406 | 3300047319 | Bacteria | 2583 |
| 498 | Ga0495674_0183477 | 3300047319 | Bacteria | 1741 |
| 499 | Ga0495674_0250785 | 3300047319 | Bacteria | 1457 |
| 500 | Ga0495676_0308024 | 3300047321 | Bacteria | 1066 |
| 501 | Ga0495687_000521 | 3300047443 | Bacteria | 46065 |
| 502 | Ga0495687_000748 | 3300047443 | Bacteria | 35192 |
| 503 | Ga0495687_002186 | 3300047443 | Bacteria | 16274 |
| 504 | Ga0495673_0047864 | 3300047469 | Bacteria | 1888 |
| 505 | Ga0495684_0004330 | 3300047471 | Bacteria | 11092 |
| 506 | Ga0495686_0077646 | 3300047472 | Bacteria | 2033 |
| 507 | Ga0495686_0184387 | 3300047472 | Bacteria | 1207 |
| 508 | Ga0495602_0018555 | 3300048088 | Bacteria | 6942 |
| 509 | Ga0495602_0130747 | 3300048088 | Bacteria | 2003 |
| 510 | Ga0496100_0002867 | 3300048903 | Bacteria | 8835 |
| 511 | Ga0496100_0014569 | 3300048903 | Bacteria | 4568 |
| 512 | Ga0496101_0001838 | 3300048904 | Bacteria | 12798 |
| 513 | Ga0496101_0020397 | 3300048904 | Bacteria | 4536 |
| 514 | Ga0496102_0048548 | 3300048905 | Bacteria | 3859 |
| 515 | Ga0496102_0060614 | 3300048905 | Bacteria | 3460 |
| 516 | Ga0496102_0297745 | 3300048905 | Bacteria | 1520 |
| 517 | Ga0496103_0006117 | 3300048906 | Bacteria | 7190 |
| 518 | Ga0496103_0016546 | 3300048906 | Bacteria | 4401 |
| 519 | Ga0496103_0021882 | 3300048906 | Bacteria | 3847 |
| 520 | Ga0496104_0018207 | 3300048907 | Bacteria | 6406 |
| 521 | Ga0496104_0021062 | 3300048907 | Bacteria | 5981 |
| 522 | Ga0496104_0070144 | 3300048907 | Bacteria | 3331 |
| 523 | Ga0496104_0159562 | 3300048907 | Bacteria | 2163 |
| 524 | Ga0496105_0012970 | 3300048908 | Bacteria | 6604 |
| 525 | Ga0496105_0041364 | 3300048908 | Bacteria | 3798 |
| 526 | Ga0496106_0000093 | 3300048909 | Bacteria | 67667 |
| 527 | Ga0496106_0051678 | 3300048909 | Bacteria | 3099 |
| 528 | Ga0496106_0101291 | 3300048909 | Bacteria | 2234 |
| 529 | Ga0496106_0307303 | 3300048909 | Bacteria | 1272 |
| 530 | Ga0496106_0519153 | 3300048909 | Bacteria | 956 |
| 531 | Ga0496107_0047573 | 3300048910 | Bacteria | 3088 |
| 532 | Ga0496107_0061952 | 3300048910 | Bacteria | 2709 |
| 533 | Ga0496107_0106792 | 3300048910 | Bacteria | 2056 |
| 534 | Ga0496107_0123725 | 3300048910 | Bacteria | 1906 |
| 535 | Ga0496108_0006949 | 3300048911 | Bacteria | 9160 |
| 536 | Ga0496108_0026774 | 3300048911 | Bacteria | 4759 |
| 537 | Ga0496109_0069613 | 3300048912 | Bacteria | 3227 |
| 538 | Ga0496109_0143251 | 3300048912 | Bacteria | 2235 |
| 539 | Ga0496109_0490000 | 3300048912 | Bacteria | 1160 |
| 540 | Ga0496110_0100973 | 3300048913 | Bacteria | 2586 |
| 541 | Ga0496110_0215354 | 3300048913 | Bacteria | 1746 |
| 542 | Ga0496110_0234946 | 3300048913 | Bacteria | 1668 |
| 543 | Ga0496111_0089652 | 3300048914 | Bacteria | 2252 |
| 544 | Ga0496112_0081132 | 3300048915 | Bacteria | 3207 |
| 545 | Ga0496112_0132350 | 3300048915 | Bacteria | 2465 |
| 546 | Ga0496112_0371258 | 3300048915 | Bacteria | 1372 |
| 547 | Ga0496113_0024311 | 3300048916 | Bacteria | 4304 |
| 548 | Ga0496114_0026876 | 3300048917 | Bacteria | 4714 |
| 549 | Ga0496114_0206226 | 3300048917 | Bacteria | 1723 |
| 550 | Ga0496115_0004235 | 3300048918 | Bacteria | 10372 |
| 551 | Ga0496115_0251185 | 3300048918 | Bacteria | 1456 |
| 552 | Ga0496116_0041410 | 3300048919 | Bacteria | 3160 |
| 553 | Ga0496116_0069069 | 3300048919 | Bacteria | 2248 |
| 554 | Ga0496117_0004844 | 3300048920 | Bacteria | 14549 |
| 555 | Ga0496117_0008863 | 3300048920 | Bacteria | 9493 |
| 556 | Ga0496117_0129150 | 3300048920 | Bacteria | 1535 |
| 557 | Ga0496118_0004178 | 3300048921 | Bacteria | 17389 |
| 558 | Ga0496118_0005397 | 3300048921 | Bacteria | 14549 |
| 559 | Ga0496118_0011760 | 3300048921 | Bacteria | 8505 |
| 560 | Ga0496118_0047620 | 3300048921 | Bacteria | 3320 |
| 561 | Ga0496119_0000390 | 3300048922 | Bacteria | 60662 |
| 562 | Ga0496119_0006421 | 3300048922 | Bacteria | 10903 |
| 563 | Ga0496119_0029847 | 3300048922 | Bacteria | 3687 |
| 564 | Ga0496119_0032878 | 3300048922 | Bacteria | 3451 |
| 565 | Ga0496119_0085568 | 3300048922 | Bacteria | 1804 |
| 566 | Ga0496120_0002913 | 3300048923 | Bacteria | 16344 |
| 567 | Ga0496120_0026293 | 3300048923 | Bacteria | 3595 |
| 568 | Ga0496121_0002660 | 3300048924 | Bacteria | 26794 |
| 569 | Ga0496121_0002696 | 3300048924 | Bacteria | 26537 |
| 570 | Ga0496121_0026649 | 3300048924 | Bacteria | 5436 |
| 571 | Ga0496121_0052853 | 3300048924 | Bacteria | 3407 |
| 572 | Ga0496121_0060528 | 3300048924 | Bacteria | 3114 |
| 573 | Ga0496122_0000047 | 3300048925 | Bacteria | 274226 |
| 574 | Ga0496122_0037604 | 3300048925 | Bacteria | 3893 |
| 575 | Ga0496122_0095401 | 3300048925 | Bacteria | 2010 |
| 576 | Ga0496122_0213571 | 3300048925 | Bacteria | 1114 |
| 577 | Ga0496123_0000077 | 3300048926 | Bacteria | 192607 |
| 578 | Ga0496123_0000393 | 3300048926 | Bacteria | 81747 |
| 579 | Ga0496123_0019962 | 3300048926 | Bacteria | 5261 |
| 580 | Ga0496123_0021688 | 3300048926 | Bacteria | 4982 |
| 581 | Ga0496124_0029367 | 3300048927 | Bacteria | 4901 |
| 582 | Ga0496124_0041508 | 3300048927 | Bacteria | 3969 |
| 583 | Ga0496124_0083496 | 3300048927 | Bacteria | 2620 |
| 584 | Ga0496124_0123602 | 3300048927 | Bacteria | 2064 |
| 585 | Ga0496124_0281151 | 3300048927 | Bacteria | 1213 |
| 586 | Ga0496125_0000105 | 3300048928 | Bacteria | 200717 |
| 587 | Ga0496125_0053125 | 3300048928 | Bacteria | 3325 |
| 588 | Ga0496126_0010668 | 3300048929 | Bacteria | 9604 |
| 589 | Ga0496126_0040859 | 3300048929 | Bacteria | 4297 |
| 590 | Ga0496126_0179249 | 3300048929 | Bacteria | 1801 |
| 591 | Ga0496126_0286912 | 3300048929 | Bacteria | 1362 |
| 592 | Ga0496126_0363782 | 3300048929 | Bacteria | 1181 |
| 593 | Ga0495682_0097034 | 3300049460 | Bacteria | 1058 |
| 594 | Ga0501031_0147246 | 3300049568 | Bacteria | 1538 |
| 595 | Ga0501032_0022921 | 3300049569 | Bacteria | 4322 |
| 596 | Ga0501033_0009780 | 3300049570 | Bacteria | 7366 |
| 597 | Ga0501033_0033244 | 3300049570 | Bacteria | 3872 |
| 598 | Ga0501033_0097200 | 3300049570 | Bacteria | 2152 |
| 599 | Ga0501034_0003451 | 3300049571 | Bacteria | 18019 |
| 600 | Ga0501034_0051312 | 3300049571 | Bacteria | 4159 |
| 601 | Ga0501034_0098738 | 3300049571 | Bacteria | 2915 |
| 602 | Ga0501034_0154722 | 3300049571 | Bacteria | 2267 |
| 603 | Ga0501034_0188927 | 3300049571 | Bacteria | 2023 |
| 604 | Ga0501034_0535031 | 3300049571 | Bacteria | 1082 |
| 605 | Ga0501036_0090569 | 3300049572 | Bacteria | 2583 |
| 606 | Ga0501036_0120847 | 3300049572 | Bacteria | 2212 |
| 607 | Ga0501037_0017509 | 3300049573 | Bacteria | 5273 |
| 608 | Ga0501037_0227513 | 3300049573 | Bacteria | 1310 |
| 609 | Ga0501038_0082564 | 3300049574 | Bacteria | 2705 |
| 610 | Ga0501038_0102082 | 3300049574 | Bacteria | 2387 |
| 611 | Ga0501038_0363153 | 3300049574 | Bacteria | 1126 |
| 612 | Ga0501039_0027289 | 3300049575 | Bacteria | 4390 |
| 613 | Ga0501039_0191077 | 3300049575 | Bacteria | 1610 |
| 614 | Ga0501042_0013985 | 3300049578 | Bacteria | 5469 |
| 615 | Ga0501043_0037940 | 3300049579 | Bacteria | 3790 |
| 616 | Ga0501043_0057065 | 3300049579 | Bacteria | 3066 |
| 617 | Ga0501043_0168413 | 3300049579 | Bacteria | 1710 |
| 618 | Ga0501046_0112978 | 3300049580 | Bacteria | 2074 |
| 619 | Ga0501046_0166256 | 3300049580 | Bacteria | 1657 |
| 620 | Ga0501047_0049777 | 3300049581 | Bacteria | 4045 |
| 621 | Ga0501047_0054806 | 3300049581 | Bacteria | 3856 |
| 622 | Ga0501047_0152148 | 3300049581 | Bacteria | 2189 |
| 623 | Ga0501047_0381201 | 3300049581 | Bacteria | 1244 |
| 624 | Ga0501048_0002535 | 3300049582 | Bacteria | 13973 |
| 625 | Ga0501048_0039881 | 3300049582 | Bacteria | 3366 |
| 626 | Ga0501069_0151525 | 3300049585 | Bacteria | 1333 |
| 627 | Ga0501070_0063375 | 3300049586 | Bacteria | 3062 |
| 628 | Ga0501070_0186078 | 3300049586 | Bacteria | 1708 |
| 629 | Ga0501073_0017180 | 3300049589 | Bacteria | 5240 |
| 630 | Ga0501074_0040694 | 3300049590 | Bacteria | 3365 |
| 631 | Ga0501083_0217365 | 3300049744 | Bacteria | 1245 |
| 632 | Ga0501035_0374333 | 3300049822 | Bacteria | 1188 |
| 633 | Ga0501035_0377287 | 3300049822 | Bacteria | 1183 |
| 634 | Ga0501044_0007532 | 3300049823 | Bacteria | 11972 |
| 635 | Ga0501044_0153059 | 3300049823 | Bacteria | 2288 |
| 636 | Ga0501045_0009657 | 3300049824 | Bacteria | 6751 |
| 637 | nmdc:mga03683_13848_c1 | 3300050489 | Bacteria | 2974 |
| 638 | nmdc:mga00v17_11869_c1 | 3300050491 | Bacteria | 4795 |
| 639 | nmdc:mga0k408_117874_c1 | 3300050493 | Bacteria | 1571 |
| 640 | nmdc:mga0k408_121597_c1 | 3300050493 | Bacteria | 1546 |
| 641 | nmdc:mga07m45_126241_c1 | 3300050496 | Bacteria | 1479 |
| 642 | nmdc:mga05p37_890_c1 | 3300050507 | Bacteria | 33690 |
| 643 | nmdc:mga09592_17280_c1 | 3300050508 | Bacteria | 5909 |
| 644 | nmdc:mga0qj67_17074_c1 | 3300050509 | Bacteria | 5515 |
| 645 | nmdc:mga06r32_12281_c1 | 3300050510 | Bacteria | 7725 |
| 646 | nmdc:mga06r32_68226_c1 | 3300050510 | Bacteria | 3435 |
| 647 | nmdc:mga08y16_1184_c1 | 3300050511 | Bacteria | 25736 |
| 648 | nmdc:mga08y16_31589_c1 | 3300050511 | Bacteria | 5569 |
| 649 | nmdc:mga08y16_609_c1 | 3300050511 | Bacteria | 33341 |
| 650 | nmdc:mga0n895_112098_c1 | 3300050512 | Bacteria | 2745 |
| 651 | nmdc:mga0a205_45969_c2 | 3300050515 | Bacteria | 3753 |
| 652 | Ga0495601_0002861 | 3300053077 | Bacteria | 9810 |
| 653 | Ga0495612_0021342 | 3300053078 | Bacteria | 2598 |
| 654 | Ga0500643_059687 | 3300053087 | Bacteria | 1073 |
| 655 | Ga0500644_0024690 | 3300053088 | Bacteria | 1841 |
| 656 | Ga0500644_0053889 | 3300053088 | Bacteria | 1390 |
| 657 | Ga0500566_0000074 | 3300053094 | Bacteria | 48359 |
| 658 | Ga0500566_0003680 | 3300053094 | Bacteria | 9155 |
| 659 | Ga0500640_000535 | 3300053095 | Bacteria | 9608 |
| 660 | Ga0500569_000794 | 3300053109 | Bacteria | 5544 |
| 661 | Ga0500569_012100 | 3300053109 | Bacteria | 2079 |
| 662 | Ga0500572_000414 | 3300053111 | Bacteria | 15011 |
| 663 | Ga0500595_000348 | 3300053119 | Bacteria | 30151 |
| 664 | Ga0500618_000720 | 3300053125 | Bacteria | 18953 |
| 665 | Ga0500618_040919 | 3300053125 | Bacteria | 1064 |
| 666 | Ga0500658_0000516 | 3300053134 | Bacteria | 16413 |
| 667 | Ga0500658_0001317 | 3300053134 | Bacteria | 10046 |
| 668 | Ga0500658_0152864 | 3300053134 | Bacteria | 1041 |
| 669 | Ga0500559_0000683 | 3300053136 | Bacteria | 22548 |
| 670 | Ga0500568_0000740 | 3300053139 | Bacteria | 23333 |
| 671 | Ga0500573_0027376 | 3300053140 | Bacteria | 3278 |
| 672 | Ga0500616_0000731 | 3300053153 | Bacteria | 37996 |
| 673 | Ga0500616_0016056 | 3300053153 | Bacteria | 4271 |
| 674 | Ga0500616_0037385 | 3300053153 | Bacteria | 2629 |
| 675 | Ga0500622_0000170 | 3300053156 | Bacteria | 70088 |
| 676 | Ga0500633_0004866 | 3300053160 | Bacteria | 3130 |
| 677 | Ga0500638_021318 | 3300053162 | Bacteria | 3060 |
| 678 | Ga0500637_0000110 | 3300053178 | Bacteria | 29626 |
| 679 | Ga0500637_0022523 | 3300053178 | Bacteria | 3433 |
| 680 | Ga0500661_002499 | 3300055283 | Bacteria | 3470 |
| 681 | Ga0501082_0014164 | 3300060353 | Bacteria | 6863 |
| 682 | Ga0501082_0121908 | 3300060353 | Bacteria | 2260 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_10442189 | Ga0105245_104421891 | 282 |
| 2 | 3300014326 | Ga0157380_10170236 | Ga0157380_101702362 | 282 |
| 3 | iso_pu_bacteria | 2643221651 | 2644289263 | 282 |
| 4 | iso_pu_bacteria | 2921296804 | 2921304039 | 285 |
| 5 | 3300009545 | Ga0105237_10173152 | Ga0105237_101731522 | 286 |
| 6 | 3300035083 | Ga0373926_0112063 | Ga0373926_0112063_112_981 | 286 |
| 7 | 3300035111 | Ga0373923_0161312 | Ga0373923_0161312_102_971 | 286 |
| 8 | 3300035170 | Ga0373943_0038999 | Ga0373943_0038999_1059_1928 | 286 |
| 9 | 3300035725 | Ga0373947_0020723 | Ga0373947_0020723_133_1002 | 286 |
| 10 | 3300041491 | Ga0451833_0055069 | Ga0451833_0055069_536_1405 | 286 |
| 11 | 3300046459 | Ga0495629_0059347 | Ga0495629_0059347_23_892 | 286 |
| 12 | 3300046461 | Ga0495641_0031217 | Ga0495641_0031217_1393_2262 | 286 |
| 13 | 3300046463 | Ga0495653_0061296 | Ga0495653_0061296_1402_2271 | 286 |
| 14 | 3300046499 | Ga0495594_0072393 | Ga0495594_0072393_877_1746 | 286 |
| 15 | 3300046526 | Ga0495666_0046736 | Ga0495666_0046736_891_1760 | 286 |
| 16 | 3300046559 | Ga0495667_0155243 | Ga0495667_0155243_519_1388 | 286 |
| 17 | 3300046642 | Ga0495634_0028166 | Ga0495634_0028166_1421_2290 | 286 |
| 18 | 3300046689 | Ga0495613_0301926 | Ga0495613_0301926_98_967 | 286 |
| 19 | 3300047319 | Ga0495674_0092406 | Ga0495674_0092406_508_1377 | 286 |
| 20 | 3300047321 | Ga0495676_0308024 | Ga0495676_0308024_99_968 | 286 |
| 21 | 3300048905 | Ga0496102_0048548 | Ga0496102_0048548_2209_3078 | 286 |
| 22 | 3300048907 | Ga0496104_0070144 | Ga0496104_0070144_2209_3078 | 286 |
| 23 | 3300048909 | Ga0496106_0519153 | Ga0496106_0519153_23_892 | 286 |
| 24 | 3300048910 | Ga0496107_0047573 | Ga0496107_0047573_11_880 | 286 |
| 25 | 3300049574 | Ga0501038_0363153 | Ga0501038_0363153_26_895 | 286 |
| 26 | 3300049581 | Ga0501047_0152148 | Ga0501047_0152148_106_975 | 286 |
| 27 | 3300050507 | nmdc:mga05p37_890_c1 | nmdc:mga05p37_890_c1_9490_10356 | 286 |
| 28 | 3300050508 | nmdc:mga09592_17280_c1 | nmdc:mga09592_17280_c1_2435_3301 | 286 |
| 29 | 3300050509 | nmdc:mga0qj67_17074_c1 | nmdc:mga0qj67_17074_c1_2358_3224 | 286 |
| 30 | 3300050510 | nmdc:mga06r32_12281_c1 | nmdc:mga06r32_12281_c1_2616_3482 | 286 |
| 31 | 3300050511 | nmdc:mga08y16_31589_c1 | nmdc:mga08y16_31589_c1_1673_2539 | 286 |
| 32 | 3300053077 | Ga0495601_0002861 | Ga0495601_0002861_6303_7172 | 286 |
| 33 | 3300053078 | Ga0495612_0021342 | Ga0495612_0021342_1682_2551 | 286 |
| 34 | 3300053088 | Ga0500644_0024690 | Ga0500644_0024690_499_1362 | 286 |
| 35 | 3300003215 | JGI25153J46596_10002446 | JGI25153J46596_100024464 | 287 |
| 36 | 3300025297 | Ga0209758_1013710 | Ga0209758_10137104 | 287 |
| 37 | 3300048920 | Ga0496117_0129150 | Ga0496117_0129150_174_1106 | 287 |
| 38 | 3300055283 | Ga0500661_002499 | Ga0500661_002499_914_1798 | 290 |
| 39 | 3300005459 | Ga0068867_100026525 | Ga0068867_1000265252 | 292 |
| 40 | 3300005719 | Ga0068861_100008392 | Ga0068861_1000083927 | 292 |
| 41 | 3300005983 | Ga0081540_1021891 | Ga0081540_10218911 | 292 |
| 42 | 3300026118 | Ga0207675_100033572 | Ga0207675_1000335725 | 292 |
| 43 | iso_pu_bacteria | 2802429605 | 2805929234 | 292 |
| 44 | iso_pu_bacteria | 2802429606 | 2805932509 | 292 |
| 45 | iso_pu_bacteria | 2838668709 | 2838673391 | 292 |
| 46 | iso_pu_bacteria | 2838701080 | 2838706138 | 292 |
| 47 | iso_pu_bacteria | 2842146304 | 2842150519 | 292 |
| 48 | iso_pu_bacteria | 2842192696 | 2842192749 | 292 |
| 49 | iso_pu_bacteria | 2842250916 | 2842255602 | 292 |
| 50 | iso_pu_bacteria | 2842317721 | 2842323868 | 292 |
| 51 | iso_pu_bacteria | 2842489311 | 2842492600 | 292 |
| 52 | iso_pu_bacteria | 2858950400 | 2858956279 | 292 |
| 53 | iso_pu_bacteria | 2917736166 | 2917742765 | 292 |
| 54 | iso_pu_bacteria | 8005301065 | 8005301389 | 292 |
| 55 | iso_pu_bacteria | 8005688590 | 8005692403 | 292 |
| 56 | iso_pu_bacteria | 8024501048 | 8024501741 | 292 |
| 57 | 3300031995 | Ga0307409_100105236 | Ga0307409_1001052363 | 293 |
| 58 | 3300041486 | Ga0451807_1369558 | Ga0451807_1369558_551_1435 | 293 |
| 59 | iso_pu_bacteria | 2941531003 | 2941537389 | 293 |
| 60 | 3300038443 | Ga0395901_0187072 | Ga0395901_0187072_1129_2028 | 294 |
| 61 | 3300047472 | Ga0495686_0184387 | Ga0495686_0184387_194_1120 | 294 |
| 62 | 3300049570 | Ga0501033_0097200 | Ga0501033_0097200_362_1306 | 294 |
| 63 | 3300049579 | Ga0501043_0037940 | Ga0501043_0037940_1145_2089 | 294 |
| 64 | 3300049580 | Ga0501046_0112978 | Ga0501046_0112978_390_1334 | 294 |
| 65 | 3300049581 | Ga0501047_0381201 | Ga0501047_0381201_120_1064 | 294 |
| 66 | 3300060353 | Ga0501082_0121908 | Ga0501082_0121908_1170_2114 | 294 |
| 67 | iso_pu_bacteria | 2513237139 | 2513873237 | 294 |
| 68 | iso_pu_bacteria | 2802429603 | 2805914774 | 294 |
| 69 | iso_pu_bacteria | 2824696289 | 2824700319 | 294 |
| 70 | iso_pu_bacteria | 2838680041 | 2838681028 | 294 |
| 71 | iso_pu_bacteria | 2838694306 | 2838694939 | 294 |
| 72 | iso_pu_bacteria | 2838707686 | 2838708315 | 294 |
| 73 | iso_pu_bacteria | 2842077413 | 2842080451 | 294 |
| 74 | iso_pu_bacteria | 2842118031 | 2842121070 | 294 |
| 75 | iso_pu_bacteria | 2842237096 | 2842237727 | 294 |
| 76 | iso_pu_bacteria | 2842291075 | 2842294110 | 294 |
| 77 | iso_pu_bacteria | 2842370503 | 2842371491 | 294 |
| 78 | iso_pu_bacteria | 2842377471 | 2842380507 | 294 |
| 79 | iso_pu_bacteria | 2842384541 | 2842387578 | 294 |
| 80 | iso_pu_bacteria | 2847939898 | 2847947139 | 294 |
| 81 | iso_pu_bacteria | 2916000859 | 2916002531 | 294 |
| 82 | iso_pu_bacteria | 2921208531 | 2921208744 | 294 |
| 83 | iso_pu_bacteria | 2924179722 | 2924186216 | 294 |
| 84 | iso_pu_bacteria | 2935894831 | 2935895461 | 294 |
| 85 | iso_pu_bacteria | 2936381700 | 2936386966 | 294 |
| 86 | iso_pu_bacteria | 2957450854 | 2957455926 | 294 |
| 87 | iso_pu_bacteria | 2970095765 | 2970096694 | 294 |
| 88 | iso_pu_bacteria | 8016603502 | 8016608704 | 294 |
| 89 | iso_pu_bacteria | 8019538911 | 8019546599 | 294 |
| 90 | iso_pu_bacteria | 8019678201 | 8019679898 | 294 |
| 91 | iso_pu_bacteria | 8057575449 | 8057580853 | 294 |
| 92 | 3300005334 | Ga0068869_100137818 | Ga0068869_1001378182 | 295 |
| 93 | 3300005347 | Ga0070668_100019835 | Ga0070668_1000198352 | 295 |
| 94 | 3300005456 | Ga0070678_100045836 | Ga0070678_1000458362 | 295 |
| 95 | 3300005843 | Ga0068860_100004221 | Ga0068860_1000042212 | 295 |
| 96 | 3300025942 | Ga0207689_10070860 | Ga0207689_100708602 | 295 |
| 97 | 3300025972 | Ga0207668_10150973 | Ga0207668_101509732 | 295 |
| 98 | 3300026121 | Ga0207683_10045034 | Ga0207683_100450342 | 295 |
| 99 | 3300028380 | Ga0268265_10011076 | Ga0268265_100110762 | 295 |
| 100 | 3300028381 | Ga0268264_10000062 | Ga0268264_100000622 | 295 |
| 101 | iso_pu_bacteria | 2615840698 | 2616553165 | 295 |
| 102 | iso_pu_bacteria | 2842694124 | 2842694626 | 295 |
| 103 | iso_pu_bacteria | 2883291878 | 2883292924 | 295 |
| 104 | iso_pu_bacteria | 2887375801 | 2887376891 | 295 |
| 105 | iso_pu_bacteria | 2894652903 | 2894657141 | 295 |
| 106 | iso_pu_bacteria | 2979100975 | 2979103287 | 295 |
| 107 | iso_pu_bacteria | 2984509177 | 2984514035 | 295 |
| 108 | iso_pu_bacteria | 2984518228 | 2984523066 | 295 |
| 109 | iso_pu_bacteria | 2984537506 | 2984542397 | 295 |
| 110 | iso_pu_bacteria | 8005682033 | 8005683438 | 295 |
| 111 | 3300005434 | Ga0070709_10197010 | Ga0070709_101970101 | 296 |
| 112 | 3300005435 | Ga0070714_100564012 | Ga0070714_1005640121 | 296 |
| 113 | 3300005437 | Ga0070710_10117997 | Ga0070710_101179972 | 296 |
| 114 | 3300005548 | Ga0070665_100016020 | Ga0070665_1000160209 | 296 |
| 115 | 3300006175 | Ga0070712_100095798 | Ga0070712_1000957981 | 296 |
| 116 | 3300025906 | Ga0207699_10213023 | Ga0207699_102130231 | 296 |
| 117 | 3300025915 | Ga0207693_10138364 | Ga0207693_101383642 | 296 |
| 118 | 3300028379 | Ga0268266_10099972 | Ga0268266_100999722 | 296 |
| 119 | 3300048929 | Ga0496126_0363782 | Ga0496126_0363782_183_1127 | 296 |
| 120 | 3300053088 | Ga0500644_0053889 | Ga0500644_0053889_125_1045 | 296 |
| 121 | iso_pu_bacteria | 2513237138 | 2513869657 | 296 |
| 122 | iso_pu_bacteria | 2513237146 | 2513923876 | 296 |
| 123 | iso_pu_bacteria | 2519899620 | 2520376163 | 296 |
| 124 | iso_pu_bacteria | 2524023205 | 2524436318 | 296 |
| 125 | iso_pu_bacteria | 2524023210 | 2524469238 | 296 |
| 126 | iso_pu_bacteria | 2529292951 | 2530645189 | 296 |
| 127 | iso_pu_bacteria | 2582581308 | 2585280898 | 296 |
| 128 | iso_pu_bacteria | 2585427527 | 2585530602 | 296 |
| 129 | iso_pu_bacteria | 2585427530 | 2585554780 | 296 |
| 130 | iso_pu_bacteria | 2599185170 | 2599415916 | 296 |
| 131 | iso_pu_bacteria | 2615840626 | 2616310719 | 296 |
| 132 | iso_pu_bacteria | 2643221626 | 2644148986 | 296 |
| 133 | iso_pu_bacteria | 2643221651 | 2644288076 | 296 |
| 134 | iso_pu_bacteria | 2643221659 | 2644336887 | 296 |
| 135 | iso_pu_bacteria | 2643221734 | 2644734444 | 296 |
| 136 | iso_pu_bacteria | 2739367651 | 2739591546 | 296 |
| 137 | iso_pu_bacteria | 2765235802 | 2765465369 | 296 |
| 138 | iso_pu_bacteria | 2775506902 | 2776272033 | 296 |
| 139 | iso_pu_bacteria | 2775506904 | 2776279447 | 296 |
| 140 | iso_pu_bacteria | 2818991448 | 2819613460 | 296 |
| 141 | iso_pu_bacteria | 2818991453 | 2819641096 | 296 |
| 142 | iso_pu_bacteria | 2824653114 | 2824659768 | 296 |
| 143 | iso_pu_bacteria | 2838029111 | 2838034441 | 296 |
| 144 | iso_pu_bacteria | 2838035591 | 2838036033 | 296 |
| 145 | iso_pu_bacteria | 2840764183 | 2840767811 | 296 |
| 146 | iso_pu_bacteria | 2842475841 | 2842481188 | 296 |
| 147 | iso_pu_bacteria | 2842502639 | 2842507901 | 296 |
| 148 | iso_pu_bacteria | 2842509118 | 2842513593 | 296 |
| 149 | iso_pu_bacteria | 2852387548 | 2852392980 | 296 |
| 150 | iso_pu_bacteria | 2879110137 | 2879112657 | 296 |
| 151 | iso_pu_bacteria | 2889016732 | 2889020903 | 296 |
| 152 | iso_pu_bacteria | 2893066018 | 2893066892 | 296 |
| 153 | iso_pu_bacteria | 2903768456 | 2903776277 | 296 |
| 154 | iso_pu_bacteria | 2904690495 | 2904698311 | 296 |
| 155 | iso_pu_bacteria | 2904699407 | 2904700655 | 296 |
| 156 | iso_pu_bacteria | 2906635258 | 2906643449 | 296 |
| 157 | iso_pu_bacteria | 2908756301 | 2908762912 | 296 |
| 158 | iso_pu_bacteria | 2917699015 | 2917704674 | 296 |
| 159 | iso_pu_bacteria | 2919119836 | 2919120744 | 296 |
| 160 | iso_pu_bacteria | 2933016740 | 2933022158 | 296 |
| 161 | iso_pu_bacteria | 2935769743 | 2935773789 | 296 |
| 162 | iso_pu_bacteria | 2935785616 | 2935788775 | 296 |
| 163 | iso_pu_bacteria | 2935793552 | 2935795599 | 296 |
| 164 | iso_pu_bacteria | 2965119406 | 2965125418 | 296 |
| 165 | iso_pu_bacteria | 2989771324 | 2989776243 | 296 |
| 166 | iso_pu_bacteria | 2996893221 | 2996893288 | 296 |
| 167 | iso_pu_bacteria | 3005416602 | 3005422265 | 296 |
| 168 | iso_pu_bacteria | 3005445848 | 3005448779 | 296 |
| 169 | iso_pu_bacteria | 8001845381 | 8001845493 | 296 |
| 170 | iso_pu_bacteria | 8005258706 | 8005262879 | 296 |
| 171 | iso_pu_bacteria | 8005289223 | 8005291239 | 296 |
| 172 | iso_pu_bacteria | 8005314921 | 8005316348 | 296 |
| 173 | iso_pu_bacteria | 8005321885 | 8005324152 | 296 |
| 174 | iso_pu_bacteria | 8005484373 | 8005488108 | 296 |
| 175 | iso_pu_bacteria | 8005542996 | 8005546954 | 296 |
| 176 | iso_pu_bacteria | 8005645114 | 8005651696 | 296 |
| 177 | iso_pu_bacteria | 8006933436 | 8006942725 | 296 |
| 178 | iso_pu_bacteria | 8006973647 | 8006982448 | 296 |
| 179 | iso_pu_bacteria | 8016511872 | 8016516191 | 296 |
| 180 | iso_pu_bacteria | 8017057580 | 8017060334 | 296 |
| 181 | 3300005367 | Ga0070667_100180094 | Ga0070667_1001800942 | 297 |
| 182 | 3300005937 | Ga0081455_10126149 | Ga0081455_101261492 | 297 |
| 183 | 3300031507 | Ga0307509_10019301 | Ga0307509_100193014 | 297 |
| 184 | 3300031730 | Ga0307516_10002464 | Ga0307516_1000246410 | 297 |
| 185 | 3300042004 | Ga0439445_0036348 | Ga0439445_0036348_287_1219 | 297 |
| 186 | 3300046459 | Ga0495629_0001177 | Ga0495629_0001177_15620_16543 | 297 |
| 187 | 3300046476 | Ga0495662_0051243 | Ga0495662_0051243_894_1817 | 297 |
| 188 | 3300046506 | Ga0495583_0001798 | Ga0495583_0001798_19029_19931 | 297 |
| 189 | 3300046512 | Ga0495610_0057426 | Ga0495610_0057426_425_1330 | 297 |
| 190 | 3300046663 | Ga0495635_0000978 | Ga0495635_0000978_6711_7634 | 297 |
| 191 | 3300046690 | Ga0495624_0045881 | Ga0495624_0045881_1567_2490 | 297 |
| 192 | 3300047317 | Ga0495604_0000626 | Ga0495604_0000626_17809_18732 | 297 |
| 193 | 3300047469 | Ga0495673_0047864 | Ga0495673_0047864_183_1085 | 297 |
| 194 | 3300048088 | Ga0495602_0130747 | Ga0495602_0130747_845_1768 | 297 |
| 195 | iso_pu_bacteria | 2551306090 | 2551716023 | 297 |
| 196 | iso_pu_bacteria | 2582581299 | 2585230453 | 297 |
| 197 | iso_pu_bacteria | 2593339239 | 2595452291 | 297 |
| 198 | iso_pu_bacteria | 2643221634 | 2644196814 | 297 |
| 199 | iso_pu_bacteria | 2643221715 | 2644636863 | 297 |
| 200 | iso_pu_bacteria | 2902810491 | 2902811668 | 297 |
| 201 | iso_pu_bacteria | 2902837492 | 2902840751 | 297 |
| 202 | 3300003771 | Ga0055526_1000704 | Ga0055526_10007045 | 298 |
| 203 | 3300003794 | Ga0055531_10001921 | Ga0055531_100019218 | 298 |
| 204 | 3300005330 | Ga0070690_100213159 | Ga0070690_1002131591 | 298 |
| 205 | 3300005335 | Ga0070666_10019019 | Ga0070666_100190195 | 298 |
| 206 | 3300005337 | Ga0070682_100060393 | Ga0070682_1000603933 | 298 |
| 207 | 3300005343 | Ga0070687_100032140 | Ga0070687_1000321403 | 298 |
| 208 | 3300005344 | Ga0070661_100247863 | Ga0070661_1002478631 | 298 |
| 209 | 3300005355 | Ga0070671_100054363 | Ga0070671_1000543633 | 298 |
| 210 | 3300005364 | Ga0070673_100108867 | Ga0070673_1001088674 | 298 |
| 211 | 3300005365 | Ga0070688_100059687 | Ga0070688_1000596873 | 298 |
| 212 | 3300005435 | Ga0070714_100145955 | Ga0070714_1001459553 | 298 |
| 213 | 3300005436 | Ga0070713_100029260 | Ga0070713_1000292602 | 298 |
| 214 | 3300005437 | Ga0070710_10038207 | Ga0070710_100382071 | 298 |
| 215 | 3300005466 | Ga0070685_10017071 | Ga0070685_100170713 | 298 |
| 216 | 3300005547 | Ga0070693_100235464 | Ga0070693_1002354642 | 298 |
| 217 | 3300005564 | Ga0070664_100210880 | Ga0070664_1002108801 | 298 |
| 218 | 3300005614 | Ga0068856_100422580 | Ga0068856_1004225801 | 298 |
| 219 | 3300005618 | Ga0068864_100040828 | Ga0068864_1000408283 | 298 |
| 220 | 3300005842 | Ga0068858_100020755 | Ga0068858_1000207552 | 298 |
| 221 | 3300005937 | Ga0081455_10119834 | Ga0081455_101198342 | 298 |
| 222 | 3300005983 | Ga0081540_1000466 | Ga0081540_100046617 | 298 |
| 223 | 3300005983 | Ga0081540_1004934 | Ga0081540_10049347 | 298 |
| 224 | 3300005983 | Ga0081540_1006682 | Ga0081540_10066824 | 298 |
| 225 | 3300005983 | Ga0081540_1034132 | Ga0081540_10341324 | 298 |
| 226 | 3300005983 | Ga0081540_1096278 | Ga0081540_10962781 | 298 |
| 227 | 3300006163 | Ga0070715_10026998 | Ga0070715_100269983 | 298 |
| 228 | 3300006175 | Ga0070712_100070714 | Ga0070712_1000707142 | 298 |
| 229 | 3300006195 | Ga0075366_10073587 | Ga0075366_100735872 | 298 |
| 230 | 3300006358 | Ga0068871_100079177 | Ga0068871_1000791774 | 298 |
| 231 | 3300009093 | Ga0105240_10237212 | Ga0105240_102372121 | 298 |
| 232 | 3300011119 | Ga0105246_10019264 | Ga0105246_100192644 | 298 |
| 233 | 3300014969 | Ga0157376_10191779 | Ga0157376_101917792 | 298 |
| 234 | 3300025292 | Ga0209676_1001350 | Ga0209676_100135015 | 298 |
| 235 | 3300025295 | Ga0209564_1000117 | Ga0209564_1000117147 | 298 |
| 236 | 3300025298 | Ga0209050_1009349 | Ga0209050_10093492 | 298 |
| 237 | 3300025299 | Ga0209256_1000131 | Ga0209256_100013129 | 298 |
| 238 | 3300025299 | Ga0209256_1000622 | Ga0209256_100062228 | 298 |
| 239 | 3300025303 | Ga0209051_1028555 | Ga0209051_10285552 | 298 |
| 240 | 3300025304 | Ga0209257_1002248 | Ga0209257_10022489 | 298 |
| 241 | 3300025304 | Ga0209257_1029512 | Ga0209257_10295122 | 298 |
| 242 | 3300025898 | Ga0207692_10239169 | Ga0207692_102391691 | 298 |
| 243 | 3300025899 | Ga0207642_10045282 | Ga0207642_100452822 | 298 |
| 244 | 3300025911 | Ga0207654_10197679 | Ga0207654_101976792 | 298 |
| 245 | 3300025918 | Ga0207662_10069500 | Ga0207662_100695002 | 298 |
| 246 | 3300025925 | Ga0207650_10074550 | Ga0207650_100745503 | 298 |
| 247 | 3300025928 | Ga0207700_10005756 | Ga0207700_100057565 | 298 |
| 248 | 3300025929 | Ga0207664_10059460 | Ga0207664_100594603 | 298 |
| 249 | 3300025931 | Ga0207644_10461318 | Ga0207644_104613181 | 298 |
| 250 | 3300025939 | Ga0207665_10008176 | Ga0207665_100081765 | 298 |
| 251 | 3300025941 | Ga0207711_10349814 | Ga0207711_103498142 | 298 |
| 252 | 3300025960 | Ga0207651_10155936 | Ga0207651_101559362 | 298 |
| 253 | 3300026035 | Ga0207703_10020070 | Ga0207703_100200705 | 298 |
| 254 | 3300026121 | Ga0207683_10049809 | Ga0207683_100498094 | 298 |
| 255 | 3300028379 | Ga0268266_10022307 | Ga0268266_100223075 | 298 |
| 256 | 3300028381 | Ga0268264_10341015 | Ga0268264_103410152 | 298 |
| 257 | 3300028666 | Ga0265336_10000816 | Ga0265336_1000081615 | 298 |
| 258 | 3300028786 | Ga0307517_10092154 | Ga0307517_100921541 | 298 |
| 259 | 3300028800 | Ga0265338_10000572 | Ga0265338_100005727 | 298 |
| 260 | 3300030521 | Ga0307511_10030724 | Ga0307511_100307242 | 298 |
| 261 | 3300031507 | Ga0307509_10046512 | Ga0307509_100465122 | 298 |
| 262 | 3300031616 | Ga0307508_10085997 | Ga0307508_100859973 | 298 |
| 263 | 3300031730 | Ga0307516_10260437 | Ga0307516_102604372 | 298 |
| 264 | 3300033180 | Ga0307510_10122315 | Ga0307510_101223153 | 298 |
| 265 | 3300033180 | Ga0307510_10256375 | Ga0307510_102563751 | 298 |
| 266 | 3300035170 | Ga0373943_0111585 | Ga0373943_0111585_462_1373 | 298 |
| 267 | 3300035207 | Ga0373942_0027848 | Ga0373942_0027848_314_1219 | 298 |
| 268 | 3300035695 | Ga0373927_0003977 | Ga0373927_0003977_9529_10440 | 298 |
| 269 | 3300037068 | Ga0373925_0006499 | Ga0373925_0006499_6739_7650 | 298 |
| 270 | 3300044735 | Ga0466968_0040719 | Ga0466968_0040719_999_1916 | 298 |
| 271 | 3300046455 | Ga0495603_0008522 | Ga0495603_0008522_1707_2636 | 298 |
| 272 | 3300046557 | Ga0495622_0025843 | Ga0495622_0025843_1648_2559 | 298 |
| 273 | 3300048904 | Ga0496101_0001838 | Ga0496101_0001838_8090_9025 | 298 |
| 274 | 3300048906 | Ga0496103_0021882 | Ga0496103_0021882_2131_3066 | 298 |
| 275 | 3300048907 | Ga0496104_0018207 | Ga0496104_0018207_1916_2851 | 298 |
| 276 | 3300048908 | Ga0496105_0041364 | Ga0496105_0041364_722_1657 | 298 |
| 277 | 3300048911 | Ga0496108_0006949 | Ga0496108_0006949_6083_7018 | 298 |
| 278 | 3300048912 | Ga0496109_0069613 | Ga0496109_0069613_2143_3078 | 298 |
| 279 | 3300048915 | Ga0496112_0081132 | Ga0496112_0081132_2143_3078 | 298 |
| 280 | 3300048917 | Ga0496114_0026876 | Ga0496114_0026876_3335_4270 | 298 |
| 281 | 3300048929 | Ga0496126_0040859 | Ga0496126_0040859_651_1580 | 298 |
| 282 | 3300050493 | nmdc:mga0k408_121597_c1 | nmdc:mga0k408_121597_c1_395_1306 | 298 |
| 283 | 3300050496 | nmdc:mga07m45_126241_c1 | nmdc:mga07m45_126241_c1_504_1415 | 298 |
| 284 | 3300053094 | Ga0500566_0000074 | Ga0500566_0000074_8716_9627 | 298 |
| 285 | 3300053095 | Ga0500640_000535 | Ga0500640_000535_7021_7932 | 298 |
| 286 | 3300053111 | Ga0500572_000414 | Ga0500572_000414_8406_9317 | 298 |
| 287 | 3300053178 | Ga0500637_0022523 | Ga0500637_0022523_2322_3233 | 298 |
| 288 | iso_pu_bacteria | 2582581294 | 2585203225 | 298 |
| 289 | iso_pu_bacteria | 2599185352 | 2600196723 | 298 |
| 290 | iso_pu_bacteria | 2643221610 | 2644064635 | 298 |
| 291 | iso_pu_bacteria | 2643221664 | 2644355276 | 298 |
| 292 | iso_pu_bacteria | 2643221668 | 2644377142 | 298 |
| 293 | iso_pu_bacteria | 2643221675 | 2644419484 | 298 |
| 294 | iso_pu_bacteria | 2643221680 | 2644452841 | 298 |
| 295 | iso_pu_bacteria | 2643221723 | 2644672030 | 298 |
| 296 | iso_pu_bacteria | 2643221726 | 2644691832 | 298 |
| 297 | iso_pu_bacteria | 2834641062 | 2834643351 | 298 |
| 298 | iso_pu_bacteria | 2842711865 | 2842715697 | 298 |
| 299 | iso_pu_bacteria | 2919462493 | 2919467343 | 298 |
| 300 | iso_pu_bacteria | 2941479691 | 2941483749 | 298 |
| 301 | iso_pu_bacteria | 2945945610 | 2945948035 | 298 |
| 302 | iso_pu_bacteria | 8003400568 | 8003402603 | 298 |
| 303 | 3300003214 | JGI25165J46597_1000571 | JGI25165J46597_100057112 | 299 |
| 304 | 3300003761 | Ga0055535_1001086 | Ga0055535_10010866 | 299 |
| 305 | 3300003762 | Ga0055542_1001080 | Ga0055542_100108011 | 299 |
| 306 | 3300003763 | Ga0055529_1000566 | Ga0055529_100056611 | 299 |
| 307 | 3300003856 | Ga0058692_1004221 | Ga0058692_10042212 | 299 |
| 308 | 3300005435 | Ga0070714_100533503 | Ga0070714_1005335031 | 299 |
| 309 | 3300005437 | Ga0070710_10029235 | Ga0070710_100292352 | 299 |
| 310 | 3300005440 | Ga0070705_100023565 | Ga0070705_1000235652 | 299 |
| 311 | 3300005444 | Ga0070694_100144956 | Ga0070694_1001449561 | 299 |
| 312 | 3300005467 | Ga0070706_100399483 | Ga0070706_1003994831 | 299 |
| 313 | 3300005468 | Ga0070707_100215857 | Ga0070707_1002158571 | 299 |
| 314 | 3300005535 | Ga0070684_100365265 | Ga0070684_1003652652 | 299 |
| 315 | 3300005539 | Ga0068853_100015579 | Ga0068853_1000155796 | 299 |
| 316 | 3300005547 | Ga0070693_100196711 | Ga0070693_1001967111 | 299 |
| 317 | 3300005548 | Ga0070665_100003591 | Ga0070665_10000359111 | 299 |
| 318 | 3300005578 | Ga0068854_100207482 | Ga0068854_1002074822 | 299 |
| 319 | 3300005614 | Ga0068856_100035527 | Ga0068856_1000355274 | 299 |
| 320 | 3300005618 | Ga0068864_100094523 | Ga0068864_1000945232 | 299 |
| 321 | 3300005841 | Ga0068863_100009504 | Ga0068863_1000095046 | 299 |
| 322 | 3300005842 | Ga0068858_100033639 | Ga0068858_1000336396 | 299 |
| 323 | 3300005843 | Ga0068860_100016692 | Ga0068860_1000166928 | 299 |
| 324 | 3300005981 | Ga0081538_10021013 | Ga0081538_100210133 | 299 |
| 325 | 3300006186 | Ga0075369_10152887 | Ga0075369_101528871 | 299 |
| 326 | 3300006358 | Ga0068871_100067601 | Ga0068871_1000676013 | 299 |
| 327 | 3300006358 | Ga0068871_100449309 | Ga0068871_1004493091 | 299 |
| 328 | 3300006881 | Ga0068865_100034127 | Ga0068865_1000341274 | 299 |
| 329 | 3300007265 | Ga0099794_10078861 | Ga0099794_100788611 | 299 |
| 330 | 3300009098 | Ga0105245_10020119 | Ga0105245_100201195 | 299 |
| 331 | 3300009174 | Ga0105241_10110362 | Ga0105241_101103622 | 299 |
| 332 | 3300009177 | Ga0105248_10032169 | Ga0105248_100321695 | 299 |
| 333 | 3300009545 | Ga0105237_10038704 | Ga0105237_100387044 | 299 |
| 334 | 3300010159 | Ga0099796_10014960 | Ga0099796_100149602 | 299 |
| 335 | 3300010375 | Ga0105239_10188875 | Ga0105239_101888752 | 299 |
| 336 | 3300010375 | Ga0105239_10327427 | Ga0105239_103274272 | 299 |
| 337 | 3300013308 | Ga0157375_10015743 | Ga0157375_100157434 | 299 |
| 338 | 3300014325 | Ga0163163_10022921 | Ga0163163_100229214 | 299 |
| 339 | 3300014968 | Ga0157379_10048312 | Ga0157379_100483122 | 299 |
| 340 | 3300025228 | Ga0209672_100129 | Ga0209672_1001297 | 299 |
| 341 | 3300025242 | Ga0209258_100088 | Ga0209258_10008855 | 299 |
| 342 | 3300025246 | Ga0209646_1000916 | Ga0209646_10009166 | 299 |
| 343 | 3300025250 | Ga0209026_1006750 | Ga0209026_10067502 | 299 |
| 344 | 3300025254 | Ga0209148_1000024 | Ga0209148_100002495 | 299 |
| 345 | 3300025256 | Ga0209759_1001537 | Ga0209759_10015377 | 299 |
| 346 | 3300025272 | Ga0209455_1000025 | Ga0209455_100002595 | 299 |
| 347 | 3300025294 | Ga0209025_1007680 | Ga0209025_10076801 | 299 |
| 348 | 3300025898 | Ga0207692_10250894 | Ga0207692_102508941 | 299 |
| 349 | 3300025910 | Ga0207684_10294367 | Ga0207684_102943671 | 299 |
| 350 | 3300025915 | Ga0207693_10081544 | Ga0207693_100815442 | 299 |
| 351 | 3300025915 | Ga0207693_10108286 | Ga0207693_101082863 | 299 |
| 352 | 3300025927 | Ga0207687_10039904 | Ga0207687_100399041 | 299 |
| 353 | 3300025929 | Ga0207664_10449485 | Ga0207664_104494851 | 299 |
| 354 | 3300025941 | Ga0207711_10049244 | Ga0207711_100492442 | 299 |
| 355 | 3300025942 | Ga0207689_10087113 | Ga0207689_100871132 | 299 |
| 356 | 3300025981 | Ga0207640_10084049 | Ga0207640_100840492 | 299 |
| 357 | 3300026041 | Ga0207639_10025696 | Ga0207639_100256962 | 299 |
| 358 | 3300026067 | Ga0207678_10089522 | Ga0207678_100895222 | 299 |
| 359 | 3300026078 | Ga0207702_10085572 | Ga0207702_100855723 | 299 |
| 360 | 3300026088 | Ga0207641_10084948 | Ga0207641_100849482 | 299 |
| 361 | 3300027312 | Ga0209371_1001722 | Ga0209371_10017222 | 299 |
| 362 | 3300027312 | Ga0209371_1003088 | Ga0209371_10030884 | 299 |
| 363 | 3300028379 | Ga0268266_10066111 | Ga0268266_100661112 | 299 |
| 364 | 3300030500 | Ga0268256_1000785 | Ga0268256_100078518 | 299 |
| 365 | 3300030500 | Ga0268256_1003493 | Ga0268256_10034936 | 299 |
| 366 | 3300035692 | Ga0373935_0171166 | Ga0373935_0171166_423_1337 | 299 |
| 367 | 3300044684 | Ga0466966_0034962 | Ga0466966_0034962_1256_2170 | 299 |
| 368 | 3300046507 | Ga0495606_0000161 | Ga0495606_0000161_113515_114480 | 299 |
| 369 | 3300046512 | Ga0495610_0051177 | Ga0495610_0051177_346_1257 | 299 |
| 370 | 3300046543 | Ga0495645_0046993 | Ga0495645_0046993_516_1427 | 299 |
| 371 | 3300047319 | Ga0495674_0183477 | Ga0495674_0183477_464_1378 | 299 |
| 372 | 3300048905 | Ga0496102_0060614 | Ga0496102_0060614_352_1332 | 299 |
| 373 | 3300048906 | Ga0496103_0016546 | Ga0496103_0016546_3049_4029 | 299 |
| 374 | 3300048909 | Ga0496106_0051678 | Ga0496106_0051678_1756_2688 | 299 |
| 375 | 3300048910 | Ga0496107_0061952 | Ga0496107_0061952_1573_2553 | 299 |
| 376 | 3300048913 | Ga0496110_0234946 | Ga0496110_0234946_361_1341 | 299 |
| 377 | 3300048915 | Ga0496112_0371258 | Ga0496112_0371258_138_1118 | 299 |
| 378 | 3300050512 | nmdc:mga0n895_112098_c1 | nmdc:mga0n895_112098_c1_150_1130 | 299 |
| 379 | 3300050515 | nmdc:mga0a205_45969_c2 | nmdc:mga0a205_45969_c2_1041_2021 | 299 |
| 380 | iso_pu_bacteria | 2690316117 | 2692318060 | 299 |
| 381 | iso_pu_bacteria | 2747842428 | 2747948559 | 299 |
| 382 | iso_pu_bacteria | 2791355199 | 2793077763 | 299 |
| 383 | iso_pu_bacteria | 2847417321 | 2847423432 | 299 |
| 384 | iso_pu_bacteria | 2889033259 | 2889039589 | 299 |
| 385 | iso_pu_bacteria | 2919134579 | 2919135963 | 299 |
| 386 | iso_pu_bacteria | 2961064222 | 2961067394 | 299 |
| 387 | iso_pu_bacteria | 2989771324 | 2989776234 | 299 |
| 388 | 3300002737 | JGI25162J39368_1000125 | JGI25162J39368_100012563 | 300 |
| 389 | 3300002773 | JGI25152J39213_1000768 | JGI25152J39213_100076815 | 300 |
| 390 | 3300002773 | JGI25152J39213_1004660 | JGI25152J39213_10046604 | 300 |
| 391 | 3300002774 | JGI25150J39212_1000001 | JGI25150J39212_1000001925 | 300 |
| 392 | 3300003187 | JGI25151J46595_10000005 | JGI25151J46595_10000005276 | 300 |
| 393 | 3300003214 | JGI25165J46597_1000495 | JGI25165J46597_100049516 | 300 |
| 394 | 3300003214 | JGI25165J46597_1004592 | JGI25165J46597_10045923 | 300 |
| 395 | 3300003215 | JGI25153J46596_10000040 | JGI25153J46596_1000004043 | 300 |
| 396 | 3300003215 | JGI25153J46596_10000532 | JGI25153J46596_1000053215 | 300 |
| 397 | 3300003215 | JGI25153J46596_10009846 | JGI25153J46596_100098461 | 300 |
| 398 | 3300003215 | JGI25153J46596_10015269 | JGI25153J46596_100152692 | 300 |
| 399 | 3300003322 | rootL2_10022068 | rootL2_1002206818 | 300 |
| 400 | 3300003374 | JGI25161J50226_1000150 | JGI25161J50226_100015039 | 300 |
| 401 | 3300003771 | Ga0055526_1006243 | Ga0055526_10062436 | 300 |
| 402 | 3300003771 | Ga0055526_1007064 | Ga0055526_10070643 | 300 |
| 403 | 3300003771 | Ga0055526_1009227 | Ga0055526_10092274 | 300 |
| 404 | 3300003775 | Ga0055524_1004394 | Ga0055524_10043943 | 300 |
| 405 | 3300003790 | Ga0055528_1000106 | Ga0055528_100010666 | 300 |
| 406 | 3300003790 | Ga0055528_1008582 | Ga0055528_10085825 | 300 |
| 407 | 3300003790 | Ga0055528_1009430 | Ga0055528_10094302 | 300 |
| 408 | 3300003792 | Ga0055540_1006682 | Ga0055540_10066823 | 300 |
| 409 | 3300004625 | Ga0055543_1000074 | Ga0055543_100007446 | 300 |
| 410 | 3300005328 | Ga0070676_10072247 | Ga0070676_100722472 | 300 |
| 411 | 3300005329 | Ga0070683_100026394 | Ga0070683_1000263942 | 300 |
| 412 | 3300005354 | Ga0070675_100375499 | Ga0070675_1003754992 | 300 |
| 413 | 3300005434 | Ga0070709_10000609 | Ga0070709_1000060922 | 300 |
| 414 | 3300005435 | Ga0070714_100010925 | Ga0070714_1000109254 | 300 |
| 415 | 3300005436 | Ga0070713_100015089 | Ga0070713_1000150893 | 300 |
| 416 | 3300005437 | Ga0070710_10000144 | Ga0070710_1000014411 | 300 |
| 417 | 3300005455 | Ga0070663_100181343 | Ga0070663_1001813431 | 300 |
| 418 | 3300005456 | Ga0070678_100342775 | Ga0070678_1003427751 | 300 |
| 419 | 3300005457 | Ga0070662_100381323 | Ga0070662_1003813231 | 300 |
| 420 | 3300005458 | Ga0070681_10032776 | Ga0070681_100327762 | 300 |
| 421 | 3300005530 | Ga0070679_100269901 | Ga0070679_1002699012 | 300 |
| 422 | 3300005548 | Ga0070665_100019552 | Ga0070665_1000195522 | 300 |
| 423 | 3300005548 | Ga0070665_100054826 | Ga0070665_1000548265 | 300 |
| 424 | 3300005548 | Ga0070665_100087733 | Ga0070665_1000877333 | 300 |
| 425 | 3300005548 | Ga0070665_100337121 | Ga0070665_1003371212 | 300 |
| 426 | 3300005564 | Ga0070664_100360118 | Ga0070664_1003601181 | 300 |
| 427 | 3300005578 | Ga0068854_100020459 | Ga0068854_1000204594 | 300 |
| 428 | 3300005614 | Ga0068856_100739364 | Ga0068856_1007393641 | 300 |
| 429 | 3300005616 | Ga0068852_100107981 | Ga0068852_1001079811 | 300 |
| 430 | 3300005842 | Ga0068858_100026065 | Ga0068858_1000260654 | 300 |
| 431 | 3300005843 | Ga0068860_100273722 | Ga0068860_1002737221 | 300 |
| 432 | 3300005937 | Ga0081455_10002274 | Ga0081455_1000227418 | 300 |
| 433 | 3300005983 | Ga0081540_1014129 | Ga0081540_10141293 | 300 |
| 434 | 3300005985 | Ga0081539_10030585 | Ga0081539_100305852 | 300 |
| 435 | 3300006038 | Ga0075365_10071338 | Ga0075365_100713384 | 300 |
| 436 | 3300006038 | Ga0075365_10188639 | Ga0075365_101886391 | 300 |
| 437 | 3300006042 | Ga0075368_10028302 | Ga0075368_100283023 | 300 |
| 438 | 3300006048 | Ga0075363_100015464 | Ga0075363_1000154644 | 300 |
| 439 | 3300006048 | Ga0075363_100044594 | Ga0075363_1000445942 | 300 |
| 440 | 3300006163 | Ga0070715_10039642 | Ga0070715_100396422 | 300 |
| 441 | 3300006173 | Ga0070716_100025095 | Ga0070716_1000250952 | 300 |
| 442 | 3300006175 | Ga0070712_100002030 | Ga0070712_10000203011 | 300 |
| 443 | 3300006175 | Ga0070712_100004935 | Ga0070712_1000049354 | 300 |
| 444 | 3300006175 | Ga0070712_100028568 | Ga0070712_1000285684 | 300 |
| 445 | 3300006177 | Ga0075362_10024312 | Ga0075362_100243122 | 300 |
| 446 | 3300006186 | Ga0075369_10000419 | Ga0075369_100004193 | 300 |
| 447 | 3300006353 | Ga0075370_10122257 | Ga0075370_101222572 | 300 |
| 448 | 3300006847 | Ga0075431_100004254 | Ga0075431_1000042543 | 300 |
| 449 | 3300006941 | Ga0099825_1044464 | Ga0099825_10444641 | 300 |
| 450 | 3300006943 | Ga0099822_1000686 | Ga0099822_10006867 | 300 |
| 451 | 3300006944 | Ga0099823_1043708 | Ga0099823_10437082 | 300 |
| 452 | 3300006946 | Ga0079104_1008261 | Ga0079104_10082614 | 300 |
| 453 | 3300007788 | Ga0099795_10022137 | Ga0099795_100221371 | 300 |
| 454 | 3300009093 | Ga0105240_10000201 | Ga0105240_1000020142 | 300 |
| 455 | 3300009148 | Ga0105243_10152113 | Ga0105243_101521133 | 300 |
| 456 | 3300009545 | Ga0105237_10003330 | Ga0105237_1000333011 | 300 |
| 457 | 3300009553 | Ga0105249_10478291 | Ga0105249_104782911 | 300 |
| 458 | 3300010375 | Ga0105239_10319437 | Ga0105239_103194372 | 300 |
| 459 | 3300010375 | Ga0105239_10495397 | Ga0105239_104953971 | 300 |
| 460 | 3300013104 | Ga0157370_10001402 | Ga0157370_100014028 | 300 |
| 461 | 3300013249 | Ga0171463_1005 | Ga0171463_1005115 | 300 |
| 462 | 3300013308 | Ga0157375_10067698 | Ga0157375_100676983 | 300 |
| 463 | 3300014326 | Ga0157380_10447846 | Ga0157380_104478461 | 300 |
| 464 | 3300014968 | Ga0157379_10053775 | Ga0157379_100537752 | 300 |
| 465 | 3300014968 | Ga0157379_10148352 | Ga0157379_101483521 | 300 |
| 466 | 3300015262 | Ga0182007_10012038 | Ga0182007_100120384 | 300 |
| 467 | 3300015265 | Ga0182005_1025912 | Ga0182005_10259121 | 300 |
| 468 | 3300015690 | Ga0183363_1022 | Ga0183363_102221 | 300 |
| 469 | 3300021320 | Ga0214544_1000013 | Ga0214544_100001370 | 300 |
| 470 | 3300021321 | Ga0214542_1000013 | Ga0214542_1000013165 | 300 |
| 471 | 3300021324 | Ga0214545_1000012 | Ga0214545_100001270 | 300 |
| 472 | 3300021324 | Ga0214545_1032757 | Ga0214545_10327573 | 300 |
| 473 | 3300025208 | Ga0209436_100011 | Ga0209436_100011115 | 300 |
| 474 | 3300025233 | Ga0209437_100022 | Ga0209437_100022566 | 300 |
| 475 | 3300025245 | Ga0207425_1000002 | Ga0207425_1000002257 | 300 |
| 476 | 3300025245 | Ga0207425_1001067 | Ga0207425_10010675 | 300 |
| 477 | 3300025245 | Ga0207425_1008952 | Ga0207425_10089522 | 300 |
| 478 | 3300025253 | Ga0209677_100174 | Ga0209677_10017446 | 300 |
| 479 | 3300025258 | Ga0209129_1000002 | Ga0209129_1000002257 | 300 |
| 480 | 3300025258 | Ga0209129_1000615 | Ga0209129_100061514 | 300 |
| 481 | 3300025258 | Ga0209129_1001256 | Ga0209129_10012568 | 300 |
| 482 | 3300025261 | Ga0209233_1000031 | Ga0209233_1000031566 | 300 |
| 483 | 3300025261 | Ga0209233_1000217 | Ga0209233_10002174 | 300 |
| 484 | 3300025273 | Ga0209673_1000139 | Ga0209673_1000139105 | 300 |
| 485 | 3300025273 | Ga0209673_1003445 | Ga0209673_10034455 | 300 |
| 486 | 3300025273 | Ga0209673_1004658 | Ga0209673_10046585 | 300 |
| 487 | 3300025284 | Ga0209130_1000066 | Ga0209130_1000066214 | 300 |
| 488 | 3300025294 | Ga0209025_1000004 | Ga0209025_1000004932 | 300 |
| 489 | 3300025294 | Ga0209025_1016628 | Ga0209025_10166284 | 300 |
| 490 | 3300025295 | Ga0209564_1000225 | Ga0209564_100022584 | 300 |
| 491 | 3300025295 | Ga0209564_1000331 | Ga0209564_100033111 | 300 |
| 492 | 3300025295 | Ga0209564_1019349 | Ga0209564_10193492 | 300 |
| 493 | 3300025297 | Ga0209758_1000006 | Ga0209758_1000006932 | 300 |
| 494 | 3300025297 | Ga0209758_1001171 | Ga0209758_100117119 | 300 |
| 495 | 3300025297 | Ga0209758_1005160 | Ga0209758_100516011 | 300 |
| 496 | 3300025297 | Ga0209758_1032067 | Ga0209758_10320671 | 300 |
| 497 | 3300025299 | Ga0209256_1000299 | Ga0209256_10002996 | 300 |
| 498 | 3300025299 | Ga0209256_1008343 | Ga0209256_10083431 | 300 |
| 499 | 3300025302 | Ga0207426_1000008 | Ga0207426_1000008669 | 300 |
| 500 | 3300025303 | Ga0209051_1000643 | Ga0209051_100064325 | 300 |
| 501 | 3300025303 | Ga0209051_1002199 | Ga0209051_10021994 | 300 |
| 502 | 3300025303 | Ga0209051_1050454 | Ga0209051_10504542 | 300 |
| 503 | 3300025898 | Ga0207692_10000215 | Ga0207692_1000021510 | 300 |
| 504 | 3300025898 | Ga0207692_10062403 | Ga0207692_100624032 | 300 |
| 505 | 3300025899 | Ga0207642_10102604 | Ga0207642_101026041 | 300 |
| 506 | 3300025906 | Ga0207699_10001468 | Ga0207699_100014685 | 300 |
| 507 | 3300025912 | Ga0207707_10017493 | Ga0207707_100174932 | 300 |
| 508 | 3300025913 | Ga0207695_10000118 | Ga0207695_10000118160 | 300 |
| 509 | 3300025914 | Ga0207671_10000175 | Ga0207671_1000017541 | 300 |
| 510 | 3300025915 | Ga0207693_10009787 | Ga0207693_100097876 | 300 |
| 511 | 3300025915 | Ga0207693_10059070 | Ga0207693_100590702 | 300 |
| 512 | 3300025921 | Ga0207652_10226328 | Ga0207652_102263282 | 300 |
| 513 | 3300025926 | Ga0207659_10177955 | Ga0207659_101779552 | 300 |
| 514 | 3300025927 | Ga0207687_10096057 | Ga0207687_100960572 | 300 |
| 515 | 3300025929 | Ga0207664_10031599 | Ga0207664_100315994 | 300 |
| 516 | 3300025931 | Ga0207644_10246474 | Ga0207644_102464742 | 300 |
| 517 | 3300025932 | Ga0207690_10137278 | Ga0207690_101372784 | 300 |
| 518 | 3300025935 | Ga0207709_10064340 | Ga0207709_100643402 | 300 |
| 519 | 3300025937 | Ga0207669_10100007 | Ga0207669_101000071 | 300 |
| 520 | 3300025937 | Ga0207669_10373675 | Ga0207669_103736751 | 300 |
| 521 | 3300025939 | Ga0207665_10007952 | Ga0207665_100079522 | 300 |
| 522 | 3300025940 | Ga0207691_10150971 | Ga0207691_101509712 | 300 |
| 523 | 3300025942 | Ga0207689_10058238 | Ga0207689_100582381 | 300 |
| 524 | 3300025944 | Ga0207661_10018471 | Ga0207661_100184715 | 300 |
| 525 | 3300025945 | Ga0207679_10381462 | Ga0207679_103814621 | 300 |
| 526 | 3300025961 | Ga0207712_10179060 | Ga0207712_101790601 | 300 |
| 527 | 3300025972 | Ga0207668_10230983 | Ga0207668_102309831 | 300 |
| 528 | 3300025981 | Ga0207640_10014501 | Ga0207640_100145012 | 300 |
| 529 | 3300026035 | Ga0207703_10033168 | Ga0207703_100331682 | 300 |
| 530 | 3300026067 | Ga0207678_10162826 | Ga0207678_101628262 | 300 |
| 531 | 3300026118 | Ga0207675_100089926 | Ga0207675_1000899262 | 300 |
| 532 | 3300026118 | Ga0207675_100234025 | Ga0207675_1002340252 | 300 |
| 533 | 3300026142 | Ga0207698_10007770 | Ga0207698_100077704 | 300 |
| 534 | 3300026142 | Ga0207698_10210856 | Ga0207698_102108561 | 300 |
| 535 | 3300027111 | Ga0209281_1001051 | Ga0209281_10010515 | 300 |
| 536 | 3300027296 | Ga0209389_1000163 | Ga0209389_100016324 | 300 |
| 537 | 3300027357 | Ga0209589_1000002 | Ga0209589_1000002647 | 300 |
| 538 | 3300027361 | Ga0209489_100002 | Ga0209489_100002647 | 300 |
| 539 | 3300027361 | Ga0209489_101100 | Ga0209489_10110024 | 300 |
| 540 | 3300027363 | Ga0209700_100002 | Ga0209700_100002647 | 300 |
| 541 | 3300027363 | Ga0209700_100014 | Ga0209700_100014237 | 300 |
| 542 | 3300027671 | Ga0209588_1004478 | Ga0209588_10044786 | 300 |
| 543 | 3300027907 | Ga0207428_10002329 | Ga0207428_1000232910 | 300 |
| 544 | 3300028379 | Ga0268266_10072134 | Ga0268266_100721344 | 300 |
| 545 | 3300028379 | Ga0268266_10072159 | Ga0268266_100721593 | 300 |
| 546 | 3300028379 | Ga0268266_10074416 | Ga0268266_100744166 | 300 |
| 547 | 3300028380 | Ga0268265_10250613 | Ga0268265_102506131 | 300 |
| 548 | 3300028573 | Ga0265334_10049386 | Ga0265334_100493861 | 300 |
| 549 | 3300028794 | Ga0307515_10138045 | Ga0307515_101380453 | 300 |
| 550 | 3300031250 | Ga0265331_10075526 | Ga0265331_100755261 | 300 |
| 551 | 3300031456 | Ga0307513_10041634 | Ga0307513_100416344 | 300 |
| 552 | 3300031456 | Ga0307513_10069169 | Ga0307513_100691694 | 300 |
| 553 | 3300031548 | Ga0307408_100003016 | Ga0307408_10000301611 | 300 |
| 554 | 3300031711 | Ga0265314_10002700 | Ga0265314_100027003 | 300 |
| 555 | 3300031712 | Ga0265342_10021476 | Ga0265342_100214766 | 300 |
| 556 | 3300031852 | Ga0307410_10012481 | Ga0307410_100124812 | 300 |
| 557 | 3300031901 | Ga0307406_10000771 | Ga0307406_100007718 | 300 |
| 558 | 3300031901 | Ga0307406_10122943 | Ga0307406_101229431 | 300 |
| 559 | 3300031911 | Ga0307412_10025137 | Ga0307412_100251372 | 300 |
| 560 | 3300031995 | Ga0307409_100134590 | Ga0307409_1001345904 | 300 |
| 561 | 3300032002 | Ga0307416_100108681 | Ga0307416_1001086812 | 300 |
| 562 | 3300032002 | Ga0307416_100394017 | Ga0307416_1003940172 | 300 |
| 563 | 3300032004 | Ga0307414_10000018 | Ga0307414_1000001862 | 300 |
| 564 | 3300032126 | Ga0307415_100255748 | Ga0307415_1002557482 | 300 |
| 565 | 3300035111 | Ga0373923_0087281 | Ga0373923_0087281_146_1081 | 300 |
| 566 | 3300035691 | Ga0373931_0071495 | Ga0373931_0071495_24_1154 | 300 |
| 567 | 3300035691 | Ga0373931_0262479 | Ga0373931_0262479_22_945 | 300 |
| 568 | 3300035695 | Ga0373927_0071556 | Ga0373927_0071556_189_1124 | 300 |
| 569 | 3300035724 | Ga0373933_0051988 | Ga0373933_0051988_383_1318 | 300 |
| 570 | 3300036401 | Ga0373937_0131839 | Ga0373937_0131839_1278_2213 | 300 |
| 571 | 3300037068 | Ga0373925_0043778 | Ga0373925_0043778_1429_2364 | 300 |
| 572 | 3300041503 | Ga0451847_0770903 | Ga0451847_0770903_469_1404 | 300 |
| 573 | 3300041507 | Ga0451851_0373797 | Ga0451851_0373797_469_1404 | 300 |
| 574 | 3300044765 | Ga0466970_0016669 | Ga0466970_0016669_2051_3124 | 300 |
| 575 | 3300046455 | Ga0495603_0095992 | Ga0495603_0095992_752_1684 | 300 |
| 576 | 3300046460 | Ga0495638_0024226 | Ga0495638_0024226_1788_2735 | 300 |
| 577 | 3300046460 | Ga0495638_0192148 | Ga0495638_0192148_154_1098 | 300 |
| 578 | 3300046474 | Ga0495605_0134187 | Ga0495605_0134187_124_1077 | 300 |
| 579 | 3300046501 | Ga0495607_0012359 | Ga0495607_0012359_2468_3547 | 300 |
| 580 | 3300046512 | Ga0495610_0015862 | Ga0495610_0015862_3428_4345 | 300 |
| 581 | 3300046512 | Ga0495610_0021278 | Ga0495610_0021278_1465_2418 | 300 |
| 582 | 3300046512 | Ga0495610_0071632 | Ga0495610_0071632_257_1174 | 300 |
| 583 | 3300046518 | Ga0495631_0077962 | Ga0495631_0077962_35_988 | 300 |
| 584 | 3300046522 | Ga0495643_0013947 | Ga0495643_0013947_2199_3152 | 300 |
| 585 | 3300046522 | Ga0495643_0017843 | Ga0495643_0017843_3197_4114 | 300 |
| 586 | 3300046522 | Ga0495643_0025587 | Ga0495643_0025587_77_994 | 300 |
| 587 | 3300046616 | Ga0495668_0177931 | Ga0495668_0177931_194_1147 | 300 |
| 588 | 3300046660 | Ga0495625_0018451 | Ga0495625_0018451_2888_3841 | 300 |
| 589 | 3300046660 | Ga0495625_0149748 | Ga0495625_0149748_114_1067 | 300 |
| 590 | 3300046674 | Ga0495588_0003105 | Ga0495588_0003105_5673_6665 | 300 |
| 591 | 3300046684 | Ga0495669_0015704 | Ga0495669_0015704_1814_2806 | 300 |
| 592 | 3300046794 | Ga0495589_0171585 | Ga0495589_0171585_18_953 | 300 |
| 593 | 3300046810 | Ga0495660_0090367 | Ga0495660_0090367_15_932 | 300 |
| 594 | 3300047443 | Ga0495687_000521 | Ga0495687_000521_23223_24296 | 300 |
| 595 | 3300047443 | Ga0495687_002186 | Ga0495687_002186_8030_8983 | 300 |
| 596 | 3300047471 | Ga0495684_0004330 | Ga0495684_0004330_3903_4838 | 300 |
| 597 | 3300047472 | Ga0495686_0077646 | Ga0495686_0077646_745_1683 | 300 |
| 598 | 3300048088 | Ga0495602_0018555 | Ga0495602_0018555_69_980 | 300 |
| 599 | 3300048903 | Ga0496100_0002867 | Ga0496100_0002867_3371_4288 | 300 |
| 600 | 3300048905 | Ga0496102_0297745 | Ga0496102_0297745_91_1008 | 300 |
| 601 | 3300048906 | Ga0496103_0006117 | Ga0496103_0006117_614_1531 | 300 |
| 602 | 3300048907 | Ga0496104_0021062 | Ga0496104_0021062_1994_2911 | 300 |
| 603 | 3300048909 | Ga0496106_0000093 | Ga0496106_0000093_10292_11209 | 300 |
| 604 | 3300048909 | Ga0496106_0307303 | Ga0496106_0307303_201_1181 | 300 |
| 605 | 3300048912 | Ga0496109_0490000 | Ga0496109_0490000_108_1049 | 300 |
| 606 | 3300048913 | Ga0496110_0100973 | Ga0496110_0100973_303_1253 | 300 |
| 607 | 3300048915 | Ga0496112_0132350 | Ga0496112_0132350_1282_2223 | 300 |
| 608 | 3300048918 | Ga0496115_0004235 | Ga0496115_0004235_1344_2285 | 300 |
| 609 | 3300048919 | Ga0496116_0069069 | Ga0496116_0069069_513_1430 | 300 |
| 610 | 3300048920 | Ga0496117_0004844 | Ga0496117_0004844_5508_6425 | 300 |
| 611 | 3300048921 | Ga0496118_0005397 | Ga0496118_0005397_5508_6425 | 300 |
| 612 | 3300048921 | Ga0496118_0047620 | Ga0496118_0047620_2103_3020 | 300 |
| 613 | 3300048922 | Ga0496119_0000390 | Ga0496119_0000390_25874_26791 | 300 |
| 614 | 3300048922 | Ga0496119_0029847 | Ga0496119_0029847_2067_2984 | 300 |
| 615 | 3300048922 | Ga0496119_0032878 | Ga0496119_0032878_2205_3122 | 300 |
| 616 | 3300048922 | Ga0496119_0085568 | Ga0496119_0085568_423_1340 | 300 |
| 617 | 3300048923 | Ga0496120_0026293 | Ga0496120_0026293_822_1739 | 300 |
| 618 | 3300048924 | Ga0496121_0002660 | Ga0496121_0002660_24763_25680 | 300 |
| 619 | 3300048924 | Ga0496121_0026649 | Ga0496121_0026649_2870_3787 | 300 |
| 620 | 3300048924 | Ga0496121_0052853 | Ga0496121_0052853_337_1254 | 300 |
| 621 | 3300048924 | Ga0496121_0060528 | Ga0496121_0060528_1314_2231 | 300 |
| 622 | 3300048925 | Ga0496122_0037604 | Ga0496122_0037604_2144_3061 | 300 |
| 623 | 3300048925 | Ga0496122_0213571 | Ga0496122_0213571_155_1072 | 300 |
| 624 | 3300048926 | Ga0496123_0021688 | Ga0496123_0021688_1301_2218 | 300 |
| 625 | 3300048927 | Ga0496124_0041508 | Ga0496124_0041508_2568_3485 | 300 |
| 626 | 3300048927 | Ga0496124_0281151 | Ga0496124_0281151_76_993 | 300 |
| 627 | 3300048929 | Ga0496126_0286912 | Ga0496126_0286912_293_1249 | 300 |
| 628 | 3300049460 | Ga0495682_0097034 | Ga0495682_0097034_44_997 | 300 |
| 629 | 3300049568 | Ga0501031_0147246 | Ga0501031_0147246_591_1508 | 300 |
| 630 | 3300049569 | Ga0501032_0022921 | Ga0501032_0022921_2408_3325 | 300 |
| 631 | 3300049570 | Ga0501033_0033244 | Ga0501033_0033244_2348_3265 | 300 |
| 632 | 3300049571 | Ga0501034_0003451 | Ga0501034_0003451_8442_9359 | 300 |
| 633 | 3300049571 | Ga0501034_0051312 | Ga0501034_0051312_835_1752 | 300 |
| 634 | 3300049571 | Ga0501034_0154722 | Ga0501034_0154722_424_1395 | 300 |
| 635 | 3300049571 | Ga0501034_0188927 | Ga0501034_0188927_346_1263 | 300 |
| 636 | 3300049571 | Ga0501034_0535031 | Ga0501034_0535031_84_995 | 300 |
| 637 | 3300049572 | Ga0501036_0090569 | Ga0501036_0090569_832_1749 | 300 |
| 638 | 3300049573 | Ga0501037_0017509 | Ga0501037_0017509_1156_2073 | 300 |
| 639 | 3300049574 | Ga0501038_0082564 | Ga0501038_0082564_1572_2489 | 300 |
| 640 | 3300049575 | Ga0501039_0027289 | Ga0501039_0027289_1616_2533 | 300 |
| 641 | 3300049575 | Ga0501039_0191077 | Ga0501039_0191077_70_984 | 300 |
| 642 | 3300049578 | Ga0501042_0013985 | Ga0501042_0013985_107_1024 | 300 |
| 643 | 3300049579 | Ga0501043_0168413 | Ga0501043_0168413_548_1468 | 300 |
| 644 | 3300049581 | Ga0501047_0054806 | Ga0501047_0054806_2208_3179 | 300 |
| 645 | 3300049582 | Ga0501048_0002535 | Ga0501048_0002535_12867_13784 | 300 |
| 646 | 3300049582 | Ga0501048_0039881 | Ga0501048_0039881_1731_2648 | 300 |
| 647 | 3300049585 | Ga0501069_0151525 | Ga0501069_0151525_159_1076 | 300 |
| 648 | 3300049586 | Ga0501070_0063375 | Ga0501070_0063375_1881_2798 | 300 |
| 649 | 3300049589 | Ga0501073_0017180 | Ga0501073_0017180_563_1480 | 300 |
| 650 | 3300049590 | Ga0501074_0040694 | Ga0501074_0040694_1780_2751 | 300 |
| 651 | 3300049822 | Ga0501035_0377287 | Ga0501035_0377287_86_1006 | 300 |
| 652 | 3300049823 | Ga0501044_0153059 | Ga0501044_0153059_1156_2073 | 300 |
| 653 | 3300049824 | Ga0501045_0009657 | Ga0501045_0009657_216_1133 | 300 |
| 654 | 3300050510 | nmdc:mga06r32_68226_c1 | nmdc:mga06r32_68226_c1_1309_2223 | 300 |
| 655 | 3300050511 | nmdc:mga08y16_1184_c1 | nmdc:mga08y16_1184_c1_15522_16436 | 300 |
| 656 | 3300053087 | Ga0500643_059687 | Ga0500643_059687_72_1040 | 300 |
| 657 | 3300053109 | Ga0500569_000794 | Ga0500569_000794_3997_4950 | 300 |
| 658 | 3300053109 | Ga0500569_012100 | Ga0500569_012100_466_1419 | 300 |
| 659 | 3300053125 | Ga0500618_000720 | Ga0500618_000720_4165_5082 | 300 |
| 660 | 3300053125 | Ga0500618_040919 | Ga0500618_040919_72_989 | 300 |
| 661 | 3300053134 | Ga0500658_0000516 | Ga0500658_0000516_4549_5502 | 300 |
| 662 | 3300053134 | Ga0500658_0152864 | Ga0500658_0152864_17_934 | 300 |
| 663 | 3300053136 | Ga0500559_0000683 | Ga0500559_0000683_13532_14476 | 300 |
| 664 | 3300053139 | Ga0500568_0000740 | Ga0500568_0000740_3914_4831 | 300 |
| 665 | 3300053153 | Ga0500616_0000731 | Ga0500616_0000731_26289_27242 | 300 |
| 666 | 3300053153 | Ga0500616_0016056 | Ga0500616_0016056_3124_4077 | 300 |
| 667 | 3300053156 | Ga0500622_0000170 | Ga0500622_0000170_48908_49825 | 300 |
| 668 | 3300053160 | Ga0500633_0004866 | Ga0500633_0004866_1648_2565 | 300 |
| 669 | 3300060353 | Ga0501082_0014164 | Ga0501082_0014164_3088_4005 | 300 |
| 670 | iso_pu_bacteria | 2509276019 | 2509380292 | 300 |
| 671 | iso_pu_bacteria | 2509276033 | 2509442533 | 300 |
| 672 | iso_pu_bacteria | 2509276033 | 2509446221 | 300 |
| 673 | iso_pu_bacteria | 2510065057 | 2510302723 | 300 |
| 674 | iso_pu_bacteria | 2510461076 | 2510894308 | 300 |
| 675 | iso_pu_bacteria | 2510461076 | 2510899333 | 300 |
| 676 | iso_pu_bacteria | 2510917028 | 2511181789 | 300 |
| 677 | iso_pu_bacteria | 2511231052 | 2511497775 | 300 |
| 678 | iso_pu_bacteria | 2513237084 | 2513569987 | 300 |
| 679 | iso_pu_bacteria | 2513237084 | 2513571651 | 300 |
| 680 | iso_pu_bacteria | 2513237085 | 2513578687 | 300 |
| 681 | iso_pu_bacteria | 2513237086 | 2513584568 | 300 |
| 682 | iso_pu_bacteria | 2513237091 | 2513616418 | 300 |
| 683 | iso_pu_bacteria | 2513237093 | 2513630130 | 300 |
| 684 | iso_pu_bacteria | 2513237098 | 2513671705 | 300 |
| 685 | iso_pu_bacteria | 2513237098 | 2513680213 | 300 |
| 686 | iso_pu_bacteria | 2513237140 | 2513883885 | 300 |
| 687 | iso_pu_bacteria | 2513237143 | 2513902011 | 300 |
| 688 | iso_pu_bacteria | 2513237146 | 2513923868 | 300 |
| 689 | iso_pu_bacteria | 2513237161 | 2514015491 | 300 |
| 690 | iso_pu_bacteria | 2513237162 | 2514019424 | 300 |
| 691 | iso_pu_bacteria | 2515075009 | 2515111880 | 300 |
| 692 | iso_pu_bacteria | 2515075009 | 2515114428 | 300 |
| 693 | iso_pu_bacteria | 2515154114 | 2515643162 | 300 |
| 694 | iso_pu_bacteria | 2515154116 | 2515656271 | 300 |
| 695 | iso_pu_bacteria | 2516653046 | 2516896575 | 300 |
| 696 | iso_pu_bacteria | 2516653085 | 2517078343 | 300 |
| 697 | iso_pu_bacteria | 2517287029 | 2517406427 | 300 |
| 698 | iso_pu_bacteria | 2517287029 | 2517408513 | 300 |
| 699 | iso_pu_bacteria | 2517572143 | 2517894613 | 300 |
| 700 | iso_pu_bacteria | 2524023209 | 2524461557 | 300 |
| 701 | iso_pu_bacteria | 2551306084 | 2551681432 | 300 |
| 702 | iso_pu_bacteria | 2551306085 | 2551684669 | 300 |
| 703 | iso_pu_bacteria | 2551306089 | 2551708251 | 300 |
| 704 | iso_pu_bacteria | 2582581294 | 2585205466 | 300 |
| 705 | iso_pu_bacteria | 2582581298 | 2585226627 | 300 |
| 706 | iso_pu_bacteria | 2582581866 | 2585394451 | 300 |
| 707 | iso_pu_bacteria | 2582581867 | 2585404530 | 300 |
| 708 | iso_pu_bacteria | 2582581867 | 2585404950 | 300 |
| 709 | iso_pu_bacteria | 2585427526 | 2585526021 | 300 |
| 710 | iso_pu_bacteria | 2585427529 | 2585549701 | 300 |
| 711 | iso_pu_bacteria | 2585427590 | 2585824226 | 300 |
| 712 | iso_pu_bacteria | 2585427633 | 2585992651 | 300 |
| 713 | iso_pu_bacteria | 2599185170 | 2599415906 | 300 |
| 714 | iso_pu_bacteria | 2600255279 | 2601611478 | 300 |
| 715 | iso_pu_bacteria | 2600255308 | 2601748101 | 300 |
| 716 | iso_pu_bacteria | 2617270735 | 2617350721 | 300 |
| 717 | iso_pu_bacteria | 2617270741 | 2617378882 | 300 |
| 718 | iso_pu_bacteria | 2643221618 | 2644109680 | 300 |
| 719 | iso_pu_bacteria | 2643221655 | 2644312558 | 300 |
| 720 | iso_pu_bacteria | 2643221698 | 2644540873 | 300 |
| 721 | iso_pu_bacteria | 2643221712 | 2644618289 | 300 |
| 722 | iso_pu_bacteria | 2718217927 | 2719385467 | 300 |
| 723 | iso_pu_bacteria | 2718218423 | 2721399215 | 300 |
| 724 | iso_pu_bacteria | 2721755755 | 2723845405 | 300 |
| 725 | iso_pu_bacteria | 2721755809 | 2724038028 | 300 |
| 726 | iso_pu_bacteria | 2724679232 | 2725949807 | 300 |
| 727 | iso_pu_bacteria | 2791355091 | 2792624916 | 300 |
| 728 | iso_pu_bacteria | 2791355094 | 2792643908 | 300 |
| 729 | iso_pu_bacteria | 2791355094 | 2792644099 | 300 |
| 730 | iso_pu_bacteria | 2791355123 | 2792749954 | 300 |
| 731 | iso_pu_bacteria | 2791355256 | 2793295362 | 300 |
| 732 | iso_pu_bacteria | 2791355259 | 2793313829 | 300 |
| 733 | iso_pu_bacteria | 2802429605 | 2805928110 | 300 |
| 734 | iso_pu_bacteria | 2824609381 | 2824616740 | 300 |
| 735 | iso_pu_bacteria | 2824653114 | 2824660398 | 300 |
| 736 | iso_pu_bacteria | 2824671348 | 2824675966 | 300 |
| 737 | iso_pu_bacteria | 2824687955 | 2824692073 | 300 |
| 738 | iso_pu_bacteria | 2824732956 | 2824734302 | 300 |
| 739 | iso_pu_bacteria | 2824746037 | 2824747858 | 300 |
| 740 | iso_pu_bacteria | 2824773399 | 2824780441 | 300 |
| 741 | iso_pu_bacteria | 2838035591 | 2838036025 | 300 |
| 742 | iso_pu_bacteria | 2838122688 | 2838127842 | 300 |
| 743 | iso_pu_bacteria | 2838661181 | 2838667446 | 300 |
| 744 | iso_pu_bacteria | 2838686498 | 2838690323 | 300 |
| 745 | iso_pu_bacteria | 2838729681 | 2838732080 | 300 |
| 746 | iso_pu_bacteria | 2838742623 | 2838744976 | 300 |
| 747 | iso_pu_bacteria | 2839993093 | 2839998168 | 300 |
| 748 | iso_pu_bacteria | 2841851746 | 2841856034 | 300 |
| 749 | iso_pu_bacteria | 2841941048 | 2841943135 | 300 |
| 750 | iso_pu_bacteria | 2841966195 | 2841968224 | 300 |
| 751 | iso_pu_bacteria | 2841974524 | 2841976565 | 300 |
| 752 | iso_pu_bacteria | 2841983080 | 2841987939 | 300 |
| 753 | iso_pu_bacteria | 2842156927 | 2842161203 | 300 |
| 754 | iso_pu_bacteria | 2842180545 | 2842184820 | 300 |
| 755 | iso_pu_bacteria | 2842205361 | 2842207097 | 300 |
| 756 | iso_pu_bacteria | 2842229732 | 2842232402 | 300 |
| 757 | iso_pu_bacteria | 2842243621 | 2842246818 | 300 |
| 758 | iso_pu_bacteria | 2842257432 | 2842261081 | 300 |
| 759 | iso_pu_bacteria | 2842271015 | 2842274343 | 300 |
| 760 | iso_pu_bacteria | 2842278818 | 2842280210 | 300 |
| 761 | iso_pu_bacteria | 2842298080 | 2842303137 | 300 |
| 762 | iso_pu_bacteria | 2842304105 | 2842305815 | 300 |
| 763 | iso_pu_bacteria | 2842357229 | 2842361427 | 300 |
| 764 | iso_pu_bacteria | 2842489311 | 2842494570 | 300 |
| 765 | iso_pu_bacteria | 2844163670 | 2844168015 | 300 |
| 766 | iso_pu_bacteria | 2844454524 | 2844456978 | 300 |
| 767 | iso_pu_bacteria | 2847930680 | 2847931330 | 300 |
| 768 | iso_pu_bacteria | 2849076700 | 2849081477 | 300 |
| 769 | iso_pu_bacteria | 2850079185 | 2850085713 | 300 |
| 770 | iso_pu_bacteria | 2855825444 | 2855828591 | 300 |
| 771 | iso_pu_bacteria | 2855839649 | 2855843717 | 300 |
| 772 | iso_pu_bacteria | 2858800743 | 2858807038 | 300 |
| 773 | iso_pu_bacteria | 2874604998 | 2874607705 | 300 |
| 774 | iso_pu_bacteria | 2876808645 | 2876812081 | 300 |
| 775 | iso_pu_bacteria | 2879083081 | 2879087629 | 300 |
| 776 | iso_pu_bacteria | 2889033259 | 2889042432 | 300 |
| 777 | iso_pu_bacteria | 2896384573 | 2896386587 | 300 |
| 778 | iso_pu_bacteria | 2902405164 | 2902407475 | 300 |
| 779 | iso_pu_bacteria | 2903768456 | 2903771098 | 300 |
| 780 | iso_pu_bacteria | 2906643746 | 2906651717 | 300 |
| 781 | iso_pu_bacteria | 2908775508 | 2908778068 | 300 |
| 782 | iso_pu_bacteria | 2915986958 | 2915988061 | 300 |
| 783 | iso_pu_bacteria | 2915993759 | 2915998184 | 300 |
| 784 | iso_pu_bacteria | 2916000859 | 2916007301 | 300 |
| 785 | iso_pu_bacteria | 2916007675 | 2916011302 | 300 |
| 786 | iso_pu_bacteria | 2916014648 | 2916020539 | 300 |
| 787 | iso_pu_bacteria | 2916021584 | 2916028123 | 300 |
| 788 | iso_pu_bacteria | 2916028427 | 2916032843 | 300 |
| 789 | iso_pu_bacteria | 2916035215 | 2916038229 | 300 |
| 790 | iso_pu_bacteria | 2916041962 | 2916044999 | 300 |
| 791 | iso_pu_bacteria | 2916048683 | 2916051936 | 300 |
| 792 | iso_pu_bacteria | 2916055098 | 2916059495 | 300 |
| 793 | iso_pu_bacteria | 2916068649 | 2916076023 | 300 |
| 794 | iso_pu_bacteria | 2916076590 | 2916077800 | 300 |
| 795 | iso_pu_bacteria | 2919100787 | 2919106133 | 300 |
| 796 | iso_pu_bacteria | 2921201388 | 2921203182 | 300 |
| 797 | iso_pu_bacteria | 2921208531 | 2921213287 | 300 |
| 798 | iso_pu_bacteria | 2921237296 | 2921240554 | 300 |
| 799 | iso_pu_bacteria | 2921244191 | 2921245756 | 300 |
| 800 | iso_pu_bacteria | 2921257292 | 2921260069 | 300 |
| 801 | iso_pu_bacteria | 2921263974 | 2921268420 | 300 |
| 802 | iso_pu_bacteria | 2921282425 | 2921284643 | 300 |
| 803 | iso_pu_bacteria | 2921289301 | 2921290540 | 300 |
| 804 | iso_pu_bacteria | 2923556063 | 2923559114 | 300 |
| 805 | iso_pu_bacteria | 2923556063 | 2923559423 | 300 |
| 806 | iso_pu_bacteria | 2924144063 | 2924148142 | 300 |
| 807 | iso_pu_bacteria | 2924150972 | 2924154741 | 300 |
| 808 | iso_pu_bacteria | 2924158325 | 2924163948 | 300 |
| 809 | iso_pu_bacteria | 2924165586 | 2924168415 | 300 |
| 810 | iso_pu_bacteria | 2924172951 | 2924177206 | 300 |
| 811 | iso_pu_bacteria | 2924179722 | 2924182060 | 300 |
| 812 | iso_pu_bacteria | 2924186466 | 2924188934 | 300 |
| 813 | iso_pu_bacteria | 2924193448 | 2924195786 | 300 |
| 814 | iso_pu_bacteria | 2924200457 | 2924202945 | 300 |
| 815 | iso_pu_bacteria | 2924207177 | 2924209979 | 300 |
| 816 | iso_pu_bacteria | 2924214083 | 2924221305 | 300 |
| 817 | iso_pu_bacteria | 2924221636 | 2924228362 | 300 |
| 818 | iso_pu_bacteria | 2924228884 | 2924233784 | 300 |
| 819 | iso_pu_bacteria | 2933016740 | 2933018982 | 300 |
| 820 | iso_pu_bacteria | 2933570622 | 2933572320 | 300 |
| 821 | iso_pu_bacteria | 2937002841 | 2937005859 | 300 |
| 822 | iso_pu_bacteria | 2937009748 | 2937014307 | 300 |
| 823 | iso_pu_bacteria | 2937016420 | 2937021555 | 300 |
| 824 | iso_pu_bacteria | 2937023124 | 2937023966 | 300 |
| 825 | iso_pu_bacteria | 2937042894 | 2937043351 | 300 |
| 826 | iso_pu_bacteria | 2937056579 | 2937056861 | 300 |
| 827 | iso_pu_bacteria | 2937063883 | 2937066078 | 300 |
| 828 | iso_pu_bacteria | 2937071275 | 2937075393 | 300 |
| 829 | iso_pu_bacteria | 2937091812 | 2937096128 | 300 |
| 830 | iso_pu_bacteria | 2937098957 | 2937105155 | 300 |
| 831 | iso_pu_bacteria | 2937106411 | 2937110518 | 300 |
| 832 | iso_pu_bacteria | 2937113482 | 2937118832 | 300 |
| 833 | iso_pu_bacteria | 2937119839 | 2937125826 | 300 |
| 834 | iso_pu_bacteria | 2937126314 | 2937131049 | 300 |
| 835 | iso_pu_bacteria | 2957382221 | 2957383012 | 300 |
| 836 | iso_pu_bacteria | 2957388812 | 2957391967 | 300 |
| 837 | iso_pu_bacteria | 2957395598 | 2957396255 | 300 |
| 838 | iso_pu_bacteria | 2957402308 | 2957402936 | 300 |
| 839 | iso_pu_bacteria | 2957408893 | 2957410708 | 300 |
| 840 | iso_pu_bacteria | 2957415311 | 2957415582 | 300 |
| 841 | iso_pu_bacteria | 2957415311 | 2957421338 | 300 |
| 842 | iso_pu_bacteria | 2957422303 | 2957427287 | 300 |
| 843 | iso_pu_bacteria | 2957430029 | 2957435281 | 300 |
| 844 | iso_pu_bacteria | 2957443900 | 2957444489 | 300 |
| 845 | iso_pu_bacteria | 2957450854 | 2957454905 | 300 |
| 846 | iso_pu_bacteria | 2957457609 | 2957461801 | 300 |
| 847 | iso_pu_bacteria | 2957464669 | 2957464831 | 300 |
| 848 | iso_pu_bacteria | 2957471148 | 2957476835 | 300 |
| 849 | iso_pu_bacteria | 2957478035 | 2957482387 | 300 |
| 850 | iso_pu_bacteria | 2957484790 | 2957490015 | 300 |
| 851 | iso_pu_bacteria | 2957491536 | 2957491696 | 300 |
| 852 | iso_pu_bacteria | 2957498199 | 2957501638 | 300 |
| 853 | iso_pu_bacteria | 2957505466 | 2957510260 | 300 |
| 854 | iso_pu_bacteria | 2960584000 | 2960585022 | 300 |
| 855 | iso_pu_bacteria | 2960597568 | 2960598464 | 300 |
| 856 | iso_pu_bacteria | 2960603979 | 2960609531 | 300 |
| 857 | iso_pu_bacteria | 2960610863 | 2960614247 | 300 |
| 858 | iso_pu_bacteria | 2960624210 | 2960629116 | 300 |
| 859 | iso_pu_bacteria | 2960637947 | 2960642809 | 300 |
| 860 | iso_pu_bacteria | 2960645483 | 2960645646 | 300 |
| 861 | iso_pu_bacteria | 2960652885 | 2960654532 | 300 |
| 862 | iso_pu_bacteria | 2960660292 | 2960660994 | 300 |
| 863 | iso_pu_bacteria | 2960667422 | 2960669769 | 300 |
| 864 | iso_pu_bacteria | 2960674078 | 2960677817 | 300 |
| 865 | iso_pu_bacteria | 2960687367 | 2960690881 | 300 |
| 866 | iso_pu_bacteria | 2964607997 | 2964610768 | 300 |
| 867 | iso_pu_bacteria | 2964615318 | 2964619287 | 300 |
| 868 | iso_pu_bacteria | 2964621998 | 2964624202 | 300 |
| 869 | iso_pu_bacteria | 2964628898 | 2964632562 | 300 |
| 870 | iso_pu_bacteria | 2964636051 | 2964640669 | 300 |
| 871 | iso_pu_bacteria | 2964643177 | 2964647965 | 300 |
| 872 | iso_pu_bacteria | 2964649959 | 2964655022 | 300 |
| 873 | iso_pu_bacteria | 2964656573 | 2964661710 | 300 |
| 874 | iso_pu_bacteria | 2964663802 | 2964666819 | 300 |
| 875 | iso_pu_bacteria | 2964670856 | 2964678007 | 300 |
| 876 | iso_pu_bacteria | 2964678106 | 2964679053 | 300 |
| 877 | iso_pu_bacteria | 2964685014 | 2964689282 | 300 |
| 878 | iso_pu_bacteria | 2964691889 | 2964696051 | 300 |
| 879 | iso_pu_bacteria | 2964698721 | 2964703224 | 300 |
| 880 | iso_pu_bacteria | 2964705432 | 2964709586 | 300 |
| 881 | iso_pu_bacteria | 2964712639 | 2964717614 | 300 |
| 882 | iso_pu_bacteria | 2964719344 | 2964725296 | 300 |
| 883 | iso_pu_bacteria | 2967664464 | 2967668539 | 300 |
| 884 | iso_pu_bacteria | 2967671571 | 2967677081 | 300 |
| 885 | iso_pu_bacteria | 2967678726 | 2967684753 | 300 |
| 886 | iso_pu_bacteria | 2967693043 | 2967697825 | 300 |
| 887 | iso_pu_bacteria | 2967699805 | 2967704406 | 300 |
| 888 | iso_pu_bacteria | 2967706974 | 2967707651 | 300 |
| 889 | iso_pu_bacteria | 2967714385 | 2967720948 | 300 |
| 890 | iso_pu_bacteria | 2967721400 | 2967725179 | 300 |
| 891 | iso_pu_bacteria | 2967735183 | 2967741875 | 300 |
| 892 | iso_pu_bacteria | 2967742019 | 2967744255 | 300 |
| 893 | iso_pu_bacteria | 2967748971 | 2967750854 | 300 |
| 894 | iso_pu_bacteria | 2967755722 | 2967761685 | 300 |
| 895 | iso_pu_bacteria | 2967762386 | 2967766014 | 300 |
| 896 | iso_pu_bacteria | 2967769361 | 2967772281 | 300 |
| 897 | iso_pu_bacteria | 2970019648 | 2970023553 | 300 |
| 898 | iso_pu_bacteria | 2970033650 | 2970038256 | 300 |
| 899 | iso_pu_bacteria | 2970040964 | 2970046499 | 300 |
| 900 | iso_pu_bacteria | 2970047711 | 2970053712 | 300 |
| 901 | iso_pu_bacteria | 2970054988 | 2970058667 | 300 |
| 902 | iso_pu_bacteria | 2970061556 | 2970062416 | 300 |
| 903 | iso_pu_bacteria | 2970068827 | 2970071303 | 300 |
| 904 | iso_pu_bacteria | 2970076120 | 2970080315 | 300 |
| 905 | iso_pu_bacteria | 2970082768 | 2970085708 | 300 |
| 906 | iso_pu_bacteria | 2970088815 | 2970094745 | 300 |
| 907 | iso_pu_bacteria | 2970095765 | 2970097345 | 300 |
| 908 | iso_pu_bacteria | 2970102677 | 2970105844 | 300 |
| 909 | iso_pu_bacteria | 2970109326 | 2970114815 | 300 |
| 910 | iso_pu_bacteria | 2970116247 | 2970119616 | 300 |
| 911 | iso_pu_bacteria | 2970129317 | 2970134930 | 300 |
| 912 | iso_pu_bacteria | 2970136068 | 2970140950 | 300 |
| 913 | iso_pu_bacteria | 2970149975 | 2970154107 | 300 |
| 914 | iso_pu_bacteria | 2970156795 | 2970162954 | 300 |
| 915 | iso_pu_bacteria | 2970164137 | 2970164651 | 300 |
| 916 | iso_pu_bacteria | 2970170962 | 2970174317 | 300 |
| 917 | iso_pu_bacteria | 2970177841 | 2970182365 | 300 |
| 918 | iso_pu_bacteria | 2970184632 | 2970189382 | 300 |
| 919 | iso_pu_bacteria | 2970191845 | 2970194679 | 300 |
| 920 | iso_pu_bacteria | 2977516862 | 2977518792 | 300 |
| 921 | iso_pu_bacteria | 2977523885 | 2977526436 | 300 |
| 922 | iso_pu_bacteria | 2977537788 | 2977541316 | 300 |
| 923 | iso_pu_bacteria | 2977551784 | 2977557723 | 300 |
| 924 | iso_pu_bacteria | 2977558990 | 2977559566 | 300 |
| 925 | iso_pu_bacteria | 2977565890 | 2977569210 | 300 |
| 926 | iso_pu_bacteria | 2977572785 | 2977578753 | 300 |
| 927 | iso_pu_bacteria | 2977579622 | 2977584696 | 300 |
| 928 | iso_pu_bacteria | 3005506211 | 3005511477 | 300 |
| 929 | iso_pu_bacteria | 648276728 | 648740930 | 300 |
| 930 | iso_pu_bacteria | 8003992118 | 8003996277 | 300 |
| 931 | iso_pu_bacteria | 8005275841 | 8005280237 | 300 |
| 932 | iso_pu_bacteria | 8005307578 | 8005314531 | 300 |
| 933 | iso_pu_bacteria | 8005460587 | 8005462539 | 300 |
| 934 | iso_pu_bacteria | 8005460587 | 8005465119 | 300 |
| 935 | iso_pu_bacteria | 8006964411 | 8006969871 | 300 |
| 936 | iso_pu_bacteria | 8006984368 | 8006985714 | 300 |
| 937 | iso_pu_bacteria | 8016583857 | 8016586128 | 300 |
| 938 | iso_pu_bacteria | 8018176218 | 8018177924 | 300 |
| 939 | iso_pu_bacteria | 8023680758 | 8023680998 | 300 |
| 940 | iso_pu_bacteria | 8023680758 | 8023686560 | 300 |
| 941 | iso_pu_bacteria | 8024501048 | 8024502242 | 300 |
| 942 | iso_pu_bacteria | 8056673599 | 8056674169 | 300 |
| 943 | iso_pu_bacteria | 8056681323 | 8056684452 | 300 |
| 944 | iso_pu_bacteria | 8056689827 | 8056691844 | 300 |
| 945 | 3300002773 | JGI25152J39213_1000145 | JGI25152J39213_100014543 | 301 |
| 946 | 3300002987 | JGI25159J45721_1003064 | JGI25159J45721_10030645 | 301 |
| 947 | 3300002987 | JGI25159J45721_1011989 | JGI25159J45721_10119892 | 301 |
| 948 | 3300003187 | JGI25151J46595_10065796 | JGI25151J46595_100657961 | 301 |
| 949 | 3300003761 | Ga0055535_1000677 | Ga0055535_100067710 | 301 |
| 950 | 3300003762 | Ga0055542_1000162 | Ga0055542_100016236 | 301 |
| 951 | 3300003775 | Ga0055524_1000817 | Ga0055524_10008177 | 301 |
| 952 | 3300003792 | Ga0055540_1003098 | Ga0055540_10030988 | 301 |
| 953 | 3300005262 | Ga0065165_1000062 | Ga0065165_1000062128 | 301 |
| 954 | 3300005548 | Ga0070665_100320289 | Ga0070665_1003202891 | 301 |
| 955 | 3300005937 | Ga0081455_10096945 | Ga0081455_100969452 | 301 |
| 956 | 3300005983 | Ga0081540_1010590 | Ga0081540_10105902 | 301 |
| 957 | 3300006051 | Ga0075364_10003895 | Ga0075364_100038955 | 301 |
| 958 | 3300006177 | Ga0075362_10004855 | Ga0075362_100048555 | 301 |
| 959 | 3300006946 | Ga0079104_1005204 | Ga0079104_10052042 | 301 |
| 960 | 3300006948 | Ga0099826_10000010 | Ga0099826_1000001057 | 301 |
| 961 | 3300009036 | Ga0105244_10013012 | Ga0105244_100130122 | 301 |
| 962 | 3300009094 | Ga0111539_10002098 | Ga0111539_1000209819 | 301 |
| 963 | 3300009177 | Ga0105248_10159725 | Ga0105248_101597252 | 301 |
| 964 | 3300009545 | Ga0105237_10002871 | Ga0105237_100028717 | 301 |
| 965 | 3300010375 | Ga0105239_10049987 | Ga0105239_100499875 | 301 |
| 966 | 3300014326 | Ga0157380_10155714 | Ga0157380_101557143 | 301 |
| 967 | 3300014497 | Ga0182008_10002242 | Ga0182008_100022429 | 301 |
| 968 | 3300025208 | Ga0209436_111532 | Ga0209436_1115321 | 301 |
| 969 | 3300025228 | Ga0209672_100829 | Ga0209672_10082910 | 301 |
| 970 | 3300025242 | Ga0209258_100236 | Ga0209258_1002369 | 301 |
| 971 | 3300025254 | Ga0209148_1000209 | Ga0209148_10002099 | 301 |
| 972 | 3300025284 | Ga0209130_1000174 | Ga0209130_100017448 | 301 |
| 973 | 3300025292 | Ga0209676_1001350 | Ga0209676_10013509 | 301 |
| 974 | 3300025297 | Ga0209758_1013710 | Ga0209758_10137103 | 301 |
| 975 | 3300025297 | Ga0209758_1018751 | Ga0209758_10187513 | 301 |
| 976 | 3300025299 | Ga0209256_1000131 | Ga0209256_100013135 | 301 |
| 977 | 3300025299 | Ga0209256_1003652 | Ga0209256_100365210 | 301 |
| 978 | 3300025302 | Ga0207426_1006027 | Ga0207426_10060275 | 301 |
| 979 | 3300025304 | Ga0209257_1002248 | Ga0209257_100224815 | 301 |
| 980 | 3300025728 | Ga0207655_1016122 | Ga0207655_10161223 | 301 |
| 981 | 3300025911 | Ga0207654_10072265 | Ga0207654_100722652 | 301 |
| 982 | 3300025941 | Ga0207711_10137788 | Ga0207711_101377882 | 301 |
| 983 | 3300025972 | Ga0207668_10287993 | Ga0207668_102879931 | 301 |
| 984 | 3300027666 | Ga0209282_1000009 | Ga0209282_100000957 | 301 |
| 985 | 3300027907 | Ga0207428_10000560 | Ga0207428_1000056024 | 301 |
| 986 | 3300028380 | Ga0268265_10163153 | Ga0268265_101631532 | 301 |
| 987 | 3300028786 | Ga0307517_10168772 | Ga0307517_101687721 | 301 |
| 988 | 3300028794 | Ga0307515_10194014 | Ga0307515_101940142 | 301 |
| 989 | 3300031731 | Ga0307405_10254827 | Ga0307405_102548271 | 301 |
| 990 | 3300031901 | Ga0307406_10044488 | Ga0307406_100444882 | 301 |
| 991 | 3300035691 | Ga0373931_0055602 | Ga0373931_0055602_43_996 | 301 |
| 992 | 3300037068 | Ga0373925_0077902 | Ga0373925_0077902_1201_2154 | 301 |
| 993 | 3300041407 | Ga0439447_000286 | Ga0439447_000286_12202_13119 | 301 |
| 994 | 3300041410 | Ga0439461_0002294 | Ga0439461_0002294_988_1902 | 301 |
| 995 | 3300041411 | Ga0439466_0008235 | Ga0439466_0008235_1002_1916 | 301 |
| 996 | 3300041411 | Ga0439466_0011134 | Ga0439466_0011134_2145_3059 | 301 |
| 997 | 3300041413 | Ga0439465_0002144 | Ga0439465_0002144_5521_6435 | 301 |
| 998 | 3300041997 | Ga0439431_0002340 | Ga0439431_0002340_2713_3627 | 301 |
| 999 | 3300042006 | Ga0439432_063961 | Ga0439432_063961_97_1014 | 301 |
| 1000 | 3300042007 | Ga0439449_0001954 | Ga0439449_0001954_2233_3150 | 301 |
| 1001 | 3300042435 | Ga0439434_0016395 | Ga0439434_0016395_737_1651 | 301 |
| 1002 | 3300046525 | Ga0495663_0026086 | Ga0495663_0026086_756_1673 | 301 |
| 1003 | 3300046616 | Ga0495668_0000002 | Ga0495668_0000002_144128_145042 | 301 |
| 1004 | 3300046660 | Ga0495625_0003303 | Ga0495625_0003303_11723_12694 | 301 |
| 1005 | 3300046810 | Ga0495660_0021283 | Ga0495660_0021283_562_1527 | 301 |
| 1006 | 3300047319 | Ga0495674_0250785 | Ga0495674_0250785_21_935 | 301 |
| 1007 | 3300047443 | Ga0495687_000748 | Ga0495687_000748_659_1576 | 301 |
| 1008 | 3300048903 | Ga0496100_0014569 | Ga0496100_0014569_462_1415 | 301 |
| 1009 | 3300048904 | Ga0496101_0020397 | Ga0496101_0020397_2553_3506 | 301 |
| 1010 | 3300048907 | Ga0496104_0159562 | Ga0496104_0159562_1161_2114 | 301 |
| 1011 | 3300048908 | Ga0496105_0012970 | Ga0496105_0012970_4908_5861 | 301 |
| 1012 | 3300048909 | Ga0496106_0101291 | Ga0496106_0101291_226_1179 | 301 |
| 1013 | 3300048910 | Ga0496107_0106792 | Ga0496107_0106792_70_1023 | 301 |
| 1014 | 3300048910 | Ga0496107_0123725 | Ga0496107_0123725_343_1284 | 301 |
| 1015 | 3300048911 | Ga0496108_0026774 | Ga0496108_0026774_352_1305 | 301 |
| 1016 | 3300048912 | Ga0496109_0143251 | Ga0496109_0143251_1261_2214 | 301 |
| 1017 | 3300048913 | Ga0496110_0215354 | Ga0496110_0215354_50_1003 | 301 |
| 1018 | 3300048914 | Ga0496111_0089652 | Ga0496111_0089652_82_1035 | 301 |
| 1019 | 3300048916 | Ga0496113_0024311 | Ga0496113_0024311_2076_3029 | 301 |
| 1020 | 3300048918 | Ga0496115_0251185 | Ga0496115_0251185_474_1388 | 301 |
| 1021 | 3300048919 | Ga0496116_0041410 | Ga0496116_0041410_1750_2667 | 301 |
| 1022 | 3300048920 | Ga0496117_0008863 | Ga0496117_0008863_3398_4315 | 301 |
| 1023 | 3300048921 | Ga0496118_0004178 | Ga0496118_0004178_13176_14093 | 301 |
| 1024 | 3300048921 | Ga0496118_0011760 | Ga0496118_0011760_6524_7441 | 301 |
| 1025 | 3300048922 | Ga0496119_0006421 | Ga0496119_0006421_109_1026 | 301 |
| 1026 | 3300048923 | Ga0496120_0002913 | Ga0496120_0002913_14774_15691 | 301 |
| 1027 | 3300048924 | Ga0496121_0002696 | Ga0496121_0002696_23540_24457 | 301 |
| 1028 | 3300048925 | Ga0496122_0000047 | Ga0496122_0000047_123538_124455 | 301 |
| 1029 | 3300048925 | Ga0496122_0095401 | Ga0496122_0095401_696_1613 | 301 |
| 1030 | 3300048926 | Ga0496123_0000077 | Ga0496123_0000077_98247_99164 | 301 |
| 1031 | 3300048926 | Ga0496123_0000393 | Ga0496123_0000393_79679_80698 | 301 |
| 1032 | 3300048926 | Ga0496123_0019962 | Ga0496123_0019962_448_1365 | 301 |
| 1033 | 3300048927 | Ga0496124_0029367 | Ga0496124_0029367_1487_2404 | 301 |
| 1034 | 3300048927 | Ga0496124_0083496 | Ga0496124_0083496_1550_2467 | 301 |
| 1035 | 3300048927 | Ga0496124_0123602 | Ga0496124_0123602_656_1573 | 301 |
| 1036 | 3300048928 | Ga0496125_0000105 | Ga0496125_0000105_156479_157396 | 301 |
| 1037 | 3300048928 | Ga0496125_0053125 | Ga0496125_0053125_1911_2828 | 301 |
| 1038 | 3300048929 | Ga0496126_0010668 | Ga0496126_0010668_3309_4226 | 301 |
| 1039 | 3300048929 | Ga0496126_0179249 | Ga0496126_0179249_609_1526 | 301 |
| 1040 | 3300050489 | nmdc:mga03683_13848_c1 | nmdc:mga03683_13848_c1_1860_2774 | 301 |
| 1041 | 3300050491 | nmdc:mga00v17_11869_c1 | nmdc:mga00v17_11869_c1_819_1733 | 301 |
| 1042 | 3300050511 | nmdc:mga08y16_609_c1 | nmdc:mga08y16_609_c1_10680_11594 | 301 |
| 1043 | 3300053134 | Ga0500658_0001317 | Ga0500658_0001317_8365_9282 | 301 |
| 1044 | 3300053140 | Ga0500573_0027376 | Ga0500573_0027376_1999_2952 | 301 |
| 1045 | 3300053153 | Ga0500616_0037385 | Ga0500616_0037385_588_1640 | 301 |
| 1046 | iso_pu_bacteria | 2513237161 | 2514015492 | 301 |
| 1047 | iso_pu_bacteria | 2599185352 | 2600196729 | 301 |
| 1048 | iso_pu_bacteria | 2643221557 | 2643805578 | 301 |
| 1049 | iso_pu_bacteria | 2643221610 | 2644064629 | 301 |
| 1050 | iso_pu_bacteria | 2643221618 | 2644106735 | 301 |
| 1051 | iso_pu_bacteria | 2643221626 | 2644148086 | 301 |
| 1052 | iso_pu_bacteria | 2643221655 | 2644310039 | 301 |
| 1053 | iso_pu_bacteria | 2643221659 | 2644331988 | 301 |
| 1054 | iso_pu_bacteria | 2643221668 | 2644377136 | 301 |
| 1055 | iso_pu_bacteria | 2643221675 | 2644419490 | 301 |
| 1056 | iso_pu_bacteria | 2643221680 | 2644452847 | 301 |
| 1057 | iso_pu_bacteria | 2643221698 | 2644543905 | 301 |
| 1058 | iso_pu_bacteria | 2643221712 | 2644616257 | 301 |
| 1059 | iso_pu_bacteria | 2643221723 | 2644672036 | 301 |
| 1060 | iso_pu_bacteria | 2643221726 | 2644691838 | 301 |
| 1061 | iso_pu_bacteria | 2643221736 | 2644747790 | 301 |
| 1062 | iso_pu_bacteria | 2791355196 | 2793061026 | 301 |
| 1063 | iso_pu_bacteria | 2841941048 | 2841943134 | 301 |
| 1064 | iso_pu_bacteria | 2841966195 | 2841968225 | 301 |
| 1065 | iso_pu_bacteria | 2876808645 | 2876817473 | 301 |
| 1066 | iso_pu_bacteria | 2879110137 | 2879110485 | 301 |
| 1067 | iso_pu_bacteria | 2921208531 | 2921208733 | 301 |
| 1068 | iso_pu_bacteria | 2924179722 | 2924186205 | 301 |
| 1069 | iso_pu_bacteria | 2957437181 | 2957441503 | 301 |
| 1070 | iso_pu_bacteria | 2957450854 | 2957455915 | 301 |
| 1071 | iso_pu_bacteria | 2960591022 | 2960594018 | 301 |
| 1072 | iso_pu_bacteria | 2970095765 | 2970096683 | 301 |
| 1073 | 3300033180 | Ga0307510_10016774 | Ga0307510_100167746 | 302 |
| 1074 | 3300049570 | Ga0501033_0009780 | Ga0501033_0009780_5087_6040 | 302 |
| 1075 | 3300049571 | Ga0501034_0098738 | Ga0501034_0098738_183_1136 | 302 |
| 1076 | 3300049572 | Ga0501036_0120847 | Ga0501036_0120847_842_1795 | 302 |
| 1077 | 3300049573 | Ga0501037_0227513 | Ga0501037_0227513_313_1266 | 302 |
| 1078 | 3300049574 | Ga0501038_0102082 | Ga0501038_0102082_923_1876 | 302 |
| 1079 | 3300049579 | Ga0501043_0057065 | Ga0501043_0057065_1779_2732 | 302 |
| 1080 | 3300049580 | Ga0501046_0166256 | Ga0501046_0166256_380_1333 | 302 |
| 1081 | 3300049581 | Ga0501047_0049777 | Ga0501047_0049777_2499_3452 | 302 |
| 1082 | 3300049586 | Ga0501070_0186078 | Ga0501070_0186078_348_1301 | 302 |
| 1083 | 3300049744 | Ga0501083_0217365 | Ga0501083_0217365_195_1148 | 302 |
| 1084 | 3300049822 | Ga0501035_0374333 | Ga0501035_0374333_125_1078 | 302 |
| 1085 | 3300049823 | Ga0501044_0007532 | Ga0501044_0007532_5765_6718 | 302 |
| 1086 | 3300003771 | Ga0055526_1000056 | Ga0055526_100005627 | 303 |
| 1087 | 3300003775 | Ga0055524_1000949 | Ga0055524_10009495 | 303 |
| 1088 | 3300003792 | Ga0055540_1015468 | Ga0055540_10154682 | 303 |
| 1089 | 3300003792 | Ga0055540_1028337 | Ga0055540_10283372 | 303 |
| 1090 | 3300005262 | Ga0065165_1022312 | Ga0065165_10223122 | 303 |
| 1091 | 3300005844 | Ga0068862_100000022 | Ga0068862_10000002217 | 303 |
| 1092 | 3300025258 | Ga0209129_1019262 | Ga0209129_10192621 | 303 |
| 1093 | 3300025263 | Ga0209565_1017141 | Ga0209565_10171412 | 303 |
| 1094 | 3300025273 | Ga0209673_1001266 | Ga0209673_100126628 | 303 |
| 1095 | 3300025273 | Ga0209673_1003378 | Ga0209673_10033788 | 303 |
| 1096 | 3300025273 | Ga0209673_1007214 | Ga0209673_10072144 | 303 |
| 1097 | 3300025284 | Ga0209130_1008246 | Ga0209130_10082461 | 303 |
| 1098 | 3300025295 | Ga0209564_1000255 | Ga0209564_100025514 | 303 |
| 1099 | 3300025297 | Ga0209758_1000861 | Ga0209758_100086137 | 303 |
| 1100 | 3300025299 | Ga0209256_1001834 | Ga0209256_10018345 | 303 |
| 1101 | 3300025302 | Ga0207426_1001743 | Ga0207426_100174315 | 303 |
| 1102 | 3300025303 | Ga0209051_1008982 | Ga0209051_10089823 | 303 |
| 1103 | 3300025303 | Ga0209051_1023723 | Ga0209051_10237234 | 303 |
| 1104 | 3300026118 | Ga0207675_100000029 | Ga0207675_10000002994 | 303 |
| 1105 | 3300028380 | Ga0268265_10000006 | Ga0268265_1000000617 | 303 |
| 1106 | iso_pu_bacteria | 2941499720 | 2941505823 | 304 |
| 1107 | 3300005347 | Ga0070668_100115010 | Ga0070668_1001150102 | 305 |
| 1108 | 3300005438 | Ga0070701_10249131 | Ga0070701_102491311 | 305 |
| 1109 | 3300005457 | Ga0070662_100068288 | Ga0070662_1000682881 | 305 |
| 1110 | 3300006881 | Ga0068865_100029277 | Ga0068865_1000292773 | 305 |
| 1111 | 3300017792 | Ga0163161_10007287 | Ga0163161_100072875 | 305 |
| 1112 | 3300025934 | Ga0207686_10080169 | Ga0207686_100801692 | 305 |
| 1113 | 3300025938 | Ga0207704_10311565 | Ga0207704_103115652 | 305 |
| 1114 | 3300025960 | Ga0207651_10047261 | Ga0207651_100472613 | 305 |
| 1115 | 3300025972 | Ga0207668_10135775 | Ga0207668_101357752 | 305 |
| 1116 | 3300026089 | Ga0207648_10310003 | Ga0207648_103100031 | 305 |
| 1117 | 3300026121 | Ga0207683_10206149 | Ga0207683_102061492 | 305 |
| 1118 | 3300048917 | Ga0496114_0206226 | Ga0496114_0206226_757_1707 | 305 |
| 1119 | 3300053094 | Ga0500566_0003680 | Ga0500566_0003680_4323_5273 | 305 |
| 1120 | 3300053119 | Ga0500595_000348 | Ga0500595_000348_21830_22780 | 305 |
| 1121 | 3300053162 | Ga0500638_021318 | Ga0500638_021318_1642_2592 | 305 |
| 1122 | 3300053178 | Ga0500637_0000110 | Ga0500637_0000110_24365_25315 | 305 |
| 1123 | 3300002459 | JGI24751J29686_10000063 | JGI24751J29686_100000631 | 308 |
| 1124 | 3300005331 | Ga0070670_100000245 | Ga0070670_1000002455 | 308 |
| 1125 | 3300005618 | Ga0068864_100000109 | Ga0068864_1000001095 | 308 |
| 1126 | 3300006195 | Ga0075366_10079295 | Ga0075366_100792951 | 308 |
| 1127 | 3300009177 | Ga0105248_10196755 | Ga0105248_101967551 | 308 |
| 1128 | 3300025925 | Ga0207650_10000039 | Ga0207650_10000039162 | 308 |
| 1129 | 3300025941 | Ga0207711_10599579 | Ga0207711_105995791 | 308 |
| 1130 | 3300026095 | Ga0207676_10000035 | Ga0207676_1000003554 | 308 |
| 1131 | 3300050493 | nmdc:mga0k408_117874_c1 | nmdc:mga0k408_117874_c1_27_953 | 308 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zo2-assembly1.cif.gz_B | aidc, a dizinc quorum-quenching lactonase | 0.9178 | 25 | 308 |
| 7y7u-assembly1.cif.gz_B | dimeric structure of a quorum-quenching metallo-hydrolase, lrsl | 0.8911 | 26 | 306 |
| 1p9e-assembly1.cif.gz_A | crystal structure analysis of methyl parathion hydrolase from pseudomonas sp wbc-3 | 0.8852 | 15 | 308 |
| 4zo2-assembly1.cif.gz_B | aidc, a dizinc quorum-quenching lactonase | 0.8849 | 25 | 308 |
| 5hif-assembly1.cif.gz_B | crystal structure of a reconstructed lactonase ancestor, anc1-mph, of the bacterial methyl parathion hydrolase, mph. | 0.8774 | 12 | 308 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4zo2A00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9165 | 25 | 308 | 3.60.15.10 |
| 4zo2A00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8866 | 25 | 308 | 3.60.15.10 |
| 6c2cA00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8693 | 9 | 308 | 3.60.15.10 |
| 4xukA00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8623 | 23 | 308 | 3.60.15.10 |
| 4le6E00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8619 | 15 | 308 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R3QI76-F1-model_v4 | Metallo-beta-lactamase superfamily protein | 0.9863 | 155 | 308 |
|
| AF-A0A4R3QI76-F1-model_v4 | Metallo-beta-lactamase superfamily protein | 0.98 | 155 | 308 |
|
| AF-A0A2X1GGK9-F1-model_v4 | deleted | 0.978 | 141 | 308 |
|
| AF-A0A2S8MNA1-F1-model_v4 | deleted | 0.9772 | 105 | 241 |
|
| AF-W6S4J1-F1-model_v4 | Metallo-beta-lactamase domain-containing protein | 0.9767 | 225 | 308 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar