F490551

General Info

Members Datasets Scaffolds Average Seq Length
1131 761 682 310

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0016669|Ga0466970_0016669_2051_3124
Length 357
Sequence MAFPLPWPDRPPNAPQHKIRAVACDRFDHAKQERIMSQTETKPHTIAQQETNMSLENNSRVGRTGADELVPSRYAVQIGDIEVLVISDGVLPLPTKMLGYNANPADHAAWLKDMFLPQDAFDWALNVVVVRSGKQTILIDAGLGLDPELNLPRAGQLIKRLEAAGIDLGSVTDVVLTHMHMDHVGGLLVDGVKARLRPDLKIHVAAAEVKFWEAPDFSHVSMPPGFPDALRAAAKQFRKEYDSHLRLFADEHEVAPGVVVSRTGGHTPGHSVVRVASGKDRLMFAGDAVFAVGFDHPDWFNGFEHDPEEAARVRVRLLRELAETGELLVATHMPFPSVGHVAADGDRFRWVPVFWDY

Samples

Sample ID Description Type Environment
1 2509276019 Ensifer aridi TW10 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
9 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
10 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
11 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
12 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
13 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
16 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
17 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
20 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
21 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
22 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
23 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
24 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
25 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
26 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
27 2519899620 Rhizobium sp. Pop5 Isolate Nodule
28 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
29 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
30 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
31 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
32 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
33 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
34 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
35 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
36 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
37 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
38 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
39 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
40 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
41 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
42 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
43 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
44 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
45 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
46 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
47 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
48 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
49 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
50 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
51 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
52 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
53 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
54 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
55 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
56 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
57 2643221557 Ensifer sp. Root558 Isolate Unclassified
58 2643221610 Ensifer sp. Root74 Isolate Unclassified
59 2643221618 Ensifer sp. Root231 Isolate Unclassified
60 2643221626 Ensifer sp. Root31 Isolate Unclassified
61 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
62 2643221651 Afipia sp. Root123D2 Isolate Unclassified
63 2643221655 Ensifer sp. Root1252 Isolate Unclassified
64 2643221659 Ensifer sp. Root127 Isolate Unclassified
65 2643221664 Massilia sp. Root418 Isolate Unclassified
66 2643221668 Ensifer sp. Root423 Isolate Unclassified
67 2643221675 Ensifer sp. Root1298 Isolate Unclassified
68 2643221680 Ensifer sp. Root1312 Isolate Unclassified
69 2643221698 Ensifer sp. Root142 Isolate Unclassified
70 2643221712 Ensifer sp. Root258 Isolate Unclassified
71 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
72 2643221723 Ensifer sp. Root278 Isolate Unclassified
73 2643221726 Ensifer sp. Root954 Isolate Unclassified
74 2643221734 Bosea sp. Root670 Isolate Unclassified
75 2643221736 Bosea sp. Root483D1 Isolate Unclassified
76 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
77 2718217927 Rhizobium sp. N324 Isolate Nodule
78 2718218423 Rhizobium sp. N941 Isolate Nodule
79 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
80 2721755809 Rhizobium sp. N541 Isolate Nodule
81 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
82 2739367651 Pedobacter sp. OK291 Isolate Unclassified
83 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
84 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
85 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
86 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
87 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
88 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
89 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
90 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
91 2791355199
92 2791355256 Rhizobium sp. M10 Isolate Nodule
93 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
94 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
95 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
96 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
97 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
98 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
99 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
100 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
101 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
102 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
103 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
104 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
105 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
106 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
107 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
108 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
109 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
110 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
111 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
112 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
113 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
114 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
115 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
116 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
117 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
118 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
119 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
120 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
121 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
122 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
123 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
124 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
125 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
126 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
127 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
128 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
129 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
130 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
131 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
132 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
133 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
134 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
135 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
136 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
137 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
138 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
139 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
140 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
141 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
142 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
143 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
144 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
145 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
146 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
147 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
148 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
149 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
150 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
151 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
152 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
153 2842694124 Methylopila sp. R-72369 Isolate Unclassified
154 2842711865 Duganella sp. R-73148 Isolate Unclassified
155 2844163670 Ensifer sp. 1H6 Isolate Unclassified
156 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
157 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
158 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
159 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
160 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
161 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
162 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
163 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
164 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
165 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
166 2858950400 Achromobacter sp. K91 Isolate Unclassified
167 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
168 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
169 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
170 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
171 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
172 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
173 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
174 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
175 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
176 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
177 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
178 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
179 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
180 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
181 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
182 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
183 2904699407
184 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
185 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
186 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
187 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
188 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
189 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
190 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
191 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
192 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
193 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
194 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
195 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
196 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
197 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
198 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
199 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
200 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
201 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
202 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
203 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
204 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
205 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
206 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
207 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
208 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
209 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
210 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
211 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
212 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
213 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
214 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
215 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
216 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
217 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
218 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
219 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
220 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
221 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
222 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
223 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
224 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
225 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
226 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
227 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
228 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
229 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
230 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
231 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
232 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
233 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
234 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
235 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
236 2936381700 Rhizobium chutanense C16 Isolate Unclassified
237 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
238 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
239 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
240 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
241 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
242 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
243 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
244 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
245 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
246 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
247 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
248 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
249 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
250 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
251 2941479691
252 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
253 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
254 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
255 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
256 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
257 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
258 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
259 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
260 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
261 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
262 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
263 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
264 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
265 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
266 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
267 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
268 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
269 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
270 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
271 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
272 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
273 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
274 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
275 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
276 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
277 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
278 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
279 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
280 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
281 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
282 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
283 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
284 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
285 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
286 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
287 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
288 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
289 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
290 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
291 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
292 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
293 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
294 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
295 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
296 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
297 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
298 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
299 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
300 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
301 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
302 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
303 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
304 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
305 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
306 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
307 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
308 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
309 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
310 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
311 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
312 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
313 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
314 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
315 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
316 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
317 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
318 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
319 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
320 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
321 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
322 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
323 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
324 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
325 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
326 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
327 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
328 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
329 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
330 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
331 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
332 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
333 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
334 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
335 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
336 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
337 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
338 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
339 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
340 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
341 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
342 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
343 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
344 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
345 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
346 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
347 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
348 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
349 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
350 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
351 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
352 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
353 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
354 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
355 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
356 2996893221 Rhizobium sp. R635 Isolate Nodule
357 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
358 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
359 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
360 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
361 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
362 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
363 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
364 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
365 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
366 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
367 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
368 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
369 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
370 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
371 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
372 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
373 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
374 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
375 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
376 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
377 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
378 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
379 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
380 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
381 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
382 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
383 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
384 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
385 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
386 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
387 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
388 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
389 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
390 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
391 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
392 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
393 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
394 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
395 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
396 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
397 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
398 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
399 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
400 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
401 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
402 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
403 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
404 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
405 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
406 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
407 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
408 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
409 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
410 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
411 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
412 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
413 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
414 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
415 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
416 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
417 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
418 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
419 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
420 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
421 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
422 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
423 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
424 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
425 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
426 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
427 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
428 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
429 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
430 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
431 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
432 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
433 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
434 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
435 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
436 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
437 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
438 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
439 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
440 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
441 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
442 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
443 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
444 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
445 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
446 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
447 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
448 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
449 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
450 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
451 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
452 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
453 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
454 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
455 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
456 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
457 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
458 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
459 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
460 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
461 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
462 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
463 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
464 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
465 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
466 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
467 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
468 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
469 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
470 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
471 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
472 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
473 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
474 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
475 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
476 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
477 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
478 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
479 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
480 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
481 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
482 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
483 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
484 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
485 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
486 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
487 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
488 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
489 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
490 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
491 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
492 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
493 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
494 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
495 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
496 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
497 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
498 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
499 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
500 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
501 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
502 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
503 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
504 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
506 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
507 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
508 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
509 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
510 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
511 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
512 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
513 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
514 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
515 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
516 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
517 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
518 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
520 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
521 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
522 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
523 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
524 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
525 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
526 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
527 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
528 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
529 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
530 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
531 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
532 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
533 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
534 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
535 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
536 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
537 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
538 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
539 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
540 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
541 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
542 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
543 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
544 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
545 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
546 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
547 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
548 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
549 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
550 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
551 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
552 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
553 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
554 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
555 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
556 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
557 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
558 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
559 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
560 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
561 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
562 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
563 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
564 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
565 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
566 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
567 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
568 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
569 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
570 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
571 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
572 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
573 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
574 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
575 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
576 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
577 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
578 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
579 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
580 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
581 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
582 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
583 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
584 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
585 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
586 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
587 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
588 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
589 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
590 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
591 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
592 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
593 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
594 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
595 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
596 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
597 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
598 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
599 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
600 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
601 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
602 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
603 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
604 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
605 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
606 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
607 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
608 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
609 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
610 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
611 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
612 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
613 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
614 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
615 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
616 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
617 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
618 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
619 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
620 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
621 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
622 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
623 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
624 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
625 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
626 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
627 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
628 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
629 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
630 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
631 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
632 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
633 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
634 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
635 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
636 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
637 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
638 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
639 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
640 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
641 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
642 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
643 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
644 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
645 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
646 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
647 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
648 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
649 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
650 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
651 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
652 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
653 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
654 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
655 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
656 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
657 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
658 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
659 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
660 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
661 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
662 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
663 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
664 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
665 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
666 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
667 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
668 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
669 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
670 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
671 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
672 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
673 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
674 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
675 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
676 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
677 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
678 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
679 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
680 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
681 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
682 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
683 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
684 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
685 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
686 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
687 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
688 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
689 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
690 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
691 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
692 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
693 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
694 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
695 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
696 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
697 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
698 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
699 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
700 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
701 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
702 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
703 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
704 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
705 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
706 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
707 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
708 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
709 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
710 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
711 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
712 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
713 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
714 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
715 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
716 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
717 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
718 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
719 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
720 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
721 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
722 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
723 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
724 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
725 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
726 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
727 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
728 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
729 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
730 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
731 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
732 8005258706 Rhizobium sp. R693 Isolate Nodule
733 8005275841 Rhizobium sp. N4311 Isolate Nodule
734 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
735 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
736 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
737 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
738 8005321885 Rhizobium sp. R72 Isolate Nodule
739 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
740 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
741 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
742 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
743 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
744 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
745 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
746 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
747 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
748 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
749 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
750 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
751 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
752 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
753 8018176218 Rhizobium sp. N122 Isolate Nodule
754 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
755 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
756 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
757 8024501048 Rhizobium sp. H4 Isolate Nodule
758 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
759 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
760 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
761 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.76
Metatranscriptomes 0
Isolates 39.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 13.7
Nodule 29
Rhizoplane 4.24
Rhizosphere 38.64
Stem 0
Stem Tuber 0
Unclassified 14.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000063 3300002459 Bacteria 60668
2 JGI25162J39368_1000125 3300002737 Bacteria 84782
3 JGI25152J39213_1000145 3300002773 Bacteria 48531
4 JGI25152J39213_1000768 3300002773 Bacteria 16180
5 JGI25152J39213_1004660 3300002773 Bacteria 4248
6 JGI25150J39212_1000001 3300002774 Bacteria 1318726
7 JGI25159J45721_1003064 3300002987 Bacteria 6045
8 JGI25159J45721_1011989 3300002987 Bacteria 2091
9 JGI25151J46595_10000005 3300003187 Bacteria 431598
10 JGI25151J46595_10065796 3300003187 Bacteria 1127
11 JGI25165J46597_1000495 3300003214 Bacteria 37949
12 JGI25165J46597_1000571 3300003214 Bacteria 32965
13 JGI25165J46597_1004592 3300003214 Bacteria 2910
14 JGI25153J46596_10000040 3300003215 Bacteria 165523
15 JGI25153J46596_10000532 3300003215 Bacteria 23955
16 JGI25153J46596_10002446 3300003215 Bacteria 10708
17 JGI25153J46596_10009846 3300003215 Bacteria 4387
18 JGI25153J46596_10015269 3300003215 Bacteria 3139
19 rootL2_10022068 3300003322 Bacteria 32667
20 JGI25161J50226_1000150 3300003374 Bacteria 48475
21 Ga0055535_1000677 3300003761 Bacteria 26506
22 Ga0055535_1001086 3300003761 Bacteria 16659
23 Ga0055542_1000162 3300003762 Bacteria 84417
24 Ga0055542_1001080 3300003762 Bacteria 16618
25 Ga0055529_1000566 3300003763 Bacteria 30480
26 Ga0055526_1000056 3300003771 Bacteria 110574
27 Ga0055526_1000704 3300003771 Bacteria 25324
28 Ga0055526_1006243 3300003771 Bacteria 6534
29 Ga0055526_1007064 3300003771 Bacteria 5936
30 Ga0055526_1009227 3300003771 Bacteria 4786
31 Ga0055524_1000817 3300003775 Bacteria 20599
32 Ga0055524_1000949 3300003775 Bacteria 18409
33 Ga0055524_1004394 3300003775 Bacteria 6505
34 Ga0055528_1000106 3300003790 Bacteria 67208
35 Ga0055528_1008582 3300003790 Bacteria 4354
36 Ga0055528_1009430 3300003790 Bacteria 4077
37 Ga0055540_1003098 3300003792 Bacteria 8261
38 Ga0055540_1006682 3300003792 Bacteria 4524
39 Ga0055540_1015468 3300003792 Bacteria 2219
40 Ga0055540_1028337 3300003792 Bacteria 1326
41 Ga0055531_10001921 3300003794 Bacteria 14537
42 Ga0058692_1004221 3300003856 Bacteria 4286
43 Ga0055543_1000074 3300004625 Bacteria 88424
44 Ga0065165_1000062 3300005262 Bacteria 178885
45 Ga0065165_1022312 3300005262 Bacteria 2174
46 Ga0070676_10072247 3300005328 Bacteria 2074
47 Ga0070683_100026394 3300005329 Bacteria 5229
48 Ga0070690_100213159 3300005330 Bacteria 1350
49 Ga0070670_100000245 3300005331 Bacteria 48841
50 Ga0068869_100137818 3300005334 Bacteria 1882
51 Ga0070666_10019019 3300005335 Bacteria 4428
52 Ga0070682_100060393 3300005337 Bacteria 2397
53 Ga0070687_100032140 3300005343 Bacteria 2580
54 Ga0070661_100247863 3300005344 Bacteria 1374
55 Ga0070668_100019835 3300005347 Bacteria 5065
56 Ga0070668_100115010 3300005347 Bacteria 2144
57 Ga0070675_100375499 3300005354 Bacteria 1265
58 Ga0070671_100054363 3300005355 Bacteria 3329
59 Ga0070673_100108867 3300005364 Bacteria 2295
60 Ga0070688_100059687 3300005365 Bacteria 2406
61 Ga0070667_100180094 3300005367 Bacteria 1869
62 Ga0070709_10000609 3300005434 Bacteria 20716
63 Ga0070709_10197010 3300005434 Bacteria 1424
64 Ga0070714_100010925 3300005435 Bacteria 7190
65 Ga0070714_100145955 3300005435 Bacteria 2128
66 Ga0070714_100533503 3300005435 Bacteria 1122
67 Ga0070714_100564012 3300005435 Bacteria 1091
68 Ga0070713_100015089 3300005436 Bacteria 5757
69 Ga0070713_100029260 3300005436 Bacteria 4360
70 Ga0070710_10000144 3300005437 Bacteria 32895
71 Ga0070710_10029235 3300005437 Bacteria 2955
72 Ga0070710_10038207 3300005437 Bacteria 2635
73 Ga0070710_10117997 3300005437 Bacteria 1602
74 Ga0070701_10249131 3300005438 Bacteria 1072
75 Ga0070705_100023565 3300005440 Bacteria 3308
76 Ga0070694_100144956 3300005444 Bacteria 1729
77 Ga0070663_100181343 3300005455 Bacteria 1634
78 Ga0070678_100045836 3300005456 Bacteria 3130
79 Ga0070678_100342775 3300005456 Bacteria 1282
80 Ga0070662_100068288 3300005457 Bacteria 2613
81 Ga0070662_100381323 3300005457 Bacteria 1160
82 Ga0070681_10032776 3300005458 Bacteria 5216
83 Ga0068867_100026525 3300005459 Bacteria 4161
84 Ga0070685_10017071 3300005466 Bacteria 3878
85 Ga0070706_100399483 3300005467 Bacteria 1279
86 Ga0070707_100215857 3300005468 Bacteria 1869
87 Ga0070679_100269901 3300005530 Bacteria 1655
88 Ga0070684_100365265 3300005535 Bacteria 1329
89 Ga0068853_100015579 3300005539 Bacteria 6246
90 Ga0070693_100196711 3300005547 Bacteria 1307
91 Ga0070693_100235464 3300005547 Bacteria 1207
92 Ga0070665_100003591 3300005548 Bacteria 16425
93 Ga0070665_100016020 3300005548 Bacteria 7525
94 Ga0070665_100019552 3300005548 Bacteria 6799
95 Ga0070665_100054826 3300005548 Bacteria 3998
96 Ga0070665_100087733 3300005548 Bacteria 3117
97 Ga0070665_100320289 3300005548 Bacteria 1555
98 Ga0070665_100337121 3300005548 Bacteria 1512
99 Ga0070664_100210880 3300005564 Bacteria 1736
100 Ga0070664_100360118 3300005564 Bacteria 1325
101 Ga0068854_100020459 3300005578 Bacteria 4478
102 Ga0068854_100207482 3300005578 Bacteria 1544
103 Ga0068856_100035527 3300005614 Bacteria 4885
104 Ga0068856_100422580 3300005614 Bacteria 1353
105 Ga0068856_100739364 3300005614 Bacteria 1004
106 Ga0068852_100107981 3300005616 Bacteria 2526
107 Ga0068864_100000109 3300005618 Bacteria 80156
108 Ga0068864_100040828 3300005618 Bacteria 3967
109 Ga0068864_100094523 3300005618 Bacteria 2642
110 Ga0068861_100008392 3300005719 Bacteria 7109
111 Ga0068863_100009504 3300005841 Bacteria 9484
112 Ga0068858_100020755 3300005842 Bacteria 6138
113 Ga0068858_100026065 3300005842 Bacteria 5435
114 Ga0068858_100033639 3300005842 Bacteria 4755
115 Ga0068860_100004221 3300005843 Bacteria 14730
116 Ga0068860_100016692 3300005843 Bacteria 7160
117 Ga0068860_100273722 3300005843 Bacteria 1648
118 Ga0068862_100000022 3300005844 Bacteria 214075
119 Ga0081455_10002274 3300005937 Bacteria 22913
120 Ga0081455_10096945 3300005937 Bacteria 2377
121 Ga0081455_10119834 3300005937 Bacteria 2075
122 Ga0081455_10126149 3300005937 Bacteria 2008
123 Ga0081538_10021013 3300005981 Bacteria 4785
124 Ga0081540_1000466 3300005983 Bacteria 40082
125 Ga0081540_1004934 3300005983 Bacteria 10037
126 Ga0081540_1006682 3300005983 Bacteria 8343
127 Ga0081540_1010590 3300005983 Bacteria 6230
128 Ga0081540_1014129 3300005983 Bacteria 5139
129 Ga0081540_1021891 3300005983 Bacteria 3788
130 Ga0081540_1034132 3300005983 Bacteria 2750
131 Ga0081540_1096278 3300005983 Bacteria 1288
132 Ga0081539_10030585 3300005985 Bacteria 3338
133 Ga0075365_10071338 3300006038 Bacteria 2338
134 Ga0075365_10188639 3300006038 Bacteria 1442
135 Ga0075368_10028302 3300006042 Bacteria 2165
136 Ga0075363_100015464 3300006048 Bacteria 3752
137 Ga0075363_100044594 3300006048 Bacteria 2350
138 Ga0075364_10003895 3300006051 Bacteria 8556
139 Ga0070715_10026998 3300006163 Bacteria 2290
140 Ga0070715_10039642 3300006163 Bacteria 1963
141 Ga0070716_100025095 3300006173 Bacteria 3177
142 Ga0070712_100002030 3300006175 Bacteria 12405
143 Ga0070712_100004935 3300006175 Bacteria 8253
144 Ga0070712_100028568 3300006175 Bacteria 3732
145 Ga0070712_100070714 3300006175 Bacteria 2494
146 Ga0070712_100095798 3300006175 Bacteria 2184
147 Ga0075362_10004855 3300006177 Bacteria 4860
148 Ga0075362_10024312 3300006177 Bacteria 2569
149 Ga0075369_10000419 3300006186 Bacteria 12857
150 Ga0075369_10152887 3300006186 Bacteria 1055
151 Ga0075366_10073587 3300006195 Bacteria 2037
152 Ga0075366_10079295 3300006195 Bacteria 1960
153 Ga0075370_10122257 3300006353 Bacteria 1516
154 Ga0068871_100067601 3300006358 Bacteria 2933
155 Ga0068871_100079177 3300006358 Bacteria 2718
156 Ga0068871_100449309 3300006358 Bacteria 1155
157 Ga0075431_100004254 3300006847 Bacteria 14024
158 Ga0068865_100029277 3300006881 Bacteria 3652
159 Ga0068865_100034127 3300006881 Bacteria 3412
160 Ga0099825_1044464 3300006941 Bacteria 1152
161 Ga0099822_1000686 3300006943 Bacteria 34261
162 Ga0099823_1043708 3300006944 Bacteria 3077
163 Ga0079104_1005204 3300006946 Bacteria 5266
164 Ga0079104_1008261 3300006946 Bacteria 3667
165 Ga0099826_10000010 3300006948 Bacteria 314346
166 Ga0099794_10078861 3300007265 Bacteria 1622
167 Ga0099795_10022137 3300007788 Bacteria 2094
168 Ga0105244_10013012 3300009036 Bacteria 4886
169 Ga0105240_10000201 3300009093 Bacteria 121112
170 Ga0105240_10237212 3300009093 Bacteria 2116
171 Ga0111539_10002098 3300009094 Bacteria 26633
172 Ga0105245_10020119 3300009098 Bacteria 5850
173 Ga0105245_10442189 3300009098 Bacteria 1307
174 Ga0105243_10152113 3300009148 Bacteria 1986
175 Ga0105241_10110362 3300009174 Bacteria 2200
176 Ga0105248_10032169 3300009177 Bacteria 5863
177 Ga0105248_10159725 3300009177 Bacteria 2543
178 Ga0105248_10196755 3300009177 Bacteria 2271
179 Ga0105237_10002871 3300009545 Bacteria 20954
180 Ga0105237_10003330 3300009545 Bacteria 19134
181 Ga0105237_10038704 3300009545 Bacteria 4816
182 Ga0105237_10173152 3300009545 Bacteria 2159
183 Ga0105249_10478291 3300009553 Bacteria 1288
184 Ga0099796_10014960 3300010159 Bacteria 2255
185 Ga0105239_10049987 3300010375 Bacteria 4585
186 Ga0105239_10188875 3300010375 Bacteria 2306
187 Ga0105239_10319437 3300010375 Bacteria 1751
188 Ga0105239_10327427 3300010375 Bacteria 1728
189 Ga0105239_10495397 3300010375 Bacteria 1389
190 Ga0105246_10019264 3300011119 Bacteria 4358
191 Ga0157370_10001402 3300013104 Bacteria 29902
192 Ga0171463_1005 3300013249 Bacteria 358236
193 Ga0157375_10015743 3300013308 Bacteria 6776
194 Ga0157375_10067698 3300013308 Bacteria 3569
195 Ga0163163_10022921 3300014325 Bacteria 5919
196 Ga0157380_10155714 3300014326 Bacteria 1980
197 Ga0157380_10170236 3300014326 Bacteria 1902
198 Ga0157380_10447846 3300014326 Bacteria 1239
199 Ga0182008_10002242 3300014497 Bacteria 12231
200 Ga0157379_10048312 3300014968 Bacteria 3798
201 Ga0157379_10053775 3300014968 Bacteria 3598
202 Ga0157379_10148352 3300014968 Bacteria 2115
203 Ga0157376_10191779 3300014969 Bacteria 1874
204 Ga0182007_10012038 3300015262 Bacteria 3342
205 Ga0182005_1025912 3300015265 Bacteria 1600
206 Ga0183363_1022 3300015690 Bacteria 57453
207 Ga0163161_10007287 3300017792 Bacteria 7632
208 Ga0214544_1000013 3300021320 Bacteria 228947
209 Ga0214542_1000013 3300021321 Bacteria 234019
210 Ga0214545_1000012 3300021324 Bacteria 187898
211 Ga0214545_1032757 3300021324 Bacteria 1959
212 Ga0209436_100011 3300025208 Bacteria 139405
213 Ga0209436_111532 3300025208 Bacteria 1548
214 Ga0209672_100129 3300025228 Bacteria 76300
215 Ga0209672_100829 3300025228 Bacteria 14408
216 Ga0209437_100022 3300025233 Bacteria 625694
217 Ga0209258_100088 3300025242 Bacteria 237738
218 Ga0209258_100236 3300025242 Bacteria 103319
219 Ga0207425_1000002 3300025245 Bacteria 1362590
220 Ga0207425_1001067 3300025245 Bacteria 12520
221 Ga0207425_1008952 3300025245 Bacteria 2522
222 Ga0209646_1000916 3300025246 Bacteria 9486
223 Ga0209026_1006750 3300025250 Bacteria 2736
224 Ga0209677_100174 3300025253 Bacteria 55175
225 Ga0209148_1000024 3300025254 Bacteria 669890
226 Ga0209148_1000209 3300025254 Bacteria 103316
227 Ga0209759_1001537 3300025256 Bacteria 12656
228 Ga0209129_1000002 3300025258 Bacteria 1359086
229 Ga0209129_1000615 3300025258 Bacteria 24007
230 Ga0209129_1001256 3300025258 Bacteria 14547
231 Ga0209129_1019262 3300025258 Bacteria 1293
232 Ga0209233_1000031 3300025261 Bacteria 624646
233 Ga0209233_1000217 3300025261 Bacteria 106187
234 Ga0209565_1017141 3300025263 Bacteria 1594
235 Ga0209455_1000025 3300025272 Bacteria 670673
236 Ga0209673_1000139 3300025273 Bacteria 157765
237 Ga0209673_1001266 3300025273 Bacteria 25980
238 Ga0209673_1003378 3300025273 Bacteria 9495
239 Ga0209673_1003445 3300025273 Bacteria 9322
240 Ga0209673_1004658 3300025273 Bacteria 7249
241 Ga0209673_1007214 3300025273 Bacteria 5178
242 Ga0209130_1000066 3300025284 Bacteria 192626
243 Ga0209130_1000174 3300025284 Bacteria 91725
244 Ga0209130_1008246 3300025284 Bacteria 3097
245 Ga0209676_1001350 3300025292 Bacteria 24409
246 Ga0209025_1000004 3300025294 Bacteria 1361782
247 Ga0209025_1007680 3300025294 Bacteria 7964
248 Ga0209025_1016628 3300025294 Bacteria 4318
249 Ga0209564_1000117 3300025295 Bacteria 207096
250 Ga0209564_1000225 3300025295 Bacteria 126209
251 Ga0209564_1000255 3300025295 Bacteria 113017
252 Ga0209564_1000331 3300025295 Bacteria 91919
253 Ga0209564_1019349 3300025295 Bacteria 2548
254 Ga0209758_1000006 3300025297 Bacteria 1359562
255 Ga0209758_1000861 3300025297 Bacteria 42010
256 Ga0209758_1001171 3300025297 Bacteria 33282
257 Ga0209758_1005160 3300025297 Bacteria 10281
258 Ga0209758_1013710 3300025297 Bacteria 4390
259 Ga0209758_1018751 3300025297 Bacteria 3374
260 Ga0209758_1032067 3300025297 Bacteria 2142
261 Ga0209050_1009349 3300025298 Bacteria 5032
262 Ga0209256_1000131 3300025299 Bacteria 162368
263 Ga0209256_1000299 3300025299 Bacteria 86909
264 Ga0209256_1000622 3300025299 Bacteria 48813
265 Ga0209256_1001834 3300025299 Bacteria 19799
266 Ga0209256_1003652 3300025299 Bacteria 10524
267 Ga0209256_1008343 3300025299 Bacteria 4828
268 Ga0207426_1000008 3300025302 Bacteria 848730
269 Ga0207426_1001743 3300025302 Bacteria 16555
270 Ga0207426_1006027 3300025302 Bacteria 5356
271 Ga0209051_1000643 3300025303 Bacteria 39847
272 Ga0209051_1002199 3300025303 Bacteria 14416
273 Ga0209051_1008982 3300025303 Bacteria 5209
274 Ga0209051_1023723 3300025303 Bacteria 2543
275 Ga0209051_1028555 3300025303 Bacteria 2201
276 Ga0209051_1050454 3300025303 Bacteria 1393
277 Ga0209257_1002248 3300025304 Bacteria 19802
278 Ga0209257_1029512 3300025304 Bacteria 1785
279 Ga0207655_1016122 3300025728 Bacteria 4109
280 Ga0207692_10000215 3300025898 Bacteria 19463
281 Ga0207692_10062403 3300025898 Bacteria 1934
282 Ga0207692_10239169 3300025898 Bacteria 1084
283 Ga0207692_10250894 3300025898 Bacteria 1060
284 Ga0207642_10045282 3300025899 Bacteria 1952
285 Ga0207642_10102604 3300025899 Bacteria 1439
286 Ga0207699_10001468 3300025906 Bacteria 11197
287 Ga0207699_10213023 3300025906 Bacteria 1315
288 Ga0207684_10294367 3300025910 Bacteria 1399
289 Ga0207654_10072265 3300025911 Bacteria 2053
290 Ga0207654_10197679 3300025911 Bacteria 1322
291 Ga0207707_10017493 3300025912 Bacteria 6249
292 Ga0207695_10000118 3300025913 Bacteria 237085
293 Ga0207671_10000175 3300025914 Bacteria 98920
294 Ga0207693_10009787 3300025915 Bacteria 7805
295 Ga0207693_10059070 3300025915 Bacteria 3004
296 Ga0207693_10081544 3300025915 Bacteria 2533
297 Ga0207693_10108286 3300025915 Bacteria 2180
298 Ga0207693_10138364 3300025915 Bacteria 1915
299 Ga0207662_10069500 3300025918 Bacteria 2128
300 Ga0207652_10226328 3300025921 Bacteria 1686
301 Ga0207650_10000039 3300025925 Bacteria 204737
302 Ga0207650_10074550 3300025925 Bacteria 2558
303 Ga0207659_10177955 3300025926 Bacteria 1683
304 Ga0207687_10039904 3300025927 Bacteria 3216
305 Ga0207687_10096057 3300025927 Bacteria 2171
306 Ga0207700_10005756 3300025928 Bacteria 7443
307 Ga0207664_10031599 3300025929 Bacteria 4052
308 Ga0207664_10059460 3300025929 Bacteria 3043
309 Ga0207664_10449485 3300025929 Bacteria 1150
310 Ga0207644_10246474 3300025931 Bacteria 1424
311 Ga0207644_10461318 3300025931 Bacteria 1044
312 Ga0207690_10137278 3300025932 Bacteria 1797
313 Ga0207686_10080169 3300025934 Bacteria 2127
314 Ga0207709_10064340 3300025935 Bacteria 2302
315 Ga0207669_10100007 3300025937 Bacteria 1914
316 Ga0207669_10373675 3300025937 Bacteria 1108
317 Ga0207704_10311565 3300025938 Bacteria 1210
318 Ga0207665_10007952 3300025939 Bacteria 7001
319 Ga0207665_10008176 3300025939 Bacteria 6906
320 Ga0207691_10150971 3300025940 Bacteria 2043
321 Ga0207711_10049244 3300025941 Bacteria 3607
322 Ga0207711_10137788 3300025941 Bacteria 2193
323 Ga0207711_10349814 3300025941 Bacteria 1368
324 Ga0207711_10599579 3300025941 Bacteria 1028
325 Ga0207689_10058238 3300025942 Bacteria 3178
326 Ga0207689_10070860 3300025942 Bacteria 2863
327 Ga0207689_10087113 3300025942 Bacteria 2566
328 Ga0207661_10018471 3300025944 Bacteria 5179
329 Ga0207679_10381462 3300025945 Bacteria 1236
330 Ga0207651_10047261 3300025960 Bacteria 2901
331 Ga0207651_10155936 3300025960 Bacteria 1784
332 Ga0207712_10179060 3300025961 Bacteria 1664
333 Ga0207668_10135775 3300025972 Bacteria 1884
334 Ga0207668_10150973 3300025972 Bacteria 1798
335 Ga0207668_10230983 3300025972 Bacteria 1491
336 Ga0207668_10287993 3300025972 Bacteria 1350
337 Ga0207640_10014501 3300025981 Bacteria 4540
338 Ga0207640_10084049 3300025981 Bacteria 2184
339 Ga0207703_10020070 3300026035 Bacteria 5223
340 Ga0207703_10033168 3300026035 Bacteria 4091
341 Ga0207639_10025696 3300026041 Bacteria 4273
342 Ga0207678_10089522 3300026067 Bacteria 2630
343 Ga0207678_10162826 3300026067 Bacteria 1905
344 Ga0207702_10085572 3300026078 Bacteria 2748
345 Ga0207641_10084948 3300026088 Bacteria 2756
346 Ga0207648_10310003 3300026089 Bacteria 1417
347 Ga0207676_10000035 3300026095 Bacteria 204737
348 Ga0207675_100000029 3300026118 Bacteria 109352
349 Ga0207675_100033572 3300026118 Bacteria 4781
350 Ga0207675_100089926 3300026118 Bacteria 2886
351 Ga0207675_100234025 3300026118 Bacteria 1773
352 Ga0207683_10045034 3300026121 Bacteria 3858
353 Ga0207683_10049809 3300026121 Bacteria 3668
354 Ga0207683_10206149 3300026121 Bacteria 1788
355 Ga0207698_10007770 3300026142 Bacteria 6736
356 Ga0207698_10210856 3300026142 Bacteria 1748
357 Ga0209281_1001051 3300027111 Bacteria 20858
358 Ga0209389_1000163 3300027296 Bacteria 55041
359 Ga0209371_1001722 3300027312 Bacteria 13838
360 Ga0209371_1003088 3300027312 Bacteria 8494
361 Ga0209589_1000002 3300027357 Bacteria 708598
362 Ga0209489_100002 3300027361 Bacteria 708609
363 Ga0209489_101100 3300027361 Bacteria 55041
364 Ga0209700_100002 3300027363 Bacteria 708598
365 Ga0209700_100014 3300027363 Bacteria 299349
366 Ga0209282_1000009 3300027666 Bacteria 233366
367 Ga0209588_1004478 3300027671 Bacteria 3944
368 Ga0207428_10000560 3300027907 Bacteria 43937
369 Ga0207428_10002329 3300027907 Bacteria 19020
370 Ga0268266_10022307 3300028379 Bacteria 5395
371 Ga0268266_10066111 3300028379 Bacteria 3126
372 Ga0268266_10072134 3300028379 Bacteria 2993
373 Ga0268266_10072159 3300028379 Bacteria 2993
374 Ga0268266_10074416 3300028379 Bacteria 2949
375 Ga0268266_10099972 3300028379 Bacteria 2554
376 Ga0268265_10000006 3300028380 Bacteria 466482
377 Ga0268265_10011076 3300028380 Bacteria 6093
378 Ga0268265_10163153 3300028380 Bacteria 1896
379 Ga0268265_10250613 3300028380 Bacteria 1568
380 Ga0268264_10000062 3300028381 Bacteria 302110
381 Ga0268264_10341015 3300028381 Bacteria 1423
382 Ga0265334_10049386 3300028573 Bacteria 1618
383 Ga0265336_10000816 3300028666 Bacteria 16369
384 Ga0307517_10092154 3300028786 Bacteria 2468
385 Ga0307517_10168772 3300028786 Bacteria 1445
386 Ga0307515_10138045 3300028794 Bacteria 2635
387 Ga0307515_10194014 3300028794 Bacteria 1930
388 Ga0265338_10000572 3300028800 Bacteria 64902
389 Ga0268256_1000785 3300030500 Bacteria 22910
390 Ga0268256_1003493 3300030500 Bacteria 7057
391 Ga0307511_10030724 3300030521 Bacteria 4819
392 Ga0265331_10075526 3300031250 Bacteria 1571
393 Ga0307513_10041634 3300031456 Bacteria 5067
394 Ga0307513_10069169 3300031456 Bacteria 3695
395 Ga0307509_10019301 3300031507 Bacteria 7781
396 Ga0307509_10046512 3300031507 Bacteria 4671
397 Ga0307408_100003016 3300031548 Bacteria 11633
398 Ga0307508_10085997 3300031616 Bacteria 2727
399 Ga0265314_10002700 3300031711 Bacteria 17767
400 Ga0265342_10021476 3300031712 Bacteria 4120
401 Ga0307516_10002464 3300031730 Bacteria 24733
402 Ga0307516_10260437 3300031730 Bacteria 1425
403 Ga0307405_10254827 3300031731 Bacteria 1308
404 Ga0307410_10012481 3300031852 Bacteria 4917
405 Ga0307406_10000771 3300031901 Bacteria 17969
406 Ga0307406_10044488 3300031901 Bacteria 2783
407 Ga0307406_10122943 3300031901 Bacteria 1808
408 Ga0307412_10025137 3300031911 Bacteria 3685
409 Ga0307409_100105236 3300031995 Bacteria 2352
410 Ga0307409_100134590 3300031995 Bacteria 2118
411 Ga0307416_100108681 3300032002 Bacteria 2437
412 Ga0307416_100394017 3300032002 Bacteria 1420
413 Ga0307414_10000018 3300032004 Bacteria 237060
414 Ga0307415_100255748 3300032126 Bacteria 1426
415 Ga0307510_10016774 3300033180 Bacteria 8640
416 Ga0307510_10122315 3300033180 Bacteria 2303
417 Ga0307510_10256375 3300033180 Bacteria 1233
418 Ga0373926_0112063 3300035083 Bacteria 1025
419 Ga0373923_0087281 3300035111 Bacteria 1360
420 Ga0373923_0161312 3300035111 Bacteria 1023
421 Ga0373943_0038999 3300035170 Bacteria 2286
422 Ga0373943_0111585 3300035170 Bacteria 1443
423 Ga0373942_0027848 3300035207 Bacteria 1473
424 Ga0373931_0055602 3300035691 Bacteria 2118
425 Ga0373931_0071495 3300035691 Bacteria 1895
426 Ga0373931_0262479 3300035691 Bacteria 1054
427 Ga0373935_0171166 3300035692 Bacteria 1486
428 Ga0373927_0003977 3300035695 Bacteria 10453
429 Ga0373927_0071556 3300035695 Bacteria 2244
430 Ga0373933_0051988 3300035724 Bacteria 2450
431 Ga0373947_0020723 3300035725 Bacteria 3799
432 Ga0373937_0131839 3300036401 Bacteria 2334
433 Ga0373925_0006499 3300037068 Bacteria 8594
434 Ga0373925_0043778 3300037068 Bacteria 3323
435 Ga0373925_0077902 3300037068 Bacteria 2517
436 Ga0395901_0187072 3300038443 Bacteria 2172
437 Ga0439447_000286 3300041407 Bacteria 18000
438 Ga0439461_0002294 3300041410 Bacteria 3037
439 Ga0439466_0008235 3300041411 Bacteria 3930
440 Ga0439466_0011134 3300041411 Bacteria 3331
441 Ga0439465_0002144 3300041413 Bacteria 6481
442 Ga0451807_1369558 3300041486 Bacteria 1776
443 Ga0451833_0055069 3300041491 Bacteria 1503
444 Ga0451847_0770903 3300041503 Bacteria 1845
445 Ga0451851_0373797 3300041507 Bacteria 3921
446 Ga0439431_0002340 3300041997 Bacteria 4187
447 Ga0439445_0036348 3300042004 Bacteria 1296
448 Ga0439432_063961 3300042006 Bacteria 1130
449 Ga0439449_0001954 3300042007 Bacteria 8096
450 Ga0439434_0016395 3300042435 Bacteria 2214
451 Ga0466966_0034962 3300044684 Bacteria 3248
452 Ga0466968_0040719 3300044735 Bacteria 1960
453 Ga0466970_0016669 3300044765 Bacteria 3791
454 Ga0495603_0008522 3300046455 Bacteria 6195
455 Ga0495603_0095992 3300046455 Bacteria 1732
456 Ga0495629_0001177 3300046459 Bacteria 20634
457 Ga0495629_0059347 3300046459 Bacteria 2674
458 Ga0495638_0024226 3300046460 Bacteria 3960
459 Ga0495638_0192148 3300046460 Bacteria 1158
460 Ga0495641_0031217 3300046461 Bacteria 2547
461 Ga0495653_0061296 3300046463 Bacteria 2847
462 Ga0495605_0134187 3300046474 Bacteria 1114
463 Ga0495662_0051243 3300046476 Bacteria 1993
464 Ga0495594_0072393 3300046499 Bacteria 1917
465 Ga0495607_0012359 3300046501 Bacteria 5642
466 Ga0495583_0001798 3300046506 Bacteria 20297
467 Ga0495606_0000161 3300046507 Bacteria 117607
468 Ga0495610_0015862 3300046512 Bacteria 4360
469 Ga0495610_0021278 3300046512 Bacteria 3571
470 Ga0495610_0051177 3300046512 Bacteria 2012
471 Ga0495610_0057426 3300046512 Bacteria 1866
472 Ga0495610_0071632 3300046512 Bacteria 1615
473 Ga0495631_0077962 3300046518 Bacteria 1430
474 Ga0495643_0013947 3300046522 Bacteria 4790
475 Ga0495643_0017843 3300046522 Bacteria 4139
476 Ga0495643_0025587 3300046522 Bacteria 3338
477 Ga0495663_0026086 3300046525 Bacteria 1709
478 Ga0495666_0046736 3300046526 Bacteria 2086
479 Ga0495645_0046993 3300046543 Bacteria 3146
480 Ga0495622_0025843 3300046557 Bacteria 2743
481 Ga0495667_0155243 3300046559 Bacteria 1473
482 Ga0495668_0000002 3300046616 Bacteria 763179
483 Ga0495668_0177931 3300046616 Bacteria 1165
484 Ga0495634_0028166 3300046642 Bacteria 3902
485 Ga0495625_0003303 3300046660 Bacteria 16271
486 Ga0495625_0018451 3300046660 Bacteria 5446
487 Ga0495625_0149748 3300046660 Bacteria 1569
488 Ga0495635_0000978 3300046663 Bacteria 18814
489 Ga0495588_0003105 3300046674 Bacteria 7192
490 Ga0495669_0015704 3300046684 Bacteria 3242
491 Ga0495613_0301926 3300046689 Bacteria 1108
492 Ga0495624_0045881 3300046690 Bacteria 2780
493 Ga0495589_0171585 3300046794 Bacteria 1031
494 Ga0495660_0021283 3300046810 Bacteria 3714
495 Ga0495660_0090367 3300046810 Bacteria 1592
496 Ga0495604_0000626 3300047317 Bacteria 30413
497 Ga0495674_0092406 3300047319 Bacteria 2583
498 Ga0495674_0183477 3300047319 Bacteria 1741
499 Ga0495674_0250785 3300047319 Bacteria 1457
500 Ga0495676_0308024 3300047321 Bacteria 1066
501 Ga0495687_000521 3300047443 Bacteria 46065
502 Ga0495687_000748 3300047443 Bacteria 35192
503 Ga0495687_002186 3300047443 Bacteria 16274
504 Ga0495673_0047864 3300047469 Bacteria 1888
505 Ga0495684_0004330 3300047471 Bacteria 11092
506 Ga0495686_0077646 3300047472 Bacteria 2033
507 Ga0495686_0184387 3300047472 Bacteria 1207
508 Ga0495602_0018555 3300048088 Bacteria 6942
509 Ga0495602_0130747 3300048088 Bacteria 2003
510 Ga0496100_0002867 3300048903 Bacteria 8835
511 Ga0496100_0014569 3300048903 Bacteria 4568
512 Ga0496101_0001838 3300048904 Bacteria 12798
513 Ga0496101_0020397 3300048904 Bacteria 4536
514 Ga0496102_0048548 3300048905 Bacteria 3859
515 Ga0496102_0060614 3300048905 Bacteria 3460
516 Ga0496102_0297745 3300048905 Bacteria 1520
517 Ga0496103_0006117 3300048906 Bacteria 7190
518 Ga0496103_0016546 3300048906 Bacteria 4401
519 Ga0496103_0021882 3300048906 Bacteria 3847
520 Ga0496104_0018207 3300048907 Bacteria 6406
521 Ga0496104_0021062 3300048907 Bacteria 5981
522 Ga0496104_0070144 3300048907 Bacteria 3331
523 Ga0496104_0159562 3300048907 Bacteria 2163
524 Ga0496105_0012970 3300048908 Bacteria 6604
525 Ga0496105_0041364 3300048908 Bacteria 3798
526 Ga0496106_0000093 3300048909 Bacteria 67667
527 Ga0496106_0051678 3300048909 Bacteria 3099
528 Ga0496106_0101291 3300048909 Bacteria 2234
529 Ga0496106_0307303 3300048909 Bacteria 1272
530 Ga0496106_0519153 3300048909 Bacteria 956
531 Ga0496107_0047573 3300048910 Bacteria 3088
532 Ga0496107_0061952 3300048910 Bacteria 2709
533 Ga0496107_0106792 3300048910 Bacteria 2056
534 Ga0496107_0123725 3300048910 Bacteria 1906
535 Ga0496108_0006949 3300048911 Bacteria 9160
536 Ga0496108_0026774 3300048911 Bacteria 4759
537 Ga0496109_0069613 3300048912 Bacteria 3227
538 Ga0496109_0143251 3300048912 Bacteria 2235
539 Ga0496109_0490000 3300048912 Bacteria 1160
540 Ga0496110_0100973 3300048913 Bacteria 2586
541 Ga0496110_0215354 3300048913 Bacteria 1746
542 Ga0496110_0234946 3300048913 Bacteria 1668
543 Ga0496111_0089652 3300048914 Bacteria 2252
544 Ga0496112_0081132 3300048915 Bacteria 3207
545 Ga0496112_0132350 3300048915 Bacteria 2465
546 Ga0496112_0371258 3300048915 Bacteria 1372
547 Ga0496113_0024311 3300048916 Bacteria 4304
548 Ga0496114_0026876 3300048917 Bacteria 4714
549 Ga0496114_0206226 3300048917 Bacteria 1723
550 Ga0496115_0004235 3300048918 Bacteria 10372
551 Ga0496115_0251185 3300048918 Bacteria 1456
552 Ga0496116_0041410 3300048919 Bacteria 3160
553 Ga0496116_0069069 3300048919 Bacteria 2248
554 Ga0496117_0004844 3300048920 Bacteria 14549
555 Ga0496117_0008863 3300048920 Bacteria 9493
556 Ga0496117_0129150 3300048920 Bacteria 1535
557 Ga0496118_0004178 3300048921 Bacteria 17389
558 Ga0496118_0005397 3300048921 Bacteria 14549
559 Ga0496118_0011760 3300048921 Bacteria 8505
560 Ga0496118_0047620 3300048921 Bacteria 3320
561 Ga0496119_0000390 3300048922 Bacteria 60662
562 Ga0496119_0006421 3300048922 Bacteria 10903
563 Ga0496119_0029847 3300048922 Bacteria 3687
564 Ga0496119_0032878 3300048922 Bacteria 3451
565 Ga0496119_0085568 3300048922 Bacteria 1804
566 Ga0496120_0002913 3300048923 Bacteria 16344
567 Ga0496120_0026293 3300048923 Bacteria 3595
568 Ga0496121_0002660 3300048924 Bacteria 26794
569 Ga0496121_0002696 3300048924 Bacteria 26537
570 Ga0496121_0026649 3300048924 Bacteria 5436
571 Ga0496121_0052853 3300048924 Bacteria 3407
572 Ga0496121_0060528 3300048924 Bacteria 3114
573 Ga0496122_0000047 3300048925 Bacteria 274226
574 Ga0496122_0037604 3300048925 Bacteria 3893
575 Ga0496122_0095401 3300048925 Bacteria 2010
576 Ga0496122_0213571 3300048925 Bacteria 1114
577 Ga0496123_0000077 3300048926 Bacteria 192607
578 Ga0496123_0000393 3300048926 Bacteria 81747
579 Ga0496123_0019962 3300048926 Bacteria 5261
580 Ga0496123_0021688 3300048926 Bacteria 4982
581 Ga0496124_0029367 3300048927 Bacteria 4901
582 Ga0496124_0041508 3300048927 Bacteria 3969
583 Ga0496124_0083496 3300048927 Bacteria 2620
584 Ga0496124_0123602 3300048927 Bacteria 2064
585 Ga0496124_0281151 3300048927 Bacteria 1213
586 Ga0496125_0000105 3300048928 Bacteria 200717
587 Ga0496125_0053125 3300048928 Bacteria 3325
588 Ga0496126_0010668 3300048929 Bacteria 9604
589 Ga0496126_0040859 3300048929 Bacteria 4297
590 Ga0496126_0179249 3300048929 Bacteria 1801
591 Ga0496126_0286912 3300048929 Bacteria 1362
592 Ga0496126_0363782 3300048929 Bacteria 1181
593 Ga0495682_0097034 3300049460 Bacteria 1058
594 Ga0501031_0147246 3300049568 Bacteria 1538
595 Ga0501032_0022921 3300049569 Bacteria 4322
596 Ga0501033_0009780 3300049570 Bacteria 7366
597 Ga0501033_0033244 3300049570 Bacteria 3872
598 Ga0501033_0097200 3300049570 Bacteria 2152
599 Ga0501034_0003451 3300049571 Bacteria 18019
600 Ga0501034_0051312 3300049571 Bacteria 4159
601 Ga0501034_0098738 3300049571 Bacteria 2915
602 Ga0501034_0154722 3300049571 Bacteria 2267
603 Ga0501034_0188927 3300049571 Bacteria 2023
604 Ga0501034_0535031 3300049571 Bacteria 1082
605 Ga0501036_0090569 3300049572 Bacteria 2583
606 Ga0501036_0120847 3300049572 Bacteria 2212
607 Ga0501037_0017509 3300049573 Bacteria 5273
608 Ga0501037_0227513 3300049573 Bacteria 1310
609 Ga0501038_0082564 3300049574 Bacteria 2705
610 Ga0501038_0102082 3300049574 Bacteria 2387
611 Ga0501038_0363153 3300049574 Bacteria 1126
612 Ga0501039_0027289 3300049575 Bacteria 4390
613 Ga0501039_0191077 3300049575 Bacteria 1610
614 Ga0501042_0013985 3300049578 Bacteria 5469
615 Ga0501043_0037940 3300049579 Bacteria 3790
616 Ga0501043_0057065 3300049579 Bacteria 3066
617 Ga0501043_0168413 3300049579 Bacteria 1710
618 Ga0501046_0112978 3300049580 Bacteria 2074
619 Ga0501046_0166256 3300049580 Bacteria 1657
620 Ga0501047_0049777 3300049581 Bacteria 4045
621 Ga0501047_0054806 3300049581 Bacteria 3856
622 Ga0501047_0152148 3300049581 Bacteria 2189
623 Ga0501047_0381201 3300049581 Bacteria 1244
624 Ga0501048_0002535 3300049582 Bacteria 13973
625 Ga0501048_0039881 3300049582 Bacteria 3366
626 Ga0501069_0151525 3300049585 Bacteria 1333
627 Ga0501070_0063375 3300049586 Bacteria 3062
628 Ga0501070_0186078 3300049586 Bacteria 1708
629 Ga0501073_0017180 3300049589 Bacteria 5240
630 Ga0501074_0040694 3300049590 Bacteria 3365
631 Ga0501083_0217365 3300049744 Bacteria 1245
632 Ga0501035_0374333 3300049822 Bacteria 1188
633 Ga0501035_0377287 3300049822 Bacteria 1183
634 Ga0501044_0007532 3300049823 Bacteria 11972
635 Ga0501044_0153059 3300049823 Bacteria 2288
636 Ga0501045_0009657 3300049824 Bacteria 6751
637 nmdc:mga03683_13848_c1 3300050489 Bacteria 2974
638 nmdc:mga00v17_11869_c1 3300050491 Bacteria 4795
639 nmdc:mga0k408_117874_c1 3300050493 Bacteria 1571
640 nmdc:mga0k408_121597_c1 3300050493 Bacteria 1546
641 nmdc:mga07m45_126241_c1 3300050496 Bacteria 1479
642 nmdc:mga05p37_890_c1 3300050507 Bacteria 33690
643 nmdc:mga09592_17280_c1 3300050508 Bacteria 5909
644 nmdc:mga0qj67_17074_c1 3300050509 Bacteria 5515
645 nmdc:mga06r32_12281_c1 3300050510 Bacteria 7725
646 nmdc:mga06r32_68226_c1 3300050510 Bacteria 3435
647 nmdc:mga08y16_1184_c1 3300050511 Bacteria 25736
648 nmdc:mga08y16_31589_c1 3300050511 Bacteria 5569
649 nmdc:mga08y16_609_c1 3300050511 Bacteria 33341
650 nmdc:mga0n895_112098_c1 3300050512 Bacteria 2745
651 nmdc:mga0a205_45969_c2 3300050515 Bacteria 3753
652 Ga0495601_0002861 3300053077 Bacteria 9810
653 Ga0495612_0021342 3300053078 Bacteria 2598
654 Ga0500643_059687 3300053087 Bacteria 1073
655 Ga0500644_0024690 3300053088 Bacteria 1841
656 Ga0500644_0053889 3300053088 Bacteria 1390
657 Ga0500566_0000074 3300053094 Bacteria 48359
658 Ga0500566_0003680 3300053094 Bacteria 9155
659 Ga0500640_000535 3300053095 Bacteria 9608
660 Ga0500569_000794 3300053109 Bacteria 5544
661 Ga0500569_012100 3300053109 Bacteria 2079
662 Ga0500572_000414 3300053111 Bacteria 15011
663 Ga0500595_000348 3300053119 Bacteria 30151
664 Ga0500618_000720 3300053125 Bacteria 18953
665 Ga0500618_040919 3300053125 Bacteria 1064
666 Ga0500658_0000516 3300053134 Bacteria 16413
667 Ga0500658_0001317 3300053134 Bacteria 10046
668 Ga0500658_0152864 3300053134 Bacteria 1041
669 Ga0500559_0000683 3300053136 Bacteria 22548
670 Ga0500568_0000740 3300053139 Bacteria 23333
671 Ga0500573_0027376 3300053140 Bacteria 3278
672 Ga0500616_0000731 3300053153 Bacteria 37996
673 Ga0500616_0016056 3300053153 Bacteria 4271
674 Ga0500616_0037385 3300053153 Bacteria 2629
675 Ga0500622_0000170 3300053156 Bacteria 70088
676 Ga0500633_0004866 3300053160 Bacteria 3130
677 Ga0500638_021318 3300053162 Bacteria 3060
678 Ga0500637_0000110 3300053178 Bacteria 29626
679 Ga0500637_0022523 3300053178 Bacteria 3433
680 Ga0500661_002499 3300055283 Bacteria 3470
681 Ga0501082_0014164 3300060353 Bacteria 6863
682 Ga0501082_0121908 3300060353 Bacteria 2260

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10442189 Ga0105245_104421891 282
2 3300014326 Ga0157380_10170236 Ga0157380_101702362 282
3 iso_pu_bacteria 2643221651 2644289263 282
4 iso_pu_bacteria 2921296804 2921304039 285
5 3300009545 Ga0105237_10173152 Ga0105237_101731522 286
6 3300035083 Ga0373926_0112063 Ga0373926_0112063_112_981 286
7 3300035111 Ga0373923_0161312 Ga0373923_0161312_102_971 286
8 3300035170 Ga0373943_0038999 Ga0373943_0038999_1059_1928 286
9 3300035725 Ga0373947_0020723 Ga0373947_0020723_133_1002 286
10 3300041491 Ga0451833_0055069 Ga0451833_0055069_536_1405 286
11 3300046459 Ga0495629_0059347 Ga0495629_0059347_23_892 286
12 3300046461 Ga0495641_0031217 Ga0495641_0031217_1393_2262 286
13 3300046463 Ga0495653_0061296 Ga0495653_0061296_1402_2271 286
14 3300046499 Ga0495594_0072393 Ga0495594_0072393_877_1746 286
15 3300046526 Ga0495666_0046736 Ga0495666_0046736_891_1760 286
16 3300046559 Ga0495667_0155243 Ga0495667_0155243_519_1388 286
17 3300046642 Ga0495634_0028166 Ga0495634_0028166_1421_2290 286
18 3300046689 Ga0495613_0301926 Ga0495613_0301926_98_967 286
19 3300047319 Ga0495674_0092406 Ga0495674_0092406_508_1377 286
20 3300047321 Ga0495676_0308024 Ga0495676_0308024_99_968 286
21 3300048905 Ga0496102_0048548 Ga0496102_0048548_2209_3078 286
22 3300048907 Ga0496104_0070144 Ga0496104_0070144_2209_3078 286
23 3300048909 Ga0496106_0519153 Ga0496106_0519153_23_892 286
24 3300048910 Ga0496107_0047573 Ga0496107_0047573_11_880 286
25 3300049574 Ga0501038_0363153 Ga0501038_0363153_26_895 286
26 3300049581 Ga0501047_0152148 Ga0501047_0152148_106_975 286
27 3300050507 nmdc:mga05p37_890_c1 nmdc:mga05p37_890_c1_9490_10356 286
28 3300050508 nmdc:mga09592_17280_c1 nmdc:mga09592_17280_c1_2435_3301 286
29 3300050509 nmdc:mga0qj67_17074_c1 nmdc:mga0qj67_17074_c1_2358_3224 286
30 3300050510 nmdc:mga06r32_12281_c1 nmdc:mga06r32_12281_c1_2616_3482 286
31 3300050511 nmdc:mga08y16_31589_c1 nmdc:mga08y16_31589_c1_1673_2539 286
32 3300053077 Ga0495601_0002861 Ga0495601_0002861_6303_7172 286
33 3300053078 Ga0495612_0021342 Ga0495612_0021342_1682_2551 286
34 3300053088 Ga0500644_0024690 Ga0500644_0024690_499_1362 286
35 3300003215 JGI25153J46596_10002446 JGI25153J46596_100024464 287
36 3300025297 Ga0209758_1013710 Ga0209758_10137104 287
37 3300048920 Ga0496117_0129150 Ga0496117_0129150_174_1106 287
38 3300055283 Ga0500661_002499 Ga0500661_002499_914_1798 290
39 3300005459 Ga0068867_100026525 Ga0068867_1000265252 292
40 3300005719 Ga0068861_100008392 Ga0068861_1000083927 292
41 3300005983 Ga0081540_1021891 Ga0081540_10218911 292
42 3300026118 Ga0207675_100033572 Ga0207675_1000335725 292
43 iso_pu_bacteria 2802429605 2805929234 292
44 iso_pu_bacteria 2802429606 2805932509 292
45 iso_pu_bacteria 2838668709 2838673391 292
46 iso_pu_bacteria 2838701080 2838706138 292
47 iso_pu_bacteria 2842146304 2842150519 292
48 iso_pu_bacteria 2842192696 2842192749 292
49 iso_pu_bacteria 2842250916 2842255602 292
50 iso_pu_bacteria 2842317721 2842323868 292
51 iso_pu_bacteria 2842489311 2842492600 292
52 iso_pu_bacteria 2858950400 2858956279 292
53 iso_pu_bacteria 2917736166 2917742765 292
54 iso_pu_bacteria 8005301065 8005301389 292
55 iso_pu_bacteria 8005688590 8005692403 292
56 iso_pu_bacteria 8024501048 8024501741 292
57 3300031995 Ga0307409_100105236 Ga0307409_1001052363 293
58 3300041486 Ga0451807_1369558 Ga0451807_1369558_551_1435 293
59 iso_pu_bacteria 2941531003 2941537389 293
60 3300038443 Ga0395901_0187072 Ga0395901_0187072_1129_2028 294
61 3300047472 Ga0495686_0184387 Ga0495686_0184387_194_1120 294
62 3300049570 Ga0501033_0097200 Ga0501033_0097200_362_1306 294
63 3300049579 Ga0501043_0037940 Ga0501043_0037940_1145_2089 294
64 3300049580 Ga0501046_0112978 Ga0501046_0112978_390_1334 294
65 3300049581 Ga0501047_0381201 Ga0501047_0381201_120_1064 294
66 3300060353 Ga0501082_0121908 Ga0501082_0121908_1170_2114 294
67 iso_pu_bacteria 2513237139 2513873237 294
68 iso_pu_bacteria 2802429603 2805914774 294
69 iso_pu_bacteria 2824696289 2824700319 294
70 iso_pu_bacteria 2838680041 2838681028 294
71 iso_pu_bacteria 2838694306 2838694939 294
72 iso_pu_bacteria 2838707686 2838708315 294
73 iso_pu_bacteria 2842077413 2842080451 294
74 iso_pu_bacteria 2842118031 2842121070 294
75 iso_pu_bacteria 2842237096 2842237727 294
76 iso_pu_bacteria 2842291075 2842294110 294
77 iso_pu_bacteria 2842370503 2842371491 294
78 iso_pu_bacteria 2842377471 2842380507 294
79 iso_pu_bacteria 2842384541 2842387578 294
80 iso_pu_bacteria 2847939898 2847947139 294
81 iso_pu_bacteria 2916000859 2916002531 294
82 iso_pu_bacteria 2921208531 2921208744 294
83 iso_pu_bacteria 2924179722 2924186216 294
84 iso_pu_bacteria 2935894831 2935895461 294
85 iso_pu_bacteria 2936381700 2936386966 294
86 iso_pu_bacteria 2957450854 2957455926 294
87 iso_pu_bacteria 2970095765 2970096694 294
88 iso_pu_bacteria 8016603502 8016608704 294
89 iso_pu_bacteria 8019538911 8019546599 294
90 iso_pu_bacteria 8019678201 8019679898 294
91 iso_pu_bacteria 8057575449 8057580853 294
92 3300005334 Ga0068869_100137818 Ga0068869_1001378182 295
93 3300005347 Ga0070668_100019835 Ga0070668_1000198352 295
94 3300005456 Ga0070678_100045836 Ga0070678_1000458362 295
95 3300005843 Ga0068860_100004221 Ga0068860_1000042212 295
96 3300025942 Ga0207689_10070860 Ga0207689_100708602 295
97 3300025972 Ga0207668_10150973 Ga0207668_101509732 295
98 3300026121 Ga0207683_10045034 Ga0207683_100450342 295
99 3300028380 Ga0268265_10011076 Ga0268265_100110762 295
100 3300028381 Ga0268264_10000062 Ga0268264_100000622 295
101 iso_pu_bacteria 2615840698 2616553165 295
102 iso_pu_bacteria 2842694124 2842694626 295
103 iso_pu_bacteria 2883291878 2883292924 295
104 iso_pu_bacteria 2887375801 2887376891 295
105 iso_pu_bacteria 2894652903 2894657141 295
106 iso_pu_bacteria 2979100975 2979103287 295
107 iso_pu_bacteria 2984509177 2984514035 295
108 iso_pu_bacteria 2984518228 2984523066 295
109 iso_pu_bacteria 2984537506 2984542397 295
110 iso_pu_bacteria 8005682033 8005683438 295
111 3300005434 Ga0070709_10197010 Ga0070709_101970101 296
112 3300005435 Ga0070714_100564012 Ga0070714_1005640121 296
113 3300005437 Ga0070710_10117997 Ga0070710_101179972 296
114 3300005548 Ga0070665_100016020 Ga0070665_1000160209 296
115 3300006175 Ga0070712_100095798 Ga0070712_1000957981 296
116 3300025906 Ga0207699_10213023 Ga0207699_102130231 296
117 3300025915 Ga0207693_10138364 Ga0207693_101383642 296
118 3300028379 Ga0268266_10099972 Ga0268266_100999722 296
119 3300048929 Ga0496126_0363782 Ga0496126_0363782_183_1127 296
120 3300053088 Ga0500644_0053889 Ga0500644_0053889_125_1045 296
121 iso_pu_bacteria 2513237138 2513869657 296
122 iso_pu_bacteria 2513237146 2513923876 296
123 iso_pu_bacteria 2519899620 2520376163 296
124 iso_pu_bacteria 2524023205 2524436318 296
125 iso_pu_bacteria 2524023210 2524469238 296
126 iso_pu_bacteria 2529292951 2530645189 296
127 iso_pu_bacteria 2582581308 2585280898 296
128 iso_pu_bacteria 2585427527 2585530602 296
129 iso_pu_bacteria 2585427530 2585554780 296
130 iso_pu_bacteria 2599185170 2599415916 296
131 iso_pu_bacteria 2615840626 2616310719 296
132 iso_pu_bacteria 2643221626 2644148986 296
133 iso_pu_bacteria 2643221651 2644288076 296
134 iso_pu_bacteria 2643221659 2644336887 296
135 iso_pu_bacteria 2643221734 2644734444 296
136 iso_pu_bacteria 2739367651 2739591546 296
137 iso_pu_bacteria 2765235802 2765465369 296
138 iso_pu_bacteria 2775506902 2776272033 296
139 iso_pu_bacteria 2775506904 2776279447 296
140 iso_pu_bacteria 2818991448 2819613460 296
141 iso_pu_bacteria 2818991453 2819641096 296
142 iso_pu_bacteria 2824653114 2824659768 296
143 iso_pu_bacteria 2838029111 2838034441 296
144 iso_pu_bacteria 2838035591 2838036033 296
145 iso_pu_bacteria 2840764183 2840767811 296
146 iso_pu_bacteria 2842475841 2842481188 296
147 iso_pu_bacteria 2842502639 2842507901 296
148 iso_pu_bacteria 2842509118 2842513593 296
149 iso_pu_bacteria 2852387548 2852392980 296
150 iso_pu_bacteria 2879110137 2879112657 296
151 iso_pu_bacteria 2889016732 2889020903 296
152 iso_pu_bacteria 2893066018 2893066892 296
153 iso_pu_bacteria 2903768456 2903776277 296
154 iso_pu_bacteria 2904690495 2904698311 296
155 iso_pu_bacteria 2904699407 2904700655 296
156 iso_pu_bacteria 2906635258 2906643449 296
157 iso_pu_bacteria 2908756301 2908762912 296
158 iso_pu_bacteria 2917699015 2917704674 296
159 iso_pu_bacteria 2919119836 2919120744 296
160 iso_pu_bacteria 2933016740 2933022158 296
161 iso_pu_bacteria 2935769743 2935773789 296
162 iso_pu_bacteria 2935785616 2935788775 296
163 iso_pu_bacteria 2935793552 2935795599 296
164 iso_pu_bacteria 2965119406 2965125418 296
165 iso_pu_bacteria 2989771324 2989776243 296
166 iso_pu_bacteria 2996893221 2996893288 296
167 iso_pu_bacteria 3005416602 3005422265 296
168 iso_pu_bacteria 3005445848 3005448779 296
169 iso_pu_bacteria 8001845381 8001845493 296
170 iso_pu_bacteria 8005258706 8005262879 296
171 iso_pu_bacteria 8005289223 8005291239 296
172 iso_pu_bacteria 8005314921 8005316348 296
173 iso_pu_bacteria 8005321885 8005324152 296
174 iso_pu_bacteria 8005484373 8005488108 296
175 iso_pu_bacteria 8005542996 8005546954 296
176 iso_pu_bacteria 8005645114 8005651696 296
177 iso_pu_bacteria 8006933436 8006942725 296
178 iso_pu_bacteria 8006973647 8006982448 296
179 iso_pu_bacteria 8016511872 8016516191 296
180 iso_pu_bacteria 8017057580 8017060334 296
181 3300005367 Ga0070667_100180094 Ga0070667_1001800942 297
182 3300005937 Ga0081455_10126149 Ga0081455_101261492 297
183 3300031507 Ga0307509_10019301 Ga0307509_100193014 297
184 3300031730 Ga0307516_10002464 Ga0307516_1000246410 297
185 3300042004 Ga0439445_0036348 Ga0439445_0036348_287_1219 297
186 3300046459 Ga0495629_0001177 Ga0495629_0001177_15620_16543 297
187 3300046476 Ga0495662_0051243 Ga0495662_0051243_894_1817 297
188 3300046506 Ga0495583_0001798 Ga0495583_0001798_19029_19931 297
189 3300046512 Ga0495610_0057426 Ga0495610_0057426_425_1330 297
190 3300046663 Ga0495635_0000978 Ga0495635_0000978_6711_7634 297
191 3300046690 Ga0495624_0045881 Ga0495624_0045881_1567_2490 297
192 3300047317 Ga0495604_0000626 Ga0495604_0000626_17809_18732 297
193 3300047469 Ga0495673_0047864 Ga0495673_0047864_183_1085 297
194 3300048088 Ga0495602_0130747 Ga0495602_0130747_845_1768 297
195 iso_pu_bacteria 2551306090 2551716023 297
196 iso_pu_bacteria 2582581299 2585230453 297
197 iso_pu_bacteria 2593339239 2595452291 297
198 iso_pu_bacteria 2643221634 2644196814 297
199 iso_pu_bacteria 2643221715 2644636863 297
200 iso_pu_bacteria 2902810491 2902811668 297
201 iso_pu_bacteria 2902837492 2902840751 297
202 3300003771 Ga0055526_1000704 Ga0055526_10007045 298
203 3300003794 Ga0055531_10001921 Ga0055531_100019218 298
204 3300005330 Ga0070690_100213159 Ga0070690_1002131591 298
205 3300005335 Ga0070666_10019019 Ga0070666_100190195 298
206 3300005337 Ga0070682_100060393 Ga0070682_1000603933 298
207 3300005343 Ga0070687_100032140 Ga0070687_1000321403 298
208 3300005344 Ga0070661_100247863 Ga0070661_1002478631 298
209 3300005355 Ga0070671_100054363 Ga0070671_1000543633 298
210 3300005364 Ga0070673_100108867 Ga0070673_1001088674 298
211 3300005365 Ga0070688_100059687 Ga0070688_1000596873 298
212 3300005435 Ga0070714_100145955 Ga0070714_1001459553 298
213 3300005436 Ga0070713_100029260 Ga0070713_1000292602 298
214 3300005437 Ga0070710_10038207 Ga0070710_100382071 298
215 3300005466 Ga0070685_10017071 Ga0070685_100170713 298
216 3300005547 Ga0070693_100235464 Ga0070693_1002354642 298
217 3300005564 Ga0070664_100210880 Ga0070664_1002108801 298
218 3300005614 Ga0068856_100422580 Ga0068856_1004225801 298
219 3300005618 Ga0068864_100040828 Ga0068864_1000408283 298
220 3300005842 Ga0068858_100020755 Ga0068858_1000207552 298
221 3300005937 Ga0081455_10119834 Ga0081455_101198342 298
222 3300005983 Ga0081540_1000466 Ga0081540_100046617 298
223 3300005983 Ga0081540_1004934 Ga0081540_10049347 298
224 3300005983 Ga0081540_1006682 Ga0081540_10066824 298
225 3300005983 Ga0081540_1034132 Ga0081540_10341324 298
226 3300005983 Ga0081540_1096278 Ga0081540_10962781 298
227 3300006163 Ga0070715_10026998 Ga0070715_100269983 298
228 3300006175 Ga0070712_100070714 Ga0070712_1000707142 298
229 3300006195 Ga0075366_10073587 Ga0075366_100735872 298
230 3300006358 Ga0068871_100079177 Ga0068871_1000791774 298
231 3300009093 Ga0105240_10237212 Ga0105240_102372121 298
232 3300011119 Ga0105246_10019264 Ga0105246_100192644 298
233 3300014969 Ga0157376_10191779 Ga0157376_101917792 298
234 3300025292 Ga0209676_1001350 Ga0209676_100135015 298
235 3300025295 Ga0209564_1000117 Ga0209564_1000117147 298
236 3300025298 Ga0209050_1009349 Ga0209050_10093492 298
237 3300025299 Ga0209256_1000131 Ga0209256_100013129 298
238 3300025299 Ga0209256_1000622 Ga0209256_100062228 298
239 3300025303 Ga0209051_1028555 Ga0209051_10285552 298
240 3300025304 Ga0209257_1002248 Ga0209257_10022489 298
241 3300025304 Ga0209257_1029512 Ga0209257_10295122 298
242 3300025898 Ga0207692_10239169 Ga0207692_102391691 298
243 3300025899 Ga0207642_10045282 Ga0207642_100452822 298
244 3300025911 Ga0207654_10197679 Ga0207654_101976792 298
245 3300025918 Ga0207662_10069500 Ga0207662_100695002 298
246 3300025925 Ga0207650_10074550 Ga0207650_100745503 298
247 3300025928 Ga0207700_10005756 Ga0207700_100057565 298
248 3300025929 Ga0207664_10059460 Ga0207664_100594603 298
249 3300025931 Ga0207644_10461318 Ga0207644_104613181 298
250 3300025939 Ga0207665_10008176 Ga0207665_100081765 298
251 3300025941 Ga0207711_10349814 Ga0207711_103498142 298
252 3300025960 Ga0207651_10155936 Ga0207651_101559362 298
253 3300026035 Ga0207703_10020070 Ga0207703_100200705 298
254 3300026121 Ga0207683_10049809 Ga0207683_100498094 298
255 3300028379 Ga0268266_10022307 Ga0268266_100223075 298
256 3300028381 Ga0268264_10341015 Ga0268264_103410152 298
257 3300028666 Ga0265336_10000816 Ga0265336_1000081615 298
258 3300028786 Ga0307517_10092154 Ga0307517_100921541 298
259 3300028800 Ga0265338_10000572 Ga0265338_100005727 298
260 3300030521 Ga0307511_10030724 Ga0307511_100307242 298
261 3300031507 Ga0307509_10046512 Ga0307509_100465122 298
262 3300031616 Ga0307508_10085997 Ga0307508_100859973 298
263 3300031730 Ga0307516_10260437 Ga0307516_102604372 298
264 3300033180 Ga0307510_10122315 Ga0307510_101223153 298
265 3300033180 Ga0307510_10256375 Ga0307510_102563751 298
266 3300035170 Ga0373943_0111585 Ga0373943_0111585_462_1373 298
267 3300035207 Ga0373942_0027848 Ga0373942_0027848_314_1219 298
268 3300035695 Ga0373927_0003977 Ga0373927_0003977_9529_10440 298
269 3300037068 Ga0373925_0006499 Ga0373925_0006499_6739_7650 298
270 3300044735 Ga0466968_0040719 Ga0466968_0040719_999_1916 298
271 3300046455 Ga0495603_0008522 Ga0495603_0008522_1707_2636 298
272 3300046557 Ga0495622_0025843 Ga0495622_0025843_1648_2559 298
273 3300048904 Ga0496101_0001838 Ga0496101_0001838_8090_9025 298
274 3300048906 Ga0496103_0021882 Ga0496103_0021882_2131_3066 298
275 3300048907 Ga0496104_0018207 Ga0496104_0018207_1916_2851 298
276 3300048908 Ga0496105_0041364 Ga0496105_0041364_722_1657 298
277 3300048911 Ga0496108_0006949 Ga0496108_0006949_6083_7018 298
278 3300048912 Ga0496109_0069613 Ga0496109_0069613_2143_3078 298
279 3300048915 Ga0496112_0081132 Ga0496112_0081132_2143_3078 298
280 3300048917 Ga0496114_0026876 Ga0496114_0026876_3335_4270 298
281 3300048929 Ga0496126_0040859 Ga0496126_0040859_651_1580 298
282 3300050493 nmdc:mga0k408_121597_c1 nmdc:mga0k408_121597_c1_395_1306 298
283 3300050496 nmdc:mga07m45_126241_c1 nmdc:mga07m45_126241_c1_504_1415 298
284 3300053094 Ga0500566_0000074 Ga0500566_0000074_8716_9627 298
285 3300053095 Ga0500640_000535 Ga0500640_000535_7021_7932 298
286 3300053111 Ga0500572_000414 Ga0500572_000414_8406_9317 298
287 3300053178 Ga0500637_0022523 Ga0500637_0022523_2322_3233 298
288 iso_pu_bacteria 2582581294 2585203225 298
289 iso_pu_bacteria 2599185352 2600196723 298
290 iso_pu_bacteria 2643221610 2644064635 298
291 iso_pu_bacteria 2643221664 2644355276 298
292 iso_pu_bacteria 2643221668 2644377142 298
293 iso_pu_bacteria 2643221675 2644419484 298
294 iso_pu_bacteria 2643221680 2644452841 298
295 iso_pu_bacteria 2643221723 2644672030 298
296 iso_pu_bacteria 2643221726 2644691832 298
297 iso_pu_bacteria 2834641062 2834643351 298
298 iso_pu_bacteria 2842711865 2842715697 298
299 iso_pu_bacteria 2919462493 2919467343 298
300 iso_pu_bacteria 2941479691 2941483749 298
301 iso_pu_bacteria 2945945610 2945948035 298
302 iso_pu_bacteria 8003400568 8003402603 298
303 3300003214 JGI25165J46597_1000571 JGI25165J46597_100057112 299
304 3300003761 Ga0055535_1001086 Ga0055535_10010866 299
305 3300003762 Ga0055542_1001080 Ga0055542_100108011 299
306 3300003763 Ga0055529_1000566 Ga0055529_100056611 299
307 3300003856 Ga0058692_1004221 Ga0058692_10042212 299
308 3300005435 Ga0070714_100533503 Ga0070714_1005335031 299
309 3300005437 Ga0070710_10029235 Ga0070710_100292352 299
310 3300005440 Ga0070705_100023565 Ga0070705_1000235652 299
311 3300005444 Ga0070694_100144956 Ga0070694_1001449561 299
312 3300005467 Ga0070706_100399483 Ga0070706_1003994831 299
313 3300005468 Ga0070707_100215857 Ga0070707_1002158571 299
314 3300005535 Ga0070684_100365265 Ga0070684_1003652652 299
315 3300005539 Ga0068853_100015579 Ga0068853_1000155796 299
316 3300005547 Ga0070693_100196711 Ga0070693_1001967111 299
317 3300005548 Ga0070665_100003591 Ga0070665_10000359111 299
318 3300005578 Ga0068854_100207482 Ga0068854_1002074822 299
319 3300005614 Ga0068856_100035527 Ga0068856_1000355274 299
320 3300005618 Ga0068864_100094523 Ga0068864_1000945232 299
321 3300005841 Ga0068863_100009504 Ga0068863_1000095046 299
322 3300005842 Ga0068858_100033639 Ga0068858_1000336396 299
323 3300005843 Ga0068860_100016692 Ga0068860_1000166928 299
324 3300005981 Ga0081538_10021013 Ga0081538_100210133 299
325 3300006186 Ga0075369_10152887 Ga0075369_101528871 299
326 3300006358 Ga0068871_100067601 Ga0068871_1000676013 299
327 3300006358 Ga0068871_100449309 Ga0068871_1004493091 299
328 3300006881 Ga0068865_100034127 Ga0068865_1000341274 299
329 3300007265 Ga0099794_10078861 Ga0099794_100788611 299
330 3300009098 Ga0105245_10020119 Ga0105245_100201195 299
331 3300009174 Ga0105241_10110362 Ga0105241_101103622 299
332 3300009177 Ga0105248_10032169 Ga0105248_100321695 299
333 3300009545 Ga0105237_10038704 Ga0105237_100387044 299
334 3300010159 Ga0099796_10014960 Ga0099796_100149602 299
335 3300010375 Ga0105239_10188875 Ga0105239_101888752 299
336 3300010375 Ga0105239_10327427 Ga0105239_103274272 299
337 3300013308 Ga0157375_10015743 Ga0157375_100157434 299
338 3300014325 Ga0163163_10022921 Ga0163163_100229214 299
339 3300014968 Ga0157379_10048312 Ga0157379_100483122 299
340 3300025228 Ga0209672_100129 Ga0209672_1001297 299
341 3300025242 Ga0209258_100088 Ga0209258_10008855 299
342 3300025246 Ga0209646_1000916 Ga0209646_10009166 299
343 3300025250 Ga0209026_1006750 Ga0209026_10067502 299
344 3300025254 Ga0209148_1000024 Ga0209148_100002495 299
345 3300025256 Ga0209759_1001537 Ga0209759_10015377 299
346 3300025272 Ga0209455_1000025 Ga0209455_100002595 299
347 3300025294 Ga0209025_1007680 Ga0209025_10076801 299
348 3300025898 Ga0207692_10250894 Ga0207692_102508941 299
349 3300025910 Ga0207684_10294367 Ga0207684_102943671 299
350 3300025915 Ga0207693_10081544 Ga0207693_100815442 299
351 3300025915 Ga0207693_10108286 Ga0207693_101082863 299
352 3300025927 Ga0207687_10039904 Ga0207687_100399041 299
353 3300025929 Ga0207664_10449485 Ga0207664_104494851 299
354 3300025941 Ga0207711_10049244 Ga0207711_100492442 299
355 3300025942 Ga0207689_10087113 Ga0207689_100871132 299
356 3300025981 Ga0207640_10084049 Ga0207640_100840492 299
357 3300026041 Ga0207639_10025696 Ga0207639_100256962 299
358 3300026067 Ga0207678_10089522 Ga0207678_100895222 299
359 3300026078 Ga0207702_10085572 Ga0207702_100855723 299
360 3300026088 Ga0207641_10084948 Ga0207641_100849482 299
361 3300027312 Ga0209371_1001722 Ga0209371_10017222 299
362 3300027312 Ga0209371_1003088 Ga0209371_10030884 299
363 3300028379 Ga0268266_10066111 Ga0268266_100661112 299
364 3300030500 Ga0268256_1000785 Ga0268256_100078518 299
365 3300030500 Ga0268256_1003493 Ga0268256_10034936 299
366 3300035692 Ga0373935_0171166 Ga0373935_0171166_423_1337 299
367 3300044684 Ga0466966_0034962 Ga0466966_0034962_1256_2170 299
368 3300046507 Ga0495606_0000161 Ga0495606_0000161_113515_114480 299
369 3300046512 Ga0495610_0051177 Ga0495610_0051177_346_1257 299
370 3300046543 Ga0495645_0046993 Ga0495645_0046993_516_1427 299
371 3300047319 Ga0495674_0183477 Ga0495674_0183477_464_1378 299
372 3300048905 Ga0496102_0060614 Ga0496102_0060614_352_1332 299
373 3300048906 Ga0496103_0016546 Ga0496103_0016546_3049_4029 299
374 3300048909 Ga0496106_0051678 Ga0496106_0051678_1756_2688 299
375 3300048910 Ga0496107_0061952 Ga0496107_0061952_1573_2553 299
376 3300048913 Ga0496110_0234946 Ga0496110_0234946_361_1341 299
377 3300048915 Ga0496112_0371258 Ga0496112_0371258_138_1118 299
378 3300050512 nmdc:mga0n895_112098_c1 nmdc:mga0n895_112098_c1_150_1130 299
379 3300050515 nmdc:mga0a205_45969_c2 nmdc:mga0a205_45969_c2_1041_2021 299
380 iso_pu_bacteria 2690316117 2692318060 299
381 iso_pu_bacteria 2747842428 2747948559 299
382 iso_pu_bacteria 2791355199 2793077763 299
383 iso_pu_bacteria 2847417321 2847423432 299
384 iso_pu_bacteria 2889033259 2889039589 299
385 iso_pu_bacteria 2919134579 2919135963 299
386 iso_pu_bacteria 2961064222 2961067394 299
387 iso_pu_bacteria 2989771324 2989776234 299
388 3300002737 JGI25162J39368_1000125 JGI25162J39368_100012563 300
389 3300002773 JGI25152J39213_1000768 JGI25152J39213_100076815 300
390 3300002773 JGI25152J39213_1004660 JGI25152J39213_10046604 300
391 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001925 300
392 3300003187 JGI25151J46595_10000005 JGI25151J46595_10000005276 300
393 3300003214 JGI25165J46597_1000495 JGI25165J46597_100049516 300
394 3300003214 JGI25165J46597_1004592 JGI25165J46597_10045923 300
395 3300003215 JGI25153J46596_10000040 JGI25153J46596_1000004043 300
396 3300003215 JGI25153J46596_10000532 JGI25153J46596_1000053215 300
397 3300003215 JGI25153J46596_10009846 JGI25153J46596_100098461 300
398 3300003215 JGI25153J46596_10015269 JGI25153J46596_100152692 300
399 3300003322 rootL2_10022068 rootL2_1002206818 300
400 3300003374 JGI25161J50226_1000150 JGI25161J50226_100015039 300
401 3300003771 Ga0055526_1006243 Ga0055526_10062436 300
402 3300003771 Ga0055526_1007064 Ga0055526_10070643 300
403 3300003771 Ga0055526_1009227 Ga0055526_10092274 300
404 3300003775 Ga0055524_1004394 Ga0055524_10043943 300
405 3300003790 Ga0055528_1000106 Ga0055528_100010666 300
406 3300003790 Ga0055528_1008582 Ga0055528_10085825 300
407 3300003790 Ga0055528_1009430 Ga0055528_10094302 300
408 3300003792 Ga0055540_1006682 Ga0055540_10066823 300
409 3300004625 Ga0055543_1000074 Ga0055543_100007446 300
410 3300005328 Ga0070676_10072247 Ga0070676_100722472 300
411 3300005329 Ga0070683_100026394 Ga0070683_1000263942 300
412 3300005354 Ga0070675_100375499 Ga0070675_1003754992 300
413 3300005434 Ga0070709_10000609 Ga0070709_1000060922 300
414 3300005435 Ga0070714_100010925 Ga0070714_1000109254 300
415 3300005436 Ga0070713_100015089 Ga0070713_1000150893 300
416 3300005437 Ga0070710_10000144 Ga0070710_1000014411 300
417 3300005455 Ga0070663_100181343 Ga0070663_1001813431 300
418 3300005456 Ga0070678_100342775 Ga0070678_1003427751 300
419 3300005457 Ga0070662_100381323 Ga0070662_1003813231 300
420 3300005458 Ga0070681_10032776 Ga0070681_100327762 300
421 3300005530 Ga0070679_100269901 Ga0070679_1002699012 300
422 3300005548 Ga0070665_100019552 Ga0070665_1000195522 300
423 3300005548 Ga0070665_100054826 Ga0070665_1000548265 300
424 3300005548 Ga0070665_100087733 Ga0070665_1000877333 300
425 3300005548 Ga0070665_100337121 Ga0070665_1003371212 300
426 3300005564 Ga0070664_100360118 Ga0070664_1003601181 300
427 3300005578 Ga0068854_100020459 Ga0068854_1000204594 300
428 3300005614 Ga0068856_100739364 Ga0068856_1007393641 300
429 3300005616 Ga0068852_100107981 Ga0068852_1001079811 300
430 3300005842 Ga0068858_100026065 Ga0068858_1000260654 300
431 3300005843 Ga0068860_100273722 Ga0068860_1002737221 300
432 3300005937 Ga0081455_10002274 Ga0081455_1000227418 300
433 3300005983 Ga0081540_1014129 Ga0081540_10141293 300
434 3300005985 Ga0081539_10030585 Ga0081539_100305852 300
435 3300006038 Ga0075365_10071338 Ga0075365_100713384 300
436 3300006038 Ga0075365_10188639 Ga0075365_101886391 300
437 3300006042 Ga0075368_10028302 Ga0075368_100283023 300
438 3300006048 Ga0075363_100015464 Ga0075363_1000154644 300
439 3300006048 Ga0075363_100044594 Ga0075363_1000445942 300
440 3300006163 Ga0070715_10039642 Ga0070715_100396422 300
441 3300006173 Ga0070716_100025095 Ga0070716_1000250952 300
442 3300006175 Ga0070712_100002030 Ga0070712_10000203011 300
443 3300006175 Ga0070712_100004935 Ga0070712_1000049354 300
444 3300006175 Ga0070712_100028568 Ga0070712_1000285684 300
445 3300006177 Ga0075362_10024312 Ga0075362_100243122 300
446 3300006186 Ga0075369_10000419 Ga0075369_100004193 300
447 3300006353 Ga0075370_10122257 Ga0075370_101222572 300
448 3300006847 Ga0075431_100004254 Ga0075431_1000042543 300
449 3300006941 Ga0099825_1044464 Ga0099825_10444641 300
450 3300006943 Ga0099822_1000686 Ga0099822_10006867 300
451 3300006944 Ga0099823_1043708 Ga0099823_10437082 300
452 3300006946 Ga0079104_1008261 Ga0079104_10082614 300
453 3300007788 Ga0099795_10022137 Ga0099795_100221371 300
454 3300009093 Ga0105240_10000201 Ga0105240_1000020142 300
455 3300009148 Ga0105243_10152113 Ga0105243_101521133 300
456 3300009545 Ga0105237_10003330 Ga0105237_1000333011 300
457 3300009553 Ga0105249_10478291 Ga0105249_104782911 300
458 3300010375 Ga0105239_10319437 Ga0105239_103194372 300
459 3300010375 Ga0105239_10495397 Ga0105239_104953971 300
460 3300013104 Ga0157370_10001402 Ga0157370_100014028 300
461 3300013249 Ga0171463_1005 Ga0171463_1005115 300
462 3300013308 Ga0157375_10067698 Ga0157375_100676983 300
463 3300014326 Ga0157380_10447846 Ga0157380_104478461 300
464 3300014968 Ga0157379_10053775 Ga0157379_100537752 300
465 3300014968 Ga0157379_10148352 Ga0157379_101483521 300
466 3300015262 Ga0182007_10012038 Ga0182007_100120384 300
467 3300015265 Ga0182005_1025912 Ga0182005_10259121 300
468 3300015690 Ga0183363_1022 Ga0183363_102221 300
469 3300021320 Ga0214544_1000013 Ga0214544_100001370 300
470 3300021321 Ga0214542_1000013 Ga0214542_1000013165 300
471 3300021324 Ga0214545_1000012 Ga0214545_100001270 300
472 3300021324 Ga0214545_1032757 Ga0214545_10327573 300
473 3300025208 Ga0209436_100011 Ga0209436_100011115 300
474 3300025233 Ga0209437_100022 Ga0209437_100022566 300
475 3300025245 Ga0207425_1000002 Ga0207425_1000002257 300
476 3300025245 Ga0207425_1001067 Ga0207425_10010675 300
477 3300025245 Ga0207425_1008952 Ga0207425_10089522 300
478 3300025253 Ga0209677_100174 Ga0209677_10017446 300
479 3300025258 Ga0209129_1000002 Ga0209129_1000002257 300
480 3300025258 Ga0209129_1000615 Ga0209129_100061514 300
481 3300025258 Ga0209129_1001256 Ga0209129_10012568 300
482 3300025261 Ga0209233_1000031 Ga0209233_1000031566 300
483 3300025261 Ga0209233_1000217 Ga0209233_10002174 300
484 3300025273 Ga0209673_1000139 Ga0209673_1000139105 300
485 3300025273 Ga0209673_1003445 Ga0209673_10034455 300
486 3300025273 Ga0209673_1004658 Ga0209673_10046585 300
487 3300025284 Ga0209130_1000066 Ga0209130_1000066214 300
488 3300025294 Ga0209025_1000004 Ga0209025_1000004932 300
489 3300025294 Ga0209025_1016628 Ga0209025_10166284 300
490 3300025295 Ga0209564_1000225 Ga0209564_100022584 300
491 3300025295 Ga0209564_1000331 Ga0209564_100033111 300
492 3300025295 Ga0209564_1019349 Ga0209564_10193492 300
493 3300025297 Ga0209758_1000006 Ga0209758_1000006932 300
494 3300025297 Ga0209758_1001171 Ga0209758_100117119 300
495 3300025297 Ga0209758_1005160 Ga0209758_100516011 300
496 3300025297 Ga0209758_1032067 Ga0209758_10320671 300
497 3300025299 Ga0209256_1000299 Ga0209256_10002996 300
498 3300025299 Ga0209256_1008343 Ga0209256_10083431 300
499 3300025302 Ga0207426_1000008 Ga0207426_1000008669 300
500 3300025303 Ga0209051_1000643 Ga0209051_100064325 300
501 3300025303 Ga0209051_1002199 Ga0209051_10021994 300
502 3300025303 Ga0209051_1050454 Ga0209051_10504542 300
503 3300025898 Ga0207692_10000215 Ga0207692_1000021510 300
504 3300025898 Ga0207692_10062403 Ga0207692_100624032 300
505 3300025899 Ga0207642_10102604 Ga0207642_101026041 300
506 3300025906 Ga0207699_10001468 Ga0207699_100014685 300
507 3300025912 Ga0207707_10017493 Ga0207707_100174932 300
508 3300025913 Ga0207695_10000118 Ga0207695_10000118160 300
509 3300025914 Ga0207671_10000175 Ga0207671_1000017541 300
510 3300025915 Ga0207693_10009787 Ga0207693_100097876 300
511 3300025915 Ga0207693_10059070 Ga0207693_100590702 300
512 3300025921 Ga0207652_10226328 Ga0207652_102263282 300
513 3300025926 Ga0207659_10177955 Ga0207659_101779552 300
514 3300025927 Ga0207687_10096057 Ga0207687_100960572 300
515 3300025929 Ga0207664_10031599 Ga0207664_100315994 300
516 3300025931 Ga0207644_10246474 Ga0207644_102464742 300
517 3300025932 Ga0207690_10137278 Ga0207690_101372784 300
518 3300025935 Ga0207709_10064340 Ga0207709_100643402 300
519 3300025937 Ga0207669_10100007 Ga0207669_101000071 300
520 3300025937 Ga0207669_10373675 Ga0207669_103736751 300
521 3300025939 Ga0207665_10007952 Ga0207665_100079522 300
522 3300025940 Ga0207691_10150971 Ga0207691_101509712 300
523 3300025942 Ga0207689_10058238 Ga0207689_100582381 300
524 3300025944 Ga0207661_10018471 Ga0207661_100184715 300
525 3300025945 Ga0207679_10381462 Ga0207679_103814621 300
526 3300025961 Ga0207712_10179060 Ga0207712_101790601 300
527 3300025972 Ga0207668_10230983 Ga0207668_102309831 300
528 3300025981 Ga0207640_10014501 Ga0207640_100145012 300
529 3300026035 Ga0207703_10033168 Ga0207703_100331682 300
530 3300026067 Ga0207678_10162826 Ga0207678_101628262 300
531 3300026118 Ga0207675_100089926 Ga0207675_1000899262 300
532 3300026118 Ga0207675_100234025 Ga0207675_1002340252 300
533 3300026142 Ga0207698_10007770 Ga0207698_100077704 300
534 3300026142 Ga0207698_10210856 Ga0207698_102108561 300
535 3300027111 Ga0209281_1001051 Ga0209281_10010515 300
536 3300027296 Ga0209389_1000163 Ga0209389_100016324 300
537 3300027357 Ga0209589_1000002 Ga0209589_1000002647 300
538 3300027361 Ga0209489_100002 Ga0209489_100002647 300
539 3300027361 Ga0209489_101100 Ga0209489_10110024 300
540 3300027363 Ga0209700_100002 Ga0209700_100002647 300
541 3300027363 Ga0209700_100014 Ga0209700_100014237 300
542 3300027671 Ga0209588_1004478 Ga0209588_10044786 300
543 3300027907 Ga0207428_10002329 Ga0207428_1000232910 300
544 3300028379 Ga0268266_10072134 Ga0268266_100721344 300
545 3300028379 Ga0268266_10072159 Ga0268266_100721593 300
546 3300028379 Ga0268266_10074416 Ga0268266_100744166 300
547 3300028380 Ga0268265_10250613 Ga0268265_102506131 300
548 3300028573 Ga0265334_10049386 Ga0265334_100493861 300
549 3300028794 Ga0307515_10138045 Ga0307515_101380453 300
550 3300031250 Ga0265331_10075526 Ga0265331_100755261 300
551 3300031456 Ga0307513_10041634 Ga0307513_100416344 300
552 3300031456 Ga0307513_10069169 Ga0307513_100691694 300
553 3300031548 Ga0307408_100003016 Ga0307408_10000301611 300
554 3300031711 Ga0265314_10002700 Ga0265314_100027003 300
555 3300031712 Ga0265342_10021476 Ga0265342_100214766 300
556 3300031852 Ga0307410_10012481 Ga0307410_100124812 300
557 3300031901 Ga0307406_10000771 Ga0307406_100007718 300
558 3300031901 Ga0307406_10122943 Ga0307406_101229431 300
559 3300031911 Ga0307412_10025137 Ga0307412_100251372 300
560 3300031995 Ga0307409_100134590 Ga0307409_1001345904 300
561 3300032002 Ga0307416_100108681 Ga0307416_1001086812 300
562 3300032002 Ga0307416_100394017 Ga0307416_1003940172 300
563 3300032004 Ga0307414_10000018 Ga0307414_1000001862 300
564 3300032126 Ga0307415_100255748 Ga0307415_1002557482 300
565 3300035111 Ga0373923_0087281 Ga0373923_0087281_146_1081 300
566 3300035691 Ga0373931_0071495 Ga0373931_0071495_24_1154 300
567 3300035691 Ga0373931_0262479 Ga0373931_0262479_22_945 300
568 3300035695 Ga0373927_0071556 Ga0373927_0071556_189_1124 300
569 3300035724 Ga0373933_0051988 Ga0373933_0051988_383_1318 300
570 3300036401 Ga0373937_0131839 Ga0373937_0131839_1278_2213 300
571 3300037068 Ga0373925_0043778 Ga0373925_0043778_1429_2364 300
572 3300041503 Ga0451847_0770903 Ga0451847_0770903_469_1404 300
573 3300041507 Ga0451851_0373797 Ga0451851_0373797_469_1404 300
574 3300044765 Ga0466970_0016669 Ga0466970_0016669_2051_3124 300
575 3300046455 Ga0495603_0095992 Ga0495603_0095992_752_1684 300
576 3300046460 Ga0495638_0024226 Ga0495638_0024226_1788_2735 300
577 3300046460 Ga0495638_0192148 Ga0495638_0192148_154_1098 300
578 3300046474 Ga0495605_0134187 Ga0495605_0134187_124_1077 300
579 3300046501 Ga0495607_0012359 Ga0495607_0012359_2468_3547 300
580 3300046512 Ga0495610_0015862 Ga0495610_0015862_3428_4345 300
581 3300046512 Ga0495610_0021278 Ga0495610_0021278_1465_2418 300
582 3300046512 Ga0495610_0071632 Ga0495610_0071632_257_1174 300
583 3300046518 Ga0495631_0077962 Ga0495631_0077962_35_988 300
584 3300046522 Ga0495643_0013947 Ga0495643_0013947_2199_3152 300
585 3300046522 Ga0495643_0017843 Ga0495643_0017843_3197_4114 300
586 3300046522 Ga0495643_0025587 Ga0495643_0025587_77_994 300
587 3300046616 Ga0495668_0177931 Ga0495668_0177931_194_1147 300
588 3300046660 Ga0495625_0018451 Ga0495625_0018451_2888_3841 300
589 3300046660 Ga0495625_0149748 Ga0495625_0149748_114_1067 300
590 3300046674 Ga0495588_0003105 Ga0495588_0003105_5673_6665 300
591 3300046684 Ga0495669_0015704 Ga0495669_0015704_1814_2806 300
592 3300046794 Ga0495589_0171585 Ga0495589_0171585_18_953 300
593 3300046810 Ga0495660_0090367 Ga0495660_0090367_15_932 300
594 3300047443 Ga0495687_000521 Ga0495687_000521_23223_24296 300
595 3300047443 Ga0495687_002186 Ga0495687_002186_8030_8983 300
596 3300047471 Ga0495684_0004330 Ga0495684_0004330_3903_4838 300
597 3300047472 Ga0495686_0077646 Ga0495686_0077646_745_1683 300
598 3300048088 Ga0495602_0018555 Ga0495602_0018555_69_980 300
599 3300048903 Ga0496100_0002867 Ga0496100_0002867_3371_4288 300
600 3300048905 Ga0496102_0297745 Ga0496102_0297745_91_1008 300
601 3300048906 Ga0496103_0006117 Ga0496103_0006117_614_1531 300
602 3300048907 Ga0496104_0021062 Ga0496104_0021062_1994_2911 300
603 3300048909 Ga0496106_0000093 Ga0496106_0000093_10292_11209 300
604 3300048909 Ga0496106_0307303 Ga0496106_0307303_201_1181 300
605 3300048912 Ga0496109_0490000 Ga0496109_0490000_108_1049 300
606 3300048913 Ga0496110_0100973 Ga0496110_0100973_303_1253 300
607 3300048915 Ga0496112_0132350 Ga0496112_0132350_1282_2223 300
608 3300048918 Ga0496115_0004235 Ga0496115_0004235_1344_2285 300
609 3300048919 Ga0496116_0069069 Ga0496116_0069069_513_1430 300
610 3300048920 Ga0496117_0004844 Ga0496117_0004844_5508_6425 300
611 3300048921 Ga0496118_0005397 Ga0496118_0005397_5508_6425 300
612 3300048921 Ga0496118_0047620 Ga0496118_0047620_2103_3020 300
613 3300048922 Ga0496119_0000390 Ga0496119_0000390_25874_26791 300
614 3300048922 Ga0496119_0029847 Ga0496119_0029847_2067_2984 300
615 3300048922 Ga0496119_0032878 Ga0496119_0032878_2205_3122 300
616 3300048922 Ga0496119_0085568 Ga0496119_0085568_423_1340 300
617 3300048923 Ga0496120_0026293 Ga0496120_0026293_822_1739 300
618 3300048924 Ga0496121_0002660 Ga0496121_0002660_24763_25680 300
619 3300048924 Ga0496121_0026649 Ga0496121_0026649_2870_3787 300
620 3300048924 Ga0496121_0052853 Ga0496121_0052853_337_1254 300
621 3300048924 Ga0496121_0060528 Ga0496121_0060528_1314_2231 300
622 3300048925 Ga0496122_0037604 Ga0496122_0037604_2144_3061 300
623 3300048925 Ga0496122_0213571 Ga0496122_0213571_155_1072 300
624 3300048926 Ga0496123_0021688 Ga0496123_0021688_1301_2218 300
625 3300048927 Ga0496124_0041508 Ga0496124_0041508_2568_3485 300
626 3300048927 Ga0496124_0281151 Ga0496124_0281151_76_993 300
627 3300048929 Ga0496126_0286912 Ga0496126_0286912_293_1249 300
628 3300049460 Ga0495682_0097034 Ga0495682_0097034_44_997 300
629 3300049568 Ga0501031_0147246 Ga0501031_0147246_591_1508 300
630 3300049569 Ga0501032_0022921 Ga0501032_0022921_2408_3325 300
631 3300049570 Ga0501033_0033244 Ga0501033_0033244_2348_3265 300
632 3300049571 Ga0501034_0003451 Ga0501034_0003451_8442_9359 300
633 3300049571 Ga0501034_0051312 Ga0501034_0051312_835_1752 300
634 3300049571 Ga0501034_0154722 Ga0501034_0154722_424_1395 300
635 3300049571 Ga0501034_0188927 Ga0501034_0188927_346_1263 300
636 3300049571 Ga0501034_0535031 Ga0501034_0535031_84_995 300
637 3300049572 Ga0501036_0090569 Ga0501036_0090569_832_1749 300
638 3300049573 Ga0501037_0017509 Ga0501037_0017509_1156_2073 300
639 3300049574 Ga0501038_0082564 Ga0501038_0082564_1572_2489 300
640 3300049575 Ga0501039_0027289 Ga0501039_0027289_1616_2533 300
641 3300049575 Ga0501039_0191077 Ga0501039_0191077_70_984 300
642 3300049578 Ga0501042_0013985 Ga0501042_0013985_107_1024 300
643 3300049579 Ga0501043_0168413 Ga0501043_0168413_548_1468 300
644 3300049581 Ga0501047_0054806 Ga0501047_0054806_2208_3179 300
645 3300049582 Ga0501048_0002535 Ga0501048_0002535_12867_13784 300
646 3300049582 Ga0501048_0039881 Ga0501048_0039881_1731_2648 300
647 3300049585 Ga0501069_0151525 Ga0501069_0151525_159_1076 300
648 3300049586 Ga0501070_0063375 Ga0501070_0063375_1881_2798 300
649 3300049589 Ga0501073_0017180 Ga0501073_0017180_563_1480 300
650 3300049590 Ga0501074_0040694 Ga0501074_0040694_1780_2751 300
651 3300049822 Ga0501035_0377287 Ga0501035_0377287_86_1006 300
652 3300049823 Ga0501044_0153059 Ga0501044_0153059_1156_2073 300
653 3300049824 Ga0501045_0009657 Ga0501045_0009657_216_1133 300
654 3300050510 nmdc:mga06r32_68226_c1 nmdc:mga06r32_68226_c1_1309_2223 300
655 3300050511 nmdc:mga08y16_1184_c1 nmdc:mga08y16_1184_c1_15522_16436 300
656 3300053087 Ga0500643_059687 Ga0500643_059687_72_1040 300
657 3300053109 Ga0500569_000794 Ga0500569_000794_3997_4950 300
658 3300053109 Ga0500569_012100 Ga0500569_012100_466_1419 300
659 3300053125 Ga0500618_000720 Ga0500618_000720_4165_5082 300
660 3300053125 Ga0500618_040919 Ga0500618_040919_72_989 300
661 3300053134 Ga0500658_0000516 Ga0500658_0000516_4549_5502 300
662 3300053134 Ga0500658_0152864 Ga0500658_0152864_17_934 300
663 3300053136 Ga0500559_0000683 Ga0500559_0000683_13532_14476 300
664 3300053139 Ga0500568_0000740 Ga0500568_0000740_3914_4831 300
665 3300053153 Ga0500616_0000731 Ga0500616_0000731_26289_27242 300
666 3300053153 Ga0500616_0016056 Ga0500616_0016056_3124_4077 300
667 3300053156 Ga0500622_0000170 Ga0500622_0000170_48908_49825 300
668 3300053160 Ga0500633_0004866 Ga0500633_0004866_1648_2565 300
669 3300060353 Ga0501082_0014164 Ga0501082_0014164_3088_4005 300
670 iso_pu_bacteria 2509276019 2509380292 300
671 iso_pu_bacteria 2509276033 2509442533 300
672 iso_pu_bacteria 2509276033 2509446221 300
673 iso_pu_bacteria 2510065057 2510302723 300
674 iso_pu_bacteria 2510461076 2510894308 300
675 iso_pu_bacteria 2510461076 2510899333 300
676 iso_pu_bacteria 2510917028 2511181789 300
677 iso_pu_bacteria 2511231052 2511497775 300
678 iso_pu_bacteria 2513237084 2513569987 300
679 iso_pu_bacteria 2513237084 2513571651 300
680 iso_pu_bacteria 2513237085 2513578687 300
681 iso_pu_bacteria 2513237086 2513584568 300
682 iso_pu_bacteria 2513237091 2513616418 300
683 iso_pu_bacteria 2513237093 2513630130 300
684 iso_pu_bacteria 2513237098 2513671705 300
685 iso_pu_bacteria 2513237098 2513680213 300
686 iso_pu_bacteria 2513237140 2513883885 300
687 iso_pu_bacteria 2513237143 2513902011 300
688 iso_pu_bacteria 2513237146 2513923868 300
689 iso_pu_bacteria 2513237161 2514015491 300
690 iso_pu_bacteria 2513237162 2514019424 300
691 iso_pu_bacteria 2515075009 2515111880 300
692 iso_pu_bacteria 2515075009 2515114428 300
693 iso_pu_bacteria 2515154114 2515643162 300
694 iso_pu_bacteria 2515154116 2515656271 300
695 iso_pu_bacteria 2516653046 2516896575 300
696 iso_pu_bacteria 2516653085 2517078343 300
697 iso_pu_bacteria 2517287029 2517406427 300
698 iso_pu_bacteria 2517287029 2517408513 300
699 iso_pu_bacteria 2517572143 2517894613 300
700 iso_pu_bacteria 2524023209 2524461557 300
701 iso_pu_bacteria 2551306084 2551681432 300
702 iso_pu_bacteria 2551306085 2551684669 300
703 iso_pu_bacteria 2551306089 2551708251 300
704 iso_pu_bacteria 2582581294 2585205466 300
705 iso_pu_bacteria 2582581298 2585226627 300
706 iso_pu_bacteria 2582581866 2585394451 300
707 iso_pu_bacteria 2582581867 2585404530 300
708 iso_pu_bacteria 2582581867 2585404950 300
709 iso_pu_bacteria 2585427526 2585526021 300
710 iso_pu_bacteria 2585427529 2585549701 300
711 iso_pu_bacteria 2585427590 2585824226 300
712 iso_pu_bacteria 2585427633 2585992651 300
713 iso_pu_bacteria 2599185170 2599415906 300
714 iso_pu_bacteria 2600255279 2601611478 300
715 iso_pu_bacteria 2600255308 2601748101 300
716 iso_pu_bacteria 2617270735 2617350721 300
717 iso_pu_bacteria 2617270741 2617378882 300
718 iso_pu_bacteria 2643221618 2644109680 300
719 iso_pu_bacteria 2643221655 2644312558 300
720 iso_pu_bacteria 2643221698 2644540873 300
721 iso_pu_bacteria 2643221712 2644618289 300
722 iso_pu_bacteria 2718217927 2719385467 300
723 iso_pu_bacteria 2718218423 2721399215 300
724 iso_pu_bacteria 2721755755 2723845405 300
725 iso_pu_bacteria 2721755809 2724038028 300
726 iso_pu_bacteria 2724679232 2725949807 300
727 iso_pu_bacteria 2791355091 2792624916 300
728 iso_pu_bacteria 2791355094 2792643908 300
729 iso_pu_bacteria 2791355094 2792644099 300
730 iso_pu_bacteria 2791355123 2792749954 300
731 iso_pu_bacteria 2791355256 2793295362 300
732 iso_pu_bacteria 2791355259 2793313829 300
733 iso_pu_bacteria 2802429605 2805928110 300
734 iso_pu_bacteria 2824609381 2824616740 300
735 iso_pu_bacteria 2824653114 2824660398 300
736 iso_pu_bacteria 2824671348 2824675966 300
737 iso_pu_bacteria 2824687955 2824692073 300
738 iso_pu_bacteria 2824732956 2824734302 300
739 iso_pu_bacteria 2824746037 2824747858 300
740 iso_pu_bacteria 2824773399 2824780441 300
741 iso_pu_bacteria 2838035591 2838036025 300
742 iso_pu_bacteria 2838122688 2838127842 300
743 iso_pu_bacteria 2838661181 2838667446 300
744 iso_pu_bacteria 2838686498 2838690323 300
745 iso_pu_bacteria 2838729681 2838732080 300
746 iso_pu_bacteria 2838742623 2838744976 300
747 iso_pu_bacteria 2839993093 2839998168 300
748 iso_pu_bacteria 2841851746 2841856034 300
749 iso_pu_bacteria 2841941048 2841943135 300
750 iso_pu_bacteria 2841966195 2841968224 300
751 iso_pu_bacteria 2841974524 2841976565 300
752 iso_pu_bacteria 2841983080 2841987939 300
753 iso_pu_bacteria 2842156927 2842161203 300
754 iso_pu_bacteria 2842180545 2842184820 300
755 iso_pu_bacteria 2842205361 2842207097 300
756 iso_pu_bacteria 2842229732 2842232402 300
757 iso_pu_bacteria 2842243621 2842246818 300
758 iso_pu_bacteria 2842257432 2842261081 300
759 iso_pu_bacteria 2842271015 2842274343 300
760 iso_pu_bacteria 2842278818 2842280210 300
761 iso_pu_bacteria 2842298080 2842303137 300
762 iso_pu_bacteria 2842304105 2842305815 300
763 iso_pu_bacteria 2842357229 2842361427 300
764 iso_pu_bacteria 2842489311 2842494570 300
765 iso_pu_bacteria 2844163670 2844168015 300
766 iso_pu_bacteria 2844454524 2844456978 300
767 iso_pu_bacteria 2847930680 2847931330 300
768 iso_pu_bacteria 2849076700 2849081477 300
769 iso_pu_bacteria 2850079185 2850085713 300
770 iso_pu_bacteria 2855825444 2855828591 300
771 iso_pu_bacteria 2855839649 2855843717 300
772 iso_pu_bacteria 2858800743 2858807038 300
773 iso_pu_bacteria 2874604998 2874607705 300
774 iso_pu_bacteria 2876808645 2876812081 300
775 iso_pu_bacteria 2879083081 2879087629 300
776 iso_pu_bacteria 2889033259 2889042432 300
777 iso_pu_bacteria 2896384573 2896386587 300
778 iso_pu_bacteria 2902405164 2902407475 300
779 iso_pu_bacteria 2903768456 2903771098 300
780 iso_pu_bacteria 2906643746 2906651717 300
781 iso_pu_bacteria 2908775508 2908778068 300
782 iso_pu_bacteria 2915986958 2915988061 300
783 iso_pu_bacteria 2915993759 2915998184 300
784 iso_pu_bacteria 2916000859 2916007301 300
785 iso_pu_bacteria 2916007675 2916011302 300
786 iso_pu_bacteria 2916014648 2916020539 300
787 iso_pu_bacteria 2916021584 2916028123 300
788 iso_pu_bacteria 2916028427 2916032843 300
789 iso_pu_bacteria 2916035215 2916038229 300
790 iso_pu_bacteria 2916041962 2916044999 300
791 iso_pu_bacteria 2916048683 2916051936 300
792 iso_pu_bacteria 2916055098 2916059495 300
793 iso_pu_bacteria 2916068649 2916076023 300
794 iso_pu_bacteria 2916076590 2916077800 300
795 iso_pu_bacteria 2919100787 2919106133 300
796 iso_pu_bacteria 2921201388 2921203182 300
797 iso_pu_bacteria 2921208531 2921213287 300
798 iso_pu_bacteria 2921237296 2921240554 300
799 iso_pu_bacteria 2921244191 2921245756 300
800 iso_pu_bacteria 2921257292 2921260069 300
801 iso_pu_bacteria 2921263974 2921268420 300
802 iso_pu_bacteria 2921282425 2921284643 300
803 iso_pu_bacteria 2921289301 2921290540 300
804 iso_pu_bacteria 2923556063 2923559114 300
805 iso_pu_bacteria 2923556063 2923559423 300
806 iso_pu_bacteria 2924144063 2924148142 300
807 iso_pu_bacteria 2924150972 2924154741 300
808 iso_pu_bacteria 2924158325 2924163948 300
809 iso_pu_bacteria 2924165586 2924168415 300
810 iso_pu_bacteria 2924172951 2924177206 300
811 iso_pu_bacteria 2924179722 2924182060 300
812 iso_pu_bacteria 2924186466 2924188934 300
813 iso_pu_bacteria 2924193448 2924195786 300
814 iso_pu_bacteria 2924200457 2924202945 300
815 iso_pu_bacteria 2924207177 2924209979 300
816 iso_pu_bacteria 2924214083 2924221305 300
817 iso_pu_bacteria 2924221636 2924228362 300
818 iso_pu_bacteria 2924228884 2924233784 300
819 iso_pu_bacteria 2933016740 2933018982 300
820 iso_pu_bacteria 2933570622 2933572320 300
821 iso_pu_bacteria 2937002841 2937005859 300
822 iso_pu_bacteria 2937009748 2937014307 300
823 iso_pu_bacteria 2937016420 2937021555 300
824 iso_pu_bacteria 2937023124 2937023966 300
825 iso_pu_bacteria 2937042894 2937043351 300
826 iso_pu_bacteria 2937056579 2937056861 300
827 iso_pu_bacteria 2937063883 2937066078 300
828 iso_pu_bacteria 2937071275 2937075393 300
829 iso_pu_bacteria 2937091812 2937096128 300
830 iso_pu_bacteria 2937098957 2937105155 300
831 iso_pu_bacteria 2937106411 2937110518 300
832 iso_pu_bacteria 2937113482 2937118832 300
833 iso_pu_bacteria 2937119839 2937125826 300
834 iso_pu_bacteria 2937126314 2937131049 300
835 iso_pu_bacteria 2957382221 2957383012 300
836 iso_pu_bacteria 2957388812 2957391967 300
837 iso_pu_bacteria 2957395598 2957396255 300
838 iso_pu_bacteria 2957402308 2957402936 300
839 iso_pu_bacteria 2957408893 2957410708 300
840 iso_pu_bacteria 2957415311 2957415582 300
841 iso_pu_bacteria 2957415311 2957421338 300
842 iso_pu_bacteria 2957422303 2957427287 300
843 iso_pu_bacteria 2957430029 2957435281 300
844 iso_pu_bacteria 2957443900 2957444489 300
845 iso_pu_bacteria 2957450854 2957454905 300
846 iso_pu_bacteria 2957457609 2957461801 300
847 iso_pu_bacteria 2957464669 2957464831 300
848 iso_pu_bacteria 2957471148 2957476835 300
849 iso_pu_bacteria 2957478035 2957482387 300
850 iso_pu_bacteria 2957484790 2957490015 300
851 iso_pu_bacteria 2957491536 2957491696 300
852 iso_pu_bacteria 2957498199 2957501638 300
853 iso_pu_bacteria 2957505466 2957510260 300
854 iso_pu_bacteria 2960584000 2960585022 300
855 iso_pu_bacteria 2960597568 2960598464 300
856 iso_pu_bacteria 2960603979 2960609531 300
857 iso_pu_bacteria 2960610863 2960614247 300
858 iso_pu_bacteria 2960624210 2960629116 300
859 iso_pu_bacteria 2960637947 2960642809 300
860 iso_pu_bacteria 2960645483 2960645646 300
861 iso_pu_bacteria 2960652885 2960654532 300
862 iso_pu_bacteria 2960660292 2960660994 300
863 iso_pu_bacteria 2960667422 2960669769 300
864 iso_pu_bacteria 2960674078 2960677817 300
865 iso_pu_bacteria 2960687367 2960690881 300
866 iso_pu_bacteria 2964607997 2964610768 300
867 iso_pu_bacteria 2964615318 2964619287 300
868 iso_pu_bacteria 2964621998 2964624202 300
869 iso_pu_bacteria 2964628898 2964632562 300
870 iso_pu_bacteria 2964636051 2964640669 300
871 iso_pu_bacteria 2964643177 2964647965 300
872 iso_pu_bacteria 2964649959 2964655022 300
873 iso_pu_bacteria 2964656573 2964661710 300
874 iso_pu_bacteria 2964663802 2964666819 300
875 iso_pu_bacteria 2964670856 2964678007 300
876 iso_pu_bacteria 2964678106 2964679053 300
877 iso_pu_bacteria 2964685014 2964689282 300
878 iso_pu_bacteria 2964691889 2964696051 300
879 iso_pu_bacteria 2964698721 2964703224 300
880 iso_pu_bacteria 2964705432 2964709586 300
881 iso_pu_bacteria 2964712639 2964717614 300
882 iso_pu_bacteria 2964719344 2964725296 300
883 iso_pu_bacteria 2967664464 2967668539 300
884 iso_pu_bacteria 2967671571 2967677081 300
885 iso_pu_bacteria 2967678726 2967684753 300
886 iso_pu_bacteria 2967693043 2967697825 300
887 iso_pu_bacteria 2967699805 2967704406 300
888 iso_pu_bacteria 2967706974 2967707651 300
889 iso_pu_bacteria 2967714385 2967720948 300
890 iso_pu_bacteria 2967721400 2967725179 300
891 iso_pu_bacteria 2967735183 2967741875 300
892 iso_pu_bacteria 2967742019 2967744255 300
893 iso_pu_bacteria 2967748971 2967750854 300
894 iso_pu_bacteria 2967755722 2967761685 300
895 iso_pu_bacteria 2967762386 2967766014 300
896 iso_pu_bacteria 2967769361 2967772281 300
897 iso_pu_bacteria 2970019648 2970023553 300
898 iso_pu_bacteria 2970033650 2970038256 300
899 iso_pu_bacteria 2970040964 2970046499 300
900 iso_pu_bacteria 2970047711 2970053712 300
901 iso_pu_bacteria 2970054988 2970058667 300
902 iso_pu_bacteria 2970061556 2970062416 300
903 iso_pu_bacteria 2970068827 2970071303 300
904 iso_pu_bacteria 2970076120 2970080315 300
905 iso_pu_bacteria 2970082768 2970085708 300
906 iso_pu_bacteria 2970088815 2970094745 300
907 iso_pu_bacteria 2970095765 2970097345 300
908 iso_pu_bacteria 2970102677 2970105844 300
909 iso_pu_bacteria 2970109326 2970114815 300
910 iso_pu_bacteria 2970116247 2970119616 300
911 iso_pu_bacteria 2970129317 2970134930 300
912 iso_pu_bacteria 2970136068 2970140950 300
913 iso_pu_bacteria 2970149975 2970154107 300
914 iso_pu_bacteria 2970156795 2970162954 300
915 iso_pu_bacteria 2970164137 2970164651 300
916 iso_pu_bacteria 2970170962 2970174317 300
917 iso_pu_bacteria 2970177841 2970182365 300
918 iso_pu_bacteria 2970184632 2970189382 300
919 iso_pu_bacteria 2970191845 2970194679 300
920 iso_pu_bacteria 2977516862 2977518792 300
921 iso_pu_bacteria 2977523885 2977526436 300
922 iso_pu_bacteria 2977537788 2977541316 300
923 iso_pu_bacteria 2977551784 2977557723 300
924 iso_pu_bacteria 2977558990 2977559566 300
925 iso_pu_bacteria 2977565890 2977569210 300
926 iso_pu_bacteria 2977572785 2977578753 300
927 iso_pu_bacteria 2977579622 2977584696 300
928 iso_pu_bacteria 3005506211 3005511477 300
929 iso_pu_bacteria 648276728 648740930 300
930 iso_pu_bacteria 8003992118 8003996277 300
931 iso_pu_bacteria 8005275841 8005280237 300
932 iso_pu_bacteria 8005307578 8005314531 300
933 iso_pu_bacteria 8005460587 8005462539 300
934 iso_pu_bacteria 8005460587 8005465119 300
935 iso_pu_bacteria 8006964411 8006969871 300
936 iso_pu_bacteria 8006984368 8006985714 300
937 iso_pu_bacteria 8016583857 8016586128 300
938 iso_pu_bacteria 8018176218 8018177924 300
939 iso_pu_bacteria 8023680758 8023680998 300
940 iso_pu_bacteria 8023680758 8023686560 300
941 iso_pu_bacteria 8024501048 8024502242 300
942 iso_pu_bacteria 8056673599 8056674169 300
943 iso_pu_bacteria 8056681323 8056684452 300
944 iso_pu_bacteria 8056689827 8056691844 300
945 3300002773 JGI25152J39213_1000145 JGI25152J39213_100014543 301
946 3300002987 JGI25159J45721_1003064 JGI25159J45721_10030645 301
947 3300002987 JGI25159J45721_1011989 JGI25159J45721_10119892 301
948 3300003187 JGI25151J46595_10065796 JGI25151J46595_100657961 301
949 3300003761 Ga0055535_1000677 Ga0055535_100067710 301
950 3300003762 Ga0055542_1000162 Ga0055542_100016236 301
951 3300003775 Ga0055524_1000817 Ga0055524_10008177 301
952 3300003792 Ga0055540_1003098 Ga0055540_10030988 301
953 3300005262 Ga0065165_1000062 Ga0065165_1000062128 301
954 3300005548 Ga0070665_100320289 Ga0070665_1003202891 301
955 3300005937 Ga0081455_10096945 Ga0081455_100969452 301
956 3300005983 Ga0081540_1010590 Ga0081540_10105902 301
957 3300006051 Ga0075364_10003895 Ga0075364_100038955 301
958 3300006177 Ga0075362_10004855 Ga0075362_100048555 301
959 3300006946 Ga0079104_1005204 Ga0079104_10052042 301
960 3300006948 Ga0099826_10000010 Ga0099826_1000001057 301
961 3300009036 Ga0105244_10013012 Ga0105244_100130122 301
962 3300009094 Ga0111539_10002098 Ga0111539_1000209819 301
963 3300009177 Ga0105248_10159725 Ga0105248_101597252 301
964 3300009545 Ga0105237_10002871 Ga0105237_100028717 301
965 3300010375 Ga0105239_10049987 Ga0105239_100499875 301
966 3300014326 Ga0157380_10155714 Ga0157380_101557143 301
967 3300014497 Ga0182008_10002242 Ga0182008_100022429 301
968 3300025208 Ga0209436_111532 Ga0209436_1115321 301
969 3300025228 Ga0209672_100829 Ga0209672_10082910 301
970 3300025242 Ga0209258_100236 Ga0209258_1002369 301
971 3300025254 Ga0209148_1000209 Ga0209148_10002099 301
972 3300025284 Ga0209130_1000174 Ga0209130_100017448 301
973 3300025292 Ga0209676_1001350 Ga0209676_10013509 301
974 3300025297 Ga0209758_1013710 Ga0209758_10137103 301
975 3300025297 Ga0209758_1018751 Ga0209758_10187513 301
976 3300025299 Ga0209256_1000131 Ga0209256_100013135 301
977 3300025299 Ga0209256_1003652 Ga0209256_100365210 301
978 3300025302 Ga0207426_1006027 Ga0207426_10060275 301
979 3300025304 Ga0209257_1002248 Ga0209257_100224815 301
980 3300025728 Ga0207655_1016122 Ga0207655_10161223 301
981 3300025911 Ga0207654_10072265 Ga0207654_100722652 301
982 3300025941 Ga0207711_10137788 Ga0207711_101377882 301
983 3300025972 Ga0207668_10287993 Ga0207668_102879931 301
984 3300027666 Ga0209282_1000009 Ga0209282_100000957 301
985 3300027907 Ga0207428_10000560 Ga0207428_1000056024 301
986 3300028380 Ga0268265_10163153 Ga0268265_101631532 301
987 3300028786 Ga0307517_10168772 Ga0307517_101687721 301
988 3300028794 Ga0307515_10194014 Ga0307515_101940142 301
989 3300031731 Ga0307405_10254827 Ga0307405_102548271 301
990 3300031901 Ga0307406_10044488 Ga0307406_100444882 301
991 3300035691 Ga0373931_0055602 Ga0373931_0055602_43_996 301
992 3300037068 Ga0373925_0077902 Ga0373925_0077902_1201_2154 301
993 3300041407 Ga0439447_000286 Ga0439447_000286_12202_13119 301
994 3300041410 Ga0439461_0002294 Ga0439461_0002294_988_1902 301
995 3300041411 Ga0439466_0008235 Ga0439466_0008235_1002_1916 301
996 3300041411 Ga0439466_0011134 Ga0439466_0011134_2145_3059 301
997 3300041413 Ga0439465_0002144 Ga0439465_0002144_5521_6435 301
998 3300041997 Ga0439431_0002340 Ga0439431_0002340_2713_3627 301
999 3300042006 Ga0439432_063961 Ga0439432_063961_97_1014 301
1000 3300042007 Ga0439449_0001954 Ga0439449_0001954_2233_3150 301
1001 3300042435 Ga0439434_0016395 Ga0439434_0016395_737_1651 301
1002 3300046525 Ga0495663_0026086 Ga0495663_0026086_756_1673 301
1003 3300046616 Ga0495668_0000002 Ga0495668_0000002_144128_145042 301
1004 3300046660 Ga0495625_0003303 Ga0495625_0003303_11723_12694 301
1005 3300046810 Ga0495660_0021283 Ga0495660_0021283_562_1527 301
1006 3300047319 Ga0495674_0250785 Ga0495674_0250785_21_935 301
1007 3300047443 Ga0495687_000748 Ga0495687_000748_659_1576 301
1008 3300048903 Ga0496100_0014569 Ga0496100_0014569_462_1415 301
1009 3300048904 Ga0496101_0020397 Ga0496101_0020397_2553_3506 301
1010 3300048907 Ga0496104_0159562 Ga0496104_0159562_1161_2114 301
1011 3300048908 Ga0496105_0012970 Ga0496105_0012970_4908_5861 301
1012 3300048909 Ga0496106_0101291 Ga0496106_0101291_226_1179 301
1013 3300048910 Ga0496107_0106792 Ga0496107_0106792_70_1023 301
1014 3300048910 Ga0496107_0123725 Ga0496107_0123725_343_1284 301
1015 3300048911 Ga0496108_0026774 Ga0496108_0026774_352_1305 301
1016 3300048912 Ga0496109_0143251 Ga0496109_0143251_1261_2214 301
1017 3300048913 Ga0496110_0215354 Ga0496110_0215354_50_1003 301
1018 3300048914 Ga0496111_0089652 Ga0496111_0089652_82_1035 301
1019 3300048916 Ga0496113_0024311 Ga0496113_0024311_2076_3029 301
1020 3300048918 Ga0496115_0251185 Ga0496115_0251185_474_1388 301
1021 3300048919 Ga0496116_0041410 Ga0496116_0041410_1750_2667 301
1022 3300048920 Ga0496117_0008863 Ga0496117_0008863_3398_4315 301
1023 3300048921 Ga0496118_0004178 Ga0496118_0004178_13176_14093 301
1024 3300048921 Ga0496118_0011760 Ga0496118_0011760_6524_7441 301
1025 3300048922 Ga0496119_0006421 Ga0496119_0006421_109_1026 301
1026 3300048923 Ga0496120_0002913 Ga0496120_0002913_14774_15691 301
1027 3300048924 Ga0496121_0002696 Ga0496121_0002696_23540_24457 301
1028 3300048925 Ga0496122_0000047 Ga0496122_0000047_123538_124455 301
1029 3300048925 Ga0496122_0095401 Ga0496122_0095401_696_1613 301
1030 3300048926 Ga0496123_0000077 Ga0496123_0000077_98247_99164 301
1031 3300048926 Ga0496123_0000393 Ga0496123_0000393_79679_80698 301
1032 3300048926 Ga0496123_0019962 Ga0496123_0019962_448_1365 301
1033 3300048927 Ga0496124_0029367 Ga0496124_0029367_1487_2404 301
1034 3300048927 Ga0496124_0083496 Ga0496124_0083496_1550_2467 301
1035 3300048927 Ga0496124_0123602 Ga0496124_0123602_656_1573 301
1036 3300048928 Ga0496125_0000105 Ga0496125_0000105_156479_157396 301
1037 3300048928 Ga0496125_0053125 Ga0496125_0053125_1911_2828 301
1038 3300048929 Ga0496126_0010668 Ga0496126_0010668_3309_4226 301
1039 3300048929 Ga0496126_0179249 Ga0496126_0179249_609_1526 301
1040 3300050489 nmdc:mga03683_13848_c1 nmdc:mga03683_13848_c1_1860_2774 301
1041 3300050491 nmdc:mga00v17_11869_c1 nmdc:mga00v17_11869_c1_819_1733 301
1042 3300050511 nmdc:mga08y16_609_c1 nmdc:mga08y16_609_c1_10680_11594 301
1043 3300053134 Ga0500658_0001317 Ga0500658_0001317_8365_9282 301
1044 3300053140 Ga0500573_0027376 Ga0500573_0027376_1999_2952 301
1045 3300053153 Ga0500616_0037385 Ga0500616_0037385_588_1640 301
1046 iso_pu_bacteria 2513237161 2514015492 301
1047 iso_pu_bacteria 2599185352 2600196729 301
1048 iso_pu_bacteria 2643221557 2643805578 301
1049 iso_pu_bacteria 2643221610 2644064629 301
1050 iso_pu_bacteria 2643221618 2644106735 301
1051 iso_pu_bacteria 2643221626 2644148086 301
1052 iso_pu_bacteria 2643221655 2644310039 301
1053 iso_pu_bacteria 2643221659 2644331988 301
1054 iso_pu_bacteria 2643221668 2644377136 301
1055 iso_pu_bacteria 2643221675 2644419490 301
1056 iso_pu_bacteria 2643221680 2644452847 301
1057 iso_pu_bacteria 2643221698 2644543905 301
1058 iso_pu_bacteria 2643221712 2644616257 301
1059 iso_pu_bacteria 2643221723 2644672036 301
1060 iso_pu_bacteria 2643221726 2644691838 301
1061 iso_pu_bacteria 2643221736 2644747790 301
1062 iso_pu_bacteria 2791355196 2793061026 301
1063 iso_pu_bacteria 2841941048 2841943134 301
1064 iso_pu_bacteria 2841966195 2841968225 301
1065 iso_pu_bacteria 2876808645 2876817473 301
1066 iso_pu_bacteria 2879110137 2879110485 301
1067 iso_pu_bacteria 2921208531 2921208733 301
1068 iso_pu_bacteria 2924179722 2924186205 301
1069 iso_pu_bacteria 2957437181 2957441503 301
1070 iso_pu_bacteria 2957450854 2957455915 301
1071 iso_pu_bacteria 2960591022 2960594018 301
1072 iso_pu_bacteria 2970095765 2970096683 301
1073 3300033180 Ga0307510_10016774 Ga0307510_100167746 302
1074 3300049570 Ga0501033_0009780 Ga0501033_0009780_5087_6040 302
1075 3300049571 Ga0501034_0098738 Ga0501034_0098738_183_1136 302
1076 3300049572 Ga0501036_0120847 Ga0501036_0120847_842_1795 302
1077 3300049573 Ga0501037_0227513 Ga0501037_0227513_313_1266 302
1078 3300049574 Ga0501038_0102082 Ga0501038_0102082_923_1876 302
1079 3300049579 Ga0501043_0057065 Ga0501043_0057065_1779_2732 302
1080 3300049580 Ga0501046_0166256 Ga0501046_0166256_380_1333 302
1081 3300049581 Ga0501047_0049777 Ga0501047_0049777_2499_3452 302
1082 3300049586 Ga0501070_0186078 Ga0501070_0186078_348_1301 302
1083 3300049744 Ga0501083_0217365 Ga0501083_0217365_195_1148 302
1084 3300049822 Ga0501035_0374333 Ga0501035_0374333_125_1078 302
1085 3300049823 Ga0501044_0007532 Ga0501044_0007532_5765_6718 302
1086 3300003771 Ga0055526_1000056 Ga0055526_100005627 303
1087 3300003775 Ga0055524_1000949 Ga0055524_10009495 303
1088 3300003792 Ga0055540_1015468 Ga0055540_10154682 303
1089 3300003792 Ga0055540_1028337 Ga0055540_10283372 303
1090 3300005262 Ga0065165_1022312 Ga0065165_10223122 303
1091 3300005844 Ga0068862_100000022 Ga0068862_10000002217 303
1092 3300025258 Ga0209129_1019262 Ga0209129_10192621 303
1093 3300025263 Ga0209565_1017141 Ga0209565_10171412 303
1094 3300025273 Ga0209673_1001266 Ga0209673_100126628 303
1095 3300025273 Ga0209673_1003378 Ga0209673_10033788 303
1096 3300025273 Ga0209673_1007214 Ga0209673_10072144 303
1097 3300025284 Ga0209130_1008246 Ga0209130_10082461 303
1098 3300025295 Ga0209564_1000255 Ga0209564_100025514 303
1099 3300025297 Ga0209758_1000861 Ga0209758_100086137 303
1100 3300025299 Ga0209256_1001834 Ga0209256_10018345 303
1101 3300025302 Ga0207426_1001743 Ga0207426_100174315 303
1102 3300025303 Ga0209051_1008982 Ga0209051_10089823 303
1103 3300025303 Ga0209051_1023723 Ga0209051_10237234 303
1104 3300026118 Ga0207675_100000029 Ga0207675_10000002994 303
1105 3300028380 Ga0268265_10000006 Ga0268265_1000000617 303
1106 iso_pu_bacteria 2941499720 2941505823 304
1107 3300005347 Ga0070668_100115010 Ga0070668_1001150102 305
1108 3300005438 Ga0070701_10249131 Ga0070701_102491311 305
1109 3300005457 Ga0070662_100068288 Ga0070662_1000682881 305
1110 3300006881 Ga0068865_100029277 Ga0068865_1000292773 305
1111 3300017792 Ga0163161_10007287 Ga0163161_100072875 305
1112 3300025934 Ga0207686_10080169 Ga0207686_100801692 305
1113 3300025938 Ga0207704_10311565 Ga0207704_103115652 305
1114 3300025960 Ga0207651_10047261 Ga0207651_100472613 305
1115 3300025972 Ga0207668_10135775 Ga0207668_101357752 305
1116 3300026089 Ga0207648_10310003 Ga0207648_103100031 305
1117 3300026121 Ga0207683_10206149 Ga0207683_102061492 305
1118 3300048917 Ga0496114_0206226 Ga0496114_0206226_757_1707 305
1119 3300053094 Ga0500566_0003680 Ga0500566_0003680_4323_5273 305
1120 3300053119 Ga0500595_000348 Ga0500595_000348_21830_22780 305
1121 3300053162 Ga0500638_021318 Ga0500638_021318_1642_2592 305
1122 3300053178 Ga0500637_0000110 Ga0500637_0000110_24365_25315 305
1123 3300002459 JGI24751J29686_10000063 JGI24751J29686_100000631 308
1124 3300005331 Ga0070670_100000245 Ga0070670_1000002455 308
1125 3300005618 Ga0068864_100000109 Ga0068864_1000001095 308
1126 3300006195 Ga0075366_10079295 Ga0075366_100792951 308
1127 3300009177 Ga0105248_10196755 Ga0105248_101967551 308
1128 3300025925 Ga0207650_10000039 Ga0207650_10000039162 308
1129 3300025941 Ga0207711_10599579 Ga0207711_105995791 308
1130 3300026095 Ga0207676_10000035 Ga0207676_1000003554 308
1131 3300050493 nmdc:mga0k408_117874_c1 nmdc:mga0k408_117874_c1_27_953 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

121

332

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zo2-assembly1.cif.gz_B aidc, a dizinc quorum-quenching lactonase 0.9178 25 308
7y7u-assembly1.cif.gz_B dimeric structure of a quorum-quenching metallo-hydrolase, lrsl 0.8911 26 306
1p9e-assembly1.cif.gz_A crystal structure analysis of methyl parathion hydrolase from pseudomonas sp wbc-3 0.8852 15 308
4zo2-assembly1.cif.gz_B aidc, a dizinc quorum-quenching lactonase 0.8849 25 308
5hif-assembly1.cif.gz_B crystal structure of a reconstructed lactonase ancestor, anc1-mph, of the bacterial methyl parathion hydrolase, mph. 0.8774 12 308
ID Description Score Start End Superfamily
4zo2A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9165 25 308 3.60.15.10
4zo2A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8866 25 308 3.60.15.10
6c2cA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8693 9 308 3.60.15.10
4xukA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8623 23 308 3.60.15.10
4le6E00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8619 15 308 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A4R3QI76-F1-model_v4 Metallo-beta-lactamase superfamily protein 0.9863 155 308
AF-A0A4R3QI76-F1-model_v4 Metallo-beta-lactamase superfamily protein 0.98 155 308
AF-A0A2X1GGK9-F1-model_v4 deleted 0.978 141 308
AF-A0A2S8MNA1-F1-model_v4 deleted 0.9772 105 241
AF-W6S4J1-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9767 225 308

Feature Viewer

pLDDT pTM Quality
90.75 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map