F490439

General Info

Members Datasets Scaffolds Average Seq Length
1123 452 1090 155

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0000847|Ga0496125_0000847_38619_39086
Length 155
Sequence MSVTENTLILETTQGPVTIEMRPDLAPGHVARIKELVREGFYDGIVFHRVIDGFMAQTGCPQGTGTGGSGKKLKAEFSKEPHVRGTLSMARAASPDSGDSQFFICFDDASFLNNQYTVWGKVTEGMENVDKIKRGEPVQNPDKIVKAHMAADAEA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
4 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
5 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
6 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
7 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
8 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
9 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
10 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
11 2643221583 Caulobacter sp. Root655 Isolate Unclassified
12 2643221584 Caulobacter sp. Root656 Isolate Unclassified
13 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
14 2643221640 Caulobacter sp. Root342 Isolate Unclassified
15 2643221642 Caulobacter sp. Root343 Isolate Unclassified
16 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
17 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
18 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
19 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
20 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
21 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
22 2818991435 Caulobacter henricii 536 Isolate Unclassified
23 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
24 2818991467 Bosea vestrisii 3192 Isolate Unclassified
25 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
26 2849560528 Caulobacter zeae 410 Isolate Unclassified
27 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
28 2851153111 Caulobacter radicis 736 Isolate Unclassified
29 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
30 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
31 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
32 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
33 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
34 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
35 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
36 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
39 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
40 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
41 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
42 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
43 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
44 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
45 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
46 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
47 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
48 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
49 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
50 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
51 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
52 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
53 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
54 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
58 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
59 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
60 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
61 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
62 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
63 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
64 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
65 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
66 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
67 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
68 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
69 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
70 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
73 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
74 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
75 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
76 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
80 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
81 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
82 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
86 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
87 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
88 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
89 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
90 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
91 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
92 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
93 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
94 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
103 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
106 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
107 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
108 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
109 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
110 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
111 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
112 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
113 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
114 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
115 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
116 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
117 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
118 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
119 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
120 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
121 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
122 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
123 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
124 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
125 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
126 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
128 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
129 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
130 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
155 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
156 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
157 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
160 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
165 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
167 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
175 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
239 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
244 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
245 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
246 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
247 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
248 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
249 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
250 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
251 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
252 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
253 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
254 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
257 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
258 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
259 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
260 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
261 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
264 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
265 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
266 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
267 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
268 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
269 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
270 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
271 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
272 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
275 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
276 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
279 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
280 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
281 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
283 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
284 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
285 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
286 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
287 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
288 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
289 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
290 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
291 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
292 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
293 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
294 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
295 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
296 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
297 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
298 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
299 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
300 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
301 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
302 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
303 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
304 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
305 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
306 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
307 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
308 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
312 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
313 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
314 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
315 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
316 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
317 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
318 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
319 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
320 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
321 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
322 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
323 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
324 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
325 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
326 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
327 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
328 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
329 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
330 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
331 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
332 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
333 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
334 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
335 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
336 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
337 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
338 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
339 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
340 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
341 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
342 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
343 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
344 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
345 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
346 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
347 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
348 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
349 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
350 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
351 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
352 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
353 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
354 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
355 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
356 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
357 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
358 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
359 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
360 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
361 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
362 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
363 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
364 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
365 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
366 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
367 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
368 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
369 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
370 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
371 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
372 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
375 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
376 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
377 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
378 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
379 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
380 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
381 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
387 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
388 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
389 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
390 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
391 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
392 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
393 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
394 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
395 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
396 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
397 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
398 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
399 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
400 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
401 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
402 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
403 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
404 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
405 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
406 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
407 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
409 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
413 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
414 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
415 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
416 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
417 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
418 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
419 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
420 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
421 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
422 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
423 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
424 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
425 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
426 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
427 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
428 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
429 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
430 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
431 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
432 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
433 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
434 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
435 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
436 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
437 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
438 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
439 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
440 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
441 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
442 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
443 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
444 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
445 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
446 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
447 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
448 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
449 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
450 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
451 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 0.18
Isolates 2.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.49
Nodule 0.09
Rhizoplane 4.45
Rhizosphere 76.4
Stem 0
Stem Tuber 0
Unclassified 7.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1281257 2162886007 Bacteria 1821
2 JGI24736J21556_1000178 3300001904 Bacteria 11315
3 JGI24752J21851_1000008 3300001976 Bacteria 23142
4 JGI24752J21851_1000844 3300001976 Bacteria 4158
5 JGI24752J21851_1003520 3300001976 Bacteria 2061
6 JGI24740J21852_10002881 3300001979 Bacteria 7689
7 JGI24740J21852_10022646 3300001979 Bacteria 2159
8 JGI24739J22299_10009266 3300001989 Bacteria 3674
9 JGI24739J22299_10041509 3300001989 Bacteria 1530
10 JGI24737J22298_10004848 3300001990 Bacteria 4668
11 JGI24737J22298_10035820 3300001990 Bacteria 1535
12 JGI24735J21928_10001909 3300002067 Bacteria 7307
13 JGI24735J21928_10036153 3300002067 Bacteria 1449
14 JGI24750J21931_1000163 3300002070 Bacteria 11107
15 JGI24748J21848_1000140 3300002074 Bacteria 12239
16 JGI24738J21930_10001111 3300002075 Bacteria 7587
17 JGI24034J26672_10000024 3300002239 Bacteria 114754
18 JGI24034J26672_10007683 3300002239 Bacteria 1568
19 JGI24742J22300_10005454 3300002244 Bacteria 2092
20 JGI25165J46597_1000187 3300003214 Bacteria 93537
21 Ga0055526_1001059 3300003771 Bacteria 20102
22 Ga0055526_1043671 3300003771 Bacteria 1089
23 Ga0055537_1000684 3300003773 Bacteria 17784
24 Ga0055524_1000078 3300003775 Bacteria 120745
25 Ga0055524_1006562 3300003775 Bacteria 5033
26 Ga0055536_1000689 3300003781 Bacteria 22680
27 Ga0055536_1000750 3300003781 Bacteria 21664
28 Ga0055528_1002530 3300003790 Bacteria 9735
29 Ga0055530_10000657 3300003791 Bacteria 29580
30 Ga0055530_10001625 3300003791 Bacteria 16093
31 Ga0055530_10004094 3300003791 Bacteria 7762
32 Ga0055531_10000307 3300003794 Bacteria 48396
33 Ga0055531_10010132 3300003794 Bacteria 4729
34 Ga0055531_10016045 3300003794 Bacteria 3258
35 Ga0055531_10041710 3300003794 Bacteria 1324
36 JGI25405J52794_10013313 3300003911 Bacteria 1594
37 Ga0055543_1009306 3300004625 Bacteria 2119
38 Ga0065165_1000238 3300005262 Bacteria 95406
39 Ga0065165_1001453 3300005262 Bacteria 25633
40 Ga0065704_10006330 3300005289 Bacteria 6170
41 Ga0065704_10073574 3300005289 Bacteria 7001
42 Ga0065704_10120189 3300005289 Bacteria 1787
43 Ga0065712_10121894 3300005290 Bacteria 1659
44 Ga0065715_10187088 3300005293 Bacteria 1438
45 Ga0065707_10082116 3300005295 Bacteria 21461
46 Ga0065707_10135510 3300005295 Bacteria 1848
47 Ga0065707_10149117 3300005295 Bacteria 1678
48 Ga0065707_10361893 3300005295 Bacteria 903
49 Ga0070658_10006127 3300005327 Bacteria 9753
50 Ga0070658_10673687 3300005327 Bacteria 898
51 Ga0070658_11148373 3300005327 Bacteria 675
52 Ga0070658_11262561 3300005327 Bacteria 642
53 Ga0070676_10398318 3300005328 Bacteria 957
54 Ga0070676_10611524 3300005328 Bacteria 787
55 Ga0070683_100214255 3300005329 Bacteria 1830
56 Ga0070683_100319811 3300005329 Bacteria 1477
57 Ga0070690_100000016 3300005330 Bacteria 85515
58 Ga0070670_100000215 3300005331 Bacteria 53387
59 Ga0070670_100000964 3300005331 Bacteria 22587
60 Ga0070670_100185662 3300005331 Bacteria 1805
61 Ga0070670_100278324 3300005331 Bacteria 1461
62 Ga0070670_100282325 3300005331 Bacteria 1450
63 Ga0070670_100644931 3300005331 Bacteria 950
64 Ga0070670_100672406 3300005331 Bacteria 930
65 Ga0070677_10001315 3300005333 Bacteria 7940
66 Ga0068869_101320753 3300005334 Bacteria 637
67 Ga0070666_10000011 3300005335 Bacteria 261736
68 Ga0070666_10000089 3300005335 Bacteria 64147
69 Ga0070666_10175569 3300005335 Bacteria 1502
70 Ga0070680_100019967 3300005336 Bacteria 5311
71 Ga0070680_100026390 3300005336 Bacteria 4647
72 Ga0070680_100042407 3300005336 Bacteria 3692
73 Ga0070680_101287490 3300005336 Bacteria 633
74 Ga0070682_100046493 3300005337 Bacteria 2694
75 Ga0070660_100001221 3300005339 Bacteria 17469
76 Ga0070660_100005294 3300005339 Bacteria 8928
77 Ga0070660_100020442 3300005339 Bacteria 4864
78 Ga0070660_100077451 3300005339 Bacteria 2605
79 Ga0070689_100006604 3300005340 Bacteria 8053
80 Ga0070691_10022983 3300005341 Bacteria 2895
81 Ga0070687_100144758 3300005343 Bacteria 1388
82 Ga0070661_100245021 3300005344 Bacteria 1381
83 Ga0070661_100601759 3300005344 Bacteria 889
84 Ga0070661_100625830 3300005344 Bacteria 872
85 Ga0070692_10506988 3300005345 Bacteria 783
86 Ga0070668_100000584 3300005347 Bacteria 24454
87 Ga0070668_100038482 3300005347 Bacteria 3656
88 Ga0070668_100042077 3300005347 Bacteria 3501
89 Ga0070668_100060128 3300005347 Bacteria 2941
90 Ga0070669_100000009 3300005353 Bacteria 224683
91 Ga0070669_100000024 3300005353 Bacteria 173107
92 Ga0070669_100066448 3300005353 Bacteria 2658
93 Ga0070669_100245533 3300005353 Bacteria 1424
94 Ga0070669_100335138 3300005353 Bacteria 1224
95 Ga0070669_100625254 3300005353 Bacteria 904
96 Ga0070675_100001982 3300005354 Bacteria 15173
97 Ga0070675_100005135 3300005354 Bacteria 9989
98 Ga0070675_100009549 3300005354 Bacteria 7547
99 Ga0070675_100110894 3300005354 Bacteria 2321
100 Ga0070671_100000006 3300005355 Bacteria 250635
101 Ga0070671_100022048 3300005355 Bacteria 5203
102 Ga0070671_100053953 3300005355 Bacteria 3341
103 Ga0070671_100065786 3300005355 Bacteria 3020
104 Ga0070671_100065925 3300005355 Bacteria 3017
105 Ga0070671_100125365 3300005355 Bacteria 2162
106 Ga0070671_100401848 3300005355 Bacteria 1172
107 Ga0070671_101000798 3300005355 Bacteria 732
108 Ga0070674_100006812 3300005356 Bacteria 6695
109 Ga0070674_100456148 3300005356 Bacteria 1056
110 Ga0070673_100017949 3300005364 Bacteria 5045
111 Ga0070659_100000549 3300005366 Bacteria 27383
112 Ga0070659_100011408 3300005366 Bacteria 6573
113 Ga0070659_100014000 3300005366 Bacteria 5986
114 Ga0070659_100041921 3300005366 Bacteria 3579
115 Ga0070659_100387121 3300005366 Bacteria 1178
116 Ga0070667_100000169 3300005367 Bacteria 81539
117 Ga0070667_100000311 3300005367 Bacteria 54491
118 Ga0070667_100002997 3300005367 Bacteria 14505
119 Ga0070667_100014825 3300005367 Bacteria 6439
120 Ga0070667_100036281 3300005367 Bacteria 4133
121 Ga0070667_100169034 3300005367 Bacteria 1929
122 Ga0070667_100176523 3300005367 Bacteria 1888
123 Ga0070714_100455486 3300005435 Bacteria 1216
124 Ga0070713_100849190 3300005436 Bacteria 877
125 Ga0070705_100099320 3300005440 Bacteria 1834
126 Ga0070700_100242011 3300005441 Bacteria 1290
127 Ga0070708_100044003 3300005445 Bacteria 3925
128 Ga0070663_100028840 3300005455 Bacteria 3784
129 Ga0070662_100007706 3300005457 Bacteria 6987
130 Ga0070662_100163543 3300005457 Bacteria 1742
131 Ga0070681_10014790 3300005458 Bacteria 7760
132 Ga0070681_10052294 3300005458 Bacteria 4073
133 Ga0070681_10186106 3300005458 Bacteria 1997
134 Ga0070681_10247111 3300005458 Bacteria 1697
135 Ga0070681_10814537 3300005458 Bacteria 851
136 Ga0068867_100540741 3300005459 Bacteria 1007
137 Ga0070685_10000186 3300005466 Bacteria 41567
138 Ga0070679_100007144 3300005530 Bacteria 10423
139 Ga0070679_100018843 3300005530 Bacteria 6701
140 Ga0070679_100954852 3300005530 Bacteria 801
141 Ga0070684_100047729 3300005535 Bacteria 3711
142 Ga0068853_100016114 3300005539 Bacteria 6147
143 Ga0068853_100077290 3300005539 Bacteria 2908
144 Ga0068853_100426848 3300005539 Bacteria 1244
145 Ga0068853_100869895 3300005539 Bacteria 865
146 Ga0070672_100026452 3300005543 Bacteria 4318
147 Ga0070672_100251605 3300005543 Bacteria 1488
148 Ga0070672_100470929 3300005543 Bacteria 1084
149 Ga0070672_100643258 3300005543 Bacteria 926
150 Ga0070686_100000001 3300005544 Bacteria 515830
151 Ga0070686_100000475 3300005544 Bacteria 24312
152 Ga0070665_100000004 3300005548 Bacteria 785500
153 Ga0070665_100000166 3300005548 Bacteria 120121
154 Ga0070665_100000610 3300005548 Bacteria 49084
155 Ga0070665_100001608 3300005548 Bacteria 26014
156 Ga0070665_100002779 3300005548 Bacteria 18970
157 Ga0070665_100007364 3300005548 Bacteria 11193
158 Ga0070665_100007560 3300005548 Bacteria 11048
159 Ga0070665_100060695 3300005548 Bacteria 3790
160 Ga0070665_100146657 3300005548 Bacteria 2363
161 Ga0070665_100553360 3300005548 Bacteria 1163
162 Ga0070665_100930616 3300005548 Bacteria 882
163 Ga0068855_100000644 3300005563 Bacteria 42733
164 Ga0068855_100034791 3300005563 Bacteria 6004
165 Ga0068855_100038534 3300005563 Bacteria 5679
166 Ga0068855_100060774 3300005563 Bacteria 4417
167 Ga0068855_100225537 3300005563 Bacteria 2100
168 Ga0068855_100307069 3300005563 Bacteria 1756
169 Ga0068855_101540918 3300005563 Bacteria 681
170 Ga0070664_100182132 3300005564 Bacteria 1867
171 Ga0068857_100008971 3300005577 Bacteria 8665
172 Ga0068857_100062721 3300005577 Bacteria 3305
173 Ga0068857_100103710 3300005577 Bacteria 2553
174 Ga0068857_100255758 3300005577 Bacteria 1606
175 Ga0068857_101989898 3300005577 Bacteria 570
176 Ga0068854_100327381 3300005578 Bacteria 1247
177 Ga0068856_100048263 3300005614 Bacteria 4195
178 Ga0068856_100120561 3300005614 Bacteria 2624
179 Ga0068856_100143212 3300005614 Bacteria 2398
180 Ga0068856_100202043 3300005614 Bacteria 2002
181 Ga0068856_101410741 3300005614 Bacteria 711
182 Ga0068856_101527048 3300005614 Bacteria 681
183 Ga0068852_100050187 3300005616 Bacteria 3574
184 Ga0068852_100105141 3300005616 Bacteria 2557
185 Ga0068852_100119522 3300005616 Bacteria 2409
186 Ga0068859_100000256 3300005617 Bacteria 52870
187 Ga0068859_100017605 3300005617 Bacteria 7184
188 Ga0068859_100158432 3300005617 Bacteria 2342
189 Ga0068859_100337575 3300005617 Bacteria 1601
190 Ga0068859_100519147 3300005617 Bacteria 1286
191 Ga0068859_100648393 3300005617 Bacteria 1148
192 Ga0068864_100000080 3300005618 Bacteria 102508
193 Ga0068864_100000191 3300005618 Bacteria 55913
194 Ga0068864_100000461 3300005618 Bacteria 35261
195 Ga0068864_100001437 3300005618 Bacteria 19648
196 Ga0068864_100006235 3300005618 Bacteria 9781
197 Ga0068864_100018087 3300005618 Bacteria 5882
198 Ga0068864_100099463 3300005618 Bacteria 2577
199 Ga0068864_100342016 3300005618 Bacteria 1410
200 Ga0068864_101015716 3300005618 Bacteria 823
201 Ga0068861_100000799 3300005719 Bacteria 18980
202 Ga0068861_100097386 3300005719 Bacteria 2333
203 Ga0068851_10022230 3300005834 Bacteria 3086
204 Ga0068870_10175028 3300005840 Bacteria 1284
205 Ga0068870_10614910 3300005840 Bacteria 740
206 Ga0068863_100000010 3300005841 Bacteria 237758
207 Ga0068863_100000072 3300005841 Bacteria 113996
208 Ga0068863_100000087 3300005841 Bacteria 102508
209 Ga0068863_100000185 3300005841 Bacteria 66169
210 Ga0068863_100005179 3300005841 Bacteria 12862
211 Ga0068863_100077452 3300005841 Bacteria 3147
212 Ga0068863_100293034 3300005841 Bacteria 1577
213 Ga0068863_101334200 3300005841 Bacteria 725
214 Ga0068863_101966986 3300005841 Bacteria 595
215 Ga0068858_100000360 3300005842 Bacteria 48023
216 Ga0068858_100000487 3300005842 Bacteria 41394
217 Ga0068858_100009402 3300005842 Bacteria 9330
218 Ga0068858_100009567 3300005842 Bacteria 9247
219 Ga0068858_100032391 3300005842 Bacteria 4855
220 Ga0068858_100614574 3300005842 Bacteria 1055
221 Ga0068858_100718083 3300005842 Bacteria 973
222 Ga0068860_100000030 3300005843 Bacteria 256364
223 Ga0068860_100000211 3300005843 Bacteria 91286
224 Ga0068860_100000549 3300005843 Bacteria 45722
225 Ga0068860_100074007 3300005843 Bacteria 3238
226 Ga0068860_100086396 3300005843 Bacteria 2985
227 Ga0068860_100242572 3300005843 Bacteria 1753
228 Ga0068862_100000101 3300005844 Bacteria 102508
229 Ga0068862_100000310 3300005844 Bacteria 53315
230 Ga0068862_100002355 3300005844 Bacteria 16829
231 Ga0068862_100013604 3300005844 Bacteria 6738
232 Ga0068862_100416236 3300005844 Bacteria 1260
233 Ga0081455_10000848 3300005937 Bacteria 39354
234 Ga0081539_10083950 3300005985 Bacteria 1666
235 Ga0070717_10072887 3300006028 Bacteria 2869
236 Ga0075368_10010676 3300006042 Bacteria 3325
237 Ga0075363_100007689 3300006048 Bacteria 4974
238 Ga0075364_10007544 3300006051 Bacteria 6467
239 Ga0075364_10137254 3300006051 Bacteria 1644
240 Ga0075362_10544217 3300006177 Bacteria 596
241 Ga0075367_10000812 3300006178 Bacteria 12330
242 Ga0075369_10035245 3300006186 Bacteria 2127
243 Ga0075366_10139834 3300006195 Bacteria 1463
244 Ga0075366_10205992 3300006195 Bacteria 1197
245 Ga0097621_100318920 3300006237 Bacteria 1376
246 Ga0075370_10056254 3300006353 Bacteria 2236
247 Ga0075370_10283773 3300006353 Bacteria 984
248 Ga0068865_100002455 3300006881 Bacteria 10973
249 Ga0075436_101058867 3300006914 Bacteria 610
250 Ga0097620_100000256 3300006931 Bacteria 52870
251 Ga0097620_100017605 3300006931 Bacteria 7184
252 Ga0097620_100158431 3300006931 Bacteria 2342
253 Ga0097620_100337580 3300006931 Bacteria 1601
254 Ga0097620_100519241 3300006931 Bacteria 1286
255 Ga0097620_100648476 3300006931 Bacteria 1148
256 Ga0105251_10000248 3300009011 Bacteria 54567
257 Ga0105250_10062687 3300009092 Bacteria 1496
258 Ga0105240_10003668 3300009093 Bacteria 23753
259 Ga0105240_10064613 3300009093 Bacteria 4546
260 Ga0105240_10081194 3300009093 Bacteria 3985
261 Ga0105240_10100168 3300009093 Bacteria 3526
262 Ga0105240_10126574 3300009093 Bacteria 3069
263 Ga0105240_10197043 3300009093 Bacteria 2363
264 Ga0105240_10598507 3300009093 Bacteria 1214
265 Ga0105240_11045527 3300009093 Bacteria 871
266 Ga0105240_11275867 3300009093 Bacteria 775
267 Ga0105240_11604328 3300009093 Bacteria 681
268 Ga0105245_10015502 3300009098 Bacteria 6645
269 Ga0105247_10009766 3300009101 Bacteria 5818
270 Ga0105247_10328332 3300009101 Bacteria 1070
271 Ga0105247_10426645 3300009101 Bacteria 950
272 Ga0105241_11828838 3300009174 Bacteria 593
273 Ga0105242_11164619 3300009176 Bacteria 788
274 Ga0105242_11708124 3300009176 Bacteria 666
275 Ga0105248_10000029 3300009177 Bacteria 223366
276 Ga0105248_10013274 3300009177 Bacteria 9068
277 Ga0105248_10015641 3300009177 Bacteria 8364
278 Ga0105248_10023145 3300009177 Bacteria 6900
279 Ga0105248_10277312 3300009177 Bacteria 1888
280 Ga0105248_10515419 3300009177 Bacteria 1348
281 Ga0105248_11308546 3300009177 Bacteria 820
282 Ga0105237_10180482 3300009545 Bacteria 2111
283 Ga0105237_10259578 3300009545 Bacteria 1740
284 Ga0105237_10553774 3300009545 Bacteria 1157
285 Ga0105238_10012645 3300009551 Bacteria 8518
286 Ga0105238_10016430 3300009551 Bacteria 7492
287 Ga0105238_10046820 3300009551 Bacteria 4362
288 Ga0105238_10084601 3300009551 Bacteria 3161
289 Ga0105238_10149356 3300009551 Bacteria 2312
290 Ga0105238_10388651 3300009551 Bacteria 1387
291 Ga0105238_10451628 3300009551 Bacteria 1282
292 Ga0105238_10603779 3300009551 Bacteria 1105
293 Ga0105238_10834039 3300009551 Bacteria 938
294 Ga0105238_11168291 3300009551 Bacteria 794
295 Ga0105238_11265184 3300009551 Bacteria 763
296 Ga0105249_10000016 3300009553 Bacteria 278643
297 Ga0105249_10000024 3300009553 Bacteria 232947
298 Ga0105249_10001221 3300009553 Bacteria 22640
299 Ga0105249_10004911 3300009553 Bacteria 11538
300 Ga0105249_10124105 3300009553 Bacteria 2457
301 Ga0105249_10507777 3300009553 Bacteria 1251
302 Ga0105249_11714494 3300009553 Bacteria 701
303 Ga0105249_11785396 3300009553 Bacteria 688
304 Ga0105148_106071 3300009978 Bacteria 882
305 Ga0105239_10441682 3300010375 Bacteria 1475
306 Ga0105239_10912481 3300010375 Bacteria 1008
307 Ga0105239_10979799 3300010375 Bacteria 972
308 Ga0105239_11738277 3300010375 Bacteria 722
309 Ga0157373_10007439 3300013100 Bacteria 8146
310 Ga0157373_11173312 3300013100 Bacteria 578
311 Ga0157371_10029586 3300013102 Bacteria 3959
312 Ga0157371_10326469 3300013102 Bacteria 1114
313 Ga0157371_10919045 3300013102 Bacteria 664
314 Ga0157370_10000337 3300013104 Bacteria 59072
315 Ga0157370_10018302 3300013104 Bacteria 7047
316 Ga0157370_10076269 3300013104 Bacteria 3158
317 Ga0157370_10874307 3300013104 Bacteria 816
318 Ga0157369_10053973 3300013105 Bacteria 4340
319 Ga0157369_10076889 3300013105 Bacteria 3578
320 Ga0157369_10182050 3300013105 Bacteria 2211
321 Ga0157369_10222324 3300013105 Bacteria 1976
322 Ga0157369_10488362 3300013105 Bacteria 1274
323 Ga0157374_10194251 3300013296 Bacteria 1986
324 Ga0163162_10010762 3300013306 Bacteria 8899
325 Ga0163162_10023427 3300013306 Bacteria 6093
326 Ga0163162_10042128 3300013306 Bacteria 4568
327 Ga0163162_10065922 3300013306 Bacteria 3670
328 Ga0163162_10359614 3300013306 Bacteria 1589
329 Ga0163162_11022988 3300013306 Bacteria 934
330 Ga0163162_11789719 3300013306 Bacteria 702
331 Ga0157372_10288904 3300013307 Bacteria 1907
332 Ga0157372_11329911 3300013307 Bacteria 829
333 Ga0157372_11498916 3300013307 Bacteria 777
334 Ga0157375_10008404 3300013308 Bacteria 9041
335 Ga0157375_11431435 3300013308 Bacteria 815
336 Ga0157375_13149554 3300013308 Bacteria 550
337 Ga0163163_10038593 3300014325 Bacteria 4656
338 Ga0163163_10055856 3300014325 Bacteria 3903
339 Ga0163163_10097195 3300014325 Bacteria 2965
340 Ga0163163_10166751 3300014325 Bacteria 2249
341 Ga0163163_10234354 3300014325 Bacteria 1885
342 Ga0163163_10303612 3300014325 Bacteria 1649
343 Ga0157380_10001406 3300014326 Bacteria 15727
344 Ga0157380_10063202 3300014326 Bacteria 2967
345 Ga0157380_10093428 3300014326 Bacteria 2487
346 Ga0157380_10779482 3300014326 Bacteria 971
347 Ga0157377_10108611 3300014745 Bacteria 1664
348 Ga0157379_10009077 3300014968 Bacteria 8665
349 Ga0157379_10072271 3300014968 Bacteria 3086
350 Ga0157379_10161443 3300014968 Bacteria 2023
351 Ga0157379_10472361 3300014968 Bacteria 1160
352 Ga0157376_11313567 3300014969 Bacteria 753
353 Ga0182006_1179295 3300015261 Bacteria 707
354 Ga0163161_10000044 3300017792 Bacteria 132739
355 Ga0163161_10031320 3300017792 Bacteria 3789
356 Ga0163161_10174942 3300017792 Bacteria 1643
357 Ga0163161_11060180 3300017792 Bacteria 695
358 Ga0213876_10145076 3300021384 Bacteria 1262
359 Ga0207672_1000703 3300025223 Bacteria 3812
360 Ga0209147_100963 3300025229 Bacteria 12611
361 Ga0207427_100584 3300025231 Bacteria 18382
362 Ga0209437_114754 3300025233 Bacteria 1082
363 Ga0209026_1000438 3300025250 Bacteria 34415
364 Ga0209026_1013091 3300025250 Bacteria 1421
365 Ga0209148_1021776 3300025254 Bacteria 1038
366 Ga0209233_1000003 3300025261 Bacteria 1607366
367 Ga0209565_1000522 3300025263 Bacteria 27324
368 Ga0209455_1008538 3300025272 Bacteria 2776
369 Ga0209673_1000645 3300025273 Bacteria 51774
370 Ga0209673_1039779 3300025273 Bacteria 1353
371 Ga0209675_1001152 3300025291 Bacteria 16106
372 Ga0209675_1011088 3300025291 Bacteria 3012
373 Ga0209676_1000136 3300025292 Bacteria 181860
374 Ga0209676_1000200 3300025292 Bacteria 133793
375 Ga0209025_1000014 3300025294 Bacteria 865448
376 Ga0209564_1000179 3300025295 Bacteria 151032
377 Ga0209564_1001982 3300025295 Bacteria 17950
378 Ga0209564_1011644 3300025295 Bacteria 3918
379 Ga0209758_1001527 3300025297 Bacteria 26774
380 Ga0209758_1005516 3300025297 Bacteria 9666
381 Ga0209758_1007344 3300025297 Bacteria 7542
382 Ga0209050_1000031 3300025298 Bacteria 458181
383 Ga0209050_1000057 3300025298 Bacteria 326289
384 Ga0209050_1000568 3300025298 Bacteria 59952
385 Ga0209050_1012182 3300025298 Bacteria 3976
386 Ga0209050_1072970 3300025298 Bacteria 759
387 Ga0209256_1000055 3300025299 Bacteria 295530
388 Ga0209256_1002486 3300025299 Bacteria 14935
389 Ga0209256_1005663 3300025299 Bacteria 7032
390 Ga0209256_1006970 3300025299 Bacteria 5753
391 Ga0209051_1000836 3300025303 Bacteria 31706
392 Ga0209257_1000073 3300025304 Bacteria 325833
393 Ga0209257_1000142 3300025304 Bacteria 200756
394 Ga0209257_1003059 3300025304 Bacteria 15077
395 Ga0209257_1008523 3300025304 Bacteria 5796
396 Ga0209257_1008959 3300025304 Bacteria 5502
397 Ga0209257_1015643 3300025304 Bacteria 3139
398 Ga0207697_10000419 3300025315 Bacteria 24002
399 Ga0207697_10009253 3300025315 Bacteria 4261
400 Ga0207656_10035738 3300025321 Bacteria 2082
401 Ga0207656_10335475 3300025321 Bacteria 753
402 Ga0207713_1001212 3300025735 Bacteria 21580
403 Ga0207682_10002821 3300025893 Bacteria 7679
404 Ga0207710_10000700 3300025900 Bacteria 18794
405 Ga0207710_10151366 3300025900 Bacteria 1126
406 Ga0207710_10181603 3300025900 Bacteria 1032
407 Ga0207688_10042242 3300025901 Bacteria 2538
408 Ga0207688_10360369 3300025901 Bacteria 897
409 Ga0207680_10000008 3300025903 Bacteria 518177
410 Ga0207680_10000481 3300025903 Bacteria 18900
411 Ga0207680_10079104 3300025903 Bacteria 2061
412 Ga0207647_10000283 3300025904 Bacteria 41512
413 Ga0207647_10507617 3300025904 Bacteria 672
414 Ga0207645_10383405 3300025907 Bacteria 944
415 Ga0207645_10492093 3300025907 Bacteria 830
416 Ga0207645_10603181 3300025907 Bacteria 745
417 Ga0207643_10064876 3300025908 Bacteria 2091
418 Ga0207705_10000143 3300025909 Bacteria 76756
419 Ga0207705_10054680 3300025909 Bacteria 2877
420 Ga0207705_10069151 3300025909 Bacteria 2557
421 Ga0207705_10074046 3300025909 Bacteria 2472
422 Ga0207654_10000709 3300025911 Bacteria 18611
423 Ga0207707_10101234 3300025912 Bacteria 2518
424 Ga0207707_10256813 3300025912 Bacteria 1517
425 Ga0207707_10405605 3300025912 Bacteria 1170
426 Ga0207695_10009002 3300025913 Bacteria 12420
427 Ga0207695_10009470 3300025913 Bacteria 12052
428 Ga0207695_10010373 3300025913 Bacteria 11402
429 Ga0207695_10038352 3300025913 Bacteria 5159
430 Ga0207695_10044298 3300025913 Bacteria 4734
431 Ga0207695_10056806 3300025913 Bacteria 4070
432 Ga0207695_10188499 3300025913 Bacteria 1981
433 Ga0207695_10355744 3300025913 Bacteria 1351
434 Ga0207695_10414414 3300025913 Bacteria 1231
435 Ga0207695_11609720 3300025913 Bacteria 530
436 Ga0207671_10001568 3300025914 Bacteria 26104
437 Ga0207671_10525924 3300025914 Bacteria 943
438 Ga0207660_10000991 3300025917 Bacteria 18818
439 Ga0207660_10056089 3300025917 Bacteria 2818
440 Ga0207660_10889173 3300025917 Bacteria 727
441 Ga0207657_10002070 3300025919 Bacteria 21704
442 Ga0207657_10004888 3300025919 Bacteria 14101
443 Ga0207657_10014275 3300025919 Bacteria 7764
444 Ga0207657_10018280 3300025919 Bacteria 6702
445 Ga0207657_10026597 3300025919 Bacteria 5312
446 Ga0207657_10740733 3300025919 Bacteria 762
447 Ga0207649_11430528 3300025920 Bacteria 547
448 Ga0207652_10003485 3300025921 Bacteria 12965
449 Ga0207681_10000004 3300025923 Bacteria 559005
450 Ga0207681_10000020 3300025923 Bacteria 240498
451 Ga0207681_10107655 3300025923 Bacteria 2022
452 Ga0207681_10293512 3300025923 Bacteria 1284
453 Ga0207681_11175584 3300025923 Bacteria 644
454 Ga0207694_10005414 3300025924 Bacteria 9825
455 Ga0207694_10114161 3300025924 Bacteria 2151
456 Ga0207694_10123581 3300025924 Bacteria 2068
457 Ga0207694_10137224 3300025924 Bacteria 1965
458 Ga0207694_10283404 3300025924 Bacteria 1361
459 Ga0207694_10553812 3300025924 Bacteria 965
460 Ga0207694_10879669 3300025924 Bacteria 757
461 Ga0207650_10000261 3300025925 Bacteria 56610
462 Ga0207650_10000315 3300025925 Bacteria 47489
463 Ga0207650_10003090 3300025925 Bacteria 11462
464 Ga0207650_10012044 3300025925 Bacteria 5961
465 Ga0207650_10154941 3300025925 Bacteria 1811
466 Ga0207650_10640789 3300025925 Bacteria 895
467 Ga0207659_10005578 3300025926 Bacteria 7637
468 Ga0207659_10006342 3300025926 Bacteria 7241
469 Ga0207659_10006968 3300025926 Bacteria 6943
470 Ga0207659_10143913 3300025926 Bacteria 1854
471 Ga0207687_10044477 3300025927 Bacteria 3065
472 Ga0207700_10323661 3300025928 Bacteria 1337
473 Ga0207700_10976282 3300025928 Bacteria 758
474 Ga0207664_10647883 3300025929 Bacteria 949
475 Ga0207644_10000009 3300025931 Bacteria 251643
476 Ga0207644_10014177 3300025931 Bacteria 5331
477 Ga0207644_10044963 3300025931 Bacteria 3140
478 Ga0207644_10051622 3300025931 Bacteria 2952
479 Ga0207644_10057497 3300025931 Bacteria 2808
480 Ga0207644_10100214 3300025931 Bacteria 2175
481 Ga0207644_10338644 3300025931 Bacteria 1219
482 Ga0207644_10847506 3300025931 Bacteria 765
483 Ga0207690_10000110 3300025932 Bacteria 67145
484 Ga0207690_10009268 3300025932 Bacteria 5848
485 Ga0207690_10017349 3300025932 Bacteria 4393
486 Ga0207690_10026667 3300025932 Bacteria 3641
487 Ga0207690_10054676 3300025932 Bacteria 2685
488 Ga0207706_10016946 3300025933 Bacteria 6572
489 Ga0207706_10036406 3300025933 Bacteria 4371
490 Ga0207706_10254636 3300025933 Bacteria 1533
491 Ga0207706_11260255 3300025933 Bacteria 612
492 Ga0207709_10491890 3300025935 Bacteria 956
493 Ga0207670_10026927 3300025936 Bacteria 3630
494 Ga0207669_10041028 3300025937 Bacteria 2690
495 Ga0207669_10477160 3300025937 Bacteria 993
496 Ga0207669_10523836 3300025937 Bacteria 952
497 Ga0207704_10007679 3300025938 Bacteria 5110
498 Ga0207704_10610601 3300025938 Bacteria 894
499 Ga0207691_10032535 3300025940 Bacteria 4862
500 Ga0207691_10169353 3300025940 Bacteria 1913
501 Ga0207691_10460236 3300025940 Bacteria 1082
502 Ga0207691_10510217 3300025940 Bacteria 1021
503 Ga0207711_10000004 3300025941 Bacteria 870636
504 Ga0207711_10009477 3300025941 Bacteria 8124
505 Ga0207711_10013577 3300025941 Bacteria 6764
506 Ga0207711_10029625 3300025941 Bacteria 4618
507 Ga0207711_10041111 3300025941 Bacteria 3936
508 Ga0207711_10056144 3300025941 Bacteria 3383
509 Ga0207711_10169418 3300025941 Bacteria 1981
510 Ga0207711_10210714 3300025941 Bacteria 1775
511 Ga0207689_10626428 3300025942 Bacteria 906
512 Ga0207689_10872919 3300025942 Bacteria 759
513 Ga0207661_10180015 3300025944 Bacteria 1846
514 Ga0207661_11118030 3300025944 Bacteria 725
515 Ga0207679_10358526 3300025945 Bacteria 1273
516 Ga0207667_10001801 3300025949 Bacteria 26994
517 Ga0207667_10013416 3300025949 Bacteria 9375
518 Ga0207667_10036818 3300025949 Bacteria 5239
519 Ga0207667_10053385 3300025949 Bacteria 4253
520 Ga0207667_10059635 3300025949 Bacteria 3996
521 Ga0207667_10123352 3300025949 Bacteria 2669
522 Ga0207667_10142838 3300025949 Bacteria 2464
523 Ga0207667_10150270 3300025949 Bacteria 2398
524 Ga0207667_10362778 3300025949 Bacteria 1477
525 Ga0207667_11733192 3300025949 Bacteria 590
526 Ga0207651_11458865 3300025960 Bacteria 616
527 Ga0207712_10000009 3300025961 Bacteria 518177
528 Ga0207712_10000034 3300025961 Bacteria 202320
529 Ga0207712_10000203 3300025961 Bacteria 59867
530 Ga0207712_10071327 3300025961 Bacteria 2498
531 Ga0207712_10178082 3300025961 Bacteria 1667
532 Ga0207712_10228300 3300025961 Bacteria 1493
533 Ga0207712_10710693 3300025961 Bacteria 878
534 Ga0207668_10000007 3300025972 Bacteria 190613
535 Ga0207668_10000427 3300025972 Bacteria 26560
536 Ga0207668_10004034 3300025972 Bacteria 8631
537 Ga0207668_10005648 3300025972 Bacteria 7366
538 Ga0207668_10120997 3300025972 Bacteria 1982
539 Ga0207668_10208223 3300025972 Bacteria 1562
540 Ga0207668_10800413 3300025972 Bacteria 834
541 Ga0207640_10294287 3300025981 Bacteria 1281
542 Ga0207640_10664059 3300025981 Bacteria 890
543 Ga0207640_11664499 3300025981 Bacteria 576
544 Ga0207640_11694003 3300025981 Bacteria 571
545 Ga0207658_10000239 3300025986 Bacteria 57662
546 Ga0207658_10001403 3300025986 Bacteria 18780
547 Ga0207658_10002888 3300025986 Bacteria 12319
548 Ga0207658_10003476 3300025986 Bacteria 11138
549 Ga0207658_10046036 3300025986 Bacteria 3183
550 Ga0207658_10243328 3300025986 Bacteria 1525
551 Ga0207658_10667250 3300025986 Bacteria 938
552 Ga0207658_10717296 3300025986 Bacteria 904
553 Ga0207658_11229636 3300025986 Bacteria 685
554 Ga0207677_10417158 3300026023 Bacteria 1142
555 Ga0207703_10000108 3300026035 Bacteria 97908
556 Ga0207703_10002484 3300026035 Bacteria 15989
557 Ga0207703_10011130 3300026035 Bacteria 7005
558 Ga0207703_10012829 3300026035 Bacteria 6534
559 Ga0207703_10027988 3300026035 Bacteria 4438
560 Ga0207703_11073939 3300026035 Bacteria 773
561 Ga0207703_11130197 3300026035 Bacteria 753
562 Ga0207639_10016045 3300026041 Bacteria 5291
563 Ga0207639_10022411 3300026041 Bacteria 4550
564 Ga0207639_10034836 3300026041 Bacteria 3723
565 Ga0207639_10122601 3300026041 Bacteria 2138
566 Ga0207639_10279469 3300026041 Bacteria 1468
567 Ga0207639_10611557 3300026041 Bacteria 1006
568 Ga0207639_10761684 3300026041 Bacteria 901
569 Ga0207678_10010321 3300026067 Bacteria 8197
570 Ga0207708_10307453 3300026075 Bacteria 1291
571 Ga0207708_10801234 3300026075 Bacteria 811
572 Ga0207702_10001125 3300026078 Bacteria 27311
573 Ga0207702_10009858 3300026078 Bacteria 8006
574 Ga0207641_10000010 3300026088 Bacteria 402193
575 Ga0207641_10000084 3300026088 Bacteria 133555
576 Ga0207641_10000171 3300026088 Bacteria 90550
577 Ga0207641_10002034 3300026088 Bacteria 19258
578 Ga0207641_10013577 3300026088 Bacteria 6681
579 Ga0207641_10034302 3300026088 Bacteria 4220
580 Ga0207641_10615749 3300026088 Bacteria 1064
581 Ga0207641_11345280 3300026088 Bacteria 715
582 Ga0207648_11000791 3300026089 Bacteria 783
583 Ga0207676_10000036 3300026095 Bacteria 198447
584 Ga0207676_10000137 3300026095 Bacteria 63867
585 Ga0207676_10000159 3300026095 Bacteria 59242
586 Ga0207676_10000532 3300026095 Bacteria 31972
587 Ga0207676_10001337 3300026095 Bacteria 18342
588 Ga0207676_10039021 3300026095 Bacteria 3629
589 Ga0207676_10130866 3300026095 Bacteria 2133
590 Ga0207676_10170852 3300026095 Bacteria 1894
591 Ga0207676_10244259 3300026095 Bacteria 1612
592 Ga0207676_10420033 3300026095 Bacteria 1254
593 Ga0207676_10488693 3300026095 Bacteria 1167
594 Ga0207674_10007324 3300026116 Bacteria 12852
595 Ga0207674_10043647 3300026116 Bacteria 4622
596 Ga0207674_10091873 3300026116 Bacteria 3025
597 Ga0207674_10104979 3300026116 Bacteria 2803
598 Ga0207674_11571122 3300026116 Bacteria 627
599 Ga0207675_100000740 3300026118 Bacteria 32427
600 Ga0207675_100341987 3300026118 Bacteria 1465
601 Ga0207675_100344498 3300026118 Bacteria 1459
602 Ga0207683_10006249 3300026121 Bacteria 10212
603 Ga0207683_10033876 3300026121 Bacteria 4438
604 Ga0207683_10396252 3300026121 Bacteria 1270
605 Ga0207698_10008309 3300026142 Bacteria 6556
606 Ga0207698_10067591 3300026142 Bacteria 2818
607 Ga0207698_10174095 3300026142 Bacteria 1898
608 Ga0207698_10613502 3300026142 Bacteria 1074
609 Ga0207698_11002603 3300026142 Bacteria 846
610 Ga0207698_12034203 3300026142 Bacteria 588
611 Ga0209981_1000702 3300027378 Bacteria 4239
612 Ga0209999_1052630 3300027543 Bacteria 770
613 Ga0209813_10410858 3300027866 Bacteria 547
614 Ga0209974_10187192 3300027876 Bacteria 760
615 Ga0268266_10000005 3300028379 Bacteria 1448194
616 Ga0268266_10000009 3300028379 Bacteria 1097737
617 Ga0268266_10001260 3300028379 Bacteria 30951
618 Ga0268266_10004041 3300028379 Bacteria 14177
619 Ga0268266_10006212 3300028379 Bacteria 10972
620 Ga0268266_10017622 3300028379 Bacteria 6090
621 Ga0268266_10044300 3300028379 Bacteria 3804
622 Ga0268266_10683782 3300028379 Bacteria 988
623 Ga0268266_10820520 3300028379 Bacteria 898
624 Ga0268266_10891891 3300028379 Bacteria 860
625 Ga0268266_11221520 3300028379 Bacteria 727
626 Ga0268265_10000059 3300028380 Bacteria 152531
627 Ga0268265_10000785 3300028380 Bacteria 30390
628 Ga0268265_10001269 3300028380 Bacteria 21775
629 Ga0268265_10002154 3300028380 Bacteria 15249
630 Ga0268265_10013764 3300028380 Bacteria 5506
631 Ga0268265_10122405 3300028380 Bacteria 2146
632 Ga0268265_10450897 3300028380 Bacteria 1201
633 Ga0268264_10000003 3300028381 Bacteria 1141976
634 Ga0268264_10000069 3300028381 Bacteria 270492
635 Ga0268264_10000270 3300028381 Bacteria 90954
636 Ga0268264_10000291 3300028381 Bacteria 84105
637 Ga0268264_10105163 3300028381 Bacteria 2462
638 Ga0268264_10710533 3300028381 Bacteria 999
639 Ga0265337_1000301 3300028556 Bacteria 26365
640 Ga0265326_10061962 3300028558 Bacteria 1058
641 Ga0265334_10001854 3300028573 Bacteria 10060
642 Ga0265334_10010930 3300028573 Bacteria 3830
643 Ga0307517_10002579 3300028786 Bacteria 28853
644 Ga0307517_10026151 3300028786 Bacteria 7089
645 Ga0307517_10203899 3300028786 Bacteria 1231
646 Ga0307515_10020192 3300028794 Bacteria 11909
647 Ga0307515_10079597 3300028794 Bacteria 4290
648 Ga0265338_10018706 3300028800 Bacteria 7402
649 Ga0265338_10042612 3300028800 Bacteria 4224
650 Ga0265338_10046066 3300028800 Bacteria 4000
651 Ga0265338_10438523 3300028800 Bacteria 926
652 Ga0316182_1013747 3300030745 Bacteria 1030
653 Ga0265328_10015604 3300031239 Bacteria 2971
654 Ga0265331_10357408 3300031250 Bacteria 654
655 Ga0265327_10000290 3300031251 Bacteria 98475
656 Ga0265327_10169311 3300031251 Bacteria 1004
657 Ga0265316_10799563 3300031344 Bacteria 661
658 Ga0307513_10000082 3300031456 Bacteria 131779
659 Ga0307513_10000588 3300031456 Bacteria 52189
660 Ga0307513_10001556 3300031456 Bacteria 32890
661 Ga0307513_10019635 3300031456 Bacteria 8039
662 Ga0307513_10454441 3300031456 Bacteria 1004
663 Ga0307408_100183150 3300031548 Bacteria 1681
664 Ga0307408_100279753 3300031548 Bacteria 1389
665 Ga0307408_101018801 3300031548 Bacteria 764
666 Ga0307408_101152087 3300031548 Bacteria 721
667 Ga0307508_10019452 3300031616 Bacteria 6173
668 Ga0265314_10035162 3300031711 Bacteria 3654
669 Ga0307516_10000042 3300031730 Bacteria 142687
670 Ga0307405_10025256 3300031731 Bacteria 3407
671 Ga0307405_10148601 3300031731 Bacteria 1644
672 Ga0307405_10394706 3300031731 Bacteria 1081
673 Ga0307405_10418418 3300031731 Bacteria 1054
674 Ga0307405_10689283 3300031731 Bacteria 845
675 Ga0307405_11419786 3300031731 Bacteria 607
676 Ga0307413_10010651 3300031824 Bacteria 4475
677 Ga0307413_10020991 3300031824 Bacteria 3486
678 Ga0307413_10034617 3300031824 Bacteria 2888
679 Ga0307413_10069560 3300031824 Bacteria 2209
680 Ga0307413_10094942 3300031824 Bacteria 1954
681 Ga0307410_10002874 3300031852 Bacteria 8473
682 Ga0307410_10004617 3300031852 Bacteria 7150
683 Ga0307410_10106133 3300031852 Bacteria 2023
684 Ga0307410_10218615 3300031852 Bacteria 1464
685 Ga0307406_10004611 3300031901 Bacteria 7504
686 Ga0307406_10029354 3300031901 Bacteria 3330
687 Ga0307406_10037970 3300031901 Bacteria 2979
688 Ga0307406_11164634 3300031901 Bacteria 668
689 Ga0307407_10219190 3300031903 Bacteria 1285
690 Ga0307412_10106977 3300031911 Bacteria 1990
691 Ga0307412_10641946 3300031911 Bacteria 904
692 Ga0307412_10784209 3300031911 Bacteria 826
693 Ga0307409_100018288 3300031995 Bacteria 4706
694 Ga0307409_100028346 3300031995 Bacteria 3988
695 Ga0307409_100074008 3300031995 Bacteria 2720
696 Ga0307409_100093174 3300031995 Bacteria 2474
697 Ga0307409_100134429 3300031995 Bacteria 2119
698 Ga0307409_100250522 3300031995 Bacteria 1619
699 Ga0307409_100294909 3300031995 Bacteria 1505
700 Ga0307409_101260394 3300031995 Bacteria 764
701 Ga0307409_101833883 3300031995 Bacteria 636
702 Ga0307416_100013746 3300032002 Bacteria 5514
703 Ga0307416_100622392 3300032002 Bacteria 1161
704 Ga0307416_102034830 3300032002 Bacteria 677
705 Ga0307414_10001123 3300032004 Bacteria 13682
706 Ga0307414_10031086 3300032004 Bacteria 3497
707 Ga0307414_10033278 3300032004 Bacteria 3405
708 Ga0307414_10034789 3300032004 Bacteria 3345
709 Ga0307414_10040435 3300032004 Bacteria 3149
710 Ga0307414_10044101 3300032004 Bacteria 3042
711 Ga0307414_10132321 3300032004 Bacteria 1938
712 Ga0307414_10150597 3300032004 Bacteria 1835
713 Ga0307414_10185069 3300032004 Bacteria 1679
714 Ga0307414_10356361 3300032004 Bacteria 1257
715 Ga0307414_10458543 3300032004 Bacteria 1119
716 Ga0307414_11104541 3300032004 Bacteria 732
717 Ga0307414_11412070 3300032004 Bacteria 647
718 Ga0307411_10002105 3300032005 Bacteria 8591
719 Ga0307411_10007909 3300032005 Bacteria 5464
720 Ga0307411_10010958 3300032005 Bacteria 4863
721 Ga0307411_10040851 3300032005 Bacteria 2945
722 Ga0307411_10053816 3300032005 Bacteria 2639
723 Ga0307411_10082107 3300032005 Bacteria 2221
724 Ga0307411_10424513 3300032005 Bacteria 1105
725 Ga0307411_10502385 3300032005 Bacteria 1025
726 Ga0307411_11512777 3300032005 Bacteria 617
727 Ga0307415_100001769 3300032126 Bacteria 10558
728 Ga0307415_100009137 3300032126 Bacteria 5537
729 Ga0307415_100648736 3300032126 Bacteria 946
730 Ga0307415_100767179 3300032126 Bacteria 877
731 Ga0307510_10001183 3300033180 Bacteria 28156
732 Ga0307510_10109455 3300033180 Bacteria 2512
733 Ga0307510_10222386 3300033180 Bacteria 1398
734 Ga0307510_10522340 3300033180 Bacteria 631
735 Ga0373944_0004351 3300035089 Bacteria 3685
736 Ga0373954_0540974 3300035118 Bacteria 577
737 Ga0373943_0236404 3300035170 Bacteria 1022
738 Ga0373946_0021252 3300035171 Bacteria 2515
739 Ga0373955_0405129 3300035172 Bacteria 829
740 Ga0373955_0439507 3300035172 Bacteria 795
741 Ga0373924_0052121 3300035410 Bacteria 1698
742 Ga0373935_0042740 3300035692 Bacteria 2851
743 Ga0373927_0000296 3300035695 Bacteria 39241
744 Ga0373927_0457505 3300035695 Bacteria 843
745 Ga0373933_0367402 3300035724 Bacteria 936
746 Ga0373947_0112393 3300035725 Bacteria 1723
747 Ga0373947_0188802 3300035725 Bacteria 1344
748 Ga0373925_0000022 3300037068 Bacteria 160046
749 Ga0373925_0174489 3300037068 Bacteria 1698
750 Ga0395899_0000070 3300037312 Bacteria 189668
751 Ga0395899_0000557 3300037312 Bacteria 40072
752 Ga0395899_0001588 3300037312 Bacteria 19105
753 Ga0395900_0000010 3300037418 Bacteria 461364
754 Ga0395900_0068674 3300037418 Bacteria 3642
755 Ga0395900_0207008 3300037418 Bacteria 1982
756 Ga0395900_0211287 3300037418 Bacteria 1959
757 Ga0395898_0008373 3300037466 Bacteria 10935
758 Ga0395898_0056246 3300037466 Bacteria 3835
759 Ga0395898_0934739 3300037466 Bacteria 804
760 Ga0395905_0006685 3300037471 Bacteria 11554
761 Ga0395905_0292885 3300037471 Bacteria 1514
762 Ga0395905_0311612 3300037471 Bacteria 1462
763 Ga0395905_0976057 3300037471 Bacteria 750
764 Ga0395901_0000007 3300038443 Bacteria 497408
765 Ga0395901_0455987 3300038443 Bacteria 1307
766 Ga0395901_0578871 3300038443 Bacteria 1134
767 Ga0436365_0294177 3300039437 Bacteria 1736
768 Ga0436365_1302053 3300039437 Bacteria 1578
769 Ga0436365_1922060 3300039437 Bacteria 5878
770 Ga0436363_0893999 3300039450 Bacteria 2011
771 Ga0436362_0653506 3300039453 Bacteria 609
772 Ga0439465_0110947 3300041413 Bacteria 955
773 Ga0451795_1077041 3300041456 Bacteria 798
774 Ga0451795_1363240 3300041456 Bacteria 771
775 Ga0451800_0600639 3300041459 Bacteria 754
776 Ga0451802_1507420 3300041460 Bacteria 5477
777 Ga0451806_832414 3300041462 Bacteria 2958
778 Ga0451807_1355475 3300041486 Bacteria 1623
779 Ga0451837_0420961 3300041494 Bacteria 831
780 Ga0451849_0234109 3300041505 Bacteria 541
781 Ga0451849_1130000 3300041505 Bacteria 553
782 Ga0451853_0872862 3300041512 Bacteria 886
783 Ga0451853_3659887 3300041512 Bacteria 668
784 Ga0439437_008353 3300042000 Bacteria 1164
785 Ga0439443_022726 3300042003 Bacteria 997
786 Ga0439443_058208 3300042003 Bacteria 688
787 Ga0439432_027318 3300042006 Bacteria 1864
788 Ga0439449_0028624 3300042007 Bacteria 2077
789 Ga0439449_0100976 3300042007 Bacteria 1067
790 Ga0439452_047041 3300042010 Bacteria 999
791 Ga0450923_020471 3300042125 Bacteria 1283
792 Ga0439446_0005219 3300042156 Bacteria 3332
793 Ga0439435_0004175 3300042436 Bacteria 3088
794 Ga0453684_0285987 3300044712 Bacteria 1879
795 Ga0453684_2375606 3300044712 Bacteria 526
796 Ga0466968_0022191 3300044735 Bacteria 2578
797 Ga0466970_0746345 3300044765 Bacteria 572
798 Ga0466957_0651425 3300044842 Bacteria 741
799 Ga0466957_0700690 3300044842 Bacteria 715
800 Ga0495627_000452 3300046453 Bacteria 35632
801 Ga0495627_015401 3300046453 Bacteria 2640
802 Ga0495592_0205417 3300046454 Bacteria 1327
803 Ga0495590_0008623 3300046457 Bacteria 3887
804 Ga0495638_0000388 3300046460 Bacteria 54286
805 Ga0495638_0000600 3300046460 Bacteria 40531
806 Ga0495638_0017040 3300046460 Bacteria 4854
807 Ga0495638_0023271 3300046460 Bacteria 4053
808 Ga0495638_0503855 3300046460 Bacteria 609
809 Ga0495650_0000007 3300046471 Bacteria 718072
810 Ga0495650_0094421 3300046471 Bacteria 1132
811 Ga0495585_0100574 3300046492 Bacteria 1546
812 Ga0495585_0370536 3300046492 Bacteria 693
813 Ga0495583_0000024 3300046506 Bacteria 274122
814 Ga0495583_0000252 3300046506 Bacteria 88617
815 Ga0495583_0022572 3300046506 Bacteria 3206
816 Ga0495583_0045121 3300046506 Bacteria 2040
817 Ga0495606_0065745 3300046507 Bacteria 2302
818 Ga0495606_0520385 3300046507 Bacteria 597
819 Ga0495610_0000029 3300046512 Bacteria 271137
820 Ga0495610_0000881 3300046512 Bacteria 27915
821 Ga0495610_0002304 3300046512 Bacteria 16132
822 Ga0495616_0001006 3300046513 Bacteria 20158
823 Ga0495620_0029399 3300046515 Bacteria 2543
824 Ga0495628_0264700 3300046516 Bacteria 1280
825 Ga0495631_0038639 3300046518 Bacteria 2121
826 Ga0495632_0000157 3300046519 Bacteria 70245
827 Ga0495632_0006938 3300046519 Bacteria 7190
828 Ga0495637_0004402 3300046520 Bacteria 7310
829 Ga0495637_0016220 3300046520 Bacteria 3484
830 Ga0495643_0045247 3300046522 Bacteria 2390
831 Ga0495643_0045411 3300046522 Bacteria 2385
832 Ga0495648_0000308 3300046524 Bacteria 54286
833 Ga0495648_0001559 3300046524 Bacteria 22402
834 Ga0495648_0034212 3300046524 Bacteria 3309
835 Ga0495648_0038169 3300046524 Bacteria 3076
836 Ga0495648_0057534 3300046524 Bacteria 2331
837 Ga0495648_0068312 3300046524 Bacteria 2074
838 Ga0495648_0076101 3300046524 Bacteria 1928
839 Ga0495648_0404720 3300046524 Bacteria 609
840 Ga0495642_0020993 3300046528 Bacteria 2567
841 Ga0495642_0129624 3300046528 Bacteria 1085
842 Ga0495654_0000116 3300046530 Bacteria 90109
843 Ga0495633_0000054 3300046558 Bacteria 151646
844 Ga0495633_0001711 3300046558 Bacteria 16447
845 Ga0495633_0023379 3300046558 Bacteria 3064
846 Ga0495633_0166943 3300046558 Bacteria 1015
847 Ga0495668_0006444 3300046616 Bacteria 7683
848 Ga0495668_0010494 3300046616 Bacteria 5603
849 Ga0495668_0013323 3300046616 Bacteria 4856
850 Ga0495668_0067858 3300046616 Bacteria 1962
851 Ga0495611_0059013 3300046648 Bacteria 1741
852 Ga0495625_0000051 3300046660 Bacteria 193325
853 Ga0495625_0002627 3300046660 Bacteria 19192
854 Ga0495625_0018457 3300046660 Bacteria 5445
855 Ga0495625_0029246 3300046660 Bacteria 4124
856 Ga0495625_0030245 3300046660 Bacteria 4042
857 Ga0495625_0060077 3300046660 Bacteria 2694
858 Ga0495625_0301060 3300046660 Bacteria 1026
859 Ga0495625_0336043 3300046660 Bacteria 958
860 Ga0495659_0268569 3300046664 Bacteria 714
861 Ga0495588_0108177 3300046674 Bacteria 1464
862 Ga0495669_0000271 3300046684 Bacteria 29724
863 Ga0495669_0000928 3300046684 Bacteria 12259
864 Ga0495670_0045322 3300046691 Bacteria 2196
865 Ga0495670_0427532 3300046691 Bacteria 717
866 Ga0495671_0000011 3300046692 Bacteria 365582
867 Ga0495671_0156059 3300046692 Bacteria 1111
868 Ga0495589_0012579 3300046794 Bacteria 4379
869 Ga0495636_0129360 3300047318 Bacteria 1122
870 Ga0495672_0013874 3300047320 Bacteria 5540
871 Ga0495672_0014296 3300047320 Bacteria 5442
872 Ga0495672_0014661 3300047320 Bacteria 5355
873 Ga0495677_0000624 3300047445 Bacteria 14278
874 Ga0495677_0007481 3300047445 Bacteria 4079
875 Ga0495677_0083613 3300047445 Bacteria 1198
876 Ga0495685_072904 3300047447 Bacteria 1149
877 Ga0495673_0000013 3300047469 Bacteria 612902
878 Ga0495673_0000082 3300047469 Bacteria 199141
879 Ga0495673_0000123 3300047469 Bacteria 144484
880 Ga0495673_0003676 3300047469 Bacteria 9996
881 Ga0495673_0022277 3300047469 Bacteria 3109
882 Ga0495681_0030772 3300047470 Bacteria 2728
883 Ga0495681_0088579 3300047470 Bacteria 1370
884 Ga0495684_0077116 3300047471 Bacteria 2531
885 Ga0495686_0000100 3300047472 Bacteria 180492
886 Ga0495686_0000238 3300047472 Bacteria 99919
887 Ga0495686_0003073 3300047472 Bacteria 14792
888 Ga0495686_0009819 3300047472 Bacteria 6866
889 Ga0495686_0028615 3300047472 Bacteria 3628
890 Ga0495686_0132217 3300047472 Bacteria 1478
891 Ga0495686_0138650 3300047472 Bacteria 1437
892 Ga0496100_1078895 3300048903 Bacteria 633
893 Ga0496101_0006329 3300048904 Bacteria 7619
894 Ga0496101_0018447 3300048904 Bacteria 4745
895 Ga0496101_0608415 3300048904 Bacteria 864
896 Ga0496101_0904271 3300048904 Bacteria 695
897 Ga0496101_1340704 3300048904 Bacteria 559
898 Ga0496102_0000640 3300048905 Bacteria 35507
899 Ga0496102_0029380 3300048905 Bacteria 4919
900 Ga0496102_0097880 3300048905 Bacteria 2721
901 Ga0496102_0139699 3300048905 Bacteria 2271
902 Ga0496103_0000197 3300048906 Bacteria 60344
903 Ga0496103_0009002 3300048906 Bacteria 5914
904 Ga0496103_0060835 3300048906 Bacteria 2348
905 Ga0496104_0074212 3300048907 Bacteria 3238
906 Ga0496105_0015983 3300048908 Bacteria 5985
907 Ga0496105_0052384 3300048908 Bacteria 3371
908 Ga0496105_0706547 3300048908 Bacteria 773
909 Ga0496106_0026998 3300048909 Bacteria 4275
910 Ga0496106_0423310 3300048909 Bacteria 1070
911 Ga0496107_0000121 3300048910 Bacteria 38317
912 Ga0496107_0025098 3300048910 Bacteria 4218
913 Ga0496107_0096922 3300048910 Bacteria 2159
914 Ga0496108_0003451 3300048911 Bacteria 12680
915 Ga0496108_0796972 3300048911 Bacteria 815
916 Ga0496108_0964045 3300048911 Bacteria 730
917 Ga0496109_0024820 3300048912 Bacteria 5334
918 Ga0496109_0076421 3300048912 Bacteria 3080
919 Ga0496109_0431172 3300048912 Bacteria 1245
920 Ga0496109_0579228 3300048912 Bacteria 1058
921 Ga0496109_1651420 3300048912 Bacteria 575
922 Ga0496110_0099642 3300048913 Bacteria 2605
923 Ga0496110_0182555 3300048913 Bacteria 1905
924 Ga0496110_0385780 3300048913 Bacteria 1277
925 Ga0496110_0661306 3300048913 Bacteria 945
926 Ga0496111_0145990 3300048914 Bacteria 1754
927 Ga0496111_0220641 3300048914 Bacteria 1408
928 Ga0496113_0090524 3300048916 Bacteria 2357
929 Ga0496113_0482023 3300048916 Bacteria 996
930 Ga0496114_0905321 3300048917 Bacteria 763
931 Ga0496115_0002044 3300048918 Bacteria 14436
932 Ga0496115_0002144 3300048918 Bacteria 14121
933 Ga0496115_0007768 3300048918 Bacteria 7909
934 Ga0496115_0008541 3300048918 Bacteria 7580
935 Ga0496115_0248007 3300048918 Bacteria 1467
936 Ga0496116_0001609 3300048919 Bacteria 24823
937 Ga0496116_0115536 3300048919 Bacteria 1565
938 Ga0496117_0000467 3300048920 Bacteria 67483
939 Ga0496117_0008343 3300048920 Bacteria 9854
940 Ga0496117_0016499 3300048920 Bacteria 6232
941 Ga0496117_0020058 3300048920 Bacteria 5466
942 Ga0496117_0093639 3300048920 Bacteria 1926
943 Ga0496117_0166198 3300048920 Bacteria 1286
944 Ga0496117_0449135 3300048920 Bacteria 638
945 Ga0496118_0000335 3300048921 Bacteria 80253
946 Ga0496118_0000459 3300048921 Bacteria 67483
947 Ga0496118_0000743 3300048921 Bacteria 52692
948 Ga0496118_0021279 3300048921 Bacteria 5716
949 Ga0496118_0064154 3300048921 Bacteria 2697
950 Ga0496119_0011329 3300048922 Bacteria 7404
951 Ga0496119_0044227 3300048922 Bacteria 2806
952 Ga0496119_0116078 3300048922 Bacteria 1478
953 Ga0496120_0016905 3300048923 Bacteria 4749
954 Ga0496121_0001561 3300048924 Bacteria 38247
955 Ga0496121_0002963 3300048924 Bacteria 24733
956 Ga0496121_0009838 3300048924 Bacteria 10913
957 Ga0496121_0012838 3300048924 Bacteria 9066
958 Ga0496121_0098049 3300048924 Bacteria 2269
959 Ga0496122_0016984 3300048925 Bacteria 6837
960 Ga0496122_0066335 3300048925 Bacteria 2608
961 Ga0496122_0150758 3300048925 Bacteria 1436
962 Ga0496123_0001927 3300048926 Bacteria 27057
963 Ga0496123_0029719 3300048926 Bacteria 4013
964 Ga0496123_0125975 3300048926 Bacteria 1430
965 Ga0496124_0000499 3300048927 Bacteria 67483
966 Ga0496124_0057012 3300048927 Bacteria 3293
967 Ga0496124_0106180 3300048927 Bacteria 2267
968 Ga0496124_0113186 3300048927 Bacteria 2181
969 Ga0496125_0000847 3300048928 Bacteria 49025
970 Ga0496125_0054561 3300048928 Bacteria 3264
971 Ga0496125_0060613 3300048928 Bacteria 3040
972 Ga0496126_0082405 3300048929 Bacteria 2842
973 Ga0496126_0519196 3300048929 Bacteria 949
974 Ga0495678_001696 3300049459 Bacteria 16649
975 Ga0495678_088164 3300049459 Bacteria 1099
976 Ga0501290_000220 3300049513 Bacteria 9492
977 Ga0501290_022754 3300049513 Bacteria 866
978 Ga0501292_000293 3300049515 Bacteria 6975
979 Ga0501294_000018 3300049517 Bacteria 17168
980 Ga0501298_009530 3300049521 Bacteria 1655
981 Ga0501299_011524 3300049522 Bacteria 1495
982 Ga0501300_016550 3300049523 Bacteria 1076
983 Ga0501032_0104122 3300049569 Bacteria 1880
984 Ga0501033_0001860 3300049570 Bacteria 18348
985 Ga0501033_0288480 3300049570 Bacteria 1157
986 Ga0501034_0010595 3300049571 Bacteria 9592
987 Ga0501034_0215246 3300049571 Bacteria 1875
988 Ga0501037_0013995 3300049573 Bacteria 5911
989 Ga0501047_0030781 3300049581 Bacteria 5173
990 Ga0501047_0122703 3300049581 Bacteria 2479
991 Ga0501047_0201623 3300049581 Bacteria 1851
992 Ga0501047_0203525 3300049581 Bacteria 1840
993 Ga0501047_0700964 3300049581 Bacteria 830
994 Ga0501047_0912146 3300049581 Bacteria 692
995 Ga0501047_1292278 3300049581 Bacteria 544
996 Ga0501073_0870059 3300049589 Bacteria 621
997 Ga0501202_003687 3300049652 Bacteria 2637
998 Ga0501206_015579 3300049653 Bacteria 1053
999 Ga0501207_005853 3300049654 Bacteria 1712
1000 Ga0501223_001222 3300049663 Bacteria 5997
1001 Ga0501224_001050 3300049664 Bacteria 3600
1002 Ga0501233_003537 3300049668 Bacteria 2814
1003 Ga0501240_127468 3300049673 Bacteria 506
1004 Ga0501257_000056 3300049686 Bacteria 31013
1005 Ga0501257_009651 3300049686 Bacteria 2182
1006 Ga0501259_000802 3300049688 Bacteria 5142
1007 Ga0501261_000122 3300049690 Bacteria 11656
1008 Ga0501221_003027 3300049704 Bacteria 2770
1009 Ga0501225_0183335 3300049705 Bacteria 655
1010 Ga0501245_000451 3300049708 Bacteria 4984
1011 Ga0501080_0299724 3300049742 Bacteria 1458
1012 Ga0501276_003789 3300049773 Bacteria 1112
1013 Ga0501279_000004 3300049775 Bacteria 175612
1014 Ga0501280_000014 3300049776 Bacteria 57720
1015 Ga0501280_001732 3300049776 Bacteria 3854
1016 Ga0501281_00038 3300049777 Bacteria 15084
1017 Ga0501282_000231 3300049778 Bacteria 6797
1018 Ga0501283_003046 3300049779 Bacteria 2202
1019 Ga0501035_0370422 3300049822 Bacteria 1196
1020 Ga0501044_0033231 3300049823 Bacteria 5422
1021 Ga0501044_0055925 3300049823 Bacteria 4051
1022 nmdc:mga03683_3161_c1 3300050489 Bacteria 5253
1023 nmdc:mga03n38_5359_c1 3300050490 Bacteria 4358
1024 nmdc:mga00v17_393_c1 3300050491 Bacteria 13156
1025 nmdc:mga0yw44_142800_c1 3300050492 Bacteria 1556
1026 nmdc:mga0k408_15166_c1 3300050493 Bacteria 4259
1027 nmdc:mga0k408_193958_c1 3300050493 Bacteria 1212
1028 nmdc:mga0k408_223106_c1 3300050493 Bacteria 1125
1029 nmdc:mga0k408_437006_c1 3300050493 Bacteria 778
1030 nmdc:mga06z11_126503_c1 3300050494 Bacteria 1431
1031 nmdc:mga04h51_456516_c1 3300050495 Bacteria 541
1032 nmdc:mga0a205_98112_c1 3300050515 Bacteria 2828
1033 nmdc:mga0sz30_31278_c1 3300050516 Bacteria 2202
1034 nmdc:mga0sz30_50133_c1 3300050516 Bacteria 1769
1035 Ga0495595_0622429 3300053084 Bacteria 552
1036 Ga0495619_0400619 3300053085 Bacteria 948
1037 Ga0500578_0000005 3300053086 Bacteria 243789
1038 Ga0500578_0251242 3300053086 Bacteria 1065
1039 Ga0500643_000098 3300053087 Bacteria 91878
1040 Ga0500643_013197 3300053087 Bacteria 2926
1041 Ga0500643_021260 3300053087 Bacteria 2105
1042 Ga0500643_035777 3300053087 Bacteria 1486
1043 Ga0500644_0000191 3300053088 Bacteria 38234
1044 Ga0500646_0041340 3300053090 Bacteria 1299
1045 Ga0500651_0002418 3300053093 Bacteria 9848
1046 Ga0500651_0101381 3300053093 Bacteria 1764
1047 Ga0500641_0002380 3300053096 Bacteria 6666
1048 Ga0500641_0008336 3300053096 Bacteria 3695
1049 Ga0500641_0021432 3300053096 Bacteria 2463
1050 Ga0500641_0296780 3300053096 Bacteria 665
1051 Ga0500650_0076533 3300053098 Bacteria 1564
1052 Ga0500554_002752 3300053102 Bacteria 3500
1053 Ga0500554_044694 3300053102 Bacteria 1374
1054 Ga0500555_001203 3300053103 Bacteria 8432
1055 Ga0500556_0000044 3300053104 Bacteria 132744
1056 Ga0500556_0000740 3300053104 Bacteria 19669
1057 Ga0500557_179065 3300053105 Bacteria 689
1058 Ga0500562_000175 3300053108 Bacteria 17715
1059 Ga0500562_000539 3300053108 Bacteria 9175
1060 Ga0500562_022962 3300053108 Bacteria 1627
1061 Ga0500594_0000329 3300053118 Bacteria 10615
1062 Ga0500595_013284 3300053119 Bacteria 3158
1063 Ga0500617_144707 3300053124 Bacteria 949
1064 Ga0500618_000129 3300053125 Bacteria 62710
1065 Ga0500642_0000014 3300053130 Bacteria 182110
1066 Ga0500642_0314444 3300053130 Bacteria 704
1067 Ga0500652_113436 3300053131 Bacteria 1133
1068 Ga0500655_000552 3300053133 Bacteria 7530
1069 Ga0500655_064507 3300053133 Bacteria 741
1070 Ga0500655_118560 3300053133 Bacteria 561
1071 Ga0500559_0000008 3300053136 Bacteria 182182
1072 Ga0500564_000070 3300053138 Bacteria 27126
1073 Ga0500577_0000387 3300053142 Bacteria 11291
1074 Ga0500590_005198 3300053148 Bacteria 6244
1075 Ga0500604_0125251 3300053151 Bacteria 861
1076 Ga0500616_0032802 3300053153 Bacteria 2838
1077 Ga0500622_0002118 3300053156 Bacteria 14773
1078 Ga0500622_0002582 3300053156 Bacteria 12950
1079 Ga0500622_0015725 3300053156 Bacteria 4049
1080 Ga0500622_0026143 3300053156 Bacteria 3082
1081 Ga0500627_0030496 3300053158 Bacteria 2258
1082 Ga0500611_010777 3300053727 Bacteria 1493
1083 Ga0500645_002580 3300053730 Bacteria 7965
1084 Ga0500645_002603 3300053730 Bacteria 7927
1085 Ga0500645_038494 3300053730 Bacteria 1419
1086 Ga0500609_000068 3300053731 Bacteria 13589
1087 Ga0501084_0502495 3300054114 Bacteria 1025
1088 Ga0501084_0570927 3300054114 Bacteria 956
1089 Ga0587077_140239 3300059493 Bacteria 622
1090 Ga0587072_093424 3300059643 Bacteria 666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221663 2644354299 144
2 iso_pu_bacteria 2928972540 2928975532 144
3 iso_pu_bacteria 2977240413 2977241563 144
4 iso_pu_bacteria 2941485952 2941487182 145
5 3300049653 Ga0501206_015579 Ga0501206_015579_22_504 147
6 3300001976 JGI24752J21851_1003520 JGI24752J21851_10035202 148
7 3300002239 JGI24034J26672_10007683 JGI24034J26672_100076831 148
8 3300005295 Ga0065707_10135510 Ga0065707_101355102 148
9 3300005331 Ga0070670_100000964 Ga0070670_10000096412 148
10 3300005335 Ga0070666_10000089 Ga0070666_1000008947 148
11 3300005347 Ga0070668_100042077 Ga0070668_1000420772 148
12 3300005353 Ga0070669_100000024 Ga0070669_100000024133 148
13 3300005355 Ga0070671_100000006 Ga0070671_100000006119 148
14 3300005367 Ga0070667_100169034 Ga0070667_1001690342 148
15 3300005445 Ga0070708_100044003 Ga0070708_1000440032 148
16 3300005548 Ga0070665_100060695 Ga0070665_1000606952 148
17 3300005617 Ga0068859_100000256 Ga0068859_10000025622 148
18 3300005618 Ga0068864_100001437 Ga0068864_1000014372 148
19 3300005719 Ga0068861_100000799 Ga0068861_10000079918 148
20 3300005841 Ga0068863_100005179 Ga0068863_10000517910 148
21 3300005842 Ga0068858_100009402 Ga0068858_1000094029 148
22 3300005843 Ga0068860_100074007 Ga0068860_1000740072 148
23 3300005844 Ga0068862_100000310 Ga0068862_10000031017 148
24 3300006931 Ga0097620_100000256 Ga0097620_10000025622 148
25 3300009101 Ga0105247_10009766 Ga0105247_100097662 148
26 3300009177 Ga0105248_10015641 Ga0105248_100156415 148
27 3300009553 Ga0105249_10004911 Ga0105249_100049119 148
28 3300013102 Ga0157371_10029586 Ga0157371_100295862 148
29 3300013104 Ga0157370_10018302 Ga0157370_100183022 148
30 3300013105 Ga0157369_10076889 Ga0157369_100768894 148
31 3300013306 Ga0163162_10065922 Ga0163162_100659222 148
32 3300014325 Ga0163163_10038593 Ga0163163_100385934 148
33 3300014326 Ga0157380_10093428 Ga0157380_100934283 148
34 3300014968 Ga0157379_10009077 Ga0157379_1000907711 148
35 3300025315 Ga0207697_10000419 Ga0207697_100004192 148
36 3300025900 Ga0207710_10000700 Ga0207710_100007008 148
37 3300025903 Ga0207680_10000481 Ga0207680_100004818 148
38 3300025923 Ga0207681_10000004 Ga0207681_10000004307 148
39 3300025925 Ga0207650_10003090 Ga0207650_1000309011 148
40 3300025931 Ga0207644_10000009 Ga0207644_10000009131 148
41 3300025941 Ga0207711_10029625 Ga0207711_100296254 148
42 3300025961 Ga0207712_10228300 Ga0207712_102283002 148
43 3300025972 Ga0207668_10004034 Ga0207668_1000403410 148
44 3300025986 Ga0207658_10002888 Ga0207658_1000288811 148
45 3300026035 Ga0207703_10002484 Ga0207703_100024842 148
46 3300026088 Ga0207641_10013577 Ga0207641_100135775 148
47 3300026095 Ga0207676_10000532 Ga0207676_1000053215 148
48 3300026118 Ga0207675_100000740 Ga0207675_1000007406 148
49 3300028379 Ga0268266_10044300 Ga0268266_100443005 148
50 3300028380 Ga0268265_10001269 Ga0268265_1000126917 148
51 3300028381 Ga0268264_10000069 Ga0268264_10000069115 148
52 3300031731 Ga0307405_10418418 Ga0307405_104184182 148
53 3300031824 Ga0307413_10094942 Ga0307413_100949421 148
54 3300032004 Ga0307414_10031086 Ga0307414_100310863 148
55 3300032004 Ga0307414_10458543 Ga0307414_104585432 148
56 3300032004 Ga0307414_11104541 Ga0307414_111045412 148
57 3300044712 Ga0453684_2375606 Ga0453684_2375606_10_459 148
58 3300046558 Ga0495633_0001711 Ga0495633_0001711_9484_9945 148
59 3300048925 Ga0496122_0016984 Ga0496122_0016984_3818_4279 148
60 3300048926 Ga0496123_0001927 Ga0496123_0001927_8560_9021 148
61 3300048929 Ga0496126_0519196 Ga0496126_0519196_31_480 148
62 3300049589 Ga0501073_0870059 Ga0501073_0870059_54_512 148
63 3300049742 Ga0501080_0299724 Ga0501080_0299724_98_556 148
64 3300053093 Ga0500651_0101381 Ga0500651_0101381_803_1252 148
65 3300054114 Ga0501084_0502495 Ga0501084_0502495_202_660 148
66 3300001989 JGI24739J22299_10041509 JGI24739J22299_100415091 149
67 3300001990 JGI24737J22298_10035820 JGI24737J22298_100358201 149
68 3300002067 JGI24735J21928_10036153 JGI24735J21928_100361531 149
69 3300003214 JGI25165J46597_1000187 JGI25165J46597_100018732 149
70 3300005289 Ga0065704_10006330 Ga0065704_100063306 149
71 3300005327 Ga0070658_10673687 Ga0070658_106736871 149
72 3300005339 Ga0070660_100001221 Ga0070660_1000012213 149
73 3300005339 Ga0070660_100005294 Ga0070660_1000052947 149
74 3300005347 Ga0070668_100038482 Ga0070668_1000384824 149
75 3300005353 Ga0070669_100245533 Ga0070669_1002455332 149
76 3300005354 Ga0070675_100001982 Ga0070675_10000198211 149
77 3300005355 Ga0070671_100022048 Ga0070671_1000220484 149
78 3300005356 Ga0070674_100006812 Ga0070674_1000068123 149
79 3300005366 Ga0070659_100014000 Ga0070659_1000140002 149
80 3300005367 Ga0070667_100002997 Ga0070667_1000029977 149
81 3300005543 Ga0070672_100026452 Ga0070672_1000264522 149
82 3300005548 Ga0070665_100001608 Ga0070665_1000016089 149
83 3300005548 Ga0070665_100007364 Ga0070665_1000073643 149
84 3300005563 Ga0068855_100307069 Ga0068855_1003070692 149
85 3300005614 Ga0068856_100048263 Ga0068856_1000482635 149
86 3300005614 Ga0068856_100120561 Ga0068856_1001205613 149
87 3300005841 Ga0068863_100000072 Ga0068863_100000072106 149
88 3300005842 Ga0068858_100032391 Ga0068858_1000323914 149
89 3300005843 Ga0068860_100000549 Ga0068860_10000054931 149
90 3300006051 Ga0075364_10137254 Ga0075364_101372542 149
91 3300009093 Ga0105240_10126574 Ga0105240_101265742 149
92 3300009176 Ga0105242_11164619 Ga0105242_111646192 149
93 3300013104 Ga0157370_10000337 Ga0157370_1000033748 149
94 3300013105 Ga0157369_10182050 Ga0157369_101820502 149
95 3300013105 Ga0157369_10222324 Ga0157369_102223242 149
96 3300017792 Ga0163161_10031320 Ga0163161_100313203 149
97 3300025229 Ga0209147_100963 Ga0209147_1009634 149
98 3300025231 Ga0207427_100584 Ga0207427_10058414 149
99 3300025233 Ga0209437_114754 Ga0209437_1147542 149
100 3300025261 Ga0209233_1000003 Ga0209233_100000332 149
101 3300025904 Ga0207647_10507617 Ga0207647_105076171 149
102 3300025909 Ga0207705_10000143 Ga0207705_1000014341 149
103 3300025913 Ga0207695_10038352 Ga0207695_100383524 149
104 3300025913 Ga0207695_10414414 Ga0207695_104144141 149
105 3300025919 Ga0207657_10004888 Ga0207657_1000488813 149
106 3300025919 Ga0207657_10014275 Ga0207657_100142755 149
107 3300025926 Ga0207659_10006968 Ga0207659_100069689 149
108 3300025931 Ga0207644_10014177 Ga0207644_100141775 149
109 3300025932 Ga0207690_10017349 Ga0207690_100173495 149
110 3300025937 Ga0207669_10041028 Ga0207669_100410283 149
111 3300025940 Ga0207691_10032535 Ga0207691_100325354 149
112 3300025949 Ga0207667_10150270 Ga0207667_101502703 149
113 3300025972 Ga0207668_10120997 Ga0207668_101209972 149
114 3300025986 Ga0207658_10003476 Ga0207658_100034764 149
115 3300026035 Ga0207703_10027988 Ga0207703_100279884 149
116 3300026078 Ga0207702_10009858 Ga0207702_100098583 149
117 3300026088 Ga0207641_10000084 Ga0207641_10000084107 149
118 3300026121 Ga0207683_10006249 Ga0207683_100062498 149
119 3300028379 Ga0268266_10004041 Ga0268266_100040418 149
120 3300028379 Ga0268266_11221520 Ga0268266_112215201 149
121 3300028381 Ga0268264_10000291 Ga0268264_1000029164 149
122 3300031731 Ga0307405_10394706 Ga0307405_103947061 149
123 3300032004 Ga0307414_10001123 Ga0307414_1000112312 149
124 3300032004 Ga0307414_10034789 Ga0307414_100347892 149
125 3300032004 Ga0307414_10044101 Ga0307414_100441013 149
126 3300032004 Ga0307414_10150597 Ga0307414_101505971 149
127 3300037312 Ga0395899_0001588 Ga0395899_0001588_12967_13431 149
128 3300037418 Ga0395900_0211287 Ga0395900_0211287_233_697 149
129 3300041456 Ga0451795_1363240 Ga0451795_1363240_176_640 149
130 3300041460 Ga0451802_1507420 Ga0451802_1507420_194_658 149
131 3300041486 Ga0451807_1355475 Ga0451807_1355475_426_890 149
132 3300041494 Ga0451837_0420961 Ga0451837_0420961_54_503 149
133 3300041512 Ga0451853_3659887 Ga0451853_3659887_202_654 149
134 3300046453 Ga0495627_015401 Ga0495627_015401_2143_2595 149
135 3300046460 Ga0495638_0000388 Ga0495638_0000388_51397_51846 149
136 3300046506 Ga0495583_0000252 Ga0495583_0000252_40476_40925 149
137 3300046519 Ga0495632_0006938 Ga0495632_0006938_4536_4985 149
138 3300046524 Ga0495648_0000308 Ga0495648_0000308_2441_2890 149
139 3300046524 Ga0495648_0034212 Ga0495648_0034212_163_615 149
140 3300046524 Ga0495648_0038169 Ga0495648_0038169_1508_1960 149
141 3300046558 Ga0495633_0000054 Ga0495633_0000054_17332_17784 149
142 3300046558 Ga0495633_0023379 Ga0495633_0023379_702_1151 149
143 3300046692 Ga0495671_0000011 Ga0495671_0000011_47662_48111 149
144 3300047469 Ga0495673_0000013 Ga0495673_0000013_315726_316175 149
145 3300048926 Ga0496123_0125975 Ga0496123_0125975_28_480 149
146 3300048927 Ga0496124_0106180 Ga0496124_0106180_21_473 149
147 3300048928 Ga0496125_0060613 Ga0496125_0060613_1838_2290 149
148 3300049673 Ga0501240_127468 Ga0501240_127468_26_490 149
149 iso_pu_bacteria 2643221614 2644085345 149
150 iso_pu_bacteria 2643221661 2644342897 149
151 iso_pu_bacteria 2643221666 2644366197 149
152 3300005327 Ga0070658_11262561 Ga0070658_112625611 150
153 3300005548 Ga0070665_100930616 Ga0070665_1009306161 150
154 3300005617 Ga0068859_100648393 Ga0068859_1006483932 150
155 3300005618 Ga0068864_100000191 Ga0068864_10000019122 150
156 3300005841 Ga0068863_101966986 Ga0068863_1019669861 150
157 3300005842 Ga0068858_100000487 Ga0068858_10000048733 150
158 3300006931 Ga0097620_100648476 Ga0097620_1006484762 150
159 3300009093 Ga0105240_11275867 Ga0105240_112758672 150
160 3300009545 Ga0105237_10259578 Ga0105237_102595782 150
161 3300010375 Ga0105239_10441682 Ga0105239_104416821 150
162 3300013306 Ga0163162_10023427 Ga0163162_100234272 150
163 3300013306 Ga0163162_11022988 Ga0163162_110229882 150
164 3300025250 Ga0209026_1013091 Ga0209026_10130912 150
165 3300025272 Ga0209455_1008538 Ga0209455_10085382 150
166 3300025304 Ga0209257_1015643 Ga0209257_10156434 150
167 3300025315 Ga0207697_10009253 Ga0207697_100092533 150
168 3300025961 Ga0207712_10178082 Ga0207712_101780822 150
169 3300026035 Ga0207703_10000108 Ga0207703_1000010828 150
170 3300026035 Ga0207703_11073939 Ga0207703_110739391 150
171 3300026095 Ga0207676_10000137 Ga0207676_1000013738 150
172 3300026118 Ga0207675_100344498 Ga0207675_1003444982 150
173 3300026121 Ga0207683_10396252 Ga0207683_103962521 150
174 3300028379 Ga0268266_10820520 Ga0268266_108205201 150
175 3300031239 Ga0265328_10015604 Ga0265328_100156042 150
176 3300031456 Ga0307513_10454441 Ga0307513_104544411 150
177 3300033180 Ga0307510_10001183 Ga0307510_100011839 150
178 3300039453 Ga0436362_0653506 Ga0436362_0653506_23_499 150
179 3300041456 Ga0451795_1077041 Ga0451795_1077041_311_766 150
180 3300046506 Ga0495583_0045121 Ga0495583_0045121_1326_1781 150
181 3300046524 Ga0495648_0076101 Ga0495648_0076101_1283_1738 150
182 3300046616 Ga0495668_0013323 Ga0495668_0013323_1031_1483 150
183 3300046660 Ga0495625_0002627 Ga0495625_0002627_2107_2559 150
184 3300047445 Ga0495677_0000624 Ga0495677_0000624_4175_4630 150
185 3300047472 Ga0495686_0000238 Ga0495686_0000238_97908_98363 150
186 3300048911 Ga0496108_0964045 Ga0496108_0964045_218_673 150
187 3300049581 Ga0501047_1292278 Ga0501047_1292278_61_519 150
188 3300050493 nmdc:mga0k408_193958_c1 nmdc:mga0k408_193958_c1_568_1020 150
189 3300053087 Ga0500643_021260 Ga0500643_021260_1340_1792 150
190 3300053087 Ga0500643_035777 Ga0500643_035777_881_1333 150
191 3300053096 Ga0500641_0008336 Ga0500641_0008336_48_500 150
192 3300053098 Ga0500650_0076533 Ga0500650_0076533_586_1038 150
193 3300053102 Ga0500554_044694 Ga0500554_044694_589_1044 150
194 3300053104 Ga0500556_0000044 Ga0500556_0000044_130253_130705 150
195 3300053108 Ga0500562_022962 Ga0500562_022962_896_1348 150
196 3300053124 Ga0500617_144707 Ga0500617_144707_109_561 150
197 3300053130 Ga0500642_0000014 Ga0500642_0000014_87644_88096 150
198 3300053131 Ga0500652_113436 Ga0500652_113436_595_1050 150
199 iso_pu_bacteria 2508501050 2508728360 150
200 iso_pu_bacteria 2582581305 2585263157 150
201 iso_pu_bacteria 2775506901 2776259310 150
202 3300005435 Ga0070714_100455486 Ga0070714_1004554861 151
203 3300005436 Ga0070713_100849190 Ga0070713_1008491902 151
204 3300005618 Ga0068864_100018087 Ga0068864_1000180874 151
205 3300005844 Ga0068862_100416236 Ga0068862_1004162362 151
206 3300009176 Ga0105242_11708124 Ga0105242_117081241 151
207 3300013104 Ga0157370_10874307 Ga0157370_108743072 151
208 3300025913 Ga0207695_11609720 Ga0207695_116097201 151
209 3300025928 Ga0207700_10323661 Ga0207700_103236612 151
210 3300025928 Ga0207700_10976282 Ga0207700_109762822 151
211 3300025929 Ga0207664_10647883 Ga0207664_106478831 151
212 3300025949 Ga0207667_11733192 Ga0207667_117331921 151
213 3300026095 Ga0207676_10039021 Ga0207676_100390214 151
214 3300028380 Ga0268265_10013764 Ga0268265_100137644 151
215 3300028556 Ga0265337_1000301 Ga0265337_10003018 151
216 3300028573 Ga0265334_10001854 Ga0265334_100018544 151
217 3300028800 Ga0265338_10042612 Ga0265338_100426123 151
218 3300031344 Ga0265316_10799563 Ga0265316_107995631 151
219 3300031616 Ga0307508_10019452 Ga0307508_100194523 151
220 3300031711 Ga0265314_10035162 Ga0265314_100351623 151
221 3300035118 Ga0373954_0540974 Ga0373954_0540974_73_543 151
222 3300035172 Ga0373955_0405129 Ga0373955_0405129_240_710 151
223 3300035410 Ga0373924_0052121 Ga0373924_0052121_253_723 151
224 3300035724 Ga0373933_0367402 Ga0373933_0367402_200_670 151
225 3300041462 Ga0451806_832414 Ga0451806_832414_27_512 151
226 3300047471 Ga0495684_0077116 Ga0495684_0077116_1154_1624 151
227 3300048906 Ga0496103_0060835 Ga0496103_0060835_1577_2044 151
228 3300048908 Ga0496105_0015983 Ga0496105_0015983_3265_3732 151
229 3300048911 Ga0496108_0003451 Ga0496108_0003451_10284_10820 151
230 3300048919 Ga0496116_0115536 Ga0496116_0115536_524_1060 151
231 3300048920 Ga0496117_0166198 Ga0496117_0166198_140_607 151
232 3300048920 Ga0496117_0449135 Ga0496117_0449135_76_612 151
233 3300048921 Ga0496118_0021279 Ga0496118_0021279_4226_4693 151
234 3300048921 Ga0496118_0064154 Ga0496118_0064154_2111_2581 151
235 3300048922 Ga0496119_0011329 Ga0496119_0011329_4819_5289 151
236 3300048923 Ga0496120_0016905 Ga0496120_0016905_76_546 151
237 3300048924 Ga0496121_0001561 Ga0496121_0001561_15727_16263 151
238 3300048924 Ga0496121_0002963 Ga0496121_0002963_4555_5022 151
239 3300048924 Ga0496121_0098049 Ga0496121_0098049_224_694 151
240 3300048928 Ga0496125_0054561 Ga0496125_0054561_973_1509 151
241 3300048929 Ga0496126_0082405 Ga0496126_0082405_44_580 151
242 3300049581 Ga0501047_0700964 Ga0501047_0700964_169_624 151
243 3300053084 Ga0495595_0622429 Ga0495595_0622429_15_485 151
244 3300053085 Ga0495619_0400619 Ga0495619_0400619_121_591 151
245 3300053105 Ga0500557_179065 Ga0500557_179065_200_655 151
246 3300053151 Ga0500604_0125251 Ga0500604_0125251_359_814 151
247 iso_pu_bacteria 2510917020 2511121399 151
248 iso_pu_bacteria 2582581279 2585149371 151
249 iso_pu_bacteria 2582581280 2585154170 151
250 iso_pu_bacteria 2582581293 2585197789 151
251 iso_pu_bacteria 2585428106 2587919718 151
252 iso_pu_bacteria 2643221545 2643747458 151
253 iso_pu_bacteria 2643221552 2643778730 151
254 iso_pu_bacteria 2643221583 2643923427 151
255 iso_pu_bacteria 2643221584 2643930090 151
256 iso_pu_bacteria 2643221640 2644226348 151
257 iso_pu_bacteria 2643221642 2644235836 151
258 iso_pu_bacteria 2643221691 2644509533 151
259 iso_pu_bacteria 2791355048 2792458889 151
260 iso_pu_bacteria 2818991435 2819538944 151
261 iso_pu_bacteria 2818991454 2819648518 151
262 iso_pu_bacteria 2818991467 2819718116 151
263 iso_pu_bacteria 2843744320 2843749045 151
264 iso_pu_bacteria 2849560528 2849564369 151
265 iso_pu_bacteria 2849573788 2849573960 151
266 iso_pu_bacteria 2851153111 2851155498 151
267 iso_pu_bacteria 2898329390 2898330904 151
268 iso_pu_bacteria 2917699015 2917699435 151
269 iso_pu_bacteria 2928531327 2928533923 151
270 3300005328 Ga0070676_10611524 Ga0070676_106115241 152
271 3300005331 Ga0070670_100278324 Ga0070670_1002783242 152
272 3300005331 Ga0070670_100282325 Ga0070670_1002823252 152
273 3300005333 Ga0070677_10001315 Ga0070677_100013153 152
274 3300005344 Ga0070661_100601759 Ga0070661_1006017591 152
275 3300005345 Ga0070692_10506988 Ga0070692_105069881 152
276 3300005347 Ga0070668_100060128 Ga0070668_1000601283 152
277 3300005354 Ga0070675_100005135 Ga0070675_1000051358 152
278 3300005354 Ga0070675_100009549 Ga0070675_1000095492 152
279 3300005356 Ga0070674_100456148 Ga0070674_1004561481 152
280 3300005441 Ga0070700_100242011 Ga0070700_1002420112 152
281 3300005457 Ga0070662_100007706 Ga0070662_1000077066 152
282 3300005458 Ga0070681_10186106 Ga0070681_101861063 152
283 3300005458 Ga0070681_10247111 Ga0070681_102471111 152
284 3300005530 Ga0070679_100954852 Ga0070679_1009548521 152
285 3300005543 Ga0070672_100251605 Ga0070672_1002516052 152
286 3300005543 Ga0070672_100643258 Ga0070672_1006432582 152
287 3300005544 Ga0070686_100000475 Ga0070686_10000047531 152
288 3300005548 Ga0070665_100553360 Ga0070665_1005533601 152
289 3300005563 Ga0068855_100000644 Ga0068855_10000064415 152
290 3300005578 Ga0068854_100327381 Ga0068854_1003273812 152
291 3300005614 Ga0068856_100143212 Ga0068856_1001432122 152
292 3300005614 Ga0068856_101410741 Ga0068856_1014107412 152
293 3300005616 Ga0068852_100105141 Ga0068852_1001051412 152
294 3300005840 Ga0068870_10614910 Ga0068870_106149102 152
295 3300005841 Ga0068863_101334200 Ga0068863_1013342002 152
296 3300005985 Ga0081539_10083950 Ga0081539_100839502 152
297 3300006914 Ga0075436_101058867 Ga0075436_1010588671 152
298 3300009093 Ga0105240_10100168 Ga0105240_101001683 152
299 3300009098 Ga0105245_10015502 Ga0105245_100155024 152
300 3300009551 Ga0105238_10016430 Ga0105238_100164304 152
301 3300009551 Ga0105238_10451628 Ga0105238_104516282 152
302 3300013100 Ga0157373_11173312 Ga0157373_111733121 152
303 3300013308 Ga0157375_13149554 Ga0157375_131495541 152
304 3300014326 Ga0157380_10063202 Ga0157380_100632023 152
305 3300014326 Ga0157380_10779482 Ga0157380_107794822 152
306 3300014745 Ga0157377_10108611 Ga0157377_101086113 152
307 3300014969 Ga0157376_11313567 Ga0157376_113135672 152
308 3300017792 Ga0163161_11060180 Ga0163161_110601802 152
309 3300025321 Ga0207656_10335475 Ga0207656_103354752 152
310 3300025893 Ga0207682_10002821 Ga0207682_100028216 152
311 3300025901 Ga0207688_10042242 Ga0207688_100422423 152
312 3300025907 Ga0207645_10383405 Ga0207645_103834052 152
313 3300025907 Ga0207645_10492093 Ga0207645_104920932 152
314 3300025912 Ga0207707_10101234 Ga0207707_101012343 152
315 3300025913 Ga0207695_10044298 Ga0207695_100442983 152
316 3300025913 Ga0207695_10355744 Ga0207695_103557442 152
317 3300025919 Ga0207657_10740733 Ga0207657_107407332 152
318 3300025920 Ga0207649_11430528 Ga0207649_114305281 152
319 3300025923 Ga0207681_10293512 Ga0207681_102935122 152
320 3300025924 Ga0207694_10123581 Ga0207694_101235813 152
321 3300025924 Ga0207694_10553812 Ga0207694_105538122 152
322 3300025925 Ga0207650_10640789 Ga0207650_106407892 152
323 3300025926 Ga0207659_10005578 Ga0207659_100055786 152
324 3300025926 Ga0207659_10006342 Ga0207659_100063422 152
325 3300025926 Ga0207659_10143913 Ga0207659_101439132 152
326 3300025927 Ga0207687_10044477 Ga0207687_100444772 152
327 3300025933 Ga0207706_10016946 Ga0207706_100169465 152
328 3300025935 Ga0207709_10491890 Ga0207709_104918902 152
329 3300025937 Ga0207669_10477160 Ga0207669_104771602 152
330 3300025937 Ga0207669_10523836 Ga0207669_105238361 152
331 3300025940 Ga0207691_10169353 Ga0207691_101693532 152
332 3300025940 Ga0207691_10510217 Ga0207691_105102172 152
333 3300025942 Ga0207689_10626428 Ga0207689_106264282 152
334 3300025949 Ga0207667_10001801 Ga0207667_100018013 152
335 3300025949 Ga0207667_10362778 Ga0207667_103627782 152
336 3300025972 Ga0207668_10800413 Ga0207668_108004132 152
337 3300025981 Ga0207640_10664059 Ga0207640_106640592 152
338 3300026041 Ga0207639_10279469 Ga0207639_102794692 152
339 3300026075 Ga0207708_10307453 Ga0207708_103074532 152
340 3300026142 Ga0207698_10067591 Ga0207698_100675913 152
341 3300030745 Ga0316182_1013747 Ga0316182_10137472 152
342 3300031548 Ga0307408_101018801 Ga0307408_1010188011 152
343 3300031548 Ga0307408_101152087 Ga0307408_1011520871 152
344 3300031901 Ga0307406_11164634 Ga0307406_111646341 152
345 3300031911 Ga0307412_10106977 Ga0307412_101069772 152
346 3300031995 Ga0307409_100134429 Ga0307409_1001344293 152
347 3300031995 Ga0307409_101260394 Ga0307409_1012603942 152
348 3300032004 Ga0307414_10132321 Ga0307414_101323212 152
349 3300032005 Ga0307411_10007909 Ga0307411_100079093 152
350 3300032005 Ga0307411_10502385 Ga0307411_105023852 152
351 3300032126 Ga0307415_100648736 Ga0307415_1006487362 152
352 3300032126 Ga0307415_100767179 Ga0307415_1007671792 152
353 3300041459 Ga0451800_0600639 Ga0451800_0600639_53_517 152
354 3300041505 Ga0451849_0234109 Ga0451849_0234109_30_491 152
355 3300042003 Ga0439443_022726 Ga0439443_022726_204_665 152
356 3300042003 Ga0439443_058208 Ga0439443_058208_179_652 152
357 3300042125 Ga0450923_020471 Ga0450923_020471_545_1006 152
358 3300044765 Ga0466970_0746345 Ga0466970_0746345_51_521 152
359 3300044842 Ga0466957_0700690 Ga0466957_0700690_232_699 152
360 3300046520 Ga0495637_0016220 Ga0495637_0016220_91_549 152
361 3300048917 Ga0496114_0905321 Ga0496114_0905321_125_586 152
362 3300048928 Ga0496125_0000847 Ga0496125_0000847_38619_39086 152
363 3300003771 Ga0055526_1001059 Ga0055526_10010597 153
364 3300003775 Ga0055524_1000078 Ga0055524_1000078103 153
365 3300003791 Ga0055530_10000657 Ga0055530_1000065714 153
366 3300003794 Ga0055531_10010132 Ga0055531_100101322 153
367 3300003794 Ga0055531_10041710 Ga0055531_100417102 153
368 3300004625 Ga0055543_1009306 Ga0055543_10093061 153
369 3300005262 Ga0065165_1000238 Ga0065165_100023814 153
370 3300005290 Ga0065712_10121894 Ga0065712_101218942 153
371 3300005293 Ga0065715_10187088 Ga0065715_101870882 153
372 3300005327 Ga0070658_11148373 Ga0070658_111483731 153
373 3300005328 Ga0070676_10398318 Ga0070676_103983182 153
374 3300005329 Ga0070683_100319811 Ga0070683_1003198112 153
375 3300005331 Ga0070670_100644931 Ga0070670_1006449312 153
376 3300005334 Ga0068869_101320753 Ga0068869_1013207531 153
377 3300005336 Ga0070680_100019967 Ga0070680_1000199671 153
378 3300005336 Ga0070680_100042407 Ga0070680_1000424072 153
379 3300005336 Ga0070680_101287490 Ga0070680_1012874901 153
380 3300005339 Ga0070660_100020442 Ga0070660_1000204424 153
381 3300005343 Ga0070687_100144758 Ga0070687_1001447582 153
382 3300005344 Ga0070661_100625830 Ga0070661_1006258301 153
383 3300005353 Ga0070669_100335138 Ga0070669_1003351382 153
384 3300005354 Ga0070675_100110894 Ga0070675_1001108942 153
385 3300005355 Ga0070671_100053953 Ga0070671_1000539533 153
386 3300005355 Ga0070671_100065925 Ga0070671_1000659254 153
387 3300005355 Ga0070671_100401848 Ga0070671_1004018482 153
388 3300005364 Ga0070673_100017949 Ga0070673_1000179494 153
389 3300005366 Ga0070659_100000549 Ga0070659_10000054917 153
390 3300005366 Ga0070659_100387121 Ga0070659_1003871212 153
391 3300005458 Ga0070681_10014790 Ga0070681_100147904 153
392 3300005459 Ga0068867_100540741 Ga0068867_1005407411 153
393 3300005530 Ga0070679_100007144 Ga0070679_1000071444 153
394 3300005539 Ga0068853_100869895 Ga0068853_1008698952 153
395 3300005543 Ga0070672_100470929 Ga0070672_1004709292 153
396 3300005548 Ga0070665_100000166 Ga0070665_10000016612 153
397 3300005548 Ga0070665_100007560 Ga0070665_1000075603 153
398 3300005548 Ga0070665_100146657 Ga0070665_1001466574 153
399 3300005563 Ga0068855_100038534 Ga0068855_1000385344 153
400 3300005563 Ga0068855_100225537 Ga0068855_1002255373 153
401 3300005577 Ga0068857_100062721 Ga0068857_1000627213 153
402 3300005577 Ga0068857_100103710 Ga0068857_1001037102 153
403 3300005577 Ga0068857_101989898 Ga0068857_1019898981 153
404 3300005618 Ga0068864_100099463 Ga0068864_1000994633 153
405 3300005618 Ga0068864_100342016 Ga0068864_1003420162 153
406 3300005618 Ga0068864_101015716 Ga0068864_1010157161 153
407 3300005840 Ga0068870_10175028 Ga0068870_101750282 153
408 3300005841 Ga0068863_100077452 Ga0068863_1000774523 153
409 3300005841 Ga0068863_100293034 Ga0068863_1002930342 153
410 3300006028 Ga0070717_10072887 Ga0070717_100728874 153
411 3300006186 Ga0075369_10035245 Ga0075369_100352452 153
412 3300006237 Ga0097621_100318920 Ga0097621_1003189202 153
413 3300006353 Ga0075370_10283773 Ga0075370_102837732 153
414 3300006881 Ga0068865_100002455 Ga0068865_1000024559 153
415 3300009093 Ga0105240_10064613 Ga0105240_100646134 153
416 3300009093 Ga0105240_10081194 Ga0105240_100811944 153
417 3300009093 Ga0105240_10598507 Ga0105240_105985072 153
418 3300009093 Ga0105240_11045527 Ga0105240_110455272 153
419 3300009551 Ga0105238_10012645 Ga0105238_100126454 153
420 3300009551 Ga0105238_10149356 Ga0105238_101493562 153
421 3300009551 Ga0105238_10388651 Ga0105238_103886512 153
422 3300009553 Ga0105249_10507777 Ga0105249_105077772 153
423 3300010375 Ga0105239_11738277 Ga0105239_117382772 153
424 3300013102 Ga0157371_10326469 Ga0157371_103264691 153
425 3300013102 Ga0157371_10919045 Ga0157371_109190451 153
426 3300013105 Ga0157369_10488362 Ga0157369_104883622 153
427 3300013296 Ga0157374_10194251 Ga0157374_101942511 153
428 3300013306 Ga0163162_10042128 Ga0163162_100421284 153
429 3300013307 Ga0157372_11329911 Ga0157372_113299112 153
430 3300013307 Ga0157372_11498916 Ga0157372_114989162 153
431 3300013308 Ga0157375_10008404 Ga0157375_100084042 153
432 3300014325 Ga0163163_10097195 Ga0163163_100971954 153
433 3300014325 Ga0163163_10166751 Ga0163163_101667512 153
434 3300014325 Ga0163163_10234354 Ga0163163_102343543 153
435 3300025250 Ga0209026_1000438 Ga0209026_100043812 153
436 3300025254 Ga0209148_1021776 Ga0209148_10217762 153
437 3300025273 Ga0209673_1039779 Ga0209673_10397792 153
438 3300025291 Ga0209675_1001152 Ga0209675_10011529 153
439 3300025294 Ga0209025_1000014 Ga0209025_1000014708 153
440 3300025295 Ga0209564_1000179 Ga0209564_100017948 153
441 3300025297 Ga0209758_1001527 Ga0209758_100152710 153
442 3300025298 Ga0209050_1000031 Ga0209050_100003189 153
443 3300025298 Ga0209050_1072970 Ga0209050_10729702 153
444 3300025299 Ga0209256_1000055 Ga0209256_1000055101 153
445 3300025304 Ga0209257_1000073 Ga0209257_1000073291 153
446 3300025304 Ga0209257_1008959 Ga0209257_10089598 153
447 3300025901 Ga0207688_10360369 Ga0207688_103603692 153
448 3300025907 Ga0207645_10603181 Ga0207645_106031812 153
449 3300025908 Ga0207643_10064876 Ga0207643_100648762 153
450 3300025909 Ga0207705_10069151 Ga0207705_100691512 153
451 3300025909 Ga0207705_10074046 Ga0207705_100740462 153
452 3300025912 Ga0207707_10405605 Ga0207707_104056052 153
453 3300025913 Ga0207695_10010373 Ga0207695_100103735 153
454 3300025913 Ga0207695_10056806 Ga0207695_100568063 153
455 3300025914 Ga0207671_10525924 Ga0207671_105259242 153
456 3300025917 Ga0207660_10000991 Ga0207660_1000099112 153
457 3300025917 Ga0207660_10056089 Ga0207660_100560893 153
458 3300025917 Ga0207660_10889173 Ga0207660_108891732 153
459 3300025919 Ga0207657_10002070 Ga0207657_100020704 153
460 3300025919 Ga0207657_10026597 Ga0207657_100265974 153
461 3300025921 Ga0207652_10003485 Ga0207652_1000348511 153
462 3300025924 Ga0207694_10137224 Ga0207694_101372243 153
463 3300025924 Ga0207694_10879669 Ga0207694_108796691 153
464 3300025925 Ga0207650_10154941 Ga0207650_101549412 153
465 3300025931 Ga0207644_10044963 Ga0207644_100449633 153
466 3300025931 Ga0207644_10051622 Ga0207644_100516222 153
467 3300025931 Ga0207644_10338644 Ga0207644_103386442 153
468 3300025932 Ga0207690_10000110 Ga0207690_1000011047 153
469 3300025932 Ga0207690_10009268 Ga0207690_100092684 153
470 3300025933 Ga0207706_10254636 Ga0207706_102546362 153
471 3300025933 Ga0207706_11260255 Ga0207706_112602552 153
472 3300025938 Ga0207704_10007679 Ga0207704_100076792 153
473 3300025940 Ga0207691_10460236 Ga0207691_104602362 153
474 3300025941 Ga0207711_10210714 Ga0207711_102107143 153
475 3300025942 Ga0207689_10872919 Ga0207689_108729192 153
476 3300025944 Ga0207661_11118030 Ga0207661_111180301 153
477 3300025945 Ga0207679_10358526 Ga0207679_103585263 153
478 3300025949 Ga0207667_10013416 Ga0207667_100134164 153
479 3300025949 Ga0207667_10059635 Ga0207667_100596352 153
480 3300025949 Ga0207667_10123352 Ga0207667_101233522 153
481 3300025960 Ga0207651_11458865 Ga0207651_114588651 153
482 3300025961 Ga0207712_10710693 Ga0207712_107106931 153
483 3300025981 Ga0207640_11694003 Ga0207640_116940031 153
484 3300025986 Ga0207658_10667250 Ga0207658_106672502 153
485 3300025986 Ga0207658_11229636 Ga0207658_112296361 153
486 3300026023 Ga0207677_10417158 Ga0207677_104171582 153
487 3300026041 Ga0207639_10034836 Ga0207639_100348362 153
488 3300026041 Ga0207639_10761684 Ga0207639_107616842 153
489 3300026088 Ga0207641_10034302 Ga0207641_100343024 153
490 3300026088 Ga0207641_10615749 Ga0207641_106157492 153
491 3300026089 Ga0207648_11000791 Ga0207648_110007911 153
492 3300026095 Ga0207676_10130866 Ga0207676_101308663 153
493 3300026095 Ga0207676_10170852 Ga0207676_101708522 153
494 3300026095 Ga0207676_10244259 Ga0207676_102442592 153
495 3300026095 Ga0207676_10420033 Ga0207676_104200331 153
496 3300026095 Ga0207676_10488693 Ga0207676_104886931 153
497 3300026116 Ga0207674_10091873 Ga0207674_100918734 153
498 3300026116 Ga0207674_10104979 Ga0207674_101049792 153
499 3300026121 Ga0207683_10033876 Ga0207683_100338762 153
500 3300026142 Ga0207698_10613502 Ga0207698_106135022 153
501 3300027378 Ga0209981_1000702 Ga0209981_10007023 153
502 3300027543 Ga0209999_1052630 Ga0209999_10526301 153
503 3300027876 Ga0209974_10187192 Ga0209974_101871922 153
504 3300028379 Ga0268266_10000005 Ga0268266_100000051331 153
505 3300028379 Ga0268266_10017622 Ga0268266_100176225 153
506 3300028380 Ga0268265_10122405 Ga0268265_101224052 153
507 3300028786 Ga0307517_10002579 Ga0307517_1000257919 153
508 3300028786 Ga0307517_10026151 Ga0307517_100261517 153
509 3300031456 Ga0307513_10001556 Ga0307513_1000155615 153
510 3300031456 Ga0307513_10019635 Ga0307513_100196357 153
511 3300031548 Ga0307408_100183150 Ga0307408_1001831503 153
512 3300031548 Ga0307408_100279753 Ga0307408_1002797532 153
513 3300031731 Ga0307405_10025256 Ga0307405_100252561 153
514 3300031731 Ga0307405_10148601 Ga0307405_101486012 153
515 3300031731 Ga0307405_11419786 Ga0307405_114197862 153
516 3300031824 Ga0307413_10010651 Ga0307413_100106513 153
517 3300031824 Ga0307413_10020991 Ga0307413_100209913 153
518 3300031824 Ga0307413_10034617 Ga0307413_100346172 153
519 3300031824 Ga0307413_10069560 Ga0307413_100695603 153
520 3300031852 Ga0307410_10002874 Ga0307410_100028747 153
521 3300031852 Ga0307410_10004617 Ga0307410_100046176 153
522 3300031852 Ga0307410_10106133 Ga0307410_101061332 153
523 3300031852 Ga0307410_10218615 Ga0307410_102186152 153
524 3300031901 Ga0307406_10004611 Ga0307406_100046114 153
525 3300031901 Ga0307406_10029354 Ga0307406_100293542 153
526 3300031901 Ga0307406_10037970 Ga0307406_100379702 153
527 3300031903 Ga0307407_10219190 Ga0307407_102191902 153
528 3300031911 Ga0307412_10641946 Ga0307412_106419462 153
529 3300031995 Ga0307409_100018288 Ga0307409_1000182882 153
530 3300031995 Ga0307409_100028346 Ga0307409_1000283463 153
531 3300031995 Ga0307409_100093174 Ga0307409_1000931742 153
532 3300031995 Ga0307409_100250522 Ga0307409_1002505222 153
533 3300031995 Ga0307409_100294909 Ga0307409_1002949092 153
534 3300031995 Ga0307409_101833883 Ga0307409_1018338832 153
535 3300032002 Ga0307416_100013746 Ga0307416_1000137462 153
536 3300032002 Ga0307416_100622392 Ga0307416_1006223922 153
537 3300032002 Ga0307416_102034830 Ga0307416_1020348302 153
538 3300032004 Ga0307414_10033278 Ga0307414_100332783 153
539 3300032004 Ga0307414_10040435 Ga0307414_100404352 153
540 3300032004 Ga0307414_10185069 Ga0307414_101850692 153
541 3300032004 Ga0307414_10356361 Ga0307414_103563612 153
542 3300032004 Ga0307414_11412070 Ga0307414_114120701 153
543 3300032005 Ga0307411_10002105 Ga0307411_100021057 153
544 3300032005 Ga0307411_10010958 Ga0307411_100109582 153
545 3300032005 Ga0307411_10040851 Ga0307411_100408513 153
546 3300032005 Ga0307411_10053816 Ga0307411_100538163 153
547 3300032005 Ga0307411_10082107 Ga0307411_100821072 153
548 3300032005 Ga0307411_10424513 Ga0307411_104245132 153
549 3300032005 Ga0307411_11512777 Ga0307411_115127772 153
550 3300032126 Ga0307415_100001769 Ga0307415_10000176910 153
551 3300032126 Ga0307415_100009137 Ga0307415_1000091372 153
552 3300033180 Ga0307510_10222386 Ga0307510_102223862 153
553 3300035089 Ga0373944_0004351 Ga0373944_0004351_22_483 153
554 3300035171 Ga0373946_0021252 Ga0373946_0021252_841_1302 153
555 3300035692 Ga0373935_0042740 Ga0373935_0042740_1101_1562 153
556 3300035695 Ga0373927_0000296 Ga0373927_0000296_21759_22220 153
557 3300035725 Ga0373947_0112393 Ga0373947_0112393_1016_1477 153
558 3300037068 Ga0373925_0000022 Ga0373925_0000022_75538_75999 153
559 3300037068 Ga0373925_0174489 Ga0373925_0174489_1190_1651 153
560 3300037312 Ga0395899_0000557 Ga0395899_0000557_5814_6275 153
561 3300037418 Ga0395900_0000010 Ga0395900_0000010_148585_149046 153
562 3300037418 Ga0395900_0068674 Ga0395900_0068674_2406_2867 153
563 3300037418 Ga0395900_0207008 Ga0395900_0207008_1082_1546 153
564 3300037466 Ga0395898_0008373 Ga0395898_0008373_6811_7272 153
565 3300037466 Ga0395898_0056246 Ga0395898_0056246_735_1196 153
566 3300037466 Ga0395898_0934739 Ga0395898_0934739_171_635 153
567 3300037471 Ga0395905_0006685 Ga0395905_0006685_790_1251 153
568 3300037471 Ga0395905_0292885 Ga0395905_0292885_538_999 153
569 3300037471 Ga0395905_0311612 Ga0395905_0311612_155_616 153
570 3300037471 Ga0395905_0976057 Ga0395905_0976057_130_591 153
571 3300038443 Ga0395901_0000007 Ga0395901_0000007_232947_233408 153
572 3300038443 Ga0395901_0578871 Ga0395901_0578871_212_676 153
573 3300039437 Ga0436365_0294177 Ga0436365_0294177_10_471 153
574 3300042006 Ga0439432_027318 Ga0439432_027318_154_618 153
575 3300042007 Ga0439449_0028624 Ga0439449_0028624_1070_1534 153
576 3300042007 Ga0439449_0100976 Ga0439449_0100976_76_540 153
577 3300042010 Ga0439452_047041 Ga0439452_047041_339_803 153
578 3300044712 Ga0453684_0285987 Ga0453684_0285987_399_860 153
579 3300044842 Ga0466957_0651425 Ga0466957_0651425_132_593 153
580 3300046454 Ga0495592_0205417 Ga0495592_0205417_92_553 153
581 3300046506 Ga0495583_0022572 Ga0495583_0022572_2703_3164 153
582 3300046516 Ga0495628_0264700 Ga0495628_0264700_230_691 153
583 3300046528 Ga0495642_0020993 Ga0495642_0020993_1240_1701 153
584 3300046648 Ga0495611_0059013 Ga0495611_0059013_344_805 153
585 3300046660 Ga0495625_0029246 Ga0495625_0029246_454_915 153
586 3300046660 Ga0495625_0060077 Ga0495625_0060077_1518_1979 153
587 3300046691 Ga0495670_0427532 Ga0495670_0427532_151_612 153
588 3300047318 Ga0495636_0129360 Ga0495636_0129360_612_1073 153
589 3300047320 Ga0495672_0014296 Ga0495672_0014296_3641_4102 153
590 3300047445 Ga0495677_0083613 Ga0495677_0083613_191_652 153
591 3300047447 Ga0495685_072904 Ga0495685_072904_389_850 153
592 3300047470 Ga0495681_0088579 Ga0495681_0088579_398_859 153
593 3300048904 Ga0496101_0018447 Ga0496101_0018447_1700_2161 153
594 3300048904 Ga0496101_1340704 Ga0496101_1340704_68_529 153
595 3300048905 Ga0496102_0097880 Ga0496102_0097880_884_1345 153
596 3300048908 Ga0496105_0706547 Ga0496105_0706547_280_741 153
597 3300048910 Ga0496107_0096922 Ga0496107_0096922_893_1354 153
598 3300048911 Ga0496108_0796972 Ga0496108_0796972_106_567 153
599 3300048912 Ga0496109_0024820 Ga0496109_0024820_3457_3918 153
600 3300048912 Ga0496109_0076421 Ga0496109_0076421_524_988 153
601 3300048912 Ga0496109_1651420 Ga0496109_1651420_27_491 153
602 3300048913 Ga0496110_0099642 Ga0496110_0099642_658_1122 153
603 3300048913 Ga0496110_0182555 Ga0496110_0182555_1004_1465 153
604 3300048914 Ga0496111_0145990 Ga0496111_0145990_1112_1576 153
605 3300048916 Ga0496113_0090524 Ga0496113_0090524_374_844 153
606 3300048916 Ga0496113_0482023 Ga0496113_0482023_513_974 153
607 3300048918 Ga0496115_0007768 Ga0496115_0007768_4753_5277 153
608 3300048918 Ga0496115_0248007 Ga0496115_0248007_279_740 153
609 3300048920 Ga0496117_0093639 Ga0496117_0093639_468_938 153
610 3300048925 Ga0496122_0066335 Ga0496122_0066335_162_632 153
611 3300048926 Ga0496123_0029719 Ga0496123_0029719_2435_2905 153
612 3300049569 Ga0501032_0104122 Ga0501032_0104122_1190_1651 153
613 3300049570 Ga0501033_0288480 Ga0501033_0288480_342_803 153
614 3300049571 Ga0501034_0215246 Ga0501034_0215246_154_624 153
615 3300049581 Ga0501047_0122703 Ga0501047_0122703_1105_1566 153
616 3300049581 Ga0501047_0201623 Ga0501047_0201623_190_651 153
617 3300049581 Ga0501047_0912146 Ga0501047_0912146_113_574 153
618 3300049822 Ga0501035_0370422 Ga0501035_0370422_173_637 153
619 3300049823 Ga0501044_0033231 Ga0501044_0033231_4047_4508 153
620 3300050492 nmdc:mga0yw44_142800_c1 nmdc:mga0yw44_142800_c1_946_1416 153
621 3300050516 nmdc:mga0sz30_31278_c1 nmdc:mga0sz30_31278_c1_1590_2060 153
622 3300050516 nmdc:mga0sz30_50133_c1 nmdc:mga0sz30_50133_c1_1182_1652 153
623 3300053096 Ga0500641_0021432 Ga0500641_0021432_477_938 153
624 3300053108 Ga0500562_000539 Ga0500562_000539_7751_8212 153
625 3300005336 Ga0070680_100026390 Ga0070680_1000263904 154
626 3300005341 Ga0070691_10022983 Ga0070691_100229833 154
627 3300005458 Ga0070681_10052294 Ga0070681_100522943 154
628 3300005530 Ga0070679_100018843 Ga0070679_1000188434 154
629 3300005563 Ga0068855_100034791 Ga0068855_1000347914 154
630 3300005614 Ga0068856_100202043 Ga0068856_1002020432 154
631 3300006177 Ga0075362_10544217 Ga0075362_105442172 154
632 3300009093 Ga0105240_10197043 Ga0105240_101970432 154
633 3300009551 Ga0105238_10046820 Ga0105238_100468205 154
634 3300009551 Ga0105238_10834039 Ga0105238_108340392 154
635 3300009553 Ga0105249_11714494 Ga0105249_117144942 154
636 3300009553 Ga0105249_11785396 Ga0105249_117853961 154
637 3300013306 Ga0163162_10359614 Ga0163162_103596141 154
638 3300014968 Ga0157379_10472361 Ga0157379_104723611 154
639 3300025912 Ga0207707_10256813 Ga0207707_102568133 154
640 3300025913 Ga0207695_10009002 Ga0207695_100090028 154
641 3300025924 Ga0207694_10283404 Ga0207694_102834042 154
642 3300025938 Ga0207704_10610601 Ga0207704_106106011 154
643 3300025949 Ga0207667_10036818 Ga0207667_100368184 154
644 3300026041 Ga0207639_10611557 Ga0207639_106115572 154
645 3300026118 Ga0207675_100341987 Ga0207675_1003419872 154
646 3300026142 Ga0207698_12034203 Ga0207698_120342031 154
647 3300028558 Ga0265326_10061962 Ga0265326_100619622 154
648 3300028800 Ga0265338_10018706 Ga0265338_100187066 154
649 3300028800 Ga0265338_10438523 Ga0265338_104385232 154
650 3300031250 Ga0265331_10357408 Ga0265331_103574081 154
651 3300031251 Ga0265327_10000290 Ga0265327_1000029074 154
652 3300035170 Ga0373943_0236404 Ga0373943_0236404_54_518 154
653 3300035695 Ga0373927_0457505 Ga0373927_0457505_146_610 154
654 3300035725 Ga0373947_0188802 Ga0373947_0188802_748_1212 154
655 3300041413 Ga0439465_0110947 Ga0439465_0110947_166_630 154
656 3300041512 Ga0451853_0872862 Ga0451853_0872862_362_829 154
657 3300046558 Ga0495633_0166943 Ga0495633_0166943_493_957 154
658 3300046616 Ga0495668_0067858 Ga0495668_0067858_1471_1935 154
659 3300047472 Ga0495686_0009819 Ga0495686_0009819_3999_4463 154
660 3300048912 Ga0496109_0431172 Ga0496109_0431172_697_1170 154
661 3300048918 Ga0496115_0002044 Ga0496115_0002044_4288_4755 154
662 3300048918 Ga0496115_0002144 Ga0496115_0002144_10242_10706 154
663 3300048925 Ga0496122_0150758 Ga0496122_0150758_943_1407 154
664 3300050489 nmdc:mga03683_3161_c1 nmdc:mga03683_3161_c1_4545_5030 154
665 3300053093 Ga0500651_0002418 Ga0500651_0002418_94_558 154
666 3300053096 Ga0500641_0296780 Ga0500641_0296780_150_614 154
667 3300053104 Ga0500556_0000740 Ga0500556_0000740_5749_6216 154
668 3300053130 Ga0500642_0314444 Ga0500642_0314444_141_605 154
669 3300053133 Ga0500655_000552 Ga0500655_000552_568_1032 154
670 3300053133 Ga0500655_118560 Ga0500655_118560_86_550 154
671 3300053148 Ga0500590_005198 Ga0500590_005198_5681_6145 154
672 3300053153 Ga0500616_0032802 Ga0500616_0032802_321_788 154
673 3300053730 Ga0500645_002603 Ga0500645_002603_1536_2000 154
674 3300053730 Ga0500645_038494 Ga0500645_038494_561_1028 154
675 3300001904 JGI24736J21556_1000178 JGI24736J21556_10001787 155
676 3300001976 JGI24752J21851_1000008 JGI24752J21851_10000089 155
677 3300001976 JGI24752J21851_1000844 JGI24752J21851_10008442 155
678 3300001979 JGI24740J21852_10002881 JGI24740J21852_100028813 155
679 3300001979 JGI24740J21852_10022646 JGI24740J21852_100226462 155
680 3300001989 JGI24739J22299_10009266 JGI24739J22299_100092663 155
681 3300001990 JGI24737J22298_10004848 JGI24737J22298_100048483 155
682 3300002067 JGI24735J21928_10001909 JGI24735J21928_100019093 155
683 3300002070 JGI24750J21931_1000163 JGI24750J21931_100016311 155
684 3300002074 JGI24748J21848_1000140 JGI24748J21848_10001406 155
685 3300002075 JGI24738J21930_10001111 JGI24738J21930_100011113 155
686 3300002239 JGI24034J26672_10000024 JGI24034J26672_1000002417 155
687 3300002244 JGI24742J22300_10005454 JGI24742J22300_100054542 155
688 3300003771 Ga0055526_1043671 Ga0055526_10436712 155
689 3300003773 Ga0055537_1000684 Ga0055537_100068417 155
690 3300003775 Ga0055524_1006562 Ga0055524_10065624 155
691 3300003781 Ga0055536_1000689 Ga0055536_100068919 155
692 3300003781 Ga0055536_1000750 Ga0055536_10007507 155
693 3300003790 Ga0055528_1002530 Ga0055528_10025307 155
694 3300003791 Ga0055530_10001625 Ga0055530_100016256 155
695 3300003791 Ga0055530_10004094 Ga0055530_100040947 155
696 3300003794 Ga0055531_10000307 Ga0055531_1000030730 155
697 3300003794 Ga0055531_10016045 Ga0055531_100160452 155
698 3300003911 JGI25405J52794_10013313 JGI25405J52794_100133132 155
699 3300005262 Ga0065165_1001453 Ga0065165_100145315 155
700 3300005289 Ga0065704_10073574 Ga0065704_100735743 155
701 3300005289 Ga0065704_10120189 Ga0065704_101201892 155
702 3300005295 Ga0065707_10082116 Ga0065707_1008211612 155
703 3300005295 Ga0065707_10149117 Ga0065707_101491171 155
704 3300005295 Ga0065707_10361893 Ga0065707_103618931 155
705 3300005327 Ga0070658_10006127 Ga0070658_100061276 155
706 3300005329 Ga0070683_100214255 Ga0070683_1002142552 155
707 3300005330 Ga0070690_100000016 Ga0070690_10000001632 155
708 3300005331 Ga0070670_100000215 Ga0070670_10000021542 155
709 3300005331 Ga0070670_100185662 Ga0070670_1001856622 155
710 3300005331 Ga0070670_100672406 Ga0070670_1006724062 155
711 3300005335 Ga0070666_10000011 Ga0070666_1000001141 155
712 3300005335 Ga0070666_10175569 Ga0070666_101755692 155
713 3300005337 Ga0070682_100046493 Ga0070682_1000464932 155
714 3300005339 Ga0070660_100077451 Ga0070660_1000774513 155
715 3300005340 Ga0070689_100006604 Ga0070689_1000066042 155
716 3300005344 Ga0070661_100245021 Ga0070661_1002450212 155
717 3300005347 Ga0070668_100000584 Ga0070668_1000005846 155
718 3300005353 Ga0070669_100000009 Ga0070669_10000000978 155
719 3300005353 Ga0070669_100066448 Ga0070669_1000664483 155
720 3300005353 Ga0070669_100625254 Ga0070669_1006252542 155
721 3300005355 Ga0070671_100065786 Ga0070671_1000657862 155
722 3300005355 Ga0070671_100125365 Ga0070671_1001253652 155
723 3300005355 Ga0070671_101000798 Ga0070671_1010007982 155
724 3300005366 Ga0070659_100011408 Ga0070659_1000114082 155
725 3300005366 Ga0070659_100041921 Ga0070659_1000419213 155
726 3300005367 Ga0070667_100000169 Ga0070667_10000016946 155
727 3300005367 Ga0070667_100000311 Ga0070667_10000031142 155
728 3300005367 Ga0070667_100014825 Ga0070667_1000148258 155
729 3300005367 Ga0070667_100036281 Ga0070667_1000362814 155
730 3300005367 Ga0070667_100176523 Ga0070667_1001765232 155
731 3300005440 Ga0070705_100099320 Ga0070705_1000993203 155
732 3300005455 Ga0070663_100028840 Ga0070663_1000288403 155
733 3300005457 Ga0070662_100163543 Ga0070662_1001635432 155
734 3300005458 Ga0070681_10814537 Ga0070681_108145371 155
735 3300005466 Ga0070685_10000186 Ga0070685_1000018616 155
736 3300005535 Ga0070684_100047729 Ga0070684_1000477292 155
737 3300005539 Ga0068853_100016114 Ga0068853_1000161145 155
738 3300005539 Ga0068853_100077290 Ga0068853_1000772902 155
739 3300005539 Ga0068853_100426848 Ga0068853_1004268482 155
740 3300005544 Ga0070686_100000001 Ga0070686_100000001478 155
741 3300005548 Ga0070665_100000004 Ga0070665_100000004213 155
742 3300005548 Ga0070665_100000610 Ga0070665_1000006105 155
743 3300005548 Ga0070665_100002779 Ga0070665_1000027798 155
744 3300005563 Ga0068855_100060774 Ga0068855_1000607743 155
745 3300005563 Ga0068855_101540918 Ga0068855_1015409181 155
746 3300005564 Ga0070664_100182132 Ga0070664_1001821322 155
747 3300005577 Ga0068857_100008971 Ga0068857_1000089713 155
748 3300005577 Ga0068857_100255758 Ga0068857_1002557582 155
749 3300005614 Ga0068856_101527048 Ga0068856_1015270481 155
750 3300005616 Ga0068852_100050187 Ga0068852_1000501872 155
751 3300005616 Ga0068852_100119522 Ga0068852_1001195223 155
752 3300005617 Ga0068859_100017605 Ga0068859_1000176052 155
753 3300005617 Ga0068859_100158432 Ga0068859_1001584322 155
754 3300005617 Ga0068859_100337575 Ga0068859_1003375752 155
755 3300005617 Ga0068859_100519147 Ga0068859_1005191472 155
756 3300005618 Ga0068864_100000080 Ga0068864_10000008055 155
757 3300005618 Ga0068864_100000461 Ga0068864_10000046127 155
758 3300005618 Ga0068864_100006235 Ga0068864_1000062354 155
759 3300005719 Ga0068861_100097386 Ga0068861_1000973863 155
760 3300005834 Ga0068851_10022230 Ga0068851_100222303 155
761 3300005841 Ga0068863_100000010 Ga0068863_100000010108 155
762 3300005841 Ga0068863_100000087 Ga0068863_10000008755 155
763 3300005841 Ga0068863_100000185 Ga0068863_10000018528 155
764 3300005842 Ga0068858_100000360 Ga0068858_10000036028 155
765 3300005842 Ga0068858_100009567 Ga0068858_1000095676 155
766 3300005842 Ga0068858_100614574 Ga0068858_1006145741 155
767 3300005842 Ga0068858_100718083 Ga0068858_1007180832 155
768 3300005843 Ga0068860_100000030 Ga0068860_100000030218 155
769 3300005843 Ga0068860_100000211 Ga0068860_10000021149 155
770 3300005843 Ga0068860_100086396 Ga0068860_1000863963 155
771 3300005843 Ga0068860_100242572 Ga0068860_1002425722 155
772 3300005844 Ga0068862_100000101 Ga0068862_10000010155 155
773 3300005844 Ga0068862_100002355 Ga0068862_1000023557 155
774 3300005844 Ga0068862_100013604 Ga0068862_1000136044 155
775 3300005937 Ga0081455_10000848 Ga0081455_1000084817 155
776 3300006042 Ga0075368_10010676 Ga0075368_100106761 155
777 3300006048 Ga0075363_100007689 Ga0075363_1000076894 155
778 3300006051 Ga0075364_10007544 Ga0075364_100075445 155
779 3300006178 Ga0075367_10000812 Ga0075367_100008124 155
780 3300006195 Ga0075366_10139834 Ga0075366_101398342 155
781 3300006195 Ga0075366_10205992 Ga0075366_102059922 155
782 3300006353 Ga0075370_10056254 Ga0075370_100562543 155
783 3300006931 Ga0097620_100017605 Ga0097620_1000176057 155
784 3300006931 Ga0097620_100158431 Ga0097620_1001584312 155
785 3300006931 Ga0097620_100337580 Ga0097620_1003375802 155
786 3300006931 Ga0097620_100519241 Ga0097620_1005192412 155
787 3300009092 Ga0105250_10062687 Ga0105250_100626871 155
788 3300009093 Ga0105240_10003668 Ga0105240_1000366815 155
789 3300009093 Ga0105240_11604328 Ga0105240_116043282 155
790 3300009101 Ga0105247_10328332 Ga0105247_103283322 155
791 3300009101 Ga0105247_10426645 Ga0105247_104266452 155
792 3300009174 Ga0105241_11828838 Ga0105241_118288381 155
793 3300009177 Ga0105248_10013274 Ga0105248_1001327410 155
794 3300009177 Ga0105248_10023145 Ga0105248_100231456 155
795 3300009177 Ga0105248_10277312 Ga0105248_102773122 155
796 3300009177 Ga0105248_10515419 Ga0105248_105154192 155
797 3300009177 Ga0105248_11308546 Ga0105248_113085461 155
798 3300009545 Ga0105237_10180482 Ga0105237_101804822 155
799 3300009545 Ga0105237_10553774 Ga0105237_105537742 155
800 3300009551 Ga0105238_10084601 Ga0105238_100846012 155
801 3300009551 Ga0105238_10603779 Ga0105238_106037791 155
802 3300009551 Ga0105238_11168291 Ga0105238_111682912 155
803 3300009551 Ga0105238_11265184 Ga0105238_112651842 155
804 3300009553 Ga0105249_10000016 Ga0105249_10000016219 155
805 3300009553 Ga0105249_10001221 Ga0105249_1000122111 155
806 3300009553 Ga0105249_10124105 Ga0105249_101241052 155
807 3300009978 Ga0105148_106071 Ga0105148_1060711 155
808 3300010375 Ga0105239_10912481 Ga0105239_109124812 155
809 3300010375 Ga0105239_10979799 Ga0105239_109797992 155
810 3300013100 Ga0157373_10007439 Ga0157373_100074396 155
811 3300013104 Ga0157370_10076269 Ga0157370_100762692 155
812 3300013105 Ga0157369_10053973 Ga0157369_100539733 155
813 3300013306 Ga0163162_11789719 Ga0163162_117897192 155
814 3300013307 Ga0157372_10288904 Ga0157372_102889042 155
815 3300014325 Ga0163163_10055856 Ga0163163_100558562 155
816 3300014325 Ga0163163_10303612 Ga0163163_103036121 155
817 3300014326 Ga0157380_10001406 Ga0157380_100014062 155
818 3300014968 Ga0157379_10161443 Ga0157379_101614433 155
819 3300017792 Ga0163161_10000044 Ga0163161_1000004467 155
820 3300017792 Ga0163161_10174942 Ga0163161_101749422 155
821 3300021384 Ga0213876_10145076 Ga0213876_101450762 155
822 3300025223 Ga0207672_1000703 Ga0207672_10007033 155
823 3300025263 Ga0209565_1000522 Ga0209565_10005224 155
824 3300025273 Ga0209673_1000645 Ga0209673_100064524 155
825 3300025291 Ga0209675_1011088 Ga0209675_10110884 155
826 3300025292 Ga0209676_1000136 Ga0209676_100013632 155
827 3300025292 Ga0209676_1000200 Ga0209676_100020031 155
828 3300025295 Ga0209564_1001982 Ga0209564_100198212 155
829 3300025295 Ga0209564_1011644 Ga0209564_10116444 155
830 3300025297 Ga0209758_1005516 Ga0209758_10055167 155
831 3300025297 Ga0209758_1007344 Ga0209758_10073445 155
832 3300025298 Ga0209050_1000057 Ga0209050_1000057148 155
833 3300025298 Ga0209050_1000568 Ga0209050_100056832 155
834 3300025298 Ga0209050_1012182 Ga0209050_10121825 155
835 3300025299 Ga0209256_1002486 Ga0209256_10024867 155
836 3300025299 Ga0209256_1005663 Ga0209256_10056637 155
837 3300025299 Ga0209256_1006970 Ga0209256_10069702 155
838 3300025303 Ga0209051_1000836 Ga0209051_100083625 155
839 3300025304 Ga0209257_1000142 Ga0209257_100014232 155
840 3300025304 Ga0209257_1003059 Ga0209257_10030596 155
841 3300025304 Ga0209257_1008523 Ga0209257_10085235 155
842 3300025321 Ga0207656_10035738 Ga0207656_100357382 155
843 3300025735 Ga0207713_1001212 Ga0207713_100121218 155
844 3300025900 Ga0207710_10151366 Ga0207710_101513662 155
845 3300025900 Ga0207710_10181603 Ga0207710_101816032 155
846 3300025903 Ga0207680_10000008 Ga0207680_10000008471 155
847 3300025903 Ga0207680_10079104 Ga0207680_100791042 155
848 3300025904 Ga0207647_10000283 Ga0207647_1000028317 155
849 3300025909 Ga0207705_10054680 Ga0207705_100546803 155
850 3300025911 Ga0207654_10000709 Ga0207654_1000070911 155
851 3300025913 Ga0207695_10009470 Ga0207695_100094703 155
852 3300025913 Ga0207695_10188499 Ga0207695_101884993 155
853 3300025914 Ga0207671_10001568 Ga0207671_1000156816 155
854 3300025919 Ga0207657_10018280 Ga0207657_100182803 155
855 3300025923 Ga0207681_10000020 Ga0207681_1000002062 155
856 3300025923 Ga0207681_10107655 Ga0207681_101076553 155
857 3300025923 Ga0207681_11175584 Ga0207681_111755842 155
858 3300025924 Ga0207694_10005414 Ga0207694_100054149 155
859 3300025924 Ga0207694_10114161 Ga0207694_101141613 155
860 3300025925 Ga0207650_10000261 Ga0207650_1000026147 155
861 3300025925 Ga0207650_10000315 Ga0207650_1000031539 155
862 3300025925 Ga0207650_10012044 Ga0207650_100120443 155
863 3300025931 Ga0207644_10057497 Ga0207644_100574972 155
864 3300025931 Ga0207644_10100214 Ga0207644_101002142 155
865 3300025931 Ga0207644_10847506 Ga0207644_108475061 155
866 3300025932 Ga0207690_10026667 Ga0207690_100266674 155
867 3300025932 Ga0207690_10054676 Ga0207690_100546762 155
868 3300025933 Ga0207706_10036406 Ga0207706_100364063 155
869 3300025936 Ga0207670_10026927 Ga0207670_100269272 155
870 3300025941 Ga0207711_10000004 Ga0207711_10000004403 155
871 3300025941 Ga0207711_10009477 Ga0207711_100094775 155
872 3300025941 Ga0207711_10013577 Ga0207711_100135776 155
873 3300025941 Ga0207711_10041111 Ga0207711_100411112 155
874 3300025941 Ga0207711_10056144 Ga0207711_100561442 155
875 3300025941 Ga0207711_10169418 Ga0207711_101694182 155
876 3300025944 Ga0207661_10180015 Ga0207661_101800152 155
877 3300025949 Ga0207667_10053385 Ga0207667_100533853 155
878 3300025949 Ga0207667_10142838 Ga0207667_101428382 155
879 3300025961 Ga0207712_10000009 Ga0207712_10000009471 155
880 3300025961 Ga0207712_10000034 Ga0207712_1000003496 155
881 3300025961 Ga0207712_10000203 Ga0207712_1000020318 155
882 3300025961 Ga0207712_10071327 Ga0207712_100713273 155
883 3300025972 Ga0207668_10000007 Ga0207668_10000007157 155
884 3300025972 Ga0207668_10000427 Ga0207668_1000042718 155
885 3300025972 Ga0207668_10005648 Ga0207668_100056484 155
886 3300025972 Ga0207668_10208223 Ga0207668_102082233 155
887 3300025981 Ga0207640_10294287 Ga0207640_102942872 155
888 3300025981 Ga0207640_11664499 Ga0207640_116644991 155
889 3300025986 Ga0207658_10000239 Ga0207658_1000023947 155
890 3300025986 Ga0207658_10001403 Ga0207658_100014035 155
891 3300025986 Ga0207658_10046036 Ga0207658_100460363 155
892 3300025986 Ga0207658_10243328 Ga0207658_102433283 155
893 3300025986 Ga0207658_10717296 Ga0207658_107172962 155
894 3300026035 Ga0207703_10011130 Ga0207703_100111305 155
895 3300026035 Ga0207703_10012829 Ga0207703_100128293 155
896 3300026035 Ga0207703_11130197 Ga0207703_111301972 155
897 3300026041 Ga0207639_10016045 Ga0207639_100160453 155
898 3300026041 Ga0207639_10022411 Ga0207639_100224113 155
899 3300026041 Ga0207639_10122601 Ga0207639_101226012 155
900 3300026067 Ga0207678_10010321 Ga0207678_100103217 155
901 3300026075 Ga0207708_10801234 Ga0207708_108012342 155
902 3300026078 Ga0207702_10001125 Ga0207702_1000112515 155
903 3300026088 Ga0207641_10000010 Ga0207641_1000001046 155
904 3300026088 Ga0207641_10000171 Ga0207641_1000017116 155
905 3300026088 Ga0207641_10002034 Ga0207641_100020347 155
906 3300026088 Ga0207641_11345280 Ga0207641_113452801 155
907 3300026095 Ga0207676_10000036 Ga0207676_1000003689 155
908 3300026095 Ga0207676_10000159 Ga0207676_1000015951 155
909 3300026095 Ga0207676_10001337 Ga0207676_100013377 155
910 3300026116 Ga0207674_10007324 Ga0207674_100073249 155
911 3300026116 Ga0207674_10043647 Ga0207674_100436472 155
912 3300026116 Ga0207674_11571122 Ga0207674_115711222 155
913 3300026142 Ga0207698_10008309 Ga0207698_100083093 155
914 3300026142 Ga0207698_10174095 Ga0207698_101740952 155
915 3300026142 Ga0207698_11002603 Ga0207698_110026032 155
916 3300027866 Ga0209813_10410858 Ga0209813_104108581 155
917 3300028379 Ga0268266_10000009 Ga0268266_10000009576 155
918 3300028379 Ga0268266_10001260 Ga0268266_100012609 155
919 3300028379 Ga0268266_10006212 Ga0268266_100062125 155
920 3300028379 Ga0268266_10683782 Ga0268266_106837822 155
921 3300028379 Ga0268266_10891891 Ga0268266_108918912 155
922 3300028380 Ga0268265_10000059 Ga0268265_1000005942 155
923 3300028380 Ga0268265_10000785 Ga0268265_1000078520 155
924 3300028380 Ga0268265_10002154 Ga0268265_100021545 155
925 3300028380 Ga0268265_10450897 Ga0268265_104508972 155
926 3300028381 Ga0268264_10000003 Ga0268264_100000031093 155
927 3300028381 Ga0268264_10000270 Ga0268264_1000027043 155
928 3300028381 Ga0268264_10105163 Ga0268264_101051633 155
929 3300028381 Ga0268264_10710533 Ga0268264_107105331 155
930 3300028573 Ga0265334_10010930 Ga0265334_100109305 155
931 3300028786 Ga0307517_10203899 Ga0307517_102038992 155
932 3300028794 Ga0307515_10020192 Ga0307515_100201929 155
933 3300028794 Ga0307515_10079597 Ga0307515_100795975 155
934 3300028800 Ga0265338_10046066 Ga0265338_100460665 155
935 3300031251 Ga0265327_10169311 Ga0265327_101693112 155
936 3300031456 Ga0307513_10000082 Ga0307513_1000008244 155
937 3300031456 Ga0307513_10000588 Ga0307513_100005886 155
938 3300031730 Ga0307516_10000042 Ga0307516_10000042119 155
939 3300031731 Ga0307405_10689283 Ga0307405_106892832 155
940 3300031911 Ga0307412_10784209 Ga0307412_107842092 155
941 3300031995 Ga0307409_100074008 Ga0307409_1000740083 155
942 3300033180 Ga0307510_10109455 Ga0307510_101094551 155
943 3300033180 Ga0307510_10522340 Ga0307510_105223401 155
944 3300035172 Ga0373955_0439507 Ga0373955_0439507_52_528 155
945 3300037312 Ga0395899_0000070 Ga0395899_0000070_93800_94270 155
946 3300038443 Ga0395901_0455987 Ga0395901_0455987_201_692 155
947 3300039437 Ga0436365_1302053 Ga0436365_1302053_279_770 155
948 3300039437 Ga0436365_1922060 Ga0436365_1922060_5080_5571 155
949 3300044735 Ga0466968_0022191 Ga0466968_0022191_1254_1724 155
950 3300046460 Ga0495638_0017040 Ga0495638_0017040_3530_3997 155
951 3300046492 Ga0495585_0100574 Ga0495585_0100574_825_1316 155
952 3300046515 Ga0495620_0029399 Ga0495620_0029399_1728_2195 155
953 3300046522 Ga0495643_0045247 Ga0495643_0045247_64_531 155
954 3300046522 Ga0495643_0045411 Ga0495643_0045411_1304_1771 155
955 3300046524 Ga0495648_0057534 Ga0495648_0057534_1468_1935 155
956 3300046524 Ga0495648_0404720 Ga0495648_0404720_78_545 155
957 3300046616 Ga0495668_0006444 Ga0495668_0006444_1596_2063 155
958 3300046660 Ga0495625_0018457 Ga0495625_0018457_3071_3538 155
959 3300047320 Ga0495672_0013874 Ga0495672_0013874_3117_3584 155
960 3300047469 Ga0495673_0022277 Ga0495673_0022277_1843_2316 155
961 3300047472 Ga0495686_0000100 Ga0495686_0000100_69169_69642 155
962 3300047472 Ga0495686_0138650 Ga0495686_0138650_491_958 155
963 3300048903 Ga0496100_1078895 Ga0496100_1078895_16_483 155
964 3300048904 Ga0496101_0904271 Ga0496101_0904271_80_547 155
965 3300048905 Ga0496102_0029380 Ga0496102_0029380_654_1121 155
966 3300048906 Ga0496103_0009002 Ga0496103_0009002_2137_2604 155
967 3300048907 Ga0496104_0074212 Ga0496104_0074212_173_640 155
968 3300048908 Ga0496105_0052384 Ga0496105_0052384_2400_2867 155
969 3300048909 Ga0496106_0423310 Ga0496106_0423310_199_666 155
970 3300048910 Ga0496107_0025098 Ga0496107_0025098_282_749 155
971 3300048912 Ga0496109_0579228 Ga0496109_0579228_123_599 155
972 3300048913 Ga0496110_0385780 Ga0496110_0385780_303_770 155
973 3300048913 Ga0496110_0661306 Ga0496110_0661306_216_692 155
974 3300048914 Ga0496111_0220641 Ga0496111_0220641_190_657 155
975 3300048920 Ga0496117_0008343 Ga0496117_0008343_3844_4311 155
976 3300048920 Ga0496117_0020058 Ga0496117_0020058_184_651 155
977 3300048921 Ga0496118_0000743 Ga0496118_0000743_18942_19409 155
978 3300048922 Ga0496119_0116078 Ga0496119_0116078_527_994 155
979 3300048927 Ga0496124_0057012 Ga0496124_0057012_16_483 155
980 3300048927 Ga0496124_0113186 Ga0496124_0113186_1540_2007 155
981 3300049513 Ga0501290_000220 Ga0501290_000220_6858_7325 155
982 3300049515 Ga0501292_000293 Ga0501292_000293_3815_4282 155
983 3300049517 Ga0501294_000018 Ga0501294_000018_7995_8462 155
984 3300049521 Ga0501298_009530 Ga0501298_009530_161_628 155
985 3300049523 Ga0501300_016550 Ga0501300_016550_325_792 155
986 3300049570 Ga0501033_0001860 Ga0501033_0001860_2746_3213 155
987 3300049571 Ga0501034_0010595 Ga0501034_0010595_2342_2809 155
988 3300049573 Ga0501037_0013995 Ga0501037_0013995_3379_3846 155
989 3300049581 Ga0501047_0030781 Ga0501047_0030781_777_1247 155
990 3300049652 Ga0501202_003687 Ga0501202_003687_1595_2062 155
991 3300049654 Ga0501207_005853 Ga0501207_005853_763_1230 155
992 3300049663 Ga0501223_001222 Ga0501223_001222_3008_3475 155
993 3300049664 Ga0501224_001050 Ga0501224_001050_1636_2103 155
994 3300049668 Ga0501233_003537 Ga0501233_003537_845_1312 155
995 3300049686 Ga0501257_000056 Ga0501257_000056_22282_22749 155
996 3300049686 Ga0501257_009651 Ga0501257_009651_1565_2032 155
997 3300049688 Ga0501259_000802 Ga0501259_000802_2769_3236 155
998 3300049690 Ga0501261_000122 Ga0501261_000122_8815_9282 155
999 3300049704 Ga0501221_003027 Ga0501221_003027_377_844 155
1000 3300049705 Ga0501225_0183335 Ga0501225_0183335_43_510 155
1001 3300049708 Ga0501245_000451 Ga0501245_000451_2234_2701 155
1002 3300049773 Ga0501276_003789 Ga0501276_003789_602_1069 155
1003 3300049775 Ga0501279_000004 Ga0501279_000004_127411_127878 155
1004 3300049776 Ga0501280_000014 Ga0501280_000014_6858_7325 155
1005 3300049776 Ga0501280_001732 Ga0501280_001732_617_1084 155
1006 3300049777 Ga0501281_00038 Ga0501281_00038_13536_14003 155
1007 3300049778 Ga0501282_000231 Ga0501282_000231_5379_5846 155
1008 3300049779 Ga0501283_003046 Ga0501283_003046_1003_1470 155
1009 3300049823 Ga0501044_0055925 Ga0501044_0055925_1723_2196 155
1010 3300050493 nmdc:mga0k408_437006_c1 nmdc:mga0k408_437006_c1_170_637 155
1011 3300050515 nmdc:mga0a205_98112_c1 nmdc:mga0a205_98112_c1_1952_2428 155
1012 3300053087 Ga0500643_000098 Ga0500643_000098_63234_63701 155
1013 3300053087 Ga0500643_013197 Ga0500643_013197_1046_1513 155
1014 3300053090 Ga0500646_0041340 Ga0500646_0041340_109_600 155
1015 3300053096 Ga0500641_0002380 Ga0500641_0002380_4718_5185 155
1016 3300053103 Ga0500555_001203 Ga0500555_001203_4390_4881 155
1017 3300053119 Ga0500595_013284 Ga0500595_013284_1177_1644 155
1018 3300053156 Ga0500622_0002582 Ga0500622_0002582_4094_4567 155
1019 3300053156 Ga0500622_0026143 Ga0500622_0026143_60_527 155
1020 3300054114 Ga0501084_0570927 Ga0501084_0570927_85_561 155
1021 3300059643 Ga0587072_093424 Ga0587072_093424_82_573 155
1022 3300041505 Ga0451849_1130000 Ga0451849_1130000_31_507 156
1023 3300046528 Ga0495642_0129624 Ga0495642_0129624_173_643 156
1024 3300046660 Ga0495625_0301060 Ga0495625_0301060_164_634 156
1025 3300046660 Ga0495625_0336043 Ga0495625_0336043_63_533 156
1026 3300046674 Ga0495588_0108177 Ga0495588_0108177_20_490 156
1027 3300046684 Ga0495669_0000271 Ga0495669_0000271_19478_19948 156
1028 3300046684 Ga0495669_0000928 Ga0495669_0000928_2286_2756 156
1029 3300047445 Ga0495677_0007481 Ga0495677_0007481_2184_2654 156
1030 3300048904 Ga0496101_0608415 Ga0496101_0608415_131_640 156
1031 3300048905 Ga0496102_0139699 Ga0496102_0139699_1246_1740 156
1032 3300049581 Ga0501047_0203525 Ga0501047_0203525_107_601 156
1033 3300050490 nmdc:mga03n38_5359_c1 nmdc:mga03n38_5359_c1_1493_1987 156
1034 3300050491 nmdc:mga00v17_393_c1 nmdc:mga00v17_393_c1_2750_3244 156
1035 3300050493 nmdc:mga0k408_15166_c1 nmdc:mga0k408_15166_c1_150_644 156
1036 3300050494 nmdc:mga06z11_126503_c1 nmdc:mga06z11_126503_c1_572_1066 156
1037 3300050495 nmdc:mga04h51_456516_c1 nmdc:mga04h51_456516_c1_30_524 156
1038 3300059493 Ga0587077_140239 Ga0587077_140239_31_504 156
1039 2162886007 SwRhRL2b_contig_1281257 SwRhRL2b_0559.00004850 157
1040 3300009011 Ga0105251_10000248 Ga0105251_100002489 157
1041 3300009177 Ga0105248_10000029 Ga0105248_10000029104 157
1042 3300009553 Ga0105249_10000024 Ga0105249_1000002496 157
1043 3300013306 Ga0163162_10010762 Ga0163162_100107623 157
1044 3300013308 Ga0157375_11431435 Ga0157375_114314351 157
1045 3300014968 Ga0157379_10072271 Ga0157379_100722713 157
1046 3300015261 Ga0182006_1179295 Ga0182006_11792952 157
1047 3300039450 Ga0436363_0893999 Ga0436363_0893999_48_569 157
1048 3300042000 Ga0439437_008353 Ga0439437_008353_49_522 157
1049 3300042156 Ga0439446_0005219 Ga0439446_0005219_981_1454 157
1050 3300042436 Ga0439435_0004175 Ga0439435_0004175_758_1231 157
1051 3300046453 Ga0495627_000452 Ga0495627_000452_21908_22381 157
1052 3300046457 Ga0495590_0008623 Ga0495590_0008623_1847_2320 157
1053 3300046460 Ga0495638_0000600 Ga0495638_0000600_22238_22711 157
1054 3300046460 Ga0495638_0023271 Ga0495638_0023271_3268_3741 157
1055 3300046460 Ga0495638_0503855 Ga0495638_0503855_29_502 157
1056 3300046471 Ga0495650_0000007 Ga0495650_0000007_423091_423564 157
1057 3300046471 Ga0495650_0094421 Ga0495650_0094421_44_517 157
1058 3300046492 Ga0495585_0370536 Ga0495585_0370536_95_568 157
1059 3300046506 Ga0495583_0000024 Ga0495583_0000024_69377_69850 157
1060 3300046507 Ga0495606_0065745 Ga0495606_0065745_193_666 157
1061 3300046507 Ga0495606_0520385 Ga0495606_0520385_41_514 157
1062 3300046512 Ga0495610_0000029 Ga0495610_0000029_227292_227765 157
1063 3300046512 Ga0495610_0000881 Ga0495610_0000881_3126_3599 157
1064 3300046512 Ga0495610_0002304 Ga0495610_0002304_9023_9583 157
1065 3300046513 Ga0495616_0001006 Ga0495616_0001006_17583_18056 157
1066 3300046518 Ga0495631_0038639 Ga0495631_0038639_1339_1812 157
1067 3300046519 Ga0495632_0000157 Ga0495632_0000157_68933_69406 157
1068 3300046520 Ga0495637_0004402 Ga0495637_0004402_3438_3911 157
1069 3300046524 Ga0495648_0001559 Ga0495648_0001559_2538_3011 157
1070 3300046524 Ga0495648_0068312 Ga0495648_0068312_1363_1836 157
1071 3300046530 Ga0495654_0000116 Ga0495654_0000116_17000_17473 157
1072 3300046616 Ga0495668_0010494 Ga0495668_0010494_3297_3770 157
1073 3300046660 Ga0495625_0000051 Ga0495625_0000051_73169_73642 157
1074 3300046660 Ga0495625_0030245 Ga0495625_0030245_723_1196 157
1075 3300046664 Ga0495659_0268569 Ga0495659_0268569_39_512 157
1076 3300046691 Ga0495670_0045322 Ga0495670_0045322_1014_1487 157
1077 3300046692 Ga0495671_0156059 Ga0495671_0156059_45_518 157
1078 3300046794 Ga0495589_0012579 Ga0495589_0012579_2537_3097 157
1079 3300047320 Ga0495672_0014661 Ga0495672_0014661_4756_5229 157
1080 3300047469 Ga0495673_0000082 Ga0495673_0000082_52477_52950 157
1081 3300047469 Ga0495673_0000123 Ga0495673_0000123_31243_31716 157
1082 3300047469 Ga0495673_0003676 Ga0495673_0003676_5240_5713 157
1083 3300047470 Ga0495681_0030772 Ga0495681_0030772_620_1093 157
1084 3300047472 Ga0495686_0003073 Ga0495686_0003073_8330_8803 157
1085 3300047472 Ga0495686_0028615 Ga0495686_0028615_2597_3070 157
1086 3300047472 Ga0495686_0132217 Ga0495686_0132217_552_1112 157
1087 3300048904 Ga0496101_0006329 Ga0496101_0006329_6385_6858 157
1088 3300048905 Ga0496102_0000640 Ga0496102_0000640_23890_24363 157
1089 3300048906 Ga0496103_0000197 Ga0496103_0000197_23890_24363 157
1090 3300048909 Ga0496106_0026998 Ga0496106_0026998_1634_2107 157
1091 3300048910 Ga0496107_0000121 Ga0496107_0000121_35828_36301 157
1092 3300048918 Ga0496115_0008541 Ga0496115_0008541_3640_4113 157
1093 3300048919 Ga0496116_0001609 Ga0496116_0001609_13181_13654 157
1094 3300048920 Ga0496117_0000467 Ga0496117_0000467_23890_24363 157
1095 3300048920 Ga0496117_0016499 Ga0496117_0016499_2793_3266 157
1096 3300048921 Ga0496118_0000335 Ga0496118_0000335_63533_64006 157
1097 3300048921 Ga0496118_0000459 Ga0496118_0000459_43121_43594 157
1098 3300048922 Ga0496119_0044227 Ga0496119_0044227_2235_2708 157
1099 3300048924 Ga0496121_0009838 Ga0496121_0009838_2032_2505 157
1100 3300048924 Ga0496121_0012838 Ga0496121_0012838_6322_6825 157
1101 3300048927 Ga0496124_0000499 Ga0496124_0000499_23890_24363 157
1102 3300049459 Ga0495678_001696 Ga0495678_001696_9672_10145 157
1103 3300049459 Ga0495678_088164 Ga0495678_088164_514_987 157
1104 3300049513 Ga0501290_022754 Ga0501290_022754_152_655 157
1105 3300049522 Ga0501299_011524 Ga0501299_011524_586_1089 157
1106 3300050493 nmdc:mga0k408_223106_c1 nmdc:mga0k408_223106_c1_294_767 157
1107 3300053086 Ga0500578_0000005 Ga0500578_0000005_6269_6742 157
1108 3300053086 Ga0500578_0251242 Ga0500578_0251242_117_590 157
1109 3300053088 Ga0500644_0000191 Ga0500644_0000191_2722_3195 157
1110 3300053102 Ga0500554_002752 Ga0500554_002752_1068_1541 157
1111 3300053108 Ga0500562_000175 Ga0500562_000175_7502_7975 157
1112 3300053118 Ga0500594_0000329 Ga0500594_0000329_9502_9975 157
1113 3300053125 Ga0500618_000129 Ga0500618_000129_20652_21125 157
1114 3300053133 Ga0500655_064507 Ga0500655_064507_182_655 157
1115 3300053136 Ga0500559_0000008 Ga0500559_0000008_129911_130444 157
1116 3300053138 Ga0500564_000070 Ga0500564_000070_7375_7848 157
1117 3300053142 Ga0500577_0000387 Ga0500577_0000387_8515_8988 157
1118 3300053156 Ga0500622_0002118 Ga0500622_0002118_5983_6456 157
1119 3300053156 Ga0500622_0015725 Ga0500622_0015725_202_675 157
1120 3300053158 Ga0500627_0030496 Ga0500627_0030496_1336_1809 157
1121 3300053727 Ga0500611_010777 Ga0500611_010777_766_1239 157
1122 3300053730 Ga0500645_002580 Ga0500645_002580_4194_4667 157
1123 3300053731 Ga0500609_000068 Ga0500609_000068_6601_7074 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00160

Pro_isomerase

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

7

149

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xyh-assembly1.cif.gz_A crystal structure of recombinant human cyclophilin j 0.9398 10 153
7abi-assembly1.cif.gz_t human pre-bact-2 spliceosome 0.9347 9 153
1zkc-assembly2.cif.gz_B crystal structure of the cyclophiln_ring domain of human peptidylprolyl isomerase (cyclophilin)-like 2 isoform b 0.9336 10 153
5ex2-assembly2.cif.gz_B crystal structure of cyclophilin aquacyp293 from hirschia baltica 0.9317 6 157
2qer-assembly1.cif.gz_A crystal structure of cryptosporidium parvum cyclophilin type peptidyl-prolyl cis-trans isomerase cgd2_1660 in the presence of dipeptide ala-pro 0.9293 10 153
ID Description Score Start End Superfamily
1xyhA00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9398 10 153 2.40.100.10
af_A0A0R4J2Z8_2_164_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9395 10 152 2.40.100.10
af_Q4DFI2_1_176_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9267 10 154 2.40.100.10
af_Q2FZU9_3_197_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.921 10 152 2.40.100.10
af_Q8ILM0_1_181_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9174 10 153 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A525JAJ7-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 1.002 7 157 GO:0006457
GO:0140839
GO:0140840
AF-A0A349J3P8-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9992 12 150 GO:0140839
GO:0140840
AF-A0A0A1PXU0-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9985 3 156 GO:0140839
GO:0140840
AF-A0A258L1N3-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9984 10 152 GO:0140839
GO:0140840
AF-A0A848SJ26-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9978 4 156 GO:0003755

Feature Viewer

pLDDT pTM Quality
95.29 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map