F490424

General Info

Members Datasets Scaffolds Average Seq Length
1122 537 1040 261

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0071312|Ga0501075_0071312_1587_2456
Length 289
Sequence MTATCLPGSGARPLETVGDPPAGTPLLRCRGICKRFGPVEALVDVDFDIDPGEVVALVGDNGAGKSTLIKAISGVQPADSGRFFFEGREVRIAGAADANRLGIETVYQDLALCDNLDTVANLFLGRELVGPSRIPALLHVLAEPDMEQRAAAQLAELGVTTIASVHSPVQALSGGQRQAVAVARPTLWDAKLLILDEPTAALGVTQTAQVLELIRRLRDSGLGVVVISHNIDVVFDVSDRIVVLYVGRHLATFDRQSTTRDEVVSAILGLAPGEQRRGSGRRALGAVAP

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
5 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
6 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
7 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
8 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
9 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
10 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
11 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
12 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
13 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
14 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
15 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
16 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
17 2643221609 Acidovorax sp. Root217 Isolate Unclassified
18 2643221610 Ensifer sp. Root74 Isolate Unclassified
19 2643221611 Acidovorax sp. Root219 Isolate Unclassified
20 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
21 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
22 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
23 2643221658 Variovorax sp. Root411 Isolate Unclassified
24 2643221672 Variovorax sp. Root434 Isolate Unclassified
25 2643221675 Ensifer sp. Root1298 Isolate Unclassified
26 2643221680 Ensifer sp. Root1312 Isolate Unclassified
27 2643221683 Variovorax sp. Root473 Isolate Unclassified
28 2643221717 Acidovorax sp. Root267 Isolate Unclassified
29 2643221726 Ensifer sp. Root954 Isolate Unclassified
30 2738541277 Variovorax sp. GV051 Isolate Unclassified
31 2738541307 Variovorax sp. GV008 Isolate Unclassified
32 2738543013 Variovorax sp. BT01 Isolate Unclassified
33 2738543019 Variovorax sp. GV040 Isolate Unclassified
34 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
35 2818991446 Variovorax sp. 1180 Isolate Unclassified
36 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
37 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
38 2842677519 Variovorax sp. R-72495 Isolate Unclassified
39 2854911287 Brucella lupini LUP21 Isolate Unclassified
40 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
41 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
42 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
43 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
44 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
45 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
46 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
47 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
48 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
49 2885198086 Variovorax sp. 679 Isolate Unclassified
50 2885211737 Variovorax sp. 553 Isolate Unclassified
51 2899924645 Variovorax sp. 369 Isolate Unclassified
52 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
53 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
54 2904456579 Variovorax sp. 2002 Isolate Unclassified
55 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
56 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
57 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
58 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
59 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
60 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
61 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
62 2928037797 Variovorax sp. 1126 Isolate Unclassified
63 2928044640 Variovorax sp. 1128 Isolate Unclassified
64 2928051484 Variovorax sp. 1133 Isolate Unclassified
65 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
66 2928070936 Variovorax gossypii 1167 Isolate Unclassified
67 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
68 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
69 2929520902 Variovorax beijingensis 502 Isolate Unclassified
70 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
71 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
72 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
73 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
74 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
75 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
76 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
77 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
78 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
79 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
80 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
81 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
82 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
83 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
84 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
85 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
86 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
87 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
88 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
89 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
90 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
91 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
92 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
93 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
94 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
95 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
96 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
97 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
98 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
99 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
100 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
101 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
102 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
103 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
104 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
105 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
106 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
107 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
108 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
109 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
110 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
111 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
112 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
113 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
114 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
115 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
116 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
117 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
118 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
119 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
120 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
121 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
122 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
123 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
124 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
125 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
126 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
127 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
128 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
129 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
130 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
131 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
132 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
133 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
134 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
135 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
136 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
137 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
138 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
139 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
140 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
141 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
142 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
143 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
144 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
145 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
146 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
147 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
148 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
149 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
150 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
151 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
152 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
153 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
154 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
155 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
156 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
157 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
158 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
159 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
160 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
161 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
162 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
163 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
164 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
165 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
166 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
167 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
168 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
169 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
170 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
171 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
172 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
173 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
174 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
175 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
176 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
177 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
178 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
179 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
180 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
181 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
182 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
183 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
184 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
185 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
186 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
187 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
188 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
189 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
190 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
191 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
192 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
193 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
194 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
195 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
196 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
197 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
198 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
199 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
200 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
201 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
202 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
203 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
204 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
205 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
206 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
207 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
208 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
209 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
210 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
211 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
212 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
213 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
214 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
215 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
216 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
217 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
218 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
219 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
220 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
221 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
222 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
223 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
224 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
225 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
226 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
227 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
232 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
234 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
235 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
236 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
239 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
240 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
241 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
243 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
244 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
245 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
246 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
248 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
249 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
250 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
252 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
253 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
310 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
311 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
312 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
314 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
318 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
319 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
320 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
321 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
322 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
323 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
324 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
325 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
326 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
327 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
328 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
329 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
330 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
331 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
332 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
333 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
334 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
335 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
336 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
337 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
338 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
339 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
340 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
341 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
342 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
343 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
344 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
345 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
346 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
347 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
348 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
349 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
350 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
351 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
352 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
353 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
354 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
355 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
356 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
357 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
358 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
359 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
360 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
361 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
362 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
363 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
364 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
365 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
366 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
367 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
368 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
369 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
370 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
371 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
372 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
373 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
374 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
375 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
376 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
377 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
378 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
379 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
380 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
381 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
382 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
383 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
384 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
385 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
386 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
387 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
388 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
389 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
390 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
391 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
392 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
393 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
394 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
395 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
396 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
397 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
398 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
399 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
400 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
401 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
402 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
403 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
404 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
405 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
406 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
407 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
408 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
409 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
410 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
411 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
412 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
413 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
414 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
415 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
416 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
417 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
418 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
419 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
420 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
421 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
422 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
423 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
424 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
425 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
426 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
427 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
428 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
429 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
430 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
431 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
432 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
433 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
434 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
435 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
436 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
437 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
438 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
439 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
440 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
441 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
442 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
443 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
444 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
445 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
446 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
447 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
448 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
449 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
450 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
451 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
452 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
453 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
454 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
455 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
456 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
457 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
458 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
459 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
460 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
461 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
462 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
463 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
464 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
465 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
466 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
467 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
468 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
469 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
470 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
471 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
472 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
473 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
474 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
475 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
476 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
477 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
478 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
479 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
480 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
481 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
482 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
483 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
484 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
485 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
486 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
487 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
488 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
489 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
490 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
491 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
492 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
493 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
494 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
495 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
496 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
497 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
498 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
499 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
500 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
501 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
502 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
503 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
504 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
505 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
506 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
507 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
508 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
509 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
510 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
511 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
512 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
513 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
514 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
515 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
516 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
517 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
518 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
519 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
520 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
521 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
522 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
523 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
524 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
525 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
526 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
527 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
528 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
529 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
530 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
531 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
532 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
533 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
534 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
535 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
536 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
537 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.51
Metatranscriptomes 0.18
Isolates 7.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.12
Nodule 2.14
Rhizoplane 3.12
Rhizosphere 54.28
Stem 0
Stem Tuber 0
Unclassified 10.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007287 3300001979 Bacteria 4506
2 JGI24739J22299_10039342 3300001989 Bacteria 1584
3 JGI25155J39150_1000002 3300002704 Bacteria 292156
4 JGI25156J39149_1000003 3300002705 Bacteria 305434
5 JGI25156J39149_1011013 3300002705 Bacteria 2077
6 JGI25154J39366_1000009 3300002738 Bacteria 305408
7 JGI25154J39366_1003329 3300002738 Bacteria 3457
8 JGI25157J39369_1000002 3300002741 Bacteria 305434
9 JGI25157J39369_1000539 3300002741 Bacteria 22753
10 JGI25157J39369_1000561 3300002741 Bacteria 22213
11 JGI25152J39213_1002575 3300002773 Bacteria 6791
12 JGI25152J39213_1005617 3300002773 Bacteria 3603
13 JGI25150J39212_1001269 3300002774 Bacteria 7257
14 JGI25150J39212_1003144 3300002774 Bacteria 3930
15 JGI25159J45721_1001036 3300002987 Bacteria 11877
16 JGI25159J45721_1004938 3300002987 Bacteria 4281
17 JGI25159J45721_1006239 3300002987 Bacteria 3603
18 JGI25159J45721_1006784 3300002987 Bacteria 3369
19 JGI25151J46595_10001811 3300003187 Bacteria 13796
20 JGI25151J46595_10002220 3300003187 Bacteria 11996
21 JGI25151J46595_10003451 3300003187 Bacteria 8732
22 JGI25151J46595_10006100 3300003187 Bacteria 6121
23 JGI25151J46595_10008081 3300003187 Bacteria 5097
24 JGI25151J46595_10011432 3300003187 Bacteria 4080
25 JGI25151J46595_10013920 3300003187 Bacteria 3603
26 JGI25151J46595_10047563 3300003187 Bacteria 1491
27 JGI25153J46596_10000548 3300003215 Bacteria 23442
28 JGI25153J46596_10010392 3300003215 Bacteria 4212
29 JGI25153J46596_10012745 3300003215 Bacteria 3603
30 JGI25153J46596_10020234 3300003215 Bacteria 2522
31 rootH1_10010335 3300003323 Bacteria 2411
32 JGI25160J50197_1000305 3300003354 Bacteria 34747
33 JGI25160J50197_1000717 3300003354 Bacteria 18171
34 JGI25160J50197_1009495 3300003354 Bacteria 3603
35 JGI25161J50226_1000018 3300003374 Bacteria 172599
36 JGI25161J50226_1002542 3300003374 Bacteria 4616
37 JGI25161J50226_1009821 3300003374 Bacteria 1328
38 Ga0006562J51391_1109923 3300003578 Bacteria 10958
39 Ga0006562J51391_1109926 3300003578 Bacteria 9410
40 Ga0055533_1000061 3300003756 Bacteria 181542
41 Ga0055525_1000604 3300003759 Bacteria 15154
42 Ga0055535_1000141 3300003761 Bacteria 75603
43 Ga0055535_1001832 3300003761 Bacteria 9118
44 Ga0055542_1000003 3300003762 Bacteria 582721
45 Ga0055529_1000216 3300003763 Bacteria 75603
46 Ga0055526_1005920 3300003771 Bacteria 6823
47 Ga0055526_1005934 3300003771 Bacteria 6811
48 Ga0055526_1009682 3300003771 Bacteria 4596
49 Ga0055526_1013672 3300003771 Bacteria 3411
50 Ga0055526_1014773 3300003771 Bacteria 3183
51 Ga0055537_1000008 3300003773 Bacteria 142572
52 Ga0055537_1000522 3300003773 Bacteria 22551
53 Ga0055537_1003664 3300003773 Bacteria 4657
54 Ga0055537_1005053 3300003773 Bacteria 3612
55 Ga0055524_1000083 3300003775 Bacteria 119259
56 Ga0055524_1006728 3300003775 Bacteria 4962
57 Ga0055524_1007561 3300003775 Bacteria 4596
58 Ga0055536_1001743 3300003781 Bacteria 12841
59 Ga0055536_1002527 3300003781 Bacteria 10245
60 Ga0055536_1004093 3300003781 Bacteria 7582
61 Ga0055536_1054667 3300003781 Bacteria 857
62 Ga0055534_1000475 3300003784 Bacteria 22551
63 Ga0055534_1003012 3300003784 Bacteria 5538
64 Ga0055534_1004006 3300003784 Bacteria 4417
65 Ga0055534_1004188 3300003784 Bacteria 4255
66 Ga0055534_1005116 3300003784 Bacteria 3603
67 Ga0055528_1000652 3300003790 Bacteria 25243
68 Ga0055528_1001142 3300003790 Bacteria 17262
69 Ga0055528_1003777 3300003790 Bacteria 7465
70 Ga0055528_1005231 3300003790 Bacteria 6096
71 Ga0055528_1036478 3300003790 Bacteria 1174
72 Ga0055530_10000211 3300003791 Bacteria 52600
73 Ga0055530_10000292 3300003791 Bacteria 45623
74 Ga0055530_10006773 3300003791 Bacteria 4999
75 Ga0055530_10010477 3300003791 Bacteria 3423
76 Ga0055530_10021720 3300003791 Bacteria 1884
77 Ga0055540_1000012 3300003792 Bacteria 262667
78 Ga0055540_1000233 3300003792 Bacteria 51303
79 Ga0055540_1001010 3300003792 Bacteria 18032
80 Ga0055540_1001968 3300003792 Bacteria 11482
81 Ga0055540_1002793 3300003792 Bacteria 8933
82 Ga0055540_1004585 3300003792 Bacteria 6142
83 Ga0055540_1033070 3300003792 Bacteria 1174
84 Ga0055531_10000098 3300003794 Bacteria 95134
85 Ga0055531_10001140 3300003794 Bacteria 20572
86 Ga0055531_10001700 3300003794 Bacteria 15772
87 Ga0055531_10004352 3300003794 Bacteria 8662
88 Ga0055531_10005187 3300003794 Bacteria 7670
89 Ga0055531_10013853 3300003794 Bacteria 3685
90 Ga0055531_10015577 3300003794 Bacteria 3340
91 Ga0055531_10022073 3300003794 Bacteria 2441
92 Ga0055543_1000418 3300004625 Bacteria 26839
93 Ga0055543_1003447 3300004625 Bacteria 4672
94 Ga0065165_1004855 3300005262 Bacteria 7989
95 Ga0065165_1008869 3300005262 Bacteria 4616
96 Ga0065165_1035854 3300005262 Bacteria 1519
97 Ga0065714_10093371 3300005288 Bacteria 1845
98 Ga0065714_10113560 3300005288 Bacteria 1440
99 Ga0070658_10065895 3300005327 Bacteria 2957
100 Ga0070658_10148075 3300005327 Bacteria 1964
101 Ga0070676_10021078 3300005328 Bacteria 3646
102 Ga0070683_100075122 3300005329 Bacteria 3157
103 Ga0070690_100393047 3300005330 Bacteria 1016
104 Ga0070670_100015208 3300005331 Bacteria 6605
105 Ga0070670_100109601 3300005331 Bacteria 2379
106 Ga0070677_10004237 3300005333 Bacteria 4670
107 Ga0070677_10101520 3300005333 Bacteria 1269
108 Ga0068869_100041457 3300005334 Bacteria 3297
109 Ga0068869_100232450 3300005334 Bacteria 1465
110 Ga0070666_10138299 3300005335 Bacteria 1696
111 Ga0070682_100193866 3300005337 Bacteria 1428
112 Ga0068868_100149780 3300005338 Bacteria 1921
113 Ga0068868_100166673 3300005338 Bacteria 1822
114 Ga0068868_100497752 3300005338 Bacteria 1067
115 Ga0070660_100065333 3300005339 Bacteria 2831
116 Ga0070689_100038076 3300005340 Bacteria 3678
117 Ga0070689_100282726 3300005340 Bacteria 1377
118 Ga0070691_10136598 3300005341 Bacteria 1246
119 Ga0070687_100014306 3300005343 Bacteria 3563
120 Ga0070661_100005588 3300005344 Bacteria 8664
121 Ga0070668_100014962 3300005347 Bacteria 5798
122 Ga0070668_100226240 3300005347 Bacteria 1545
123 Ga0070669_100008979 3300005353 Bacteria 7135
124 Ga0070675_100280577 3300005354 Bacteria 1464
125 Ga0070671_100018945 3300005355 Bacteria 5596
126 Ga0070674_100028134 3300005356 Bacteria 3690
127 Ga0070674_100146355 3300005356 Bacteria 1779
128 Ga0070674_100432224 3300005356 Bacteria 1083
129 Ga0070673_100043450 3300005364 Bacteria 3473
130 Ga0070673_100084541 3300005364 Bacteria 2581
131 Ga0070673_100147784 3300005364 Bacteria 1988
132 Ga0070673_100166771 3300005364 Bacteria 1877
133 Ga0070688_100002758 3300005365 Bacteria 8925
134 Ga0070659_100124902 3300005366 Bacteria 2087
135 Ga0070659_100480126 3300005366 Bacteria 1057
136 Ga0070667_100035008 3300005367 Bacteria 4205
137 Ga0070667_100063934 3300005367 Bacteria 3121
138 Ga0070667_100154845 3300005367 Bacteria 2015
139 Ga0070667_100226673 3300005367 Bacteria 1665
140 Ga0070667_100657388 3300005367 Bacteria 968
141 Ga0070714_100592505 3300005435 Bacteria 1064
142 Ga0070713_100355884 3300005436 Bacteria 1359
143 Ga0070701_10007283 3300005438 Bacteria 4712
144 Ga0070711_100293692 3300005439 Bacteria 1290
145 Ga0070700_100006087 3300005441 Bacteria 6425
146 Ga0070708_100394075 3300005445 Bacteria 1306
147 Ga0070663_100022209 3300005455 Bacteria 4238
148 Ga0070678_100005040 3300005456 Bacteria 7577
149 Ga0070678_100189308 3300005456 Bacteria 1691
150 Ga0070678_100401820 3300005456 Bacteria 1190
151 Ga0070662_100003105 3300005457 Bacteria 10320
152 Ga0070662_100158311 3300005457 Bacteria 1769
153 Ga0070681_10004145 3300005458 Bacteria 13714
154 Ga0068867_100120861 3300005459 Bacteria 2024
155 Ga0068867_100488806 3300005459 Bacteria 1056
156 Ga0070685_10009672 3300005466 Bacteria 4990
157 Ga0070706_100165996 3300005467 Bacteria 2061
158 Ga0070707_100019334 3300005468 Bacteria 6414
159 Ga0070707_100191393 3300005468 Bacteria 1995
160 Ga0070698_100074825 3300005471 Bacteria 3392
161 Ga0070698_100328830 3300005471 Bacteria 1459
162 Ga0070679_100079070 3300005530 Bacteria 3278
163 Ga0070684_100001972 3300005535 Bacteria 15081
164 Ga0070684_100080204 3300005535 Bacteria 2887
165 Ga0068853_100022531 3300005539 Bacteria 5261
166 Ga0068853_100043067 3300005539 Bacteria 3862
167 Ga0068853_100075272 3300005539 Bacteria 2946
168 Ga0068853_100207833 3300005539 Bacteria 1783
169 Ga0070672_100014002 3300005543 Bacteria 5674
170 Ga0070672_100016884 3300005543 Bacteria 5238
171 Ga0070672_100185756 3300005543 Bacteria 1734
172 Ga0070672_100358150 3300005543 Bacteria 1245
173 Ga0070686_100207446 3300005544 Bacteria 1408
174 Ga0070695_100234135 3300005545 Bacteria 1329
175 Ga0070665_100001708 3300005548 Bacteria 25215
176 Ga0070665_100007621 3300005548 Bacteria 11005
177 Ga0070665_100079552 3300005548 Bacteria 3284
178 Ga0070665_100285171 3300005548 Bacteria 1653
179 Ga0070665_100406450 3300005548 Bacteria 1370
180 Ga0070665_100869031 3300005548 Bacteria 915
181 Ga0068855_100095842 3300005563 Bacteria 3419
182 Ga0068855_100123614 3300005563 Bacteria 2960
183 Ga0068855_100309830 3300005563 Bacteria 1747
184 Ga0070664_100095180 3300005564 Bacteria 2583
185 Ga0070664_100219579 3300005564 Bacteria 1700
186 Ga0068857_100008214 3300005577 Bacteria 9021
187 Ga0068857_100027446 3300005577 Bacteria 5022
188 Ga0068857_100090897 3300005577 Bacteria 2732
189 Ga0068857_100127695 3300005577 Bacteria 2292
190 Ga0068857_100619482 3300005577 Bacteria 1024
191 Ga0068854_100005120 3300005578 Bacteria 8261
192 Ga0068856_100005685 3300005614 Bacteria 12282
193 Ga0068856_100352250 3300005614 Bacteria 1491
194 Ga0068856_100456162 3300005614 Bacteria 1299
195 Ga0068856_100829190 3300005614 Bacteria 944
196 Ga0070702_100185276 3300005615 Bacteria 1365
197 Ga0070702_100245573 3300005615 Bacteria 1210
198 Ga0068852_100180920 3300005616 Bacteria 1982
199 Ga0068852_100561504 3300005616 Bacteria 1143
200 Ga0068859_100042077 3300005617 Bacteria 4589
201 Ga0068859_100167746 3300005617 Bacteria 2275
202 Ga0068859_100217825 3300005617 Bacteria 1996
203 Ga0068859_100362888 3300005617 Bacteria 1544
204 Ga0068859_100564648 3300005617 Bacteria 1232
205 Ga0068864_100050175 3300005618 Bacteria 3591
206 Ga0068864_100321919 3300005618 Bacteria 1452
207 Ga0068866_10010375 3300005718 Bacteria 3991
208 Ga0068866_10158968 3300005718 Bacteria 1316
209 Ga0068861_100044042 3300005719 Bacteria 3353
210 Ga0068851_10001256 3300005834 Bacteria 11040
211 Ga0068851_10017442 3300005834 Bacteria 3448
212 Ga0068851_10194218 3300005834 Bacteria 1130
213 Ga0068863_100021846 3300005841 Bacteria 6107
214 Ga0068863_100101338 3300005841 Bacteria 2737
215 Ga0068858_100015852 3300005842 Bacteria 7083
216 Ga0068860_100024531 3300005843 Bacteria 5826
217 Ga0068860_100523759 3300005843 Bacteria 1185
218 Ga0068862_100022834 3300005844 Bacteria 5237
219 Ga0068862_100148756 3300005844 Bacteria 2083
220 Ga0068862_100411196 3300005844 Bacteria 1267
221 Ga0075365_10032083 3300006038 Bacteria 3374
222 Ga0075365_10093712 3300006038 Bacteria 2049
223 Ga0075365_10178447 3300006038 Bacteria 1484
224 Ga0075368_10052418 3300006042 Bacteria 1623
225 Ga0075363_100028112 3300006048 Bacteria 2889
226 Ga0075363_100050802 3300006048 Bacteria 2209
227 Ga0075363_100122076 3300006048 Bacteria 1455
228 Ga0075364_10019732 3300006051 Bacteria 4234
229 Ga0075364_10035747 3300006051 Bacteria 3211
230 Ga0075362_10006676 3300006177 Bacteria 4310
231 Ga0075362_10011626 3300006177 Bacteria 3474
232 Ga0075362_10014623 3300006177 Bacteria 3171
233 Ga0075362_10032346 3300006177 Bacteria 2269
234 Ga0075362_10076778 3300006177 Bacteria 1534
235 Ga0075362_10118821 3300006177 Bacteria 1250
236 Ga0075367_10039908 3300006178 Bacteria 2739
237 Ga0075367_10097136 3300006178 Bacteria 1797
238 Ga0075367_10164656 3300006178 Bacteria 1379
239 Ga0075369_10095619 3300006186 Bacteria 1329
240 Ga0075369_10209907 3300006186 Bacteria 900
241 Ga0075366_10006843 3300006195 Bacteria 6272
242 Ga0075366_10009252 3300006195 Bacteria 5500
243 Ga0075366_10016511 3300006195 Bacteria 4246
244 Ga0075366_10017710 3300006195 Bacteria 4105
245 Ga0075366_10103337 3300006195 Bacteria 1711
246 Ga0075366_10125397 3300006195 Bacteria 1548
247 Ga0075366_10126369 3300006195 Bacteria 1542
248 Ga0075366_10154625 3300006195 Bacteria 1389
249 Ga0075366_10278722 3300006195 Bacteria 1022
250 Ga0075366_10386181 3300006195 Bacteria 861
251 Ga0097621_100097000 3300006237 Bacteria 2474
252 Ga0075370_10000233 3300006353 Bacteria 19925
253 Ga0075370_10000867 3300006353 Bacteria 12306
254 Ga0075370_10001471 3300006353 Bacteria 10254
255 Ga0075370_10002554 3300006353 Bacteria 8471
256 Ga0075370_10003658 3300006353 Bacteria 7360
257 Ga0075370_10022906 3300006353 Bacteria 3435
258 Ga0075370_10038426 3300006353 Bacteria 2693
259 Ga0075370_10038855 3300006353 Bacteria 2679
260 Ga0075370_10075185 3300006353 Bacteria 1936
261 Ga0075370_10224280 3300006353 Bacteria 1111
262 Ga0068871_100004582 3300006358 Bacteria 9639
263 Ga0068871_100023326 3300006358 Bacteria 4783
264 Ga0068871_100138148 3300006358 Bacteria 2071
265 Ga0068865_100389597 3300006881 Bacteria 1139
266 Ga0097620_100042077 3300006931 Bacteria 4589
267 Ga0097620_100167759 3300006931 Bacteria 2275
268 Ga0097620_100217822 3300006931 Bacteria 1996
269 Ga0097620_100362885 3300006931 Bacteria 1544
270 Ga0097620_100564755 3300006931 Bacteria 1232
271 Ga0079104_1000333 3300006946 Bacteria 57718
272 Ga0099826_10000249 3300006948 Bacteria 23710
273 Ga0075435_100279155 3300007076 Bacteria 1426
274 Ga0105244_10001068 3300009036 Bacteria 22905
275 Ga0105244_10125026 3300009036 Bacteria 1243
276 Ga0105240_10002596 3300009093 Bacteria 28900
277 Ga0105240_10013511 3300009093 Bacteria 11208
278 Ga0105240_10144231 3300009093 Bacteria 2843
279 Ga0105240_10260290 3300009093 Bacteria 2002
280 Ga0105240_10288789 3300009093 Bacteria 1881
281 Ga0105240_10311960 3300009093 Bacteria 1796
282 Ga0105240_10801336 3300009093 Bacteria 1020
283 Ga0111539_10114129 3300009094 Bacteria 3168
284 Ga0105245_10421948 3300009098 Bacteria 1337
285 Ga0105245_10532762 3300009098 Bacteria 1194
286 Ga0114129_10762120 3300009147 Bacteria 1238
287 Ga0105243_10002419 3300009148 Bacteria 15633
288 Ga0105243_10006060 3300009148 Bacteria 9350
289 Ga0105243_10018931 3300009148 Bacteria 5221
290 Ga0105243_10021169 3300009148 Bacteria 4935
291 Ga0105243_10671867 3300009148 Bacteria 1006
292 Ga0105242_10038785 3300009176 Bacteria 3833
293 Ga0105242_10138596 3300009176 Bacteria 2108
294 Ga0105242_10565779 3300009176 Bacteria 1092
295 Ga0105248_10149840 3300009177 Bacteria 2632
296 Ga0105248_10429937 3300009177 Bacteria 1487
297 Ga0105248_10879084 3300009177 Bacteria 1012
298 Ga0105237_10000585 3300009545 Bacteria 50881
299 Ga0105237_10002824 3300009545 Bacteria 21125
300 Ga0105237_10009973 3300009545 Bacteria 10135
301 Ga0105237_10401091 3300009545 Bacteria 1376
302 Ga0105238_10001715 3300009551 Bacteria 22102
303 Ga0105238_10027671 3300009551 Bacteria 5778
304 Ga0105238_10090067 3300009551 Bacteria 3055
305 Ga0105238_10352687 3300009551 Bacteria 1460
306 Ga0105249_10590279 3300009553 Bacteria 1165
307 Ga0105239_10000598 3300010375 Bacteria 51483
308 Ga0105239_10003074 3300010375 Bacteria 20735
309 Ga0105239_10021373 3300010375 Bacteria 7135
310 Ga0105239_10150797 3300010375 Bacteria 2594
311 Ga0105239_10216198 3300010375 Bacteria 2149
312 Ga0105239_10300286 3300010375 Bacteria 1808
313 Ga0105246_10128148 3300011119 Bacteria 1891
314 Ga0105246_10782965 3300011119 Bacteria 844
315 Ga0157347_1000792 3300012502 Bacteria 2228
316 Ga0157327_1011566 3300012512 Bacteria 855
317 Ga0157373_10054830 3300013100 Bacteria 2832
318 Ga0157373_10056447 3300013100 Bacteria 2789
319 Ga0157371_10131325 3300013102 Bacteria 1782
320 Ga0157371_10143197 3300013102 Bacteria 1703
321 Ga0157370_10014536 3300013104 Bacteria 8046
322 Ga0157370_10208125 3300013104 Bacteria 1813
323 Ga0157369_10101999 3300013105 Bacteria 3058
324 Ga0157378_10043769 3300013297 Bacteria 3974
325 Ga0157378_10322206 3300013297 Bacteria 1502
326 Ga0163162_10047810 3300013306 Bacteria 4286
327 Ga0163162_10264782 3300013306 Bacteria 1850
328 Ga0163162_10571857 3300013306 Bacteria 1257
329 Ga0163162_10615037 3300013306 Bacteria 1212
330 Ga0157372_10129925 3300013307 Bacteria 2897
331 Ga0157372_10473569 3300013307 Bacteria 1460
332 Ga0157375_10078946 3300013308 Bacteria 3326
333 Ga0157375_10145466 3300013308 Bacteria 2501
334 Ga0157375_10155887 3300013308 Bacteria 2422
335 Ga0163163_10002596 3300014325 Bacteria 15311
336 Ga0163163_10030843 3300014325 Bacteria 5170
337 Ga0157380_10013288 3300014326 Bacteria 5998
338 Ga0182008_10008991 3300014497 Bacteria 5412
339 Ga0182008_10009875 3300014497 Bacteria 5131
340 Ga0182008_10010926 3300014497 Bacteria 4843
341 Ga0182008_10027827 3300014497 Bacteria 2861
342 Ga0157377_10004392 3300014745 Bacteria 6484
343 Ga0157379_10020325 3300014968 Bacteria 5870
344 Ga0157379_10492899 3300014968 Bacteria 1135
345 Ga0157379_10747620 3300014968 Bacteria 920
346 Ga0157376_10001480 3300014969 Bacteria 15475
347 Ga0182006_1007361 3300015261 Bacteria 5043
348 Ga0182006_1016430 3300015261 Bacteria 3157
349 Ga0182007_10001485 3300015262 Bacteria 12546
350 Ga0182007_10001760 3300015262 Bacteria 11377
351 Ga0182007_10006499 3300015262 Bacteria 5014
352 Ga0182007_10035970 3300015262 Bacteria 1668
353 Ga0183362_10007 3300015683 Bacteria 240101
354 Ga0163161_10001326 3300017792 Bacteria 18422
355 Ga0163161_10006026 3300017792 Bacteria 8401
356 Ga0163161_10022613 3300017792 Bacteria 4429
357 Ga0163161_10029568 3300017792 Bacteria 3895
358 Ga0163161_10057116 3300017792 Bacteria 2836
359 Ga0163161_10168512 3300017792 Bacteria 1673
360 Ga0213872_10000067 3300021361 Bacteria 92410
361 Ga0213872_10001461 3300021361 Bacteria 15360
362 Ga0213872_10023875 3300021361 Bacteria 2813
363 Ga0213872_10102871 3300021361 Bacteria 1272
364 Ga0213871_10013856 3300021441 Bacteria 1902
365 Ga0209435_100001 3300025206 Bacteria 1424171
366 Ga0209436_103221 3300025208 Bacteria 4437
367 Ga0209436_108356 3300025208 Bacteria 2069
368 Ga0209674_100003 3300025226 Bacteria 2196646
369 Ga0209672_100709 3300025228 Bacteria 16591
370 Ga0209147_100791 3300025229 Bacteria 15333
371 Ga0209563_100086 3300025230 Bacteria 182199
372 Ga0207427_100292 3300025231 Bacteria 35576
373 Ga0209258_100015 3300025242 Bacteria 706310
374 Ga0209258_100044 3300025242 Bacteria 376336
375 Ga0209258_100645 3300025242 Bacteria 26222
376 Ga0207425_1000234 3300025245 Bacteria 42951
377 Ga0207425_1000287 3300025245 Bacteria 36896
378 Ga0207425_1002100 3300025245 Bacteria 7363
379 Ga0207425_1004781 3300025245 Bacteria 3986
380 Ga0207425_1026555 3300025245 Bacteria 1186
381 Ga0207425_1031360 3300025245 Bacteria 1059
382 Ga0209646_1000001 3300025246 Bacteria 3092932
383 Ga0209646_1000067 3300025246 Bacteria 241595
384 Ga0209026_1000003 3300025250 Bacteria 1060571
385 Ga0209026_1000033 3300025250 Bacteria 318512
386 Ga0209677_100087 3300025253 Bacteria 109892
387 Ga0209677_100136 3300025253 Bacteria 68374
388 Ga0209148_1000028 3300025254 Bacteria 582773
389 Ga0209148_1007707 3300025254 Bacteria 2215
390 Ga0209759_1000001 3300025256 Bacteria 2799452
391 Ga0209759_1000024 3300025256 Bacteria 318512
392 Ga0209759_1009494 3300025256 Bacteria 2938
393 Ga0209129_1000049 3300025258 Bacteria 268086
394 Ga0209129_1000149 3300025258 Bacteria 114222
395 Ga0209129_1000222 3300025258 Bacteria 64597
396 Ga0209129_1001507 3300025258 Bacteria 12934
397 Ga0209129_1005188 3300025258 Bacteria 4736
398 Ga0209129_1022639 3300025258 Bacteria 1133
399 Ga0209565_1000004 3300025263 Bacteria 983150
400 Ga0209565_1000108 3300025263 Bacteria 120719
401 Ga0209565_1000337 3300025263 Bacteria 41609
402 Ga0209565_1000418 3300025263 Bacteria 34964
403 Ga0209565_1001765 3300025263 Bacteria 8806
404 Ga0209455_1000048 3300025272 Bacteria 376260
405 Ga0209455_1022908 3300025272 Bacteria 1181
406 Ga0209673_1000074 3300025273 Bacteria 233552
407 Ga0209673_1000193 3300025273 Bacteria 123134
408 Ga0209673_1000477 3300025273 Bacteria 66849
409 Ga0209673_1000817 3300025273 Bacteria 41131
410 Ga0209673_1002390 3300025273 Bacteria 13155
411 Ga0209673_1034299 3300025273 Bacteria 1535
412 Ga0209673_1037241 3300025273 Bacteria 1432
413 Ga0209130_1000050 3300025284 Bacteria 222092
414 Ga0209130_1000267 3300025284 Bacteria 65435
415 Ga0209130_1000584 3300025284 Bacteria 35499
416 Ga0209130_1003292 3300025284 Bacteria 7015
417 Ga0209130_1007333 3300025284 Bacteria 3417
418 Ga0207673_1006749 3300025290 Bacteria 1427
419 Ga0209675_1000044 3300025291 Bacteria 230392
420 Ga0209675_1000163 3300025291 Bacteria 81884
421 Ga0209675_1002545 3300025291 Bacteria 9263
422 Ga0209675_1004259 3300025291 Bacteria 6447
423 Ga0209675_1005308 3300025291 Bacteria 5427
424 Ga0209675_1007207 3300025291 Bacteria 4306
425 Ga0209675_1017120 3300025291 Bacteria 2080
426 Ga0209675_1021225 3300025291 Bacteria 1736
427 Ga0209675_1038270 3300025291 Bacteria 1070
428 Ga0209676_1000029 3300025292 Bacteria 520536
429 Ga0209676_1000137 3300025292 Bacteria 179437
430 Ga0209676_1000903 3300025292 Bacteria 37397
431 Ga0209676_1001273 3300025292 Bacteria 26119
432 Ga0209676_1002525 3300025292 Bacteria 12767
433 Ga0209676_1004125 3300025292 Bacteria 8278
434 Ga0209676_1030009 3300025292 Bacteria 1669
435 Ga0209025_1000253 3300025294 Bacteria 125975
436 Ga0209025_1000409 3300025294 Bacteria 86577
437 Ga0209025_1000481 3300025294 Bacteria 77405
438 Ga0209025_1000707 3300025294 Bacteria 56879
439 Ga0209025_1004308 3300025294 Bacteria 12467
440 Ga0209025_1005333 3300025294 Bacteria 10549
441 Ga0209025_1006141 3300025294 Bacteria 9461
442 Ga0209025_1007205 3300025294 Bacteria 8378
443 Ga0209025_1012348 3300025294 Bacteria 5490
444 Ga0209025_1032870 3300025294 Bacteria 2414
445 Ga0209564_1000232 3300025295 Bacteria 122080
446 Ga0209564_1000470 3300025295 Bacteria 67507
447 Ga0209564_1000498 3300025295 Bacteria 64577
448 Ga0209564_1001382 3300025295 Bacteria 25319
449 Ga0209564_1004034 3300025295 Bacteria 9281
450 Ga0209758_1000135 3300025297 Bacteria 177753
451 Ga0209758_1000296 3300025297 Bacteria 97937
452 Ga0209758_1004899 3300025297 Bacteria 10766
453 Ga0209758_1005197 3300025297 Bacteria 10225
454 Ga0209758_1010937 3300025297 Bacteria 5341
455 Ga0209758_1012831 3300025297 Bacteria 4642
456 Ga0209050_1000003 3300025298 Bacteria 1609245
457 Ga0209050_1000015 3300025298 Bacteria 759102
458 Ga0209050_1000600 3300025298 Bacteria 57329
459 Ga0209050_1000936 3300025298 Bacteria 38151
460 Ga0209050_1000947 3300025298 Bacteria 37719
461 Ga0209050_1002573 3300025298 Bacteria 15095
462 Ga0209050_1009899 3300025298 Bacteria 4788
463 Ga0209050_1019284 3300025298 Bacteria 2599
464 Ga0209256_1000001 3300025299 Bacteria 2166974
465 Ga0209256_1000024 3300025299 Bacteria 448909
466 Ga0209256_1000129 3300025299 Bacteria 163766
467 Ga0209256_1000604 3300025299 Bacteria 49837
468 Ga0209256_1044449 3300025299 Bacteria 1109
469 Ga0207426_1000071 3300025302 Bacteria 329539
470 Ga0207426_1000171 3300025302 Bacteria 163766
471 Ga0207426_1000185 3300025302 Bacteria 154146
472 Ga0207426_1005768 3300025302 Bacteria 5563
473 Ga0209051_1000003 3300025303 Bacteria 1609245
474 Ga0209051_1000010 3300025303 Bacteria 641298
475 Ga0209051_1000132 3300025303 Bacteria 139145
476 Ga0209051_1000137 3300025303 Bacteria 137784
477 Ga0209051_1000155 3300025303 Bacteria 129560
478 Ga0209051_1000172 3300025303 Bacteria 117180
479 Ga0209051_1000556 3300025303 Bacteria 45471
480 Ga0209051_1000940 3300025303 Bacteria 28752
481 Ga0209051_1003368 3300025303 Bacteria 10517
482 Ga0209051_1010284 3300025303 Bacteria 4745
483 Ga0209257_1000015 3300025304 Bacteria 908141
484 Ga0209257_1000018 3300025304 Bacteria 836016
485 Ga0209257_1000021 3300025304 Bacteria 771986
486 Ga0209257_1000026 3300025304 Bacteria 723225
487 Ga0209257_1000108 3300025304 Bacteria 240229
488 Ga0209257_1000205 3300025304 Bacteria 143735
489 Ga0209257_1000209 3300025304 Bacteria 141383
490 Ga0209257_1000236 3300025304 Bacteria 129543
491 Ga0209257_1006431 3300025304 Bacteria 7573
492 Ga0209257_1008011 3300025304 Bacteria 6166
493 Ga0209257_1017387 3300025304 Bacteria 2836
494 Ga0207697_10000691 3300025315 Bacteria 19183
495 Ga0207656_10009748 3300025321 Bacteria 3571
496 Ga0207656_10126870 3300025321 Bacteria 1192
497 Ga0207655_1000800 3300025728 Bacteria 34234
498 Ga0207655_1026744 3300025728 Bacteria 2763
499 Ga0207682_10031186 3300025893 Bacteria 2138
500 Ga0207682_10031339 3300025893 Bacteria 2134
501 Ga0207682_10033434 3300025893 Bacteria 2070
502 Ga0207642_10002195 3300025899 Bacteria 6050
503 Ga0207642_10013538 3300025899 Bacteria 2980
504 Ga0207688_10013598 3300025901 Bacteria 4424
505 Ga0207645_10002030 3300025907 Bacteria 16256
506 Ga0207645_10159688 3300025907 Bacteria 1474
507 Ga0207643_10217259 3300025908 Bacteria 1169
508 Ga0207705_10045494 3300025909 Bacteria 3154
509 Ga0207705_10083918 3300025909 Bacteria 2325
510 Ga0207705_10478366 3300025909 Bacteria 967
511 Ga0207684_10107831 3300025910 Bacteria 2383
512 Ga0207684_10183333 3300025910 Bacteria 1805
513 Ga0207654_10055188 3300025911 Bacteria 2299
514 Ga0207707_10334993 3300025912 Bacteria 1305
515 Ga0207695_10011095 3300025913 Bacteria 10941
516 Ga0207695_10012587 3300025913 Bacteria 10139
517 Ga0207695_10075509 3300025913 Bacteria 3429
518 Ga0207695_10202069 3300025913 Bacteria 1901
519 Ga0207671_10001425 3300025914 Bacteria 27749
520 Ga0207671_10008246 3300025914 Bacteria 8864
521 Ga0207671_10290902 3300025914 Bacteria 1290
522 Ga0207663_10242856 3300025916 Bacteria 1322
523 Ga0207663_10419230 3300025916 Bacteria 1027
524 Ga0207657_10014801 3300025919 Bacteria 7594
525 Ga0207657_10032485 3300025919 Bacteria 4715
526 Ga0207652_10514864 3300025921 Bacteria 1077
527 Ga0207646_10064535 3300025922 Bacteria 3269
528 Ga0207646_10084059 3300025922 Bacteria 2847
529 Ga0207681_10179302 3300025923 Bacteria 1612
530 Ga0207694_10022593 3300025924 Bacteria 4772
531 Ga0207694_10090265 3300025924 Bacteria 2417
532 Ga0207650_10039340 3300025925 Bacteria 3456
533 Ga0207650_10081100 3300025925 Bacteria 2461
534 Ga0207659_10000907 3300025926 Bacteria 17655
535 Ga0207659_10219428 3300025926 Bacteria 1528
536 Ga0207687_10135091 3300025927 Bacteria 1865
537 Ga0207687_10372468 3300025927 Bacteria 1168
538 Ga0207644_10031181 3300025931 Bacteria 3712
539 Ga0207644_10043494 3300025931 Bacteria 3187
540 Ga0207644_10149790 3300025931 Bacteria 1804
541 Ga0207644_10254066 3300025931 Bacteria 1403
542 Ga0207690_10063187 3300025932 Bacteria 2524
543 Ga0207706_10002765 3300025933 Bacteria 17065
544 Ga0207706_10006045 3300025933 Bacteria 11261
545 Ga0207706_10037043 3300025933 Bacteria 4332
546 Ga0207706_10113113 3300025933 Bacteria 2388
547 Ga0207706_10170801 3300025933 Bacteria 1910
548 Ga0207706_10205423 3300025933 Bacteria 1727
549 Ga0207686_10034184 3300025934 Bacteria 3041
550 Ga0207709_10000461 3300025935 Bacteria 37464
551 Ga0207709_10000947 3300025935 Bacteria 21689
552 Ga0207709_10003037 3300025935 Bacteria 10180
553 Ga0207709_10115494 3300025935 Bacteria 1803
554 Ga0207709_10123587 3300025935 Bacteria 1752
555 Ga0207709_10161519 3300025935 Bacteria 1563
556 Ga0207670_10332633 3300025936 Bacteria 1198
557 Ga0207669_10002453 3300025937 Bacteria 7914
558 Ga0207669_10009042 3300025937 Bacteria 4718
559 Ga0207669_10040999 3300025937 Bacteria 2691
560 Ga0207669_10231586 3300025937 Bacteria 1363
561 Ga0207704_10133607 3300025938 Bacteria 1723
562 Ga0207691_10017550 3300025940 Bacteria 6784
563 Ga0207691_10022656 3300025940 Bacteria 5923
564 Ga0207691_10071497 3300025940 Bacteria 3131
565 Ga0207691_10106025 3300025940 Bacteria 2503
566 Ga0207711_10083336 3300025941 Bacteria 2797
567 Ga0207711_10452702 3300025941 Bacteria 1195
568 Ga0207689_10007873 3300025942 Bacteria 9309
569 Ga0207689_10026907 3300025942 Bacteria 4814
570 Ga0207689_10048978 3300025942 Bacteria 3486
571 Ga0207661_10294413 3300025944 Bacteria 1453
572 Ga0207679_10023598 3300025945 Bacteria 4208
573 Ga0207679_10457955 3300025945 Bacteria 1132
574 Ga0207667_10060340 3300025949 Bacteria 3970
575 Ga0207667_10070807 3300025949 Bacteria 3629
576 Ga0207667_10075147 3300025949 Bacteria 3509
577 Ga0207667_10076732 3300025949 Bacteria 3467
578 Ga0207667_10468611 3300025949 Bacteria 1279
579 Ga0207651_10034462 3300025960 Bacteria 3279
580 Ga0207651_10095642 3300025960 Bacteria 2188
581 Ga0207651_10117620 3300025960 Bacteria 2009
582 Ga0207651_10125288 3300025960 Bacteria 1956
583 Ga0207651_10164961 3300025960 Bacteria 1741
584 Ga0207651_10590916 3300025960 Bacteria 969
585 Ga0207712_10293751 3300025961 Bacteria 1331
586 Ga0207640_10169512 3300025981 Bacteria 1625
587 Ga0207640_10265555 3300025981 Bacteria 1340
588 Ga0207658_10045245 3300025986 Bacteria 3208
589 Ga0207658_10048694 3300025986 Bacteria 3109
590 Ga0207658_10093038 3300025986 Bacteria 2343
591 Ga0207677_10056952 3300026023 Bacteria 2681
592 Ga0207677_10340385 3300026023 Bacteria 1253
593 Ga0207677_10488401 3300026023 Bacteria 1062
594 Ga0207703_10007336 3300026035 Bacteria 8763
595 Ga0207639_10023597 3300026041 Bacteria 4442
596 Ga0207639_10028286 3300026041 Bacteria 4091
597 Ga0207639_10175930 3300026041 Bacteria 1817
598 Ga0207639_10392177 3300026041 Bacteria 1249
599 Ga0207639_10507204 3300026041 Bacteria 1103
600 Ga0207678_10016542 3300026067 Bacteria 6478
601 Ga0207708_10014322 3300026075 Bacteria 5933
602 Ga0207708_10026624 3300026075 Bacteria 4379
603 Ga0207702_10000145 3300026078 Bacteria 83991
604 Ga0207641_10011759 3300026088 Bacteria 7188
605 Ga0207641_10037541 3300026088 Bacteria 4046
606 Ga0207641_10074860 3300026088 Bacteria 2922
607 Ga0207641_10408210 3300026088 Bacteria 1305
608 Ga0207648_10165863 3300026089 Bacteria 1952
609 Ga0207676_10088967 3300026095 Bacteria 2529
610 Ga0207676_10316339 3300026095 Bacteria 1431
611 Ga0207674_10003414 3300026116 Bacteria 19453
612 Ga0207674_10021721 3300026116 Bacteria 6907
613 Ga0207674_10025782 3300026116 Bacteria 6262
614 Ga0207674_10046630 3300026116 Bacteria 4449
615 Ga0207674_10111472 3300026116 Bacteria 2710
616 Ga0207675_100009754 3300026118 Bacteria 8989
617 Ga0207675_100033969 3300026118 Bacteria 4753
618 Ga0207675_100212718 3300026118 Bacteria 1860
619 Ga0207683_10004049 3300026121 Bacteria 12670
620 Ga0207683_10016134 3300026121 Bacteria 6357
621 Ga0207683_10416350 3300026121 Bacteria 1237
622 Ga0207698_10149167 3300026142 Bacteria 2027
623 Ga0207698_10307145 3300026142 Bacteria 1479
624 Ga0209281_1000322 3300027111 Bacteria 84374
625 Ga0209973_1002203 3300027252 Bacteria 1795
626 Ga0209282_1006898 3300027666 Bacteria 7087
627 Ga0209974_10014212 3300027876 Bacteria 2653
628 Ga0209974_10015239 3300027876 Bacteria 2554
629 Ga0207428_10025795 3300027907 Bacteria 4914
630 Ga0268266_10006931 3300028379 Bacteria 10308
631 Ga0268266_10029871 3300028379 Bacteria 4631
632 Ga0268266_10060335 3300028379 Bacteria 3269
633 Ga0268266_10660781 3300028379 Bacteria 1006
634 Ga0268265_10022398 3300028380 Bacteria 4438
635 Ga0268265_10347881 3300028380 Bacteria 1352
636 Ga0268265_10367294 3300028380 Bacteria 1319
637 Ga0268264_10022505 3300028381 Bacteria 5144
638 Ga0265336_10000057 3300028666 Bacteria 105485
639 Ga0307517_10000005 3300028786 Bacteria 260207
640 Ga0307517_10019341 3300028786 Bacteria 8746
641 Ga0307517_10065593 3300028786 Bacteria 3356
642 Ga0307515_10000030 3300028794 Bacteria 364482
643 Ga0307515_10000063 3300028794 Bacteria 245504
644 Ga0307515_10002444 3300028794 Bacteria 40447
645 Ga0307515_10005820 3300028794 Bacteria 24881
646 Ga0307515_10011387 3300028794 Bacteria 16883
647 Ga0307515_10028520 3300028794 Bacteria 9485
648 Ga0307515_10053774 3300028794 Bacteria 5929
649 Ga0307515_10056077 3300028794 Bacteria 5737
650 Ga0265324_10000767 3300029957 Bacteria 21141
651 Ga0307512_10021622 3300030522 Bacteria 5797
652 Ga0307512_10025963 3300030522 Bacteria 5178
653 Ga0307512_10092946 3300030522 Bacteria 2090
654 Ga0316177_1096632 3300030731 Bacteria 1005
655 Ga0314311_1061367 3300030733 Bacteria 3384
656 Ga0316179_1062327 3300030734 Bacteria 1268
657 Ga0316178_1018347 3300030735 Bacteria 3836
658 Ga0316183_1170909 3300030742 Bacteria 3606
659 Ga0316181_1045493 3300030744 Bacteria 2834
660 Ga0316182_1066926 3300030745 Bacteria 1526
661 Ga0265340_10002044 3300031247 Bacteria 11560
662 Ga0265339_10004125 3300031249 Bacteria 10016
663 Ga0265327_10000035 3300031251 Bacteria 314419
664 Ga0265327_10000746 3300031251 Bacteria 50605
665 Ga0265327_10014656 3300031251 Bacteria 5116
666 Ga0265316_10024263 3300031344 Bacteria 5087
667 Ga0307513_10000019 3300031456 Bacteria 231194
668 Ga0307513_10001360 3300031456 Bacteria 35330
669 Ga0307513_10007826 3300031456 Bacteria 13780
670 Ga0307513_10088346 3300031456 Bacteria 3168
671 Ga0307513_10417193 3300031456 Bacteria 1073
672 Ga0307509_10000097 3300031507 Bacteria 121968
673 Ga0307509_10015125 3300031507 Bacteria 9028
674 Ga0307509_10162035 3300031507 Bacteria 2132
675 Ga0307509_10189462 3300031507 Bacteria 1910
676 Ga0307408_100000163 3300031548 Bacteria 73974
677 Ga0307408_100015271 3300031548 Bacteria 5112
678 Ga0265313_10003795 3300031595 Bacteria 11977
679 Ga0307508_10005670 3300031616 Bacteria 11832
680 Ga0307508_10028242 3300031616 Bacteria 5074
681 Ga0307514_10002613 3300031649 Bacteria 18424
682 Ga0307514_10003924 3300031649 Bacteria 13905
683 Ga0307516_10000237 3300031730 Bacteria 70929
684 Ga0307516_10000426 3300031730 Bacteria 55262
685 Ga0307516_10020645 3300031730 Bacteria 6802
686 Ga0307516_10020900 3300031730 Bacteria 6755
687 Ga0307516_10046577 3300031730 Bacteria 4278
688 Ga0307516_10177308 3300031730 Bacteria 1867
689 Ga0307405_10034135 3300031731 Bacteria 3024
690 Ga0307405_10117110 3300031731 Bacteria 1816
691 Ga0307405_10237532 3300031731 Bacteria 1347
692 Ga0307413_10129765 3300031824 Bacteria 1723
693 Ga0307413_10417840 3300031824 Bacteria 1055
694 Ga0307406_10000802 3300031901 Bacteria 17627
695 Ga0307406_10001551 3300031901 Bacteria 12680
696 Ga0307406_10020585 3300031901 Bacteria 3888
697 Ga0307412_10009434 3300031911 Bacteria 5600
698 Ga0307412_10083620 3300031911 Bacteria 2213
699 Ga0307412_10160653 3300031911 Bacteria 1669
700 Ga0307412_10169784 3300031911 Bacteria 1630
701 Ga0307412_10624842 3300031911 Bacteria 915
702 Ga0307409_100677231 3300031995 Bacteria 1028
703 Ga0307416_100637020 3300032002 Bacteria 1149
704 Ga0307414_10243368 3300032004 Bacteria 1490
705 Ga0307414_10248048 3300032004 Bacteria 1478
706 Ga0307411_10015436 3300032005 Bacteria 4289
707 Ga0307411_10053962 3300032005 Bacteria 2636
708 Ga0307411_10070402 3300032005 Bacteria 2367
709 Ga0307411_10231907 3300032005 Bacteria 1439
710 Ga0307411_10359887 3300032005 Bacteria 1189
711 Ga0307507_10210733 3300033179 Bacteria 1325
712 Ga0307510_10048474 3300033180 Bacteria 4532
713 Ga0307510_10122138 3300033180 Bacteria 2305
714 Ga0373928_0022843 3300035084 Bacteria 1330
715 Ga0373934_0053243 3300035086 Bacteria 1605
716 Ga0373932_0022530 3300035112 Bacteria 1674
717 Ga0373960_0080997 3300035121 Bacteria 1022
718 Ga0373931_0001631 3300035691 Bacteria 9705
719 Ga0373931_0009874 3300035691 Bacteria 4573
720 Ga0373935_0385625 3300035692 Bacteria 1004
721 Ga0373947_0080793 3300035725 Bacteria 2012
722 Ga0373937_0120337 3300036401 Bacteria 2446
723 Ga0373937_0280185 3300036401 Bacteria 1574
724 Ga0373937_0704237 3300036401 Bacteria 957
725 Ga0373925_0114766 3300037068 Bacteria 2085
726 Ga0373925_0384133 3300037068 Bacteria 1144
727 Ga0395899_0011207 3300037312 Bacteria 6869
728 Ga0395899_0187053 3300037312 Bacteria 1451
729 Ga0395898_0034177 3300037466 Bacteria 5069
730 Ga0395905_0000063 3300037471 Bacteria 187830
731 Ga0395905_0033022 3300037471 Bacteria 4865
732 Ga0395905_0145694 3300037471 Bacteria 2228
733 Ga0395901_0004081 3300038443 Bacteria 14708
734 Ga0436360_0208375 3300039438 Bacteria 2589
735 Ga0436361_0003074 3300039447 Bacteria 3496
736 Ga0436361_0369921 3300039447 Bacteria 6404
737 Ga0436361_0448438 3300039447 Bacteria 2651
738 Ga0436361_0470603 3300039447 Bacteria 3242
739 Ga0436361_0750298 3300039447 Bacteria 51036
740 Ga0436362_0768465 3300039453 Bacteria 876
741 Ga0439436_0000461 3300041404 Bacteria 10431
742 Ga0439436_0004114 3300041404 Bacteria 4456
743 Ga0439439_0004279 3300041406 Bacteria 3208
744 Ga0439439_0025263 3300041406 Bacteria 1494
745 Ga0439447_030238 3300041407 Bacteria 1366
746 Ga0439466_0000370 3300041411 Bacteria 17330
747 Ga0439466_0060143 3300041411 Bacteria 1225
748 Ga0439465_0000199 3300041413 Bacteria 15833
749 Ga0451789_0334369 3300041443 Bacteria 955
750 Ga0451793_0588810 3300041452 Bacteria 1610
751 Ga0451797_0755596 3300041453 Bacteria 1573
752 Ga0451798_0334034 3300041458 Bacteria 1873
753 Ga0451800_1298611 3300041459 Bacteria 1506
754 Ga0451807_1186613 3300041486 Bacteria 1356
755 Ga0451807_2695820 3300041486 Bacteria 3050
756 Ga0451845_0772503 3300041501 Bacteria 1150
757 Ga0451843_1113347 3300041509 Bacteria 1004
758 Ga0451853_3660836 3300041512 Bacteria 1152
759 Ga0439431_0000478 3300041997 Bacteria 8489
760 Ga0439433_0008358 3300041999 Bacteria 2244
761 Ga0439433_0019987 3300041999 Bacteria 1494
762 Ga0439442_000541 3300042002 Bacteria 8346
763 Ga0439442_015235 3300042002 Bacteria 1583
764 Ga0439445_0002298 3300042004 Bacteria 4242
765 Ga0439432_001585 3300042006 Bacteria 8506
766 Ga0439449_0000845 3300042007 Bacteria 11881
767 Ga0439449_0005343 3300042007 Bacteria 4919
768 Ga0439449_0012445 3300042007 Bacteria 3198
769 Ga0439452_001693 3300042010 Bacteria 8662
770 Ga0439457_011663 3300042014 Bacteria 1994
771 Ga0439457_025284 3300042014 Bacteria 1314
772 Ga0439462_0003937 3300042015 Bacteria 3592
773 Ga0439462_0013111 3300042015 Bacteria 2123
774 Ga0450923_000238 3300042125 Bacteria 5435
775 Ga0450897_000110 3300042128 Bacteria 3767
776 Ga0450896_000608 3300042133 Bacteria 3885
777 Ga0450898_000810 3300042134 Bacteria 3869
778 Ga0450906_009503 3300042145 Bacteria 1853
779 Ga0439446_0000308 3300042156 Bacteria 9302
780 Ga0439434_0008502 3300042435 Bacteria 3010
781 Ga0439434_0026231 3300042435 Bacteria 1760
782 Ga0439434_0046564 3300042435 Bacteria 1339
783 Ga0450918_000053 3300042531 Bacteria 23799
784 Ga0450918_002514 3300042531 Bacteria 3463
785 Ga0450893_0013588 3300042532 Bacteria 1359
786 Ga0451577_0000540 3300042876 Bacteria 62191
787 Ga0451577_0001937 3300042876 Bacteria 26108
788 Ga0451577_0278935 3300042876 Bacteria 1514
789 Ga0451577_0821714 3300042876 Bacteria 839
790 Ga0466969_0054528 3300044656 Bacteria 1958
791 Ga0466969_0068190 3300044656 Bacteria 1714
792 Ga0466972_0009515 3300044658 Bacteria 4882
793 Ga0466972_0020341 3300044658 Bacteria 3317
794 Ga0466972_0032402 3300044658 Bacteria 2567
795 Ga0466965_0006687 3300044683 Bacteria 5256
796 Ga0466965_0045400 3300044683 Bacteria 2173
797 Ga0466965_0189659 3300044683 Bacteria 1087
798 Ga0466966_0012555 3300044684 Bacteria 5612
799 Ga0466966_0061201 3300044684 Bacteria 2375
800 Ga0466961_0000070 3300044693 Bacteria 62574
801 Ga0466961_0023434 3300044693 Bacteria 3971
802 Ga0466961_0176411 3300044693 Bacteria 1328
803 Ga0466963_0070098 3300044694 Bacteria 2358
804 Ga0466964_0006639 3300044706 Bacteria 4312
805 Ga0466964_0032479 3300044706 Bacteria 2075
806 Ga0453684_0001952 3300044712 Bacteria 53204
807 Ga0453684_0008007 3300044712 Bacteria 19131
808 Ga0453684_0095791 3300044712 Bacteria 3647
809 Ga0453684_0754623 3300044712 Bacteria 1053
810 Ga0466971_0001645 3300044719 Bacteria 9441
811 Ga0466971_0054702 3300044719 Bacteria 1798
812 Ga0466968_0142011 3300044735 Bacteria 1099
813 Ga0466970_0015652 3300044765 Bacteria 3904
814 Ga0466970_0166613 3300044765 Bacteria 1220
815 Ga0466970_0220535 3300044765 Bacteria 1058
816 Ga0466957_0064624 3300044842 Bacteria 2251
817 Ga0466957_0110151 3300044842 Bacteria 1745
818 Ga0466960_0004720 3300044901 Bacteria 5352
819 Ga0466960_0134506 3300044901 Bacteria 1308
820 Ga0466960_0225641 3300044901 Bacteria 1032
821 Ga0466959_0002402 3300045049 Bacteria 11948
822 Ga0466959_0034463 3300045049 Bacteria 3744
823 Ga0451576_0002149 3300045051 Bacteria 30527
824 Ga0451576_0102607 3300045051 Bacteria 2975
825 Ga0466958_0019837 3300045836 Bacteria 3915
826 Ga0466967_0028456 3300045976 Bacteria 4665
827 Ga0495627_008697 3300046453 Bacteria 3787
828 Ga0495627_047147 3300046453 Bacteria 1307
829 Ga0495592_0006294 3300046454 Bacteria 8833
830 Ga0495590_0069905 3300046457 Bacteria 1231
831 Ga0495638_0027048 3300046460 Bacteria 3715
832 Ga0495638_0033703 3300046460 Bacteria 3274
833 Ga0495651_0033993 3300046462 Bacteria 3975
834 Ga0495650_0100484 3300046471 Bacteria 1087
835 Ga0495639_0006452 3300046475 Bacteria 5047
836 Ga0495639_0028950 3300046475 Bacteria 2456
837 Ga0495585_0034382 3300046492 Bacteria 2865
838 Ga0495583_0000073 3300046506 Bacteria 178177
839 Ga0495606_0014272 3300046507 Bacteria 6212
840 Ga0495610_0011873 3300046512 Bacteria 5291
841 Ga0495610_0027885 3300046512 Bacteria 2994
842 Ga0495610_0032267 3300046512 Bacteria 2723
843 Ga0495616_0002945 3300046513 Bacteria 11071
844 Ga0495620_0000285 3300046515 Bacteria 36787
845 Ga0495620_0008624 3300046515 Bacteria 5465
846 Ga0495630_0217174 3300046517 Bacteria 1460
847 Ga0495631_0000456 3300046518 Bacteria 27772
848 Ga0495632_0010831 3300046519 Bacteria 5364
849 Ga0495632_0192064 3300046519 Bacteria 932
850 Ga0495637_0002058 3300046520 Bacteria 11317
851 Ga0495637_0046610 3300046520 Bacteria 1833
852 Ga0495643_0046338 3300046522 Bacteria 2357
853 Ga0495643_0074523 3300046522 Bacteria 1777
854 Ga0495654_0127582 3300046530 Bacteria 1145
855 Ga0495586_0051387 3300046535 Bacteria 2231
856 Ga0495609_0115887 3300046538 Bacteria 1154
857 Ga0495645_0195399 3300046543 Bacteria 1376
858 Ga0495656_0000049 3300046615 Bacteria 56829
859 Ga0495668_0111509 3300046616 Bacteria 1496
860 Ga0495625_0000510 3300046660 Bacteria 57454
861 Ga0495625_0004438 3300046660 Bacteria 13279
862 Ga0495625_0005595 3300046660 Bacteria 11393
863 Ga0495625_0030716 3300046660 Bacteria 4004
864 Ga0495625_0161905 3300046660 Bacteria 1498
865 Ga0495625_0226050 3300046660 Bacteria 1224
866 Ga0495635_0063778 3300046663 Bacteria 2530
867 Ga0495588_0070939 3300046674 Bacteria 1811
868 Ga0495657_0160344 3300046675 Bacteria 1392
869 Ga0495599_0094692 3300046678 Bacteria 1863
870 Ga0495658_0282017 3300046683 Bacteria 1048
871 Ga0495671_0002111 3300046692 Bacteria 12709
872 Ga0495649_0001792 3300046694 Bacteria 15795
873 Ga0495649_0005171 3300046694 Bacteria 8362
874 Ga0495649_0116583 3300046694 Bacteria 1414
875 Ga0495589_0005986 3300046794 Bacteria 6426
876 Ga0495660_0235268 3300046810 Bacteria 856
877 Ga0495604_0221887 3300047317 Bacteria 1301
878 Ga0495676_0012661 3300047321 Bacteria 7592
879 Ga0495676_0023118 3300047321 Bacteria 5399
880 Ga0495683_0018813 3300047323 Bacteria 3568
881 Ga0495687_000183 3300047443 Bacteria 91212
882 Ga0495687_000636 3300047443 Bacteria 40190
883 Ga0495686_0153144 3300047472 Bacteria 1352
884 Ga0495593_0179112 3300047673 Bacteria 1068
885 Ga0495602_0118521 3300048088 Bacteria 2135
886 Ga0495614_0016039 3300048089 Bacteria 3262
887 Ga0495615_0003258 3300048090 Bacteria 2699
888 Ga0496100_0003479 3300048903 Bacteria 8216
889 Ga0496100_0149076 3300048903 Bacteria 1666
890 Ga0496101_0010046 3300048904 Bacteria 6237
891 Ga0496101_0024551 3300048904 Bacteria 4172
892 Ga0496102_0002768 3300048905 Bacteria 14953
893 Ga0496102_0019260 3300048905 Bacteria 6012
894 Ga0496102_0102102 3300048905 Bacteria 2666
895 Ga0496102_0496629 3300048905 Bacteria 1142
896 Ga0496104_0007745 3300048907 Bacteria 9514
897 Ga0496104_0218674 3300048907 Bacteria 1817
898 Ga0496104_0269415 3300048907 Bacteria 1615
899 Ga0496104_0697635 3300048907 Bacteria 923
900 Ga0496105_0003222 3300048908 Bacteria 12021
901 Ga0496105_0166715 3300048908 Bacteria 1807
902 Ga0496106_0010906 3300048909 Bacteria 6715
903 Ga0496108_0029665 3300048911 Bacteria 4531
904 Ga0496109_0035583 3300048912 Bacteria 4493
905 Ga0496109_0436251 3300048912 Bacteria 1237
906 Ga0496110_0014988 3300048913 Bacteria 6445
907 Ga0496112_0017957 3300048915 Bacteria 6657
908 Ga0496113_0335920 3300048916 Bacteria 1212
909 Ga0496114_0005360 3300048917 Bacteria 10026
910 Ga0496114_0272396 3300048917 Bacteria 1492
911 Ga0496114_0425463 3300048917 Bacteria 1176
912 Ga0496116_0005513 3300048919 Bacteria 11696
913 Ga0496116_0018143 3300048919 Bacteria 5434
914 Ga0496117_0037659 3300048920 Bacteria 3599
915 Ga0496117_0203280 3300048920 Bacteria 1117
916 Ga0496117_0231136 3300048920 Bacteria 1022
917 Ga0496118_0024266 3300048921 Bacteria 5242
918 Ga0496118_0031202 3300048921 Bacteria 4424
919 Ga0496118_0211042 3300048921 Bacteria 1139
920 Ga0496119_0001360 3300048922 Bacteria 29836
921 Ga0496119_0060375 3300048922 Bacteria 2270
922 Ga0496121_0003609 3300048924 Bacteria 21849
923 Ga0496121_0007015 3300048924 Bacteria 13686
924 Ga0496121_0044154 3300048924 Bacteria 3849
925 Ga0496121_0080306 3300048924 Bacteria 2586
926 Ga0496122_0020990 3300048925 Bacteria 5868
927 Ga0496122_0149154 3300048925 Bacteria 1447
928 Ga0496123_0024156 3300048926 Bacteria 4628
929 Ga0496123_0088898 3300048926 Bacteria 1842
930 Ga0496124_0335760 3300048927 Bacteria 1075
931 Ga0496125_0003718 3300048928 Bacteria 18205
932 Ga0496125_0021233 3300048928 Bacteria 6064
933 Ga0496126_0000856 3300048929 Bacteria 53635
934 Ga0501075_0071312 3300049591 Bacteria 2626
935 Ga0501199_003704 3300049650 Bacteria 1478
936 Ga0501222_015683 3300049662 Bacteria 1001
937 Ga0501249_001899 3300049679 Bacteria 4246
938 Ga0501257_043566 3300049686 Bacteria 1106
939 Ga0501225_0065646 3300049705 Bacteria 1025
940 Ga0501241_029740 3300049758 Bacteria 1029
941 Ga0501262_000139 3300049759 Bacteria 9027
942 Ga0501279_001410 3300049775 Bacteria 3140
943 nmdc:mga03683_25301_c1 3300050489 Bacteria 2330
944 nmdc:mga03683_4671_c1 3300050489 Bacteria 3195
945 nmdc:mga03683_55992_c1 3300050489 Bacteria 1657
946 nmdc:mga03683_7991_c1 3300050489 Bacteria 3699
947 nmdc:mga03683_99202_c1 3300050489 Bacteria 1278
948 nmdc:mga03683_99604_c1 3300050489 Bacteria 1276
949 nmdc:mga03n38_37182_c1 3300050490 Bacteria 2098
950 nmdc:mga03n38_46772_c1 3300050490 Bacteria 1912
951 nmdc:mga00v17_100622_c1 3300050491 Bacteria 1824
952 nmdc:mga00v17_10163_c1 3300050491 Bacteria 5129
953 nmdc:mga0yw44_10842_c2 3300050492 Bacteria 3630
954 nmdc:mga0yw44_181831_c1 3300050492 Bacteria 1384
955 nmdc:mga0yw44_192987_c1 3300050492 Bacteria 1344
956 nmdc:mga0yw44_7798_c1 3300050492 Bacteria 5295
957 nmdc:mga0k408_114351_c1 3300050493 Bacteria 1596
958 nmdc:mga0k408_11672_c1 3300050493 Bacteria 4788
959 nmdc:mga0k408_171940_c1 3300050493 Bacteria 1292
960 nmdc:mga0k408_20338_c1 3300050493 Bacteria 3718
961 nmdc:mga0k408_2825_c1 3300050493 Bacteria 9218
962 nmdc:mga0k408_364571_c1 3300050493 Bacteria 861
963 nmdc:mga0k408_47122_c1 3300050493 Bacteria 2491
964 nmdc:mga0k408_71065_c1 3300050493 Bacteria 2031
965 nmdc:mga0k408_8363_c1 3300050493 Bacteria 5552
966 nmdc:mga0k408_8875_c1 3300050493 Bacteria 5407
967 nmdc:mga0k408_88963_c1 3300050493 Bacteria 1813
968 nmdc:mga06z11_206068_c1 3300050494 Bacteria 1144
969 nmdc:mga07m45_1141_c1 3300050496 Bacteria 11905
970 nmdc:mga07m45_230652_c1 3300050496 Bacteria 1077
971 nmdc:mga07m45_2527_c1 3300050496 Bacteria 8588
972 nmdc:mga07m45_25517_c1 3300050496 Bacteria 3242
973 nmdc:mga07m45_3294_c1 3300050496 Bacteria 7774
974 nmdc:mga07m45_3352_c1 3300050496 Bacteria 7724
975 nmdc:mga07m45_753_c1 3300050496 Bacteria 13864
976 nmdc:mga07m45_8034_c1 3300050496 Bacteria 5410
977 nmdc:mga07m45_8484_c1 3300050496 Bacteria 5286
978 nmdc:mga08y16_95866_c1 3300050511 Bacteria 3090
979 Ga0500610_0000432 3300053079 Bacteria 12910
980 Ga0500610_0002036 3300053079 Bacteria 7251
981 Ga0500610_0037825 3300053079 Bacteria 2485
982 Ga0500578_0000900 3300053086 Bacteria 33675
983 Ga0500643_026820 3300053087 Bacteria 1798
984 Ga0500643_065210 3300053087 Bacteria 1017
985 Ga0500644_0001244 3300053088 Bacteria 7016
986 Ga0500644_0003133 3300053088 Bacteria 4096
987 Ga0500651_0000674 3300053093 Bacteria 17006
988 Ga0500651_0001145 3300053093 Bacteria 13156
989 Ga0500651_0036942 3300053093 Bacteria 3077
990 Ga0500566_0015702 3300053094 Bacteria 4444
991 Ga0500650_0178204 3300053098 Bacteria 974
992 Ga0500562_033576 3300053108 Bacteria 1356
993 Ga0500562_035297 3300053108 Bacteria 1324
994 Ga0500569_008111 3300053109 Bacteria 2390
995 Ga0500569_010596 3300053109 Bacteria 2178
996 Ga0500571_000095 3300053110 Bacteria 28943
997 Ga0500592_006390 3300053116 Bacteria 1878
998 Ga0500593_000937 3300053117 Bacteria 10762
999 Ga0500593_003564 3300053117 Bacteria 5905
1000 Ga0500593_129841 3300053117 Bacteria 1008
1001 Ga0500594_0000956 3300053118 Bacteria 6226
1002 Ga0500607_001138 3300053121 Bacteria 24753
1003 Ga0500607_008952 3300053121 Bacteria 6039
1004 Ga0500608_012368 3300053122 Bacteria 3740
1005 Ga0500608_012562 3300053122 Bacteria 3719
1006 Ga0500608_145979 3300053122 Bacteria 1043
1007 Ga0500621_082638 3300053126 Bacteria 1286
1008 Ga0500626_027119 3300053128 Bacteria 2580
1009 Ga0500628_005018 3300053129 Bacteria 2197
1010 Ga0500652_002060 3300053131 Bacteria 6050
1011 Ga0500652_033582 3300053131 Bacteria 2028
1012 Ga0500655_000461 3300053133 Bacteria 8325
1013 Ga0500655_011079 3300053133 Bacteria 1631
1014 Ga0500658_0000346 3300053134 Bacteria 20659
1015 Ga0500658_0000347 3300053134 Bacteria 20625
1016 Ga0500658_0017980 3300053134 Bacteria 2646
1017 Ga0500559_0000020 3300053136 Bacteria 134858
1018 Ga0500559_0018726 3300053136 Bacteria 2924
1019 Ga0500559_0036318 3300053136 Bacteria 2130
1020 Ga0500564_043043 3300053138 Bacteria 2076
1021 Ga0500568_0000286 3300053139 Bacteria 41823
1022 Ga0500568_0000483 3300053139 Bacteria 29418
1023 Ga0500568_0001897 3300053139 Bacteria 12852
1024 Ga0500568_0015932 3300053139 Bacteria 3353
1025 Ga0500574_001944 3300053141 Bacteria 3254
1026 Ga0500577_0008215 3300053142 Bacteria 2965
1027 Ga0500604_0075549 3300053151 Bacteria 1081
1028 Ga0500622_0000064 3300053156 Bacteria 127531
1029 Ga0500622_0000142 3300053156 Bacteria 76275
1030 Ga0500622_0004919 3300053156 Bacteria 8161
1031 Ga0500627_0005799 3300053158 Bacteria 4138
1032 Ga0500638_192799 3300053162 Bacteria 869
1033 Ga0500636_0012547 3300053177 Bacteria 4967
1034 Ga0500645_004897 3300053730 Bacteria 5040
1035 Ga0500596_016569 3300053735 Bacteria 1106
1036 Ga0500587_000977 3300053739 Bacteria 3847
1037 Ga0500661_003301 3300055283 Bacteria 3033
1038 Ga0590071_005297 3300059421 Bacteria 3108
1039 Ga0466962_0004054 3300061719 Bacteria 7008
1040 Ga0466962_0070345 3300061719 Bacteria 1671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049662 Ga0501222_015683 Ga0501222_015683_190_936 243
2 3300042531 Ga0450918_000053 Ga0450918_000053_13527_14270 245
3 3300005458 Ga0070681_10004145 Ga0070681_100041459 246
4 3300005530 Ga0070679_100079070 Ga0070679_1000790703 246
5 3300025912 Ga0207707_10334993 Ga0207707_103349932 246
6 3300037068 Ga0373925_0384133 Ga0373925_0384133_276_1016 246
7 iso_pu_bacteria 2854911287 2854915947 247
8 iso_pu_bacteria 8005645114 8005651195 247
9 3300005614 Ga0068856_100456162 Ga0068856_1004561621 248
10 3300006195 Ga0075366_10154625 Ga0075366_101546252 248
11 3300031616 Ga0307508_10028242 Ga0307508_100282423 248
12 iso_pu_bacteria 2582581867 2585399284 248
13 iso_pu_bacteria 2585427530 2585557755 248
14 iso_pu_bacteria 2585427531 2585563547 248
15 iso_pu_bacteria 2643221610 2644067888 248
16 iso_pu_bacteria 2643221675 2644417828 248
17 iso_pu_bacteria 2643221680 2644451256 248
18 iso_pu_bacteria 2643221726 2644687354 248
19 iso_pu_bacteria 2920822456 2920827933 248
20 3300003794 Ga0055531_10001700 Ga0055531_1000170014 249
21 3300005337 Ga0070682_100193866 Ga0070682_1001938662 249
22 3300005435 Ga0070714_100592505 Ga0070714_1005925051 249
23 3300005436 Ga0070713_100355884 Ga0070713_1003558842 249
24 3300005577 Ga0068857_100619482 Ga0068857_1006194822 249
25 3300006195 Ga0075366_10126369 Ga0075366_101263692 249
26 3300006353 Ga0075370_10022906 Ga0075370_100229064 249
27 3300021441 Ga0213871_10013856 Ga0213871_100138562 249
28 3300025298 Ga0209050_1019284 Ga0209050_10192843 249
29 3300025299 Ga0209256_1044449 Ga0209256_10444492 249
30 3300025303 Ga0209051_1003368 Ga0209051_10033684 249
31 3300025304 Ga0209257_1000021 Ga0209257_100002114 249
32 3300025916 Ga0207663_10419230 Ga0207663_104192302 249
33 3300028794 Ga0307515_10056077 Ga0307515_100560774 249
34 3300031251 Ga0265327_10000035 Ga0265327_10000035271 249
35 3300031995 Ga0307409_100677231 Ga0307409_1006772312 249
36 3300032004 Ga0307414_10248048 Ga0307414_102480482 249
37 3300032005 Ga0307411_10015436 Ga0307411_100154364 249
38 3300039438 Ga0436360_0208375 Ga0436360_0208375_1607_2356 249
39 3300039453 Ga0436362_0768465 Ga0436362_0768465_39_788 249
40 3300042435 Ga0439434_0046564 Ga0439434_0046564_334_1101 249
41 3300050496 nmdc:mga07m45_8484_c1 nmdc:mga07m45_8484_c1_1915_2664 249
42 iso_pu_bacteria 2585428062 2587759696 249
43 3300005548 Ga0070665_100285171 Ga0070665_1002851712 250
44 3300006195 Ga0075366_10278722 Ga0075366_102787222 250
45 3300021361 Ga0213872_10000067 Ga0213872_1000006782 250
46 3300021361 Ga0213872_10001461 Ga0213872_100014619 250
47 3300021361 Ga0213872_10023875 Ga0213872_100238751 250
48 3300021361 Ga0213872_10102871 Ga0213872_101028712 250
49 3300031456 Ga0307513_10417193 Ga0307513_104171932 250
50 3300031507 Ga0307509_10189462 Ga0307509_101894622 250
51 3300037471 Ga0395905_0000063 Ga0395905_0000063_154444_155199 250
52 3300039447 Ga0436361_0003074 Ga0436361_0003074_531_1283 250
53 3300039447 Ga0436361_0369921 Ga0436361_0369921_26_778 250
54 3300039447 Ga0436361_0448438 Ga0436361_0448438_1154_1906 250
55 3300039447 Ga0436361_0750298 Ga0436361_0750298_50197_50949 250
56 3300041459 Ga0451800_1298611 Ga0451800_1298611_155_907 250
57 3300041486 Ga0451807_1186613 Ga0451807_1186613_172_924 250
58 3300049650 Ga0501199_003704 Ga0501199_003704_187_954 250
59 3300050493 nmdc:mga0k408_8875_c1 nmdc:mga0k408_8875_c1_2283_3035 250
60 iso_pu_bacteria 2585428058 2587732336 250
61 iso_pu_bacteria 2643221592 2643971192 250
62 iso_pu_bacteria 2643221609 2644060412 250
63 iso_pu_bacteria 2643221611 2644076159 250
64 iso_pu_bacteria 2643221625 2644142888 250
65 iso_pu_bacteria 2643221648 2644273811 250
66 3300003794 Ga0055531_10000098 Ga0055531_100000989 251
67 3300006195 Ga0075366_10006843 Ga0075366_100068433 251
68 3300025303 Ga0209051_1000132 Ga0209051_1000132124 251
69 3300025304 Ga0209257_1000209 Ga0209257_100020915 251
70 3300031247 Ga0265340_10002044 Ga0265340_1000204411 251
71 3300031249 Ga0265339_10004125 Ga0265339_100041258 251
72 3300031344 Ga0265316_10024263 Ga0265316_100242633 251
73 3300031595 Ga0265313_10003795 Ga0265313_100037958 251
74 3300042876 Ga0451577_0000540 Ga0451577_0000540_55177_55950 251
75 3300044683 Ga0466965_0189659 Ga0466965_0189659_32_787 251
76 3300045051 Ga0451576_0102607 Ga0451576_0102607_742_1500 251
77 3300048922 Ga0496119_0001360 Ga0496119_0001360_6534_7292 251
78 3300049591 Ga0501075_0071312 Ga0501075_0071312_1587_2456 251
79 3300050493 nmdc:mga0k408_2825_c1 nmdc:mga0k408_2825_c1_7899_8654 251
80 iso_pu_bacteria 2738543013 2739251141 251
81 3300003215 JGI25153J46596_10000548 JGI25153J46596_100005488 252
82 3300006178 Ga0075367_10097136 Ga0075367_100971362 252
83 3300006195 Ga0075366_10386181 Ga0075366_103861811 252
84 3300006353 Ga0075370_10224280 Ga0075370_102242801 252
85 3300009093 Ga0105240_10002596 Ga0105240_1000259616 252
86 3300009545 Ga0105237_10002824 Ga0105237_1000282417 252
87 3300009551 Ga0105238_10027671 Ga0105238_100276715 252
88 3300010375 Ga0105239_10003074 Ga0105239_1000307411 252
89 3300015262 Ga0182007_10001760 Ga0182007_100017608 252
90 3300025245 Ga0207425_1026555 Ga0207425_10265552 252
91 3300025258 Ga0209129_1000149 Ga0209129_100014954 252
92 3300025294 Ga0209025_1000253 Ga0209025_100025326 252
93 3300025297 Ga0209758_1000296 Ga0209758_100029626 252
94 3300025913 Ga0207695_10011095 Ga0207695_100110959 252
95 3300025914 Ga0207671_10008246 Ga0207671_100082465 252
96 3300025924 Ga0207694_10090265 Ga0207694_100902652 252
97 3300036401 Ga0373937_0120337 Ga0373937_0120337_76_837 252
98 3300046457 Ga0495590_0069905 Ga0495590_0069905_380_1141 252
99 3300046515 Ga0495620_0000285 Ga0495620_0000285_21665_22426 252
100 3300046522 Ga0495643_0074523 Ga0495643_0074523_544_1305 252
101 3300046660 Ga0495625_0004438 Ga0495625_0004438_4900_5661 252
102 3300046675 Ga0495657_0160344 Ga0495657_0160344_72_833 252
103 3300046694 Ga0495649_0005171 Ga0495649_0005171_2109_2870 252
104 3300046810 Ga0495660_0235268 Ga0495660_0235268_31_792 252
105 3300047323 Ga0495683_0018813 Ga0495683_0018813_2686_3447 252
106 3300047443 Ga0495687_000183 Ga0495687_000183_58856_59617 252
107 3300047472 Ga0495686_0153144 Ga0495686_0153144_17_778 252
108 3300048917 Ga0496114_0272396 Ga0496114_0272396_365_1126 252
109 3300048919 Ga0496116_0005513 Ga0496116_0005513_8581_9342 252
110 3300048924 Ga0496121_0003609 Ga0496121_0003609_10802_11563 252
111 3300048924 Ga0496121_0007015 Ga0496121_0007015_11911_12672 252
112 3300048928 Ga0496125_0003718 Ga0496125_0003718_3125_3886 252
113 3300048929 Ga0496126_0000856 Ga0496126_0000856_42492_43253 252
114 3300050492 nmdc:mga0yw44_181831_c1 nmdc:mga0yw44_181831_c1_287_1048 252
115 3300050493 nmdc:mga0k408_364571_c1 nmdc:mga0k408_364571_c1_30_791 252
116 3300053139 Ga0500568_0000286 Ga0500568_0000286_28108_28869 252
117 3300053139 Ga0500568_0000483 Ga0500568_0000483_18302_19066 252
118 3300053156 Ga0500622_0000064 Ga0500622_0000064_8133_8894 252
119 3300006177 Ga0075362_10076778 Ga0075362_100767782 253
120 3300006195 Ga0075366_10103337 Ga0075366_101033372 253
121 3300028786 Ga0307517_10000005 Ga0307517_1000000515 253
122 3300028794 Ga0307515_10000030 Ga0307515_1000003024 253
123 3300028794 Ga0307515_10002444 Ga0307515_1000244441 253
124 3300028794 Ga0307515_10005820 Ga0307515_100058207 253
125 3300028794 Ga0307515_10028520 Ga0307515_1002852010 253
126 3300030522 Ga0307512_10025963 Ga0307512_100259632 253
127 3300030522 Ga0307512_10092946 Ga0307512_100929462 253
128 3300031456 Ga0307513_10001360 Ga0307513_1000136031 253
129 3300031456 Ga0307513_10007826 Ga0307513_100078263 253
130 3300031507 Ga0307509_10015125 Ga0307509_100151255 253
131 3300031616 Ga0307508_10005670 Ga0307508_100056705 253
132 3300031730 Ga0307516_10000426 Ga0307516_100004267 253
133 3300031730 Ga0307516_10020900 Ga0307516_100209005 253
134 3300033179 Ga0307507_10210733 Ga0307507_102107332 253
135 3300033180 Ga0307510_10122138 Ga0307510_101221382 253
136 3300035112 Ga0373932_0022530 Ga0373932_0022530_300_1064 253
137 3300035691 Ga0373931_0009874 Ga0373931_0009874_1764_2528 253
138 3300036401 Ga0373937_0280185 Ga0373937_0280185_79_840 253
139 3300037068 Ga0373925_0114766 Ga0373925_0114766_534_1298 253
140 3300041452 Ga0451793_0588810 Ga0451793_0588810_573_1337 253
141 3300041453 Ga0451797_0755596 Ga0451797_0755596_36_803 253
142 3300046471 Ga0495650_0100484 Ga0495650_0100484_54_818 253
143 3300046512 Ga0495610_0032267 Ga0495610_0032267_1332_2096 253
144 3300046517 Ga0495630_0217174 Ga0495630_0217174_20_784 253
145 3300046519 Ga0495632_0192064 Ga0495632_0192064_104_868 253
146 3300046522 Ga0495643_0046338 Ga0495643_0046338_679_1443 253
147 3300046660 Ga0495625_0005595 Ga0495625_0005595_1646_2410 253
148 3300047321 Ga0495676_0023118 Ga0495676_0023118_2448_3212 253
149 3300047443 Ga0495687_000636 Ga0495687_000636_38790_39554 253
150 3300048905 Ga0496102_0019260 Ga0496102_0019260_4343_5107 253
151 3300048916 Ga0496113_0335920 Ga0496113_0335920_256_1020 253
152 3300050493 nmdc:mga0k408_88963_c1 nmdc:mga0k408_88963_c1_455_1216 253
153 3300053088 Ga0500644_0003133 Ga0500644_0003133_1227_1991 253
154 3300053093 Ga0500651_0036942 Ga0500651_0036942_834_1598 253
155 3300053118 Ga0500594_0000956 Ga0500594_0000956_2830_3594 253
156 3300053126 Ga0500621_082638 Ga0500621_082638_474_1238 253
157 3300053133 Ga0500655_011079 Ga0500655_011079_13_777 253
158 3300053134 Ga0500658_0017980 Ga0500658_0017980_1016_1780 253
159 3300053136 Ga0500559_0000020 Ga0500559_0000020_16116_16880 253
160 3300053156 Ga0500622_0004919 Ga0500622_0004919_4175_4939 253
161 3300053739 Ga0500587_000977 Ga0500587_000977_2943_3707 253
162 iso_pu_bacteria 2954767861 2954769568 253
163 3300002773 JGI25152J39213_1002575 JGI25152J39213_10025755 254
164 3300002774 JGI25150J39212_1001269 JGI25150J39212_10012694 254
165 3300003187 JGI25151J46595_10006100 JGI25151J46595_100061002 254
166 3300003215 JGI25153J46596_10020234 JGI25153J46596_100202343 254
167 3300003771 Ga0055526_1013672 Ga0055526_10136723 254
168 3300005262 Ga0065165_1004855 Ga0065165_10048556 254
169 3300005262 Ga0065165_1035854 Ga0065165_10358542 254
170 3300006051 Ga0075364_10035747 Ga0075364_100357472 254
171 3300006186 Ga0075369_10095619 Ga0075369_100956192 254
172 3300006195 Ga0075366_10009252 Ga0075366_100092524 254
173 3300006195 Ga0075366_10125397 Ga0075366_101253972 254
174 3300006353 Ga0075370_10003658 Ga0075370_100036588 254
175 3300006946 Ga0079104_1000333 Ga0079104_100033328 254
176 3300017792 Ga0163161_10168512 Ga0163161_101685122 254
177 3300025245 Ga0207425_1000287 Ga0207425_100028721 254
178 3300025245 Ga0207425_1002100 Ga0207425_10021005 254
179 3300025258 Ga0209129_1000222 Ga0209129_10002224 254
180 3300025263 Ga0209565_1000418 Ga0209565_100041817 254
181 3300025273 Ga0209673_1037241 Ga0209673_10372412 254
182 3300025291 Ga0209675_1005308 Ga0209675_10053086 254
183 3300025291 Ga0209675_1021225 Ga0209675_10212252 254
184 3300025294 Ga0209025_1007205 Ga0209025_10072055 254
185 3300025295 Ga0209564_1000498 Ga0209564_10004984 254
186 3300025297 Ga0209758_1005197 Ga0209758_10051977 254
187 3300025297 Ga0209758_1012831 Ga0209758_10128313 254
188 3300025298 Ga0209050_1000600 Ga0209050_10006004 254
189 3300025299 Ga0209256_1000024 Ga0209256_1000024415 254
190 3300027111 Ga0209281_1000322 Ga0209281_100032227 254
191 3300027252 Ga0209973_1002203 Ga0209973_10022032 254
192 3300027876 Ga0209974_10014212 Ga0209974_100142122 254
193 3300028786 Ga0307517_10065593 Ga0307517_100655932 254
194 3300028794 Ga0307515_10011387 Ga0307515_100113874 254
195 3300031507 Ga0307509_10000097 Ga0307509_1000009778 254
196 3300031548 Ga0307408_100000163 Ga0307408_10000016350 254
197 3300031730 Ga0307516_10177308 Ga0307516_101773082 254
198 3300031901 Ga0307406_10000802 Ga0307406_1000080213 254
199 3300036401 Ga0373937_0704237 Ga0373937_0704237_154_921 254
200 3300041458 Ga0451798_0334034 Ga0451798_0334034_647_1411 254
201 3300041486 Ga0451807_2695820 Ga0451807_2695820_610_1374 254
202 3300042876 Ga0451577_0278935 Ga0451577_0278935_450_1241 254
203 3300044712 Ga0453684_0095791 Ga0453684_0095791_2504_3295 254
204 3300044765 Ga0466970_0166613 Ga0466970_0166613_91_873 254
205 3300044901 Ga0466960_0225641 Ga0466960_0225641_46_828 254
206 3300046460 Ga0495638_0033703 Ga0495638_0033703_86_850 254
207 3300046519 Ga0495632_0010831 Ga0495632_0010831_2133_2897 254
208 3300048917 Ga0496114_0005360 Ga0496114_0005360_1304_2068 254
209 3300049775 Ga0501279_001410 Ga0501279_001410_1336_2100 254
210 3300050489 nmdc:mga03683_25301_c1 nmdc:mga03683_25301_c1_1406_2194 254
211 3300050491 nmdc:mga00v17_100622_c1 nmdc:mga00v17_100622_c1_240_1028 254
212 3300050493 nmdc:mga0k408_47122_c1 nmdc:mga0k408_47122_c1_1400_2164 254
213 3300050496 nmdc:mga07m45_1141_c1 nmdc:mga07m45_1141_c1_9630_10394 254
214 3300050496 nmdc:mga07m45_230652_c1 nmdc:mga07m45_230652_c1_45_833 254
215 3300053093 Ga0500651_0001145 Ga0500651_0001145_12330_13094 254
216 3300053098 Ga0500650_0178204 Ga0500650_0178204_140_904 254
217 3300053108 Ga0500562_033576 Ga0500562_033576_111_875 254
218 3300053109 Ga0500569_008111 Ga0500569_008111_326_1090 254
219 3300053117 Ga0500593_129841 Ga0500593_129841_39_803 254
220 3300053129 Ga0500628_005018 Ga0500628_005018_1229_1993 254
221 3300053131 Ga0500652_002060 Ga0500652_002060_3670_4434 254
222 3300053139 Ga0500568_0015932 Ga0500568_0015932_294_1058 254
223 3300053142 Ga0500577_0008215 Ga0500577_0008215_1782_2546 254
224 3300053156 Ga0500622_0000142 Ga0500622_0000142_71881_72645 254
225 3300059421 Ga0590071_005297 Ga0590071_005297_1595_2365 254
226 iso_pu_bacteria 2511231002 2511243682 254
227 iso_pu_bacteria 2585428057 2587728690 254
228 iso_pu_bacteria 2588253510 2588292042 254
229 iso_pu_bacteria 2643221628 2644161528 254
230 iso_pu_bacteria 2842677519 2842678367 254
231 iso_pu_bacteria 2885192300 2885197806 254
232 iso_pu_bacteria 2904449895 2904451044 254
233 iso_pu_bacteria 2904456579 2904457900 254
234 iso_pu_bacteria 2919462493 2919465742 254
235 iso_pu_bacteria 2929520902 2929523680 254
236 iso_pu_bacteria 2945945610 2945951035 254
237 iso_pu_bacteria 2945972063 2945974306 254
238 3300003784 Ga0055534_1004006 Ga0055534_10040062 255
239 3300005543 Ga0070672_100358150 Ga0070672_1003581502 255
240 3300005548 Ga0070665_100869031 Ga0070665_1008690311 255
241 3300006038 Ga0075365_10178447 Ga0075365_101784472 255
242 3300009093 Ga0105240_10311960 Ga0105240_103119603 255
243 3300009148 Ga0105243_10671867 Ga0105243_106718672 255
244 3300009545 Ga0105237_10009973 Ga0105237_1000997313 255
245 3300015683 Ga0183362_10007 Ga0183362_1000750 255
246 3300017792 Ga0163161_10057116 Ga0163161_100571162 255
247 3300025284 Ga0209130_1007333 Ga0209130_10073333 255
248 3300025291 Ga0209675_1038270 Ga0209675_10382702 255
249 3300025292 Ga0209676_1004125 Ga0209676_10041256 255
250 3300025304 Ga0209257_1017387 Ga0209257_10173872 255
251 3300025935 Ga0207709_10161519 Ga0207709_101615192 255
252 3300025940 Ga0207691_10106025 Ga0207691_101060251 255
253 3300028666 Ga0265336_10000057 Ga0265336_1000005744 255
254 3300029957 Ga0265324_10000767 Ga0265324_100007676 255
255 3300031456 Ga0307513_10088346 Ga0307513_100883463 255
256 3300035691 Ga0373931_0001631 Ga0373931_0001631_3998_4768 255
257 3300044656 Ga0466969_0054528 Ga0466969_0054528_439_1230 255
258 3300044656 Ga0466969_0068190 Ga0466969_0068190_687_1457 255
259 3300044658 Ga0466972_0032402 Ga0466972_0032402_729_1520 255
260 3300044684 Ga0466966_0061201 Ga0466966_0061201_1390_2181 255
261 3300044693 Ga0466961_0023434 Ga0466961_0023434_272_1042 255
262 3300044706 Ga0466964_0032479 Ga0466964_0032479_581_1351 255
263 3300044719 Ga0466971_0054702 Ga0466971_0054702_272_1042 255
264 3300044735 Ga0466968_0142011 Ga0466968_0142011_53_823 255
265 3300044765 Ga0466970_0220535 Ga0466970_0220535_239_1009 255
266 3300044901 Ga0466960_0134506 Ga0466960_0134506_13_783 255
267 3300045049 Ga0466959_0034463 Ga0466959_0034463_2734_3504 255
268 3300046492 Ga0495585_0034382 Ga0495585_0034382_1331_2101 255
269 3300046615 Ga0495656_0000049 Ga0495656_0000049_32267_33034 255
270 3300046660 Ga0495625_0226050 Ga0495625_0226050_228_998 255
271 3300046683 Ga0495658_0282017 Ga0495658_0282017_268_1038 255
272 3300048090 Ga0495615_0003258 Ga0495615_0003258_1827_2594 255
273 3300050492 nmdc:mga0yw44_7798_c1 nmdc:mga0yw44_7798_c1_1870_2640 255
274 3300053087 Ga0500643_026820 Ga0500643_026820_955_1722 255
275 3300053116 Ga0500592_006390 Ga0500592_006390_1097_1864 255
276 3300061719 Ga0466962_0070345 Ga0466962_0070345_634_1404 255
277 iso_pu_bacteria 2919704043 2919707045 255
278 3300003792 Ga0055540_1004585 Ga0055540_10045857 256
279 3300003794 Ga0055531_10004352 Ga0055531_100043522 256
280 3300005535 Ga0070684_100080204 Ga0070684_1000802043 256
281 3300015262 Ga0182007_10035970 Ga0182007_100359701 256
282 3300025273 Ga0209673_1034299 Ga0209673_10342992 256
283 3300025290 Ga0207673_1006749 Ga0207673_10067492 256
284 3300025303 Ga0209051_1000172 Ga0209051_100017228 256
285 3300025304 Ga0209257_1000015 Ga0209257_1000015559 256
286 3300025304 Ga0209257_1000108 Ga0209257_1000108151 256
287 3300025893 Ga0207682_10033434 Ga0207682_100334342 256
288 3300037471 Ga0395905_0145694 Ga0395905_0145694_688_1461 256
289 3300041501 Ga0451845_0772503 Ga0451845_0772503_173_958 256
290 3300041512 Ga0451853_3660836 Ga0451853_3660836_168_953 256
291 3300042876 Ga0451577_0821714 Ga0451577_0821714_20_790 256
292 3300044693 Ga0466961_0000070 Ga0466961_0000070_52905_53696 256
293 3300044712 Ga0453684_0754623 Ga0453684_0754623_48_845 256
294 iso_pu_bacteria 2547132374 2548497636 256
295 iso_pu_bacteria 2643221717 2644649622 256
296 3300002704 JGI25155J39150_1000002 JGI25155J39150_1000002205 257
297 3300002705 JGI25156J39149_1000003 JGI25156J39149_1000003101 257
298 3300002738 JGI25154J39366_1000009 JGI25154J39366_1000009205 257
299 3300002741 JGI25157J39369_1000002 JGI25157J39369_1000002205 257
300 3300002987 JGI25159J45721_1001036 JGI25159J45721_10010365 257
301 3300003187 JGI25151J46595_10003451 JGI25151J46595_100034515 257
302 3300003354 JGI25160J50197_1000305 JGI25160J50197_100030533 257
303 3300003354 JGI25160J50197_1000717 JGI25160J50197_10007172 257
304 3300003374 JGI25161J50226_1000018 JGI25161J50226_100001898 257
305 3300003791 Ga0055530_10021720 Ga0055530_100217202 257
306 3300003792 Ga0055540_1000233 Ga0055540_100023325 257
307 3300003794 Ga0055531_10015577 Ga0055531_100155772 257
308 3300004625 Ga0055543_1000418 Ga0055543_100041812 257
309 3300005288 Ga0065714_10113560 Ga0065714_101135601 257
310 3300005367 Ga0070667_100035008 Ga0070667_1000350082 257
311 3300005548 Ga0070665_100406450 Ga0070665_1004064502 257
312 3300006042 Ga0075368_10052418 Ga0075368_100524182 257
313 3300006177 Ga0075362_10032346 Ga0075362_100323461 257
314 3300006178 Ga0075367_10039908 Ga0075367_100399083 257
315 3300006353 Ga0075370_10000233 Ga0075370_100002334 257
316 3300006353 Ga0075370_10000867 Ga0075370_100008672 257
317 3300006353 Ga0075370_10038855 Ga0075370_100388552 257
318 3300013308 Ga0157375_10145466 Ga0157375_101454662 257
319 3300014497 Ga0182008_10009875 Ga0182008_100098751 257
320 3300015261 Ga0182006_1016430 Ga0182006_10164304 257
321 3300015262 Ga0182007_10001485 Ga0182007_100014857 257
322 3300025206 Ga0209435_100001 Ga0209435_100001512 257
323 3300025208 Ga0209436_108356 Ga0209436_1083562 257
324 3300025246 Ga0209646_1000001 Ga0209646_1000001881 257
325 3300025250 Ga0209026_1000003 Ga0209026_1000003512 257
326 3300025256 Ga0209759_1000001 Ga0209759_1000001512 257
327 3300025284 Ga0209130_1000050 Ga0209130_100005098 257
328 3300025292 Ga0209676_1002525 Ga0209676_10025254 257
329 3300025294 Ga0209025_1004308 Ga0209025_10043085 257
330 3300025298 Ga0209050_1000947 Ga0209050_100094714 257
331 3300025298 Ga0209050_1002573 Ga0209050_10025735 257
332 3300025298 Ga0209050_1009899 Ga0209050_10098992 257
333 3300025302 Ga0207426_1000071 Ga0207426_1000071158 257
334 3300025303 Ga0209051_1000155 Ga0209051_100015526 257
335 3300025304 Ga0209257_1000236 Ga0209257_100023626 257
336 3300025304 Ga0209257_1006431 Ga0209257_10064318 257
337 3300025960 Ga0207651_10164961 Ga0207651_101649612 257
338 3300025986 Ga0207658_10048694 Ga0207658_100486943 257
339 3300026041 Ga0207639_10392177 Ga0207639_103921772 257
340 3300027876 Ga0209974_10015239 Ga0209974_100152392 257
341 3300030522 Ga0307512_10021622 Ga0307512_100216222 257
342 3300031456 Ga0307513_10000019 Ga0307513_10000019147 257
343 3300031731 Ga0307405_10034135 Ga0307405_100341352 257
344 3300031824 Ga0307413_10129765 Ga0307413_101297652 257
345 3300031911 Ga0307412_10169784 Ga0307412_101697842 257
346 3300033180 Ga0307510_10048474 Ga0307510_100484743 257
347 3300041443 Ga0451789_0334369 Ga0451789_0334369_72_869 257
348 3300044658 Ga0466972_0009515 Ga0466972_0009515_3959_4759 257
349 3300044683 Ga0466965_0006687 Ga0466965_0006687_153_929 257
350 3300044683 Ga0466965_0045400 Ga0466965_0045400_892_1692 257
351 3300044684 Ga0466966_0012555 Ga0466966_0012555_408_1184 257
352 3300044693 Ga0466961_0176411 Ga0466961_0176411_35_835 257
353 3300044694 Ga0466963_0070098 Ga0466963_0070098_1557_2333 257
354 3300044706 Ga0466964_0006639 Ga0466964_0006639_2526_3302 257
355 3300044712 Ga0453684_0008007 Ga0453684_0008007_8648_9454 257
356 3300044719 Ga0466971_0001645 Ga0466971_0001645_3894_4670 257
357 3300044765 Ga0466970_0015652 Ga0466970_0015652_931_1707 257
358 3300044842 Ga0466957_0064624 Ga0466957_0064624_490_1266 257
359 3300045049 Ga0466959_0002402 Ga0466959_0002402_3826_4602 257
360 3300045836 Ga0466958_0019837 Ga0466958_0019837_1249_2025 257
361 3300045976 Ga0466967_0028456 Ga0466967_0028456_2900_3676 257
362 3300046454 Ga0495592_0006294 Ga0495592_0006294_711_1508 257
363 3300046475 Ga0495639_0028950 Ga0495639_0028950_170_943 257
364 3300046663 Ga0495635_0063778 Ga0495635_0063778_1380_2153 257
365 3300047317 Ga0495604_0221887 Ga0495604_0221887_324_1097 257
366 3300047673 Ga0495593_0179112 Ga0495593_0179112_198_971 257
367 3300048903 Ga0496100_0003479 Ga0496100_0003479_3297_4070 257
368 3300048904 Ga0496101_0010046 Ga0496101_0010046_1240_2013 257
369 3300048905 Ga0496102_0002768 Ga0496102_0002768_1150_1923 257
370 3300048907 Ga0496104_0007745 Ga0496104_0007745_5278_6051 257
371 3300048908 Ga0496105_0003222 Ga0496105_0003222_10896_11669 257
372 3300048909 Ga0496106_0010906 Ga0496106_0010906_1355_2128 257
373 3300048912 Ga0496109_0436251 Ga0496109_0436251_371_1144 257
374 3300048913 Ga0496110_0014988 Ga0496110_0014988_176_949 257
375 3300050493 nmdc:mga0k408_114351_c1 nmdc:mga0k408_114351_c1_523_1296 257
376 3300050493 nmdc:mga0k408_71065_c1 nmdc:mga0k408_71065_c1_15_794 257
377 3300050493 nmdc:mga0k408_8363_c1 nmdc:mga0k408_8363_c1_1204_1977 257
378 3300050494 nmdc:mga06z11_206068_c1 nmdc:mga06z11_206068_c1_200_976 257
379 3300050496 nmdc:mga07m45_2527_c1 nmdc:mga07m45_2527_c1_5445_6218 257
380 3300050496 nmdc:mga07m45_753_c1 nmdc:mga07m45_753_c1_11480_12256 257
381 3300053088 Ga0500644_0001244 Ga0500644_0001244_4088_4867 257
382 3300053117 Ga0500593_000937 Ga0500593_000937_6306_7103 257
383 3300053131 Ga0500652_033582 Ga0500652_033582_1106_1930 257
384 3300053151 Ga0500604_0075549 Ga0500604_0075549_52_840 257
385 3300053730 Ga0500645_004897 Ga0500645_004897_3272_4051 257
386 3300055283 Ga0500661_003301 Ga0500661_003301_1941_2720 257
387 3300061719 Ga0466962_0004054 Ga0466962_0004054_305_1081 257
388 3300002987 JGI25159J45721_1006784 JGI25159J45721_10067842 258
389 3300003578 Ga0006562J51391_1109923 Ga0006562J51391_11099235 258
390 3300003578 Ga0006562J51391_1109926 Ga0006562J51391_11099265 258
391 3300003771 Ga0055526_1005920 Ga0055526_10059206 258
392 3300003771 Ga0055526_1005934 Ga0055526_10059346 258
393 3300003773 Ga0055537_1000008 Ga0055537_1000008117 258
394 3300003773 Ga0055537_1000522 Ga0055537_100052213 258
395 3300003775 Ga0055524_1000083 Ga0055524_100008359 258
396 3300003781 Ga0055536_1001743 Ga0055536_100174311 258
397 3300003781 Ga0055536_1054667 Ga0055536_10546671 258
398 3300003784 Ga0055534_1000475 Ga0055534_100047513 258
399 3300003784 Ga0055534_1003012 Ga0055534_10030123 258
400 3300003790 Ga0055528_1000652 Ga0055528_10006527 258
401 3300003790 Ga0055528_1001142 Ga0055528_100114213 258
402 3300003790 Ga0055528_1036478 Ga0055528_10364781 258
403 3300003791 Ga0055530_10000211 Ga0055530_1000021150 258
404 3300003791 Ga0055530_10006773 Ga0055530_100067732 258
405 3300003791 Ga0055530_10010477 Ga0055530_100104773 258
406 3300003792 Ga0055540_1000012 Ga0055540_100001259 258
407 3300003792 Ga0055540_1001010 Ga0055540_100101011 258
408 3300003792 Ga0055540_1002793 Ga0055540_10027933 258
409 3300003794 Ga0055531_10001140 Ga0055531_1000114013 258
410 3300003794 Ga0055531_10005187 Ga0055531_100051876 258
411 3300005288 Ga0065714_10093371 Ga0065714_100933712 258
412 3300005366 Ga0070659_100124902 Ga0070659_1001249022 258
413 3300006038 Ga0075365_10032083 Ga0075365_100320832 258
414 3300006038 Ga0075365_10093712 Ga0075365_100937122 258
415 3300006048 Ga0075363_100028112 Ga0075363_1000281122 258
416 3300006048 Ga0075363_100122076 Ga0075363_1001220762 258
417 3300006051 Ga0075364_10019732 Ga0075364_100197322 258
418 3300006177 Ga0075362_10006676 Ga0075362_100066762 258
419 3300006177 Ga0075362_10011626 Ga0075362_100116262 258
420 3300006177 Ga0075362_10014623 Ga0075362_100146234 258
421 3300006177 Ga0075362_10118821 Ga0075362_101188212 258
422 3300006195 Ga0075366_10016511 Ga0075366_100165112 258
423 3300006353 Ga0075370_10001471 Ga0075370_100014713 258
424 3300006353 Ga0075370_10075185 Ga0075370_100751852 258
425 3300006881 Ga0068865_100389597 Ga0068865_1003895972 258
426 3300006948 Ga0099826_10000249 Ga0099826_1000024918 258
427 3300013306 Ga0163162_10615037 Ga0163162_106150372 258
428 3300014497 Ga0182008_10027827 Ga0182008_100278271 258
429 3300017792 Ga0163161_10006026 Ga0163161_100060263 258
430 3300025263 Ga0209565_1000004 Ga0209565_1000004695 258
431 3300025263 Ga0209565_1000337 Ga0209565_100033713 258
432 3300025273 Ga0209673_1000074 Ga0209673_100007487 258
433 3300025273 Ga0209673_1000193 Ga0209673_100019399 258
434 3300025273 Ga0209673_1002390 Ga0209673_10023904 258
435 3300025284 Ga0209130_1000584 Ga0209130_10005842 258
436 3300025291 Ga0209675_1000044 Ga0209675_1000044118 258
437 3300025291 Ga0209675_1000163 Ga0209675_100016313 258
438 3300025291 Ga0209675_1017120 Ga0209675_10171202 258
439 3300025292 Ga0209676_1000029 Ga0209676_1000029207 258
440 3300025292 Ga0209676_1000903 Ga0209676_100090317 258
441 3300025292 Ga0209676_1030009 Ga0209676_10300092 258
442 3300025295 Ga0209564_1000470 Ga0209564_100047013 258
443 3300025295 Ga0209564_1004034 Ga0209564_10040346 258
444 3300025298 Ga0209050_1000003 Ga0209050_1000003269 258
445 3300025298 Ga0209050_1000936 Ga0209050_100093617 258
446 3300025299 Ga0209256_1000001 Ga0209256_1000001272 258
447 3300025302 Ga0207426_1005768 Ga0207426_10057682 258
448 3300025303 Ga0209051_1000003 Ga0209051_1000003269 258
449 3300025303 Ga0209051_1000137 Ga0209051_1000137120 258
450 3300025303 Ga0209051_1000940 Ga0209051_100094014 258
451 3300025304 Ga0209257_1000018 Ga0209257_1000018269 258
452 3300025304 Ga0209257_1000205 Ga0209257_1000205123 258
453 3300025935 Ga0207709_10123587 Ga0207709_101235872 258
454 3300025938 Ga0207704_10133607 Ga0207704_101336072 258
455 3300027666 Ga0209282_1006898 Ga0209282_10068983 258
456 3300027907 Ga0207428_10025795 Ga0207428_100257954 258
457 3300028786 Ga0307517_10019341 Ga0307517_100193413 258
458 3300028794 Ga0307515_10000063 Ga0307515_10000063112 258
459 3300028794 Ga0307515_10053774 Ga0307515_100537743 258
460 3300030731 Ga0316177_1096632 Ga0316177_10966321 258
461 3300030733 Ga0314311_1061367 Ga0314311_10613671 258
462 3300030734 Ga0316179_1062327 Ga0316179_10623271 258
463 3300030735 Ga0316178_1018347 Ga0316178_10183473 258
464 3300030742 Ga0316183_1170909 Ga0316183_11709093 258
465 3300030744 Ga0316181_1045493 Ga0316181_10454933 258
466 3300030745 Ga0316182_1066926 Ga0316182_10669261 258
467 3300031251 Ga0265327_10014656 Ga0265327_100146565 258
468 3300031507 Ga0307509_10162035 Ga0307509_101620352 258
469 3300031548 Ga0307408_100015271 Ga0307408_1000152713 258
470 3300031649 Ga0307514_10002613 Ga0307514_100026134 258
471 3300031649 Ga0307514_10003924 Ga0307514_100039247 258
472 3300031730 Ga0307516_10000237 Ga0307516_1000023736 258
473 3300031731 Ga0307405_10237532 Ga0307405_102375322 258
474 3300031824 Ga0307413_10417840 Ga0307413_104178402 258
475 3300031901 Ga0307406_10001551 Ga0307406_100015513 258
476 3300031911 Ga0307412_10083620 Ga0307412_100836202 258
477 3300031911 Ga0307412_10624842 Ga0307412_106248421 258
478 3300032004 Ga0307414_10243368 Ga0307414_102433682 258
479 3300032005 Ga0307411_10053962 Ga0307411_100539623 258
480 3300032005 Ga0307411_10070402 Ga0307411_100704023 258
481 3300032005 Ga0307411_10231907 Ga0307411_102319071 258
482 3300037312 Ga0395899_0011207 Ga0395899_0011207_3039_3839 258
483 3300037312 Ga0395899_0187053 Ga0395899_0187053_147_947 258
484 3300037471 Ga0395905_0033022 Ga0395905_0033022_2890_3690 258
485 3300039447 Ga0436361_0470603 Ga0436361_0470603_1726_2505 258
486 3300041404 Ga0439436_0000461 Ga0439436_0000461_201_977 258
487 3300041404 Ga0439436_0004114 Ga0439436_0004114_3327_4103 258
488 3300041406 Ga0439439_0004279 Ga0439439_0004279_336_1112 258
489 3300041406 Ga0439439_0025263 Ga0439439_0025263_517_1293 258
490 3300041407 Ga0439447_030238 Ga0439447_030238_422_1198 258
491 3300041411 Ga0439466_0000370 Ga0439466_0000370_510_1286 258
492 3300041411 Ga0439466_0060143 Ga0439466_0060143_297_1073 258
493 3300041413 Ga0439465_0000199 Ga0439465_0000199_13565_14341 258
494 3300041509 Ga0451843_1113347 Ga0451843_1113347_45_965 258
495 3300041997 Ga0439431_0000478 Ga0439431_0000478_728_1504 258
496 3300041999 Ga0439433_0008358 Ga0439433_0008358_1344_2120 258
497 3300041999 Ga0439433_0019987 Ga0439433_0019987_145_921 258
498 3300042002 Ga0439442_000541 Ga0439442_000541_3798_4574 258
499 3300042002 Ga0439442_015235 Ga0439442_015235_304_1080 258
500 3300042004 Ga0439445_0002298 Ga0439445_0002298_540_1316 258
501 3300042006 Ga0439432_001585 Ga0439432_001585_1604_2380 258
502 3300042007 Ga0439449_0000845 Ga0439449_0000845_6596_7372 258
503 3300042007 Ga0439449_0005343 Ga0439449_0005343_3895_4671 258
504 3300042007 Ga0439449_0012445 Ga0439449_0012445_2275_3051 258
505 3300042010 Ga0439452_001693 Ga0439452_001693_3136_3912 258
506 3300042014 Ga0439457_011663 Ga0439457_011663_1113_1889 258
507 3300042014 Ga0439457_025284 Ga0439457_025284_526_1302 258
508 3300042015 Ga0439462_0003937 Ga0439462_0003937_2069_2845 258
509 3300042015 Ga0439462_0013111 Ga0439462_0013111_148_924 258
510 3300042125 Ga0450923_000238 Ga0450923_000238_2618_3394 258
511 3300042128 Ga0450897_000110 Ga0450897_000110_2736_3512 258
512 3300042133 Ga0450896_000608 Ga0450896_000608_1161_1937 258
513 3300042134 Ga0450898_000810 Ga0450898_000810_1279_2055 258
514 3300042145 Ga0450906_009503 Ga0450906_009503_793_1569 258
515 3300042156 Ga0439446_0000308 Ga0439446_0000308_796_1572 258
516 3300042435 Ga0439434_0008502 Ga0439434_0008502_1115_1891 258
517 3300042435 Ga0439434_0026231 Ga0439434_0026231_728_1504 258
518 3300042531 Ga0450918_002514 Ga0450918_002514_133_909 258
519 3300042532 Ga0450893_0013588 Ga0450893_0013588_239_1015 258
520 3300042876 Ga0451577_0001937 Ga0451577_0001937_17207_17986 258
521 3300044712 Ga0453684_0001952 Ga0453684_0001952_8078_8857 258
522 3300045051 Ga0451576_0002149 Ga0451576_0002149_16695_17474 258
523 3300046660 Ga0495625_0000510 Ga0495625_0000510_28890_29666 258
524 3300046678 Ga0495599_0094692 Ga0495599_0094692_200_976 258
525 3300048925 Ga0496122_0020990 Ga0496122_0020990_1362_2138 258
526 3300049679 Ga0501249_001899 Ga0501249_001899_2027_2803 258
527 3300049686 Ga0501257_043566 Ga0501257_043566_38_847 258
528 3300049705 Ga0501225_0065646 Ga0501225_0065646_144_920 258
529 3300049758 Ga0501241_029740 Ga0501241_029740_57_833 258
530 3300049759 Ga0501262_000139 Ga0501262_000139_1584_2360 258
531 3300050489 nmdc:mga03683_4671_c1 nmdc:mga03683_4671_c1_2200_2976 258
532 3300050489 nmdc:mga03683_55992_c1 nmdc:mga03683_55992_c1_557_1333 258
533 3300050489 nmdc:mga03683_7991_c1 nmdc:mga03683_7991_c1_1457_2233 258
534 3300050489 nmdc:mga03683_99604_c1 nmdc:mga03683_99604_c1_232_1011 258
535 3300050490 nmdc:mga03n38_37182_c1 nmdc:mga03n38_37182_c1_517_1293 258
536 3300050490 nmdc:mga03n38_46772_c1 nmdc:mga03n38_46772_c1_831_1607 258
537 3300050491 nmdc:mga00v17_10163_c1 nmdc:mga00v17_10163_c1_3040_3816 258
538 3300050492 nmdc:mga0yw44_10842_c2 nmdc:mga0yw44_10842_c2_1902_2678 258
539 3300050492 nmdc:mga0yw44_192987_c1 nmdc:mga0yw44_192987_c1_496_1272 258
540 3300050493 nmdc:mga0k408_171940_c1 nmdc:mga0k408_171940_c1_317_1096 258
541 3300050493 nmdc:mga0k408_20338_c1 nmdc:mga0k408_20338_c1_2042_2818 258
542 3300050496 nmdc:mga07m45_25517_c1 nmdc:mga07m45_25517_c1_539_1315 258
543 3300053086 Ga0500578_0000900 Ga0500578_0000900_30280_31056 258
544 iso_pu_bacteria 2599185301 2599939170 258
545 iso_pu_bacteria 2791355123 2792750551 258
546 iso_pu_bacteria 2856364286 2856366614 258
547 iso_pu_bacteria 2869285874 2869287975 258
548 iso_pu_bacteria 2871429161 2871429863 258
549 iso_pu_bacteria 2871466892 2871467561 258
550 iso_pu_bacteria 2874146452 2874151608 258
551 iso_pu_bacteria 2874155637 2874159240 258
552 iso_pu_bacteria 2876413966 2876417659 258
553 iso_pu_bacteria 2878745973 2878749486 258
554 iso_pu_bacteria 2903492973 2903493716 258
555 iso_pu_bacteria 2906308376 2906310524 258
556 iso_pu_bacteria 2906321335 2906324589 258
557 iso_pu_bacteria 2906378014 2906384068 258
558 iso_pu_bacteria 2937813078 2937817353 258
559 iso_pu_bacteria 2958130278 2958132379 258
560 iso_pu_bacteria 2958179912 2958182193 258
561 iso_pu_bacteria 2961077736 2961080037 258
562 iso_pu_bacteria 2977843712 2977847640 258
563 iso_pu_bacteria 8004387939 8004389763 258
564 iso_pu_bacteria 8004714634 8004718160 258
565 3300005328 Ga0070676_10021078 Ga0070676_100210783 259
566 3300005331 Ga0070670_100109601 Ga0070670_1001096012 259
567 3300005338 Ga0068868_100166673 Ga0068868_1001666732 259
568 3300005355 Ga0070671_100018945 Ga0070671_1000189453 259
569 3300005364 Ga0070673_100166771 Ga0070673_1001667712 259
570 3300005367 Ga0070667_100657388 Ga0070667_1006573882 259
571 3300005457 Ga0070662_100003105 Ga0070662_1000031059 259
572 3300005468 Ga0070707_100019334 Ga0070707_1000193342 259
573 3300005471 Ga0070698_100074825 Ga0070698_1000748253 259
574 3300005539 Ga0068853_100207833 Ga0068853_1002078331 259
575 3300005543 Ga0070672_100016884 Ga0070672_1000168844 259
576 3300005563 Ga0068855_100095842 Ga0068855_1000958422 259
577 3300005577 Ga0068857_100127695 Ga0068857_1001276952 259
578 3300005614 Ga0068856_100352250 Ga0068856_1003522502 259
579 3300005617 Ga0068859_100042077 Ga0068859_1000420774 259
580 3300005617 Ga0068859_100564648 Ga0068859_1005646481 259
581 3300005841 Ga0068863_100021846 Ga0068863_1000218463 259
582 3300006048 Ga0075363_100050802 Ga0075363_1000508022 259
583 3300006178 Ga0075367_10164656 Ga0075367_101646562 259
584 3300006195 Ga0075366_10017710 Ga0075366_100177102 259
585 3300006353 Ga0075370_10038426 Ga0075370_100384263 259
586 3300006931 Ga0097620_100042077 Ga0097620_1000420774 259
587 3300006931 Ga0097620_100564755 Ga0097620_1005647552 259
588 3300009093 Ga0105240_10288789 Ga0105240_102887894 259
589 3300009098 Ga0105245_10532762 Ga0105245_105327621 259
590 3300010375 Ga0105239_10216198 Ga0105239_102161982 259
591 3300013306 Ga0163162_10571857 Ga0163162_105718572 259
592 3300013308 Ga0157375_10078946 Ga0157375_100789462 259
593 3300025291 Ga0209675_1004259 Ga0209675_10042594 259
594 3300025294 Ga0209025_1005333 Ga0209025_10053332 259
595 3300025297 Ga0209758_1010937 Ga0209758_10109373 259
596 3300025907 Ga0207645_10159688 Ga0207645_101596882 259
597 3300025910 Ga0207684_10107831 Ga0207684_101078311 259
598 3300025922 Ga0207646_10064535 Ga0207646_100645352 259
599 3300025923 Ga0207681_10179302 Ga0207681_101793022 259
600 3300025925 Ga0207650_10081100 Ga0207650_100811002 259
601 3300025931 Ga0207644_10043494 Ga0207644_100434942 259
602 3300025931 Ga0207644_10254066 Ga0207644_102540662 259
603 3300025933 Ga0207706_10002765 Ga0207706_1000276513 259
604 3300025933 Ga0207706_10205423 Ga0207706_102054232 259
605 3300025940 Ga0207691_10022656 Ga0207691_100226565 259
606 3300025941 Ga0207711_10083336 Ga0207711_100833363 259
607 3300025949 Ga0207667_10075147 Ga0207667_100751472 259
608 3300025949 Ga0207667_10468611 Ga0207667_104686112 259
609 3300025960 Ga0207651_10095642 Ga0207651_100956422 259
610 3300025986 Ga0207658_10093038 Ga0207658_100930383 259
611 3300026023 Ga0207677_10488401 Ga0207677_104884012 259
612 3300026088 Ga0207641_10037541 Ga0207641_100375412 259
613 3300026095 Ga0207676_10088967 Ga0207676_100889673 259
614 3300026116 Ga0207674_10111472 Ga0207674_101114722 259
615 3300028379 Ga0268266_10060335 Ga0268266_100603352 259
616 3300031251 Ga0265327_10000746 Ga0265327_1000074636 259
617 3300031730 Ga0307516_10046577 Ga0307516_100465773 259
618 3300031911 Ga0307412_10160653 Ga0307412_101606532 259
619 3300035084 Ga0373928_0022843 Ga0373928_0022843_332_1276 259
620 3300044658 Ga0466972_0020341 Ga0466972_0020341_2239_3045 259
621 3300044901 Ga0466960_0004720 Ga0466960_0004720_2273_3079 259
622 3300046694 Ga0495649_0116583 Ga0495649_0116583_98_877 259
623 3300048905 Ga0496102_0102102 Ga0496102_0102102_1100_1882 259
624 3300048919 Ga0496116_0018143 Ga0496116_0018143_3356_4135 259
625 3300048920 Ga0496117_0203280 Ga0496117_0203280_12_791 259
626 3300048924 Ga0496121_0044154 Ga0496121_0044154_1462_2241 259
627 3300048926 Ga0496123_0088898 Ga0496123_0088898_300_1079 259
628 3300050496 nmdc:mga07m45_3352_c1 nmdc:mga07m45_3352_c1_2229_3014 259
629 3300002705 JGI25156J39149_1011013 JGI25156J39149_10110132 260
630 3300002738 JGI25154J39366_1003329 JGI25154J39366_10033293 260
631 3300002741 JGI25157J39369_1000539 JGI25157J39369_10005395 260
632 3300002741 JGI25157J39369_1000561 JGI25157J39369_100056119 260
633 3300003323 rootH1_10010335 rootH1_100103352 260
634 3300003756 Ga0055533_1000061 Ga0055533_100006169 260
635 3300003759 Ga0055525_1000604 Ga0055525_10006047 260
636 3300003761 Ga0055535_1000141 Ga0055535_10001417 260
637 3300003763 Ga0055529_1000216 Ga0055529_100021668 260
638 3300005327 Ga0070658_10065895 Ga0070658_100658952 260
639 3300005327 Ga0070658_10148075 Ga0070658_101480752 260
640 3300005338 Ga0068868_100149780 Ga0068868_1001497802 260
641 3300005339 Ga0070660_100065333 Ga0070660_1000653332 260
642 3300005347 Ga0070668_100226240 Ga0070668_1002262402 260
643 3300005356 Ga0070674_100028134 Ga0070674_1000281342 260
644 3300005364 Ga0070673_100147784 Ga0070673_1001477842 260
645 3300005367 Ga0070667_100063934 Ga0070667_1000639342 260
646 3300005367 Ga0070667_100226673 Ga0070667_1002266731 260
647 3300005456 Ga0070678_100005040 Ga0070678_1000050402 260
648 3300005539 Ga0068853_100075272 Ga0068853_1000752722 260
649 3300005543 Ga0070672_100014002 Ga0070672_1000140022 260
650 3300005548 Ga0070665_100001708 Ga0070665_1000017086 260
651 3300005563 Ga0068855_100123614 Ga0068855_1001236143 260
652 3300005577 Ga0068857_100027446 Ga0068857_1000274462 260
653 3300005614 Ga0068856_100005685 Ga0068856_1000056854 260
654 3300006186 Ga0075369_10209907 Ga0075369_102099072 260
655 3300009177 Ga0105248_10429937 Ga0105248_104299372 260
656 3300009545 Ga0105237_10401091 Ga0105237_104010912 260
657 3300009551 Ga0105238_10090067 Ga0105238_100900672 260
658 3300012512 Ga0157327_1011566 Ga0157327_10115661 260
659 3300013297 Ga0157378_10043769 Ga0157378_100437692 260
660 3300013306 Ga0163162_10264782 Ga0163162_102647822 260
661 3300014325 Ga0163163_10030843 Ga0163163_100308431 260
662 3300014969 Ga0157376_10001480 Ga0157376_1000148012 260
663 3300025226 Ga0209674_100003 Ga0209674_100003123 260
664 3300025230 Ga0209563_100086 Ga0209563_10008670 260
665 3300025242 Ga0209258_100044 Ga0209258_100044320 260
666 3300025242 Ga0209258_100645 Ga0209258_10064519 260
667 3300025246 Ga0209646_1000067 Ga0209646_1000067201 260
668 3300025250 Ga0209026_1000033 Ga0209026_100003328 260
669 3300025253 Ga0209677_100087 Ga0209677_10008711 260
670 3300025253 Ga0209677_100136 Ga0209677_10013610 260
671 3300025254 Ga0209148_1007707 Ga0209148_10077071 260
672 3300025256 Ga0209759_1000024 Ga0209759_100002428 260
673 3300025256 Ga0209759_1009494 Ga0209759_10094943 260
674 3300025272 Ga0209455_1000048 Ga0209455_1000048320 260
675 3300025272 Ga0209455_1022908 Ga0209455_10229082 260
676 3300025909 Ga0207705_10045494 Ga0207705_100454942 260
677 3300025909 Ga0207705_10478366 Ga0207705_104783662 260
678 3300025911 Ga0207654_10055188 Ga0207654_100551882 260
679 3300025913 Ga0207695_10075509 Ga0207695_100755092 260
680 3300025914 Ga0207671_10290902 Ga0207671_102909022 260
681 3300025919 Ga0207657_10032485 Ga0207657_100324853 260
682 3300025924 Ga0207694_10022593 Ga0207694_100225932 260
683 3300025931 Ga0207644_10031181 Ga0207644_100311811 260
684 3300025937 Ga0207669_10009042 Ga0207669_100090423 260
685 3300025937 Ga0207669_10231586 Ga0207669_102315862 260
686 3300025940 Ga0207691_10017550 Ga0207691_100175505 260
687 3300025941 Ga0207711_10452702 Ga0207711_104527022 260
688 3300025960 Ga0207651_10125288 Ga0207651_101252882 260
689 3300025986 Ga0207658_10045245 Ga0207658_100452453 260
690 3300026023 Ga0207677_10056952 Ga0207677_100569522 260
691 3300026078 Ga0207702_10000145 Ga0207702_1000014536 260
692 3300026116 Ga0207674_10025782 Ga0207674_100257822 260
693 3300026121 Ga0207683_10004049 Ga0207683_1000404912 260
694 3300026121 Ga0207683_10416350 Ga0207683_104163502 260
695 3300028379 Ga0268266_10029871 Ga0268266_100298713 260
696 3300031730 Ga0307516_10020645 Ga0307516_100206457 260
697 3300035121 Ga0373960_0080997 Ga0373960_0080997_205_990 260
698 3300044842 Ga0466957_0110151 Ga0466957_0110151_839_1627 260
699 3300046462 Ga0495651_0033993 Ga0495651_0033993_3056_3862 260
700 3300046475 Ga0495639_0006452 Ga0495639_0006452_2840_3646 260
701 3300046506 Ga0495583_0000073 Ga0495583_0000073_87250_88038 260
702 3300046507 Ga0495606_0014272 Ga0495606_0014272_1108_1896 260
703 3300046543 Ga0495645_0195399 Ga0495645_0195399_520_1317 260
704 3300046616 Ga0495668_0111509 Ga0495668_0111509_145_933 260
705 3300046660 Ga0495625_0161905 Ga0495625_0161905_232_1020 260
706 3300046694 Ga0495649_0001792 Ga0495649_0001792_5588_6376 260
707 3300046794 Ga0495589_0005986 Ga0495589_0005986_1833_2621 260
708 3300050493 nmdc:mga0k408_11672_c1 nmdc:mga0k408_11672_c1_2283_3137 260
709 3300053122 Ga0500608_012562 Ga0500608_012562_2874_3662 260
710 3300053136 Ga0500559_0036318 Ga0500559_0036318_382_1170 260
711 3300053162 Ga0500638_192799 Ga0500638_192799_58_846 260
712 3300003187 JGI25151J46595_10008081 JGI25151J46595_100080811 261
713 3300003187 JGI25151J46595_10047563 JGI25151J46595_100475632 261
714 3300005329 Ga0070683_100075122 Ga0070683_1000751222 261
715 3300005330 Ga0070690_100393047 Ga0070690_1003930471 261
716 3300005331 Ga0070670_100015208 Ga0070670_1000152082 261
717 3300005333 Ga0070677_10004237 Ga0070677_100042373 261
718 3300005334 Ga0068869_100232450 Ga0068869_1002324502 261
719 3300005340 Ga0070689_100038076 Ga0070689_1000380762 261
720 3300005340 Ga0070689_100282726 Ga0070689_1002827262 261
721 3300005341 Ga0070691_10136598 Ga0070691_101365982 261
722 3300005343 Ga0070687_100014306 Ga0070687_1000143062 261
723 3300005344 Ga0070661_100005588 Ga0070661_1000055889 261
724 3300005347 Ga0070668_100014962 Ga0070668_1000149624 261
725 3300005365 Ga0070688_100002758 Ga0070688_1000027589 261
726 3300005366 Ga0070659_100480126 Ga0070659_1004801262 261
727 3300005367 Ga0070667_100154845 Ga0070667_1001548452 261
728 3300005438 Ga0070701_10007283 Ga0070701_100072835 261
729 3300005441 Ga0070700_100006087 Ga0070700_1000060875 261
730 3300005455 Ga0070663_100022209 Ga0070663_1000222092 261
731 3300005456 Ga0070678_100401820 Ga0070678_1004018201 261
732 3300005466 Ga0070685_10009672 Ga0070685_100096725 261
733 3300005535 Ga0070684_100001972 Ga0070684_1000019724 261
734 3300005539 Ga0068853_100043067 Ga0068853_1000430671 261
735 3300005548 Ga0070665_100007621 Ga0070665_1000076219 261
736 3300005564 Ga0070664_100219579 Ga0070664_1002195792 261
737 3300005577 Ga0068857_100008214 Ga0068857_10000821410 261
738 3300005578 Ga0068854_100005120 Ga0068854_1000051207 261
739 3300005615 Ga0070702_100185276 Ga0070702_1001852762 261
740 3300005616 Ga0068852_100180920 Ga0068852_1001809202 261
741 3300005617 Ga0068859_100167746 Ga0068859_1001677462 261
742 3300005618 Ga0068864_100050175 Ga0068864_1000501753 261
743 3300005718 Ga0068866_10010375 Ga0068866_100103752 261
744 3300005719 Ga0068861_100044042 Ga0068861_1000440422 261
745 3300005834 Ga0068851_10001256 Ga0068851_100012563 261
746 3300005843 Ga0068860_100024531 Ga0068860_1000245317 261
747 3300006358 Ga0068871_100004582 Ga0068871_1000045823 261
748 3300006931 Ga0097620_100167759 Ga0097620_1001677592 261
749 3300009094 Ga0111539_10114129 Ga0111539_101141293 261
750 3300010375 Ga0105239_10300286 Ga0105239_103002862 261
751 3300013102 Ga0157371_10131325 Ga0157371_101313252 261
752 3300014325 Ga0163163_10002596 Ga0163163_1000259615 261
753 3300014326 Ga0157380_10013288 Ga0157380_100132883 261
754 3300014745 Ga0157377_10004392 Ga0157377_100043927 261
755 3300017792 Ga0163161_10022613 Ga0163161_100226133 261
756 3300025231 Ga0207427_100292 Ga0207427_1002924 261
757 3300025245 Ga0207425_1004781 Ga0207425_10047814 261
758 3300025294 Ga0209025_1006141 Ga0209025_10061417 261
759 3300025294 Ga0209025_1032870 Ga0209025_10328702 261
760 3300025315 Ga0207697_10000691 Ga0207697_1000069118 261
761 3300025321 Ga0207656_10126870 Ga0207656_101268702 261
762 3300025893 Ga0207682_10031186 Ga0207682_100311862 261
763 3300025899 Ga0207642_10002195 Ga0207642_100021955 261
764 3300025901 Ga0207688_10013598 Ga0207688_100135984 261
765 3300025907 Ga0207645_10002030 Ga0207645_1000203016 261
766 3300025908 Ga0207643_10217259 Ga0207643_102172592 261
767 3300025919 Ga0207657_10014801 Ga0207657_100148012 261
768 3300025925 Ga0207650_10039340 Ga0207650_100393403 261
769 3300025926 Ga0207659_10000907 Ga0207659_100009072 261
770 3300025927 Ga0207687_10135091 Ga0207687_101350912 261
771 3300025931 Ga0207644_10149790 Ga0207644_101497902 261
772 3300025932 Ga0207690_10063187 Ga0207690_100631872 261
773 3300025933 Ga0207706_10006045 Ga0207706_100060453 261
774 3300025936 Ga0207670_10332633 Ga0207670_103326332 261
775 3300025937 Ga0207669_10002453 Ga0207669_100024536 261
776 3300025942 Ga0207689_10048978 Ga0207689_100489783 261
777 3300025944 Ga0207661_10294413 Ga0207661_102944132 261
778 3300025945 Ga0207679_10457955 Ga0207679_104579552 261
779 3300025960 Ga0207651_10590916 Ga0207651_105909161 261
780 3300025981 Ga0207640_10265555 Ga0207640_102655552 261
781 3300026041 Ga0207639_10028286 Ga0207639_100282861 261
782 3300026067 Ga0207678_10016542 Ga0207678_100165424 261
783 3300026075 Ga0207708_10014322 Ga0207708_100143225 261
784 3300026088 Ga0207641_10011759 Ga0207641_100117592 261
785 3300026116 Ga0207674_10003414 Ga0207674_100034142 261
786 3300026118 Ga0207675_100009754 Ga0207675_1000097542 261
787 3300026142 Ga0207698_10307145 Ga0207698_103071452 261
788 3300028379 Ga0268266_10006931 Ga0268266_1000693110 261
789 3300031731 Ga0307405_10117110 Ga0307405_101171102 261
790 3300031901 Ga0307406_10020585 Ga0307406_100205852 261
791 3300037466 Ga0395898_0034177 Ga0395898_0034177_4096_4887 261
792 3300038443 Ga0395901_0004081 Ga0395901_0004081_8099_8890 261
793 3300046453 Ga0495627_047147 Ga0495627_047147_22_855 261
794 3300048903 Ga0496100_0149076 Ga0496100_0149076_228_1016 261
795 3300048907 Ga0496104_0218674 Ga0496104_0218674_789_1577 261
796 3300048907 Ga0496104_0269415 Ga0496104_0269415_297_1085 261
797 3300048908 Ga0496105_0166715 Ga0496105_0166715_401_1189 261
798 3300048911 Ga0496108_0029665 Ga0496108_0029665_3097_3885 261
799 3300048912 Ga0496109_0035583 Ga0496109_0035583_417_1205 261
800 3300048917 Ga0496114_0425463 Ga0496114_0425463_84_872 261
801 3300050511 nmdc:mga08y16_95866_c1 nmdc:mga08y16_95866_c1_62_850 261
802 iso_pu_bacteria 2513020051 2513227848 261
803 iso_pu_bacteria 2643221658 2644326963 261
804 iso_pu_bacteria 2643221683 2644466455 261
805 iso_pu_bacteria 2738541277 2738721951 261
806 iso_pu_bacteria 2738541307 2738882118 261
807 iso_pu_bacteria 2738543019 2739282315 261
808 iso_pu_bacteria 2818991446 2819598049 261
809 iso_pu_bacteria 2831265667 2831269039 261
810 iso_pu_bacteria 2838054893 2838058463 261
811 iso_pu_bacteria 2899924645 2899929468 261
812 iso_pu_bacteria 2904541872 2904543334 261
813 iso_pu_bacteria 2928037797 2928040088 261
814 iso_pu_bacteria 2928044640 2928047163 261
815 iso_pu_bacteria 2928051484 2928057634 261
816 iso_pu_bacteria 2928064002 2928067984 261
817 iso_pu_bacteria 2928084124 2928085740 261
818 iso_pu_bacteria 2929160207 2929160566 261
819 iso_pu_bacteria 2945909444 2945914937 261
820 3300003792 Ga0055540_1033070 Ga0055540_10330702 262
821 3300005333 Ga0070677_10101520 Ga0070677_101015201 262
822 3300005334 Ga0068869_100041457 Ga0068869_1000414572 262
823 3300005335 Ga0070666_10138299 Ga0070666_101382992 262
824 3300005338 Ga0068868_100497752 Ga0068868_1004977521 262
825 3300005353 Ga0070669_100008979 Ga0070669_1000089795 262
826 3300005354 Ga0070675_100280577 Ga0070675_1002805771 262
827 3300005356 Ga0070674_100432224 Ga0070674_1004322241 262
828 3300005364 Ga0070673_100043450 Ga0070673_1000434502 262
829 3300005364 Ga0070673_100084541 Ga0070673_1000845413 262
830 3300005439 Ga0070711_100293692 Ga0070711_1002936922 262
831 3300005456 Ga0070678_100189308 Ga0070678_1001893082 262
832 3300005459 Ga0068867_100120861 Ga0068867_1001208612 262
833 3300005459 Ga0068867_100488806 Ga0068867_1004888061 262
834 3300005539 Ga0068853_100022531 Ga0068853_1000225314 262
835 3300005543 Ga0070672_100185756 Ga0070672_1001857562 262
836 3300005544 Ga0070686_100207446 Ga0070686_1002074462 262
837 3300005548 Ga0070665_100079552 Ga0070665_1000795522 262
838 3300005563 Ga0068855_100309830 Ga0068855_1003098302 262
839 3300005564 Ga0070664_100095180 Ga0070664_1000951802 262
840 3300005614 Ga0068856_100829190 Ga0068856_1008291902 262
841 3300005615 Ga0070702_100245573 Ga0070702_1002455732 262
842 3300005617 Ga0068859_100217825 Ga0068859_1002178251 262
843 3300005617 Ga0068859_100362888 Ga0068859_1003628882 262
844 3300005618 Ga0068864_100321919 Ga0068864_1003219192 262
845 3300005718 Ga0068866_10158968 Ga0068866_101589682 262
846 3300005834 Ga0068851_10194218 Ga0068851_101942182 262
847 3300005841 Ga0068863_100101338 Ga0068863_1001013382 262
848 3300005843 Ga0068860_100523759 Ga0068860_1005237591 262
849 3300005844 Ga0068862_100148756 Ga0068862_1001487562 262
850 3300005844 Ga0068862_100411196 Ga0068862_1004111962 262
851 3300006237 Ga0097621_100097000 Ga0097621_1000970002 262
852 3300006358 Ga0068871_100023326 Ga0068871_1000233264 262
853 3300006931 Ga0097620_100217822 Ga0097620_1002178221 262
854 3300006931 Ga0097620_100362885 Ga0097620_1003628852 262
855 3300009093 Ga0105240_10013511 Ga0105240_100135118 262
856 3300009093 Ga0105240_10260290 Ga0105240_102602902 262
857 3300009093 Ga0105240_10801336 Ga0105240_108013362 262
858 3300009148 Ga0105243_10018931 Ga0105243_100189312 262
859 3300009176 Ga0105242_10038785 Ga0105242_100387853 262
860 3300009176 Ga0105242_10138596 Ga0105242_101385962 262
861 3300009177 Ga0105248_10149840 Ga0105248_101498403 262
862 3300009177 Ga0105248_10879084 Ga0105248_108790842 262
863 3300009545 Ga0105237_10000585 Ga0105237_1000058542 262
864 3300009551 Ga0105238_10001715 Ga0105238_1000171522 262
865 3300009553 Ga0105249_10590279 Ga0105249_105902792 262
866 3300010375 Ga0105239_10000598 Ga0105239_1000059842 262
867 3300011119 Ga0105246_10782965 Ga0105246_107829651 262
868 3300013297 Ga0157378_10322206 Ga0157378_103222062 262
869 3300013306 Ga0163162_10047810 Ga0163162_100478105 262
870 3300013307 Ga0157372_10473569 Ga0157372_104735692 262
871 3300013308 Ga0157375_10155887 Ga0157375_101558873 262
872 3300014968 Ga0157379_10492899 Ga0157379_104928992 262
873 3300017792 Ga0163161_10029568 Ga0163161_100295683 262
874 3300025303 Ga0209051_1010284 Ga0209051_10102842 262
875 3300025893 Ga0207682_10031339 Ga0207682_100313393 262
876 3300025899 Ga0207642_10013538 Ga0207642_100135383 262
877 3300025909 Ga0207705_10083918 Ga0207705_100839182 262
878 3300025913 Ga0207695_10012587 Ga0207695_100125878 262
879 3300025913 Ga0207695_10202069 Ga0207695_102020692 262
880 3300025914 Ga0207671_10001425 Ga0207671_100014253 262
881 3300025916 Ga0207663_10242856 Ga0207663_102428562 262
882 3300025921 Ga0207652_10514864 Ga0207652_105148642 262
883 3300025926 Ga0207659_10219428 Ga0207659_102194282 262
884 3300025933 Ga0207706_10170801 Ga0207706_101708012 262
885 3300025934 Ga0207686_10034184 Ga0207686_100341843 262
886 3300025937 Ga0207669_10040999 Ga0207669_100409993 262
887 3300025940 Ga0207691_10071497 Ga0207691_100714973 262
888 3300025942 Ga0207689_10007873 Ga0207689_100078735 262
889 3300025942 Ga0207689_10026907 Ga0207689_100269072 262
890 3300025949 Ga0207667_10070807 Ga0207667_100708072 262
891 3300025949 Ga0207667_10076732 Ga0207667_100767323 262
892 3300025960 Ga0207651_10034462 Ga0207651_100344622 262
893 3300025960 Ga0207651_10117620 Ga0207651_101176202 262
894 3300025961 Ga0207712_10293751 Ga0207712_102937512 262
895 3300026023 Ga0207677_10340385 Ga0207677_103403852 262
896 3300026041 Ga0207639_10175930 Ga0207639_101759302 262
897 3300026075 Ga0207708_10026624 Ga0207708_100266244 262
898 3300026088 Ga0207641_10074860 Ga0207641_100748603 262
899 3300026088 Ga0207641_10408210 Ga0207641_104082102 262
900 3300026089 Ga0207648_10165863 Ga0207648_101658632 262
901 3300026095 Ga0207676_10316339 Ga0207676_103163392 262
902 3300026118 Ga0207675_100033969 Ga0207675_1000339693 262
903 3300026118 Ga0207675_100212718 Ga0207675_1002127182 262
904 3300026121 Ga0207683_10016134 Ga0207683_100161345 262
905 3300028379 Ga0268266_10660781 Ga0268266_106607811 262
906 3300028380 Ga0268265_10022398 Ga0268265_100223982 262
907 3300028380 Ga0268265_10347881 Ga0268265_103478812 262
908 3300028381 Ga0268264_10022505 Ga0268264_100225052 262
909 3300035086 Ga0373934_0053243 Ga0373934_0053243_543_1337 262
910 3300035692 Ga0373935_0385625 Ga0373935_0385625_148_942 262
911 3300035725 Ga0373947_0080793 Ga0373947_0080793_66_860 262
912 3300046535 Ga0495586_0051387 Ga0495586_0051387_544_1452 262
913 iso_pu_bacteria 2599185214 2599621980 262
914 iso_pu_bacteria 2599185226 2599676855 262
915 iso_pu_bacteria 2599185227 2599685173 262
916 iso_pu_bacteria 2599185229 2599691490 262
917 iso_pu_bacteria 2643221672 2644398763 262
918 iso_pu_bacteria 2885198086 2885203794 262
919 iso_pu_bacteria 2885211737 2885217871 262
920 iso_pu_bacteria 2928070936 2928072560 262
921 iso_pu_bacteria 2945984333 2945989660 262
922 3300005356 Ga0070674_100146355 Ga0070674_1001463552 263
923 3300010375 Ga0105239_10150797 Ga0105239_101507972 263
924 3300014968 Ga0157379_10747620 Ga0157379_107476201 263
925 3300048907 Ga0496104_0697635 Ga0496104_0697635_94_906 263
926 3300048915 Ga0496112_0017957 Ga0496112_0017957_147_959 263
927 3300050489 nmdc:mga03683_99202_c1 nmdc:mga03683_99202_c1_280_1086 263
928 3300005616 Ga0068852_100561504 Ga0068852_1005615042 264
929 3300009036 Ga0105244_10125026 Ga0105244_101250261 264
930 3300010375 Ga0105239_10021373 Ga0105239_100213736 264
931 3300012502 Ga0157347_1000792 Ga0157347_10007922 264
932 3300013100 Ga0157373_10054830 Ga0157373_100548303 264
933 3300013104 Ga0157370_10014536 Ga0157370_100145365 264
934 3300013105 Ga0157369_10101999 Ga0157369_101019991 264
935 3300014497 Ga0182008_10008991 Ga0182008_100089915 264
936 3300025949 Ga0207667_10060340 Ga0207667_100603401 264
937 3300032002 Ga0307416_100637020 Ga0307416_1006370202 264
938 3300046512 Ga0495610_0011873 Ga0495610_0011873_234_1031 264
939 3300046520 Ga0495637_0002058 Ga0495637_0002058_1016_1813 264
940 3300048920 Ga0496117_0231136 Ga0496117_0231136_76_870 264
941 3300048921 Ga0496118_0211042 Ga0496118_0211042_20_943 264
942 3300048927 Ga0496124_0335760 Ga0496124_0335760_162_956 264
943 3300053079 Ga0500610_0002036 Ga0500610_0002036_953_1750 264
944 3300053122 Ga0500608_012368 Ga0500608_012368_1001_1795 264
945 3300002773 JGI25152J39213_1005617 JGI25152J39213_10056173 265
946 3300002774 JGI25150J39212_1003144 JGI25150J39212_10031443 265
947 3300002987 JGI25159J45721_1004938 JGI25159J45721_10049382 265
948 3300002987 JGI25159J45721_1006239 JGI25159J45721_10062393 265
949 3300003187 JGI25151J46595_10001811 JGI25151J46595_100018117 265
950 3300003187 JGI25151J46595_10002220 JGI25151J46595_100022202 265
951 3300003187 JGI25151J46595_10011432 JGI25151J46595_100114323 265
952 3300003187 JGI25151J46595_10013920 JGI25151J46595_100139203 265
953 3300003215 JGI25153J46596_10010392 JGI25153J46596_100103923 265
954 3300003215 JGI25153J46596_10012745 JGI25153J46596_100127453 265
955 3300003354 JGI25160J50197_1009495 JGI25160J50197_10094953 265
956 3300003374 JGI25161J50226_1002542 JGI25161J50226_10025423 265
957 3300003374 JGI25161J50226_1009821 JGI25161J50226_10098212 265
958 3300003761 Ga0055535_1001832 Ga0055535_10018322 265
959 3300003762 Ga0055542_1000003 Ga0055542_100000327 265
960 3300003771 Ga0055526_1009682 Ga0055526_10096823 265
961 3300003771 Ga0055526_1014773 Ga0055526_10147732 265
962 3300003773 Ga0055537_1003664 Ga0055537_10036643 265
963 3300003773 Ga0055537_1005053 Ga0055537_10050533 265
964 3300003775 Ga0055524_1006728 Ga0055524_10067282 265
965 3300003775 Ga0055524_1007561 Ga0055524_10075613 265
966 3300003781 Ga0055536_1004093 Ga0055536_10040934 265
967 3300003784 Ga0055534_1004188 Ga0055534_10041882 265
968 3300003784 Ga0055534_1005116 Ga0055534_10051163 265
969 3300003790 Ga0055528_1003777 Ga0055528_10037773 265
970 3300003790 Ga0055528_1005231 Ga0055528_10052315 265
971 3300003791 Ga0055530_10000292 Ga0055530_1000029224 265
972 3300003794 Ga0055531_10013853 Ga0055531_100138532 265
973 3300003794 Ga0055531_10022073 Ga0055531_100220732 265
974 3300004625 Ga0055543_1003447 Ga0055543_10034473 265
975 3300005262 Ga0065165_1008869 Ga0065165_10088693 265
976 3300005445 Ga0070708_100394075 Ga0070708_1003940752 265
977 3300005457 Ga0070662_100158311 Ga0070662_1001583112 265
978 3300005467 Ga0070706_100165996 Ga0070706_1001659963 265
979 3300005468 Ga0070707_100191393 Ga0070707_1001913932 265
980 3300005471 Ga0070698_100328830 Ga0070698_1003288302 265
981 3300005545 Ga0070695_100234135 Ga0070695_1002341353 265
982 3300005577 Ga0068857_100090897 Ga0068857_1000908972 265
983 3300005834 Ga0068851_10017442 Ga0068851_100174422 265
984 3300005844 Ga0068862_100022834 Ga0068862_1000228342 265
985 3300006353 Ga0075370_10002554 Ga0075370_100025545 265
986 3300006358 Ga0068871_100138148 Ga0068871_1001381482 265
987 3300007076 Ga0075435_100279155 Ga0075435_1002791552 265
988 3300009036 Ga0105244_10001068 Ga0105244_1000106817 265
989 3300009093 Ga0105240_10144231 Ga0105240_101442311 265
990 3300009098 Ga0105245_10421948 Ga0105245_104219482 265
991 3300009147 Ga0114129_10762120 Ga0114129_107621202 265
992 3300009148 Ga0105243_10006060 Ga0105243_100060606 265
993 3300009148 Ga0105243_10021169 Ga0105243_100211694 265
994 3300009176 Ga0105242_10565779 Ga0105242_105657792 265
995 3300009551 Ga0105238_10352687 Ga0105238_103526872 265
996 3300011119 Ga0105246_10128148 Ga0105246_101281482 265
997 3300013100 Ga0157373_10056447 Ga0157373_100564472 265
998 3300013102 Ga0157371_10143197 Ga0157371_101431972 265
999 3300013104 Ga0157370_10208125 Ga0157370_102081252 265
1000 3300013307 Ga0157372_10129925 Ga0157372_101299253 265
1001 3300014497 Ga0182008_10010926 Ga0182008_100109262 265
1002 3300015261 Ga0182006_1007361 Ga0182006_10073612 265
1003 3300015262 Ga0182007_10006499 Ga0182007_100064993 265
1004 3300017792 Ga0163161_10001326 Ga0163161_100013269 265
1005 3300025208 Ga0209436_103221 Ga0209436_1032213 265
1006 3300025228 Ga0209672_100709 Ga0209672_10070910 265
1007 3300025229 Ga0209147_100791 Ga0209147_1007913 265
1008 3300025242 Ga0209258_100015 Ga0209258_100015145 265
1009 3300025245 Ga0207425_1000234 Ga0207425_100023419 265
1010 3300025245 Ga0207425_1031360 Ga0207425_10313602 265
1011 3300025254 Ga0209148_1000028 Ga0209148_1000028523 265
1012 3300025258 Ga0209129_1000049 Ga0209129_1000049151 265
1013 3300025258 Ga0209129_1001507 Ga0209129_10015075 265
1014 3300025258 Ga0209129_1005188 Ga0209129_10051883 265
1015 3300025258 Ga0209129_1022639 Ga0209129_10226392 265
1016 3300025263 Ga0209565_1000108 Ga0209565_10001082 265
1017 3300025263 Ga0209565_1001765 Ga0209565_10017656 265
1018 3300025273 Ga0209673_1000477 Ga0209673_100047738 265
1019 3300025273 Ga0209673_1000817 Ga0209673_10008172 265
1020 3300025284 Ga0209130_1000267 Ga0209130_100026726 265
1021 3300025284 Ga0209130_1003292 Ga0209130_10032925 265
1022 3300025291 Ga0209675_1002545 Ga0209675_10025455 265
1023 3300025291 Ga0209675_1007207 Ga0209675_10072073 265
1024 3300025292 Ga0209676_1000137 Ga0209676_100013731 265
1025 3300025294 Ga0209025_1000409 Ga0209025_100040946 265
1026 3300025294 Ga0209025_1000481 Ga0209025_100048149 265
1027 3300025294 Ga0209025_1000707 Ga0209025_100070727 265
1028 3300025294 Ga0209025_1012348 Ga0209025_10123483 265
1029 3300025295 Ga0209564_1000232 Ga0209564_10002322 265
1030 3300025295 Ga0209564_1001382 Ga0209564_100138222 265
1031 3300025297 Ga0209758_1000135 Ga0209758_100013526 265
1032 3300025297 Ga0209758_1004899 Ga0209758_10048997 265
1033 3300025298 Ga0209050_1000015 Ga0209050_1000015149 265
1034 3300025299 Ga0209256_1000129 Ga0209256_100012926 265
1035 3300025299 Ga0209256_1000604 Ga0209256_100060423 265
1036 3300025302 Ga0207426_1000171 Ga0207426_100017126 265
1037 3300025302 Ga0207426_1000185 Ga0207426_100018525 265
1038 3300025303 Ga0209051_1000010 Ga0209051_1000010149 265
1039 3300025304 Ga0209257_1000026 Ga0209257_1000026529 265
1040 3300025304 Ga0209257_1008011 Ga0209257_10080115 265
1041 3300025321 Ga0207656_10009748 Ga0207656_100097483 265
1042 3300025728 Ga0207655_1000800 Ga0207655_100080025 265
1043 3300025728 Ga0207655_1026744 Ga0207655_10267443 265
1044 3300025910 Ga0207684_10183333 Ga0207684_101833332 265
1045 3300025922 Ga0207646_10084059 Ga0207646_100840593 265
1046 3300025927 Ga0207687_10372468 Ga0207687_103724682 265
1047 3300025933 Ga0207706_10037043 Ga0207706_100370432 265
1048 3300025933 Ga0207706_10113113 Ga0207706_101131132 265
1049 3300025935 Ga0207709_10000947 Ga0207709_1000094716 265
1050 3300025935 Ga0207709_10003037 Ga0207709_100030378 265
1051 3300025935 Ga0207709_10115494 Ga0207709_101154942 265
1052 3300025945 Ga0207679_10023598 Ga0207679_100235983 265
1053 3300026041 Ga0207639_10507204 Ga0207639_105072042 265
1054 3300026116 Ga0207674_10046630 Ga0207674_100466302 265
1055 3300026142 Ga0207698_10149167 Ga0207698_101491672 265
1056 3300028380 Ga0268265_10367294 Ga0268265_103672942 265
1057 3300032005 Ga0307411_10359887 Ga0307411_103598872 265
1058 3300046453 Ga0495627_008697 Ga0495627_008697_104_904 265
1059 3300046460 Ga0495638_0027048 Ga0495638_0027048_2316_3113 265
1060 3300046512 Ga0495610_0027885 Ga0495610_0027885_749_1546 265
1061 3300046513 Ga0495616_0002945 Ga0495616_0002945_6191_6988 265
1062 3300046515 Ga0495620_0008624 Ga0495620_0008624_1396_2196 265
1063 3300046518 Ga0495631_0000456 Ga0495631_0000456_3360_4157 265
1064 3300046520 Ga0495637_0046610 Ga0495637_0046610_783_1583 265
1065 3300046660 Ga0495625_0030716 Ga0495625_0030716_2317_3114 265
1066 3300046674 Ga0495588_0070939 Ga0495588_0070939_548_1345 265
1067 3300046692 Ga0495671_0002111 Ga0495671_0002111_10458_11258 265
1068 3300047321 Ga0495676_0012661 Ga0495676_0012661_2517_3314 265
1069 3300048088 Ga0495602_0118521 Ga0495602_0118521_174_971 265
1070 3300048089 Ga0495614_0016039 Ga0495614_0016039_284_1081 265
1071 3300048904 Ga0496101_0024551 Ga0496101_0024551_3218_4021 265
1072 3300048905 Ga0496102_0496629 Ga0496102_0496629_106_903 265
1073 3300048920 Ga0496117_0037659 Ga0496117_0037659_26_823 265
1074 3300048921 Ga0496118_0024266 Ga0496118_0024266_4227_5024 265
1075 3300048922 Ga0496119_0060375 Ga0496119_0060375_192_989 265
1076 3300048924 Ga0496121_0080306 Ga0496121_0080306_864_1661 265
1077 3300048925 Ga0496122_0149154 Ga0496122_0149154_144_941 265
1078 3300050496 nmdc:mga07m45_3294_c1 nmdc:mga07m45_3294_c1_2765_3562 265
1079 3300053079 Ga0500610_0000432 Ga0500610_0000432_3341_4141 265
1080 3300053079 Ga0500610_0037825 Ga0500610_0037825_1040_1840 265
1081 3300053087 Ga0500643_065210 Ga0500643_065210_98_898 265
1082 3300053093 Ga0500651_0000674 Ga0500651_0000674_12982_13779 265
1083 3300053094 Ga0500566_0015702 Ga0500566_0015702_631_1428 265
1084 3300053108 Ga0500562_035297 Ga0500562_035297_349_1146 265
1085 3300053109 Ga0500569_010596 Ga0500569_010596_1022_1822 265
1086 3300053110 Ga0500571_000095 Ga0500571_000095_24739_25536 265
1087 3300053117 Ga0500593_003564 Ga0500593_003564_2183_2983 265
1088 3300053121 Ga0500607_001138 Ga0500607_001138_3283_4083 265
1089 3300053128 Ga0500626_027119 Ga0500626_027119_1553_2350 265
1090 3300053133 Ga0500655_000461 Ga0500655_000461_1165_1962 265
1091 3300053134 Ga0500658_0000346 Ga0500658_0000346_17423_18220 265
1092 3300053134 Ga0500658_0000347 Ga0500658_0000347_2440_3237 265
1093 3300053136 Ga0500559_0018726 Ga0500559_0018726_1278_2075 265
1094 3300053138 Ga0500564_043043 Ga0500564_043043_707_1504 265
1095 3300053139 Ga0500568_0001897 Ga0500568_0001897_10454_11251 265
1096 3300053141 Ga0500574_001944 Ga0500574_001944_2321_3118 265
1097 3300053158 Ga0500627_0005799 Ga0500627_0005799_450_1250 265
1098 3300053177 Ga0500636_0012547 Ga0500636_0012547_2947_3744 265
1099 3300001979 JGI24740J21852_10007287 JGI24740J21852_100072876 266
1100 3300001989 JGI24739J22299_10039342 JGI24739J22299_100393422 266
1101 3300003781 Ga0055536_1002527 Ga0055536_10025277 266
1102 3300003792 Ga0055540_1001968 Ga0055540_10019683 266
1103 3300005842 Ga0068858_100015852 Ga0068858_1000158524 266
1104 3300009148 Ga0105243_10002419 Ga0105243_100024193 266
1105 3300014968 Ga0157379_10020325 Ga0157379_100203252 266
1106 3300025292 Ga0209676_1001273 Ga0209676_100127312 266
1107 3300025303 Ga0209051_1000556 Ga0209051_100055619 266
1108 3300025935 Ga0207709_10000461 Ga0207709_1000046116 266
1109 3300025981 Ga0207640_10169512 Ga0207640_101695122 266
1110 3300026035 Ga0207703_10007336 Ga0207703_100073363 266
1111 3300026041 Ga0207639_10023597 Ga0207639_100235974 266
1112 3300026116 Ga0207674_10021721 Ga0207674_100217214 266
1113 3300031911 Ga0307412_10009434 Ga0307412_100094343 266
1114 3300046530 Ga0495654_0127582 Ga0495654_0127582_232_1035 266
1115 3300046538 Ga0495609_0115887 Ga0495609_0115887_174_977 266
1116 3300048921 Ga0496118_0031202 Ga0496118_0031202_385_1185 266
1117 3300048926 Ga0496123_0024156 Ga0496123_0024156_416_1252 266
1118 3300048928 Ga0496125_0021233 Ga0496125_0021233_3068_3868 266
1119 3300050496 nmdc:mga07m45_8034_c1 nmdc:mga07m45_8034_c1_1189_1992 266
1120 3300053121 Ga0500607_008952 Ga0500607_008952_4360_5193 266
1121 3300053122 Ga0500608_145979 Ga0500608_145979_152_985 266
1122 3300053735 Ga0500596_016569 Ga0500596_016569_238_1071 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

42

200

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.8977 12 235
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.8876 12 235
4jbw-assembly1.cif.gz_A crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8765 12 235
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.8669 9 233
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.8652 9 232
ID Description Score Start End Superfamily
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9345 9 246 3.40.50.300
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9269 9 246 3.40.50.300
af_P0AAG8_265_500_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9234 12 241 3.40.50.300
af_P0AAF3_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9201 9 246 3.40.50.300
af_Q6BEX0_1_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9184 1 246 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A833G3H7-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9492 9 247 GO:0005524
GO:0016887
AF-A0A5Q2TP82-F1-model_v4 ATP-binding cassette domain-containing protein 0.9435 8 247 GO:0005524
GO:0015611
GO:0016887
AF-A0A7C6M782-F1-model_v4 deleted 0.9429 10 247
AF-A0A349NBL0-F1-model_v4 Sugar ABC transporter 0.9426 15 247 GO:0005524
GO:0016887
AF-A0A1V5TAC4-F1-model_v4 Ribose import ATP-binding protein RbsA (EC 3.6.3.17) 0.9421 7 246 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
82.02 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map