F490418

General Info

Members Datasets Scaffolds Average Seq Length
1122 500 1046 257

Family's Representative Sequence

Representative Sequence 3300015265|Ga0182005_1025595|Ga0182005_10255952
Length 311
Sequence VDNGGGKRRAQRVAGPSSCAAPAAERALARRDWPSRLATVKIPVGRPVTDFPLKIASWNVNSLNVRLPHLQQWLEAFAPDVVGIQETKLEDHKFPDAALAAAGYRSVFAGQKTYNGVAILSRAPASDVQIGVRGLDDEQKRVIAATVGDLRIVNLYVVNGQDVGTDKYAYKLRWLEAVHDWLAAELQRHPRMVVLGDFNIAPDARDVYDPLVWSDNHILTSTAERGALHKLQALGLHDGFRLHHDDGGIFSWWDYRQAGFRRDLGLRIDLTLVSDALKAQTRAAGIDREPRTWDRPSDHAPAWIELGEGGA

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
3 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
4 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
5 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
6 2643221559 Lysobacter sp. Root559 Isolate Unclassified
7 2643221569 Achromobacter sp. Root565 Isolate Unclassified
8 2643221573 Lysobacter sp. Root604 Isolate Unclassified
9 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
10 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
11 2643221586 Lysobacter sp. Root667 Isolate Unclassified
12 2643221593 Lysobacter sp. Root690 Isolate Unclassified
13 2643221594 Achromobacter sp. Root170 Isolate Unclassified
14 2643221612 Lysobacter sp. Root76 Isolate Unclassified
15 2643221621 Achromobacter sp. Root83 Isolate Unclassified
16 2643221638 Duganella sp. Root336D2 Isolate Unclassified
17 2643221720 Lysobacter sp. Root916 Isolate Unclassified
18 2643221727 Lysobacter sp. Root96 Isolate Unclassified
19 2643221728 Lysobacter sp. Root983 Isolate Unclassified
20 2738543009 Luteibacter sp. OK325 Isolate Unclassified
21 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
22 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
23 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
24 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
25 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
26 2818991457 Xanthomonas translucens 569 Isolate Unclassified
27 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
28 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
29 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
30 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
31 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
32 2855730933 Achromobacter sp. HZ28 Isolate Nodule
33 2855767633 Achromobacter sp. HZ34 Isolate Nodule
34 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
35 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
36 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
37 2858950400 Achromobacter sp. K91 Isolate Unclassified
38 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
39 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
40 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
41 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
42 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
43 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
44 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
45 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
46 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
47 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
48 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
49 2919513703 Luteimonas sp. 3794 Isolate Unclassified
50 2919675420 Luteimonas terrae 4099 Isolate Unclassified
51 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
52 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
53 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
54 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
55 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
56 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
57 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
58 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
59 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
60 2941479691
61 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
62 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
63 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
64 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
65 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
66 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
67 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
68 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
69 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
70 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
71 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
72 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
73 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
74 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
75 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
76 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
77 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
78 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
79 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
80 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
81 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
82 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
83 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
84 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
85 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
86 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
87 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
88 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
89 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
90 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
91 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
92 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
93 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
94 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
95 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
96 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
97 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
98 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
99 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
100 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
101 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
102 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
103 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
104 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
105 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
106 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
107 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
108 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
109 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
110 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
111 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
112 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
113 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
114 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
115 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
116 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
117 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
118 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
119 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
120 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
121 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
122 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
123 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
124 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
125 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
126 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
127 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
128 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
129 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
130 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
131 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
132 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
133 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
134 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
135 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
136 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
137 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
138 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
139 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
140 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
141 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
142 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
143 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
144 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
145 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
146 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
147 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
148 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
149 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
150 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
151 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
152 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
153 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
154 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
155 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
156 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
157 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
158 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
159 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
160 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
161 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
162 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
163 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
164 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
165 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
166 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
167 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
168 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
169 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
170 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
171 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
172 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
173 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
174 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
175 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
176 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
177 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
178 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
179 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
180 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
181 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
182 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
183 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
184 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
185 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
186 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
187 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
188 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
189 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
190 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
191 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
192 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
193 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
194 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
195 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
196 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
197 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
198 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
199 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
200 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
202 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
203 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
204 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
208 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
211 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
213 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
216 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
284 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
288 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
289 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
290 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
291 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
292 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
293 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
294 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
295 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
296 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
297 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
298 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
299 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
300 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
301 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
302 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
303 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
304 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
305 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
306 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
307 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
308 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
309 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
310 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
311 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
312 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
314 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
315 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
316 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
317 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
318 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
319 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
320 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
321 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
322 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
323 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
324 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
325 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
326 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
327 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
328 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
329 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
330 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
331 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
332 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
333 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
334 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
335 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
336 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
337 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
338 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
339 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
340 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
341 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
342 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
343 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
344 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
345 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
346 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
347 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
348 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
349 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
350 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
351 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
352 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
353 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
354 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
355 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
356 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
357 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
358 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
359 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
360 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
361 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
362 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
363 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
364 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
365 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
366 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
367 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
368 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
369 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
370 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
371 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
372 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
373 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
374 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
375 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
376 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
377 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
378 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
379 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
380 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
381 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
382 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
383 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
384 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
385 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
386 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
387 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
388 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
389 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
390 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
391 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
392 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
393 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
394 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
395 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
396 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
397 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
398 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
399 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
400 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
401 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
402 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
403 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
404 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
405 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
406 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
407 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
408 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
409 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
410 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
411 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
412 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
413 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
414 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
415 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
416 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
417 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
418 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
419 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
420 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
421 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
422 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
423 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
424 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
425 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
426 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
427 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
428 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
429 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
430 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
431 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
432 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
433 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
434 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
435 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
436 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
437 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
438 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
439 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
440 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
441 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
442 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
443 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
444 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
445 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
446 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
447 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
448 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
449 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
463 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
464 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
465 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
466 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
467 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
468 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
469 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
470 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
471 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
472 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
473 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
474 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
475 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
476 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
478 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
479 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
480 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
481 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
482 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
483 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
484 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
485 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
486 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
487 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
488 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
489 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
490 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
491 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
492 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
493 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
494 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
495 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
496 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
497 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
498 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
499 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
500 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.14
Metatranscriptomes 0.09
Isolates 6.77

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 13.99
Nodule 0.36
Rhizoplane 3.3
Rhizosphere 71.57
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1024077 3300001904 Bacteria 950
2 JGI24743J22301_10004704 3300001991 Bacteria 2239
3 JGI25158J39367_1000920 3300002739 Bacteria 5507
4 JGI25152J39213_1000038 3300002773 Bacteria 91482
5 JGI25152J39213_1000193 3300002773 Bacteria 41047
6 JGI25152J39213_1004366 3300002773 Bacteria 4476
7 JGI25150J39212_1000750 3300002774 Bacteria 11391
8 JGI25150J39212_1000853 3300002774 Bacteria 10154
9 JGI25150J39212_1018475 3300002774 Bacteria 1108
10 JGI25159J45721_1003984 3300002987 Bacteria 5031
11 JGI25151J46595_10000088 3300003187 Bacteria 124209
12 JGI25151J46595_10000150 3300003187 Bacteria 91486
13 JGI25151J46595_10000301 3300003187 Bacteria 54192
14 JGI25153J46596_10000114 3300003215 Bacteria 91486
15 JGI25153J46596_10030078 3300003215 Bacteria 1854
16 rootH2_10001820 3300003320 Bacteria 8737
17 JGI25161J50226_1000297 3300003374 Bacteria 28038
18 Ga0055529_1000732 3300003763 Bacteria 21350
19 Ga0055526_1000004 3300003771 Bacteria 355037
20 Ga0055526_1000814 3300003771 Bacteria 23259
21 Ga0055526_1001727 3300003771 Bacteria 15205
22 Ga0055526_1010633 3300003771 Bacteria 4255
23 Ga0055526_1023336 3300003771 Bacteria 2068
24 Ga0055537_1000895 3300003773 Bacteria 14128
25 Ga0055537_1000989 3300003773 Bacteria 12883
26 Ga0055537_1001624 3300003773 Bacteria 8437
27 Ga0055537_1013448 3300003773 Bacteria 1536
28 Ga0055537_1014085 3300003773 Bacteria 1467
29 Ga0055524_1000004 3300003775 Bacteria 354710
30 Ga0055524_1000643 3300003775 Bacteria 24836
31 Ga0055524_1001633 3300003775 Bacteria 12501
32 Ga0055524_1002234 3300003775 Bacteria 10139
33 Ga0055524_1007359 3300003775 Bacteria 4684
34 Ga0055524_1009812 3300003775 Bacteria 3861
35 Ga0055536_1001019 3300003781 Bacteria 17763
36 Ga0055536_1004649 3300003781 Bacteria 6942
37 Ga0055536_1005039 3300003781 Bacteria 6562
38 Ga0055536_1005666 3300003781 Bacteria 6041
39 Ga0055534_1000011 3300003784 Bacteria 168909
40 Ga0055534_1000307 3300003784 Bacteria 32970
41 Ga0055534_1002504 3300003784 Bacteria 6313
42 Ga0055534_1018663 3300003784 Bacteria 1203
43 Ga0055528_1000015 3300003790 Bacteria 169011
44 Ga0055528_1000402 3300003790 Bacteria 35107
45 Ga0055528_1015545 3300003790 Bacteria 2744
46 Ga0055530_10000735 3300003791 Bacteria 27312
47 Ga0055530_10001900 3300003791 Bacteria 14312
48 Ga0055530_10002434 3300003791 Bacteria 12018
49 Ga0055530_10002970 3300003791 Bacteria 10204
50 Ga0055530_10003788 3300003791 Bacteria 8335
51 Ga0055531_10000957 3300003794 Bacteria 23173
52 Ga0055531_10004989 3300003794 Bacteria 7873
53 Ga0055531_10009018 3300003794 Bacteria 5157
54 Ga0055531_10012636 3300003794 Bacteria 3958
55 Ga0055531_10018072 3300003794 Bacteria 2933
56 Ga0055531_10031237 3300003794 Bacteria 1767
57 Ga0058692_1000004 3300003856 Bacteria 431119
58 Ga0058692_1000081 3300003856 Bacteria 69376
59 Ga0055543_1000252 3300004625 Bacteria 40605
60 Ga0065165_1001171 3300005262 Bacteria 30471
61 Ga0065704_10003668 3300005289 Bacteria 4826
62 Ga0065704_10078390 3300005289 Bacteria 4443
63 Ga0065704_10108682 3300005289 Bacteria 2022
64 Ga0065704_10261491 3300005289 Bacteria 964
65 Ga0065715_10092369 3300005293 Bacteria 5159
66 Ga0065715_10176008 3300005293 Bacteria 1511
67 Ga0070658_10002650 3300005327 Bacteria 14885
68 Ga0070658_10165102 3300005327 Bacteria 1859
69 Ga0070676_10001120 3300005328 Bacteria 13380
70 Ga0070676_10189132 3300005328 Bacteria 1343
71 Ga0070683_100285066 3300005329 Bacteria 1571
72 Ga0070690_100005180 3300005330 Bacteria 7299
73 Ga0070670_100003557 3300005331 Bacteria 12962
74 Ga0070670_100003888 3300005331 Bacteria 12457
75 Ga0070670_100010975 3300005331 Bacteria 7738
76 Ga0070670_100054519 3300005331 Bacteria 3433
77 Ga0070670_100151556 3300005331 Bacteria 2006
78 Ga0070670_100441955 3300005331 Bacteria 1152
79 Ga0068869_100006084 3300005334 Bacteria 7629
80 Ga0068869_100040635 3300005334 Bacteria 3327
81 Ga0070666_10000577 3300005335 Bacteria 22209
82 Ga0070666_10020409 3300005335 Bacteria 4283
83 Ga0070680_100314196 3300005336 Bacteria 1330
84 Ga0070682_100443507 3300005337 Bacteria 992
85 Ga0068868_100025585 3300005338 Bacteria 4492
86 Ga0068868_100185175 3300005338 Bacteria 1729
87 Ga0068868_100278767 3300005338 Bacteria 1414
88 Ga0070660_100047843 3300005339 Bacteria 3283
89 Ga0070689_100002618 3300005340 Bacteria 11788
90 Ga0070691_10025785 3300005341 Bacteria 2739
91 Ga0070687_100145626 3300005343 Bacteria 1384
92 Ga0070661_100005508 3300005344 Bacteria 8727
93 Ga0070661_100016100 3300005344 Bacteria 5277
94 Ga0070661_100026513 3300005344 Bacteria 4168
95 Ga0070661_100043597 3300005344 Bacteria 3276
96 Ga0070661_100159092 3300005344 Bacteria 1710
97 Ga0070692_10051008 3300005345 Bacteria 2151
98 Ga0070668_100002646 3300005347 Bacteria 13158
99 Ga0070668_100007344 3300005347 Bacteria 8172
100 Ga0070668_100093516 3300005347 Bacteria 2373
101 Ga0070668_100514772 3300005347 Bacteria 1037
102 Ga0070669_100008575 3300005353 Bacteria 7297
103 Ga0070671_100297102 3300005355 Bacteria 1375
104 Ga0070671_100385743 3300005355 Bacteria 1198
105 Ga0070674_100032045 3300005356 Bacteria 3489
106 Ga0070674_100061491 3300005356 Bacteria 2621
107 Ga0070674_100368122 3300005356 Bacteria 1166
108 Ga0070673_100083000 3300005364 Bacteria 2602
109 Ga0070673_100134766 3300005364 Bacteria 2077
110 Ga0070673_100268745 3300005364 Bacteria 1492
111 Ga0070688_100002518 3300005365 Bacteria 9269
112 Ga0070659_100058852 3300005366 Bacteria 3033
113 Ga0070667_100000093 3300005367 Bacteria 111322
114 Ga0070667_100016502 3300005367 Bacteria 6112
115 Ga0070667_100021576 3300005367 Bacteria 5345
116 Ga0070667_100087528 3300005367 Bacteria 2673
117 Ga0070667_100179755 3300005367 Bacteria 1871
118 Ga0070711_100135372 3300005439 Bacteria 1841
119 Ga0070700_100009560 3300005441 Bacteria 5328
120 Ga0070663_100000074 3300005455 Bacteria 43680
121 Ga0070663_100007006 3300005455 Bacteria 6828
122 Ga0070663_100039692 3300005455 Bacteria 3291
123 Ga0070663_100045216 3300005455 Bacteria 3109
124 Ga0070663_100063642 3300005455 Bacteria 2664
125 Ga0070663_100250283 3300005455 Bacteria 1402
126 Ga0070678_100000776 3300005456 Bacteria 15999
127 Ga0070678_100011104 3300005456 Bacteria 5540
128 Ga0070678_100076617 3300005456 Bacteria 2520
129 Ga0070678_100149965 3300005456 Bacteria 1877
130 Ga0070678_100175284 3300005456 Bacteria 1750
131 Ga0070662_100001663 3300005457 Bacteria 13677
132 Ga0070662_100014449 3300005457 Bacteria 5277
133 Ga0070681_10000243 3300005458 Bacteria 43157
134 Ga0070681_10063074 3300005458 Bacteria 3679
135 Ga0068867_100077114 3300005459 Bacteria 2504
136 Ga0068867_100099611 3300005459 Bacteria 2218
137 Ga0068867_100218592 3300005459 Bacteria 1534
138 Ga0070685_10003579 3300005466 Bacteria 7889
139 Ga0070679_100159767 3300005530 Bacteria 2228
140 Ga0070684_100133713 3300005535 Bacteria 2239
141 Ga0070684_100194648 3300005535 Bacteria 1846
142 Ga0070684_100596506 3300005535 Bacteria 1027
143 Ga0068853_100000578 3300005539 Bacteria 25023
144 Ga0068853_100021814 3300005539 Bacteria 5343
145 Ga0068853_100054059 3300005539 Bacteria 3460
146 Ga0068853_100129864 3300005539 Bacteria 2255
147 Ga0068853_100184051 3300005539 Bacteria 1895
148 Ga0068853_100279156 3300005539 Bacteria 1540
149 Ga0070672_100003822 3300005543 Bacteria 9810
150 Ga0070672_100005243 3300005543 Bacteria 8578
151 Ga0070672_100180021 3300005543 Bacteria 1761
152 Ga0070686_100055974 3300005544 Bacteria 2528
153 Ga0070695_100157790 3300005545 Bacteria 1590
154 Ga0070696_100018733 3300005546 Bacteria 4683
155 Ga0070696_100132180 3300005546 Bacteria 1817
156 Ga0070693_100000509 3300005547 Bacteria 17435
157 Ga0070693_100082494 3300005547 Bacteria 1919
158 Ga0070693_100100654 3300005547 Bacteria 1760
159 Ga0070665_100007229 3300005548 Bacteria 11280
160 Ga0070665_100109232 3300005548 Bacteria 2768
161 Ga0070665_100111864 3300005548 Bacteria 2733
162 Ga0070665_100187628 3300005548 Bacteria 2068
163 Ga0070665_100635149 3300005548 Bacteria 1081
164 Ga0068855_100004536 3300005563 Bacteria 16966
165 Ga0068855_100009173 3300005563 Bacteria 11948
166 Ga0068855_100040398 3300005563 Bacteria 5537
167 Ga0068855_100313357 3300005563 Bacteria 1735
168 Ga0068855_100335328 3300005563 Bacteria 1669
169 Ga0068855_100337440 3300005563 Bacteria 1663
170 Ga0068855_100379273 3300005563 Bacteria 1553
171 Ga0070664_100010274 3300005564 Bacteria 7593
172 Ga0070664_100194393 3300005564 Bacteria 1808
173 Ga0070664_100209492 3300005564 Bacteria 1742
174 Ga0068857_100061469 3300005577 Bacteria 3337
175 Ga0068854_100001301 3300005578 Bacteria 15042
176 Ga0068854_100011907 3300005578 Bacteria 5683
177 Ga0068854_100027976 3300005578 Bacteria 3891
178 Ga0068854_100048656 3300005578 Bacteria 3026
179 Ga0068854_100277202 3300005578 Bacteria 1349
180 Ga0068856_100018818 3300005614 Bacteria 6697
181 Ga0068856_100044064 3300005614 Bacteria 4390
182 Ga0068856_100129659 3300005614 Bacteria 2526
183 Ga0068856_100443287 3300005614 Bacteria 1319
184 Ga0070702_100001462 3300005615 Bacteria 9684
185 Ga0070702_100066305 3300005615 Bacteria 2116
186 Ga0068852_100026922 3300005616 Bacteria 4681
187 Ga0068852_100028348 3300005616 Bacteria 4581
188 Ga0068852_100118919 3300005616 Bacteria 2415
189 Ga0068859_100000070 3300005617 Bacteria 94311
190 Ga0068859_100012026 3300005617 Bacteria 8695
191 Ga0068859_100190722 3300005617 Bacteria 2134
192 Ga0068864_100125069 3300005618 Bacteria 2303
193 Ga0068864_100227982 3300005618 Bacteria 1722
194 Ga0068864_100292975 3300005618 Bacteria 1521
195 Ga0068866_10009679 3300005718 Bacteria 4102
196 Ga0068866_10071179 3300005718 Bacteria 1838
197 Ga0068866_10113996 3300005718 Bacteria 1513
198 Ga0068851_10001563 3300005834 Bacteria 10045
199 Ga0068851_10006025 3300005834 Bacteria 5526
200 Ga0068851_10081987 3300005834 Bacteria 1686
201 Ga0068851_10139577 3300005834 Bacteria 1317
202 Ga0068870_10291551 3300005840 Bacteria 1027
203 Ga0068863_100010036 3300005841 Bacteria 9215
204 Ga0068863_100164046 3300005841 Bacteria 2130
205 Ga0068858_100000804 3300005842 Bacteria 32891
206 Ga0068858_100110461 3300005842 Bacteria 2567
207 Ga0068858_100260631 3300005842 Bacteria 1648
208 Ga0068858_100493402 3300005842 Bacteria 1183
209 Ga0068860_100106820 3300005843 Bacteria 2674
210 Ga0068860_100197464 3300005843 Bacteria 1949
211 Ga0068860_100271980 3300005843 Bacteria 1654
212 Ga0068860_100381518 3300005843 Bacteria 1391
213 Ga0068862_100000041 3300005844 Bacteria 166801
214 Ga0068862_100369154 3300005844 Bacteria 1335
215 Ga0081455_10120705 3300005937 Bacteria 2066
216 Ga0075365_10007996 3300006038 Bacteria 5968
217 Ga0075364_10000485 3300006051 Bacteria 20180
218 Ga0075364_10001168 3300006051 Bacteria 14075
219 Ga0075364_10022082 3300006051 Bacteria 4016
220 Ga0075364_10055881 3300006051 Bacteria 2584
221 Ga0075364_10082547 3300006051 Bacteria 2126
222 Ga0075364_10179337 3300006051 Bacteria 1433
223 Ga0075362_10047354 3300006177 Bacteria 1915
224 Ga0075367_10031717 3300006178 Bacteria 3036
225 Ga0075369_10054283 3300006186 Bacteria 1740
226 Ga0075366_10169232 3300006195 Bacteria 1326
227 Ga0097621_100007318 3300006237 Bacteria 7889
228 Ga0097621_100151269 3300006237 Bacteria 1990
229 Ga0068871_100013081 3300006358 Bacteria 6152
230 Ga0068871_100119672 3300006358 Bacteria 2223
231 Ga0068871_100165938 3300006358 Bacteria 1890
232 Ga0068871_100266055 3300006358 Bacteria 1497
233 Ga0075428_100019227 3300006844 Bacteria 7555
234 Ga0068865_100011567 3300006881 Bacteria 5529
235 Ga0068865_100044347 3300006881 Bacteria 3043
236 Ga0068865_100113766 3300006881 Bacteria 2000
237 Ga0097620_100000070 3300006931 Bacteria 94311
238 Ga0097620_100012024 3300006931 Bacteria 8695
239 Ga0097620_100190723 3300006931 Bacteria 2134
240 Ga0105251_10000008 3300009011 Bacteria 213669
241 Ga0105251_10002580 3300009011 Bacteria 14054
242 Ga0105244_10021705 3300009036 Bacteria 3546
243 Ga0105240_10000992 3300009093 Bacteria 50667
244 Ga0105240_10001714 3300009093 Bacteria 37013
245 Ga0105240_10014134 3300009093 Bacteria 10907
246 Ga0105240_10769215 3300009093 Bacteria 1045
247 Ga0111539_10006771 3300009094 Bacteria 14748
248 Ga0111539_10827245 3300009094 Bacteria 1077
249 Ga0105245_10019996 3300009098 Bacteria 5868
250 Ga0105245_10034912 3300009098 Bacteria 4462
251 Ga0105245_10202139 3300009098 Bacteria 1908
252 Ga0105245_10369068 3300009098 Bacteria 1426
253 Ga0105247_10027332 3300009101 Bacteria 3451
254 Ga0105243_10061151 3300009148 Bacteria 3011
255 Ga0105243_10116950 3300009148 Bacteria 2240
256 Ga0105241_10072522 3300009174 Bacteria 2677
257 Ga0105241_10435173 3300009174 Bacteria 1157
258 Ga0105242_10009006 3300009176 Bacteria 7667
259 Ga0105242_10024319 3300009176 Bacteria 4783
260 Ga0105242_10188148 3300009176 Bacteria 1826
261 Ga0105242_10292505 3300009176 Bacteria 1484
262 Ga0105248_10000248 3300009177 Bacteria 62700
263 Ga0105248_10006632 3300009177 Bacteria 12692
264 Ga0105248_10069552 3300009177 Bacteria 3952
265 Ga0105248_10120284 3300009177 Bacteria 2963
266 Ga0105248_10149591 3300009177 Bacteria 2634
267 Ga0105248_10552135 3300009177 Bacteria 1299
268 Ga0105237_10002027 3300009545 Bacteria 25765
269 Ga0105237_10011873 3300009545 Bacteria 9209
270 Ga0105237_10012838 3300009545 Bacteria 8807
271 Ga0105237_10159926 3300009545 Bacteria 2251
272 Ga0105238_10131137 3300009551 Bacteria 2484
273 Ga0105238_10684490 3300009551 Bacteria 1037
274 Ga0105249_10000461 3300009553 Bacteria 37943
275 Ga0105249_10002353 3300009553 Bacteria 16430
276 Ga0105249_10313365 3300009553 Bacteria 1578
277 Ga0105249_10347126 3300009553 Bacteria 1502
278 Ga0105032_100625 3300009979 Bacteria 3468
279 Ga0105028_100958 3300009993 Bacteria 3036
280 Ga0105239_10003209 3300010375 Bacteria 20221
281 Ga0105239_10011170 3300010375 Bacteria 10020
282 Ga0105239_10037420 3300010375 Bacteria 5319
283 Ga0105239_10564802 3300010375 Bacteria 1296
284 Ga0105246_10043071 3300011119 Bacteria 3061
285 Ga0105246_10102369 3300011119 Bacteria 2088
286 Ga0105246_10734917 3300011119 Bacteria 869
287 Ga0157324_1005182 3300012506 Bacteria 933
288 Ga0157373_10007795 3300013100 Bacteria 7960
289 Ga0157373_10059492 3300013100 Bacteria 2707
290 Ga0157373_10222618 3300013100 Bacteria 1331
291 Ga0157371_10009777 3300013102 Bacteria 7522
292 Ga0157371_10059570 3300013102 Bacteria 2707
293 Ga0157370_10005233 3300013104 Bacteria 14593
294 Ga0157370_10026814 3300013104 Bacteria 5684
295 Ga0157370_10072516 3300013104 Bacteria 3249
296 Ga0157370_10135275 3300013104 Bacteria 2298
297 Ga0157370_10295486 3300013104 Bacteria 1496
298 Ga0157370_10803634 3300013104 Bacteria 856
299 Ga0157369_10157246 3300013105 Bacteria 2400
300 Ga0157369_10165287 3300013105 Bacteria 2334
301 Ga0157369_10231428 3300013105 Bacteria 1932
302 Ga0157374_10024579 3300013296 Bacteria 5402
303 Ga0157374_10089761 3300013296 Bacteria 2929
304 Ga0157378_10000266 3300013297 Bacteria 50836
305 Ga0157378_10018161 3300013297 Bacteria 6176
306 Ga0163162_10026275 3300013306 Bacteria 5754
307 Ga0163162_10030151 3300013306 Bacteria 5374
308 Ga0163162_10283861 3300013306 Bacteria 1787
309 Ga0163162_10801224 3300013306 Bacteria 1059
310 Ga0157372_10125621 3300013307 Bacteria 2949
311 Ga0157372_10172357 3300013307 Bacteria 2504
312 Ga0157372_10179320 3300013307 Bacteria 2452
313 Ga0157372_10215953 3300013307 Bacteria 2223
314 Ga0157372_10344230 3300013307 Bacteria 1737
315 Ga0157372_10483589 3300013307 Bacteria 1443
316 Ga0157372_10622088 3300013307 Bacteria 1258
317 Ga0157375_10000590 3300013308 Bacteria 32228
318 Ga0157375_10125276 3300013308 Bacteria 2683
319 Ga0157375_10205533 3300013308 Bacteria 2125
320 Ga0157375_10293737 3300013308 Bacteria 1788
321 Ga0157375_10330217 3300013308 Bacteria 1690
322 Ga0157375_10396353 3300013308 Bacteria 1547
323 Ga0157375_10660075 3300013308 Bacteria 1201
324 Ga0157380_10004314 3300014326 Bacteria 9862
325 Ga0157380_10385809 3300014326 Bacteria 1324
326 Ga0182008_10000913 3300014497 Bacteria 20555
327 Ga0182008_10006499 3300014497 Bacteria 6527
328 Ga0157377_10084001 3300014745 Bacteria 1867
329 Ga0157377_10404001 3300014745 Bacteria 931
330 Ga0157379_10015085 3300014968 Bacteria 6777
331 Ga0157379_10189035 3300014968 Bacteria 1861
332 Ga0157379_10295181 3300014968 Bacteria 1476
333 Ga0157376_10002766 3300014969 Bacteria 11972
334 Ga0157376_10006265 3300014969 Bacteria 8392
335 Ga0157376_10070955 3300014969 Bacteria 2958
336 Ga0157376_10156788 3300014969 Bacteria 2059
337 Ga0182006_1002721 3300015261 Bacteria 9478
338 Ga0182006_1039260 3300015261 Bacteria 1868
339 Ga0182006_1065963 3300015261 Bacteria 1354
340 Ga0182006_1069303 3300015261 Bacteria 1312
341 Ga0182007_10000019 3300015262 Bacteria 194770
342 Ga0182005_1004719 3300015265 Bacteria 4352
343 Ga0182005_1025595 3300015265 Bacteria 1610
344 Ga0182005_1084766 3300015265 Bacteria 877
345 Ga0183360_10004 3300015689 Bacteria 289992
346 Ga0163161_10022996 3300017792 Bacteria 4392
347 Ga0163161_10044710 3300017792 Bacteria 3191
348 Ga0163161_10079211 3300017792 Bacteria 2416
349 Ga0209436_100676 3300025208 Bacteria 14517
350 Ga0209672_102702 3300025228 Bacteria 4123
351 Ga0207425_1000017 3300025245 Bacteria 423851
352 Ga0207425_1000029 3300025245 Bacteria 268521
353 Ga0207425_1000207 3300025245 Bacteria 46813
354 Ga0209129_1000039 3300025258 Bacteria 322444
355 Ga0209129_1000073 3300025258 Bacteria 207709
356 Ga0209129_1000911 3300025258 Bacteria 18095
357 Ga0209233_1001467 3300025261 Bacteria 9303
358 Ga0209565_1000002 3300025263 Bacteria 1423083
359 Ga0209565_1000113 3300025263 Bacteria 116343
360 Ga0209565_1001914 3300025263 Bacteria 8222
361 Ga0209565_1003744 3300025263 Bacteria 4815
362 Ga0209565_1006878 3300025263 Bacteria 3137
363 Ga0209455_1001143 3300025272 Bacteria 12825
364 Ga0209673_1000002 3300025273 Bacteria 1423083
365 Ga0209673_1000369 3300025273 Bacteria 81061
366 Ga0209673_1005008 3300025273 Bacteria 6849
367 Ga0209673_1045019 3300025273 Bacteria 1216
368 Ga0209130_1000491 3300025284 Bacteria 40619
369 Ga0209130_1004985 3300025284 Bacteria 4797
370 Ga0209675_1000002 3300025291 Bacteria 1423083
371 Ga0209675_1000007 3300025291 Bacteria 683430
372 Ga0209675_1001501 3300025291 Bacteria 13384
373 Ga0209675_1008509 3300025291 Bacteria 3759
374 Ga0209676_1000018 3300025292 Bacteria 631385
375 Ga0209676_1000063 3300025292 Bacteria 322025
376 Ga0209676_1000143 3300025292 Bacteria 175267
377 Ga0209676_1001214 3300025292 Bacteria 27415
378 Ga0209676_1001361 3300025292 Bacteria 24039
379 Ga0209676_1001572 3300025292 Bacteria 20396
380 Ga0209676_1001849 3300025292 Bacteria 17458
381 Ga0209676_1003463 3300025292 Bacteria 9690
382 Ga0209676_1004197 3300025292 Bacteria 8174
383 Ga0209676_1008023 3300025292 Bacteria 4804
384 Ga0209676_1055337 3300025292 Bacteria 1017
385 Ga0209025_1000003 3300025294 Bacteria 1366495
386 Ga0209025_1000076 3300025294 Bacteria 273934
387 Ga0209025_1000134 3300025294 Bacteria 194505
388 Ga0209025_1001794 3300025294 Bacteria 25490
389 Ga0209025_1020240 3300025294 Bacteria 3649
390 Ga0209025_1040287 3300025294 Bacteria 2023
391 Ga0209564_1000004 3300025295 Bacteria 1424639
392 Ga0209564_1000333 3300025295 Bacteria 91663
393 Ga0209564_1001074 3300025295 Bacteria 32862
394 Ga0209564_1006121 3300025295 Bacteria 6604
395 Ga0209564_1012232 3300025295 Bacteria 3759
396 Ga0209758_1000112 3300025297 Bacteria 207640
397 Ga0209758_1000192 3300025297 Bacteria 136933
398 Ga0209758_1015301 3300025297 Bacteria 3987
399 Ga0209050_1000396 3300025298 Bacteria 81559
400 Ga0209050_1000762 3300025298 Bacteria 46324
401 Ga0209050_1001013 3300025298 Bacteria 35068
402 Ga0209050_1001391 3300025298 Bacteria 26316
403 Ga0209050_1001430 3300025298 Bacteria 25721
404 Ga0209050_1001743 3300025298 Bacteria 21647
405 Ga0209050_1029071 3300025298 Bacteria 1776
406 Ga0209256_1000004 3300025299 Bacteria 1424643
407 Ga0209256_1000651 3300025299 Bacteria 47267
408 Ga0209256_1000744 3300025299 Bacteria 42676
409 Ga0209256_1002151 3300025299 Bacteria 17009
410 Ga0209256_1005124 3300025299 Bacteria 7762
411 Ga0207426_1002252 3300025302 Bacteria 12793
412 Ga0209051_1000449 3300025303 Bacteria 54625
413 Ga0209051_1019788 3300025303 Bacteria 2925
414 Ga0209051_1024402 3300025303 Bacteria 2487
415 Ga0209051_1028554 3300025303 Bacteria 2201
416 Ga0209257_1000035 3300025304 Bacteria 631463
417 Ga0209257_1000240 3300025304 Bacteria 128014
418 Ga0209257_1000474 3300025304 Bacteria 73194
419 Ga0209257_1000501 3300025304 Bacteria 69426
420 Ga0209257_1000568 3300025304 Bacteria 62433
421 Ga0209257_1000861 3300025304 Bacteria 43224
422 Ga0209257_1002284 3300025304 Bacteria 19524
423 Ga0209257_1002512 3300025304 Bacteria 18042
424 Ga0209257_1002921 3300025304 Bacteria 15747
425 Ga0209257_1004223 3300025304 Bacteria 11378
426 Ga0209257_1010545 3300025304 Bacteria 4650
427 Ga0207697_10000237 3300025315 Bacteria 30060
428 Ga0207656_10000534 3300025321 Bacteria 12582
429 Ga0207656_10031968 3300025321 Bacteria 2183
430 Ga0207656_10076576 3300025321 Bacteria 1496
431 Ga0207655_1022247 3300025728 Bacteria 3186
432 Ga0207713_1000170 3300025735 Bacteria 94864
433 Ga0207713_1015181 3300025735 Bacteria 3965
434 Ga0207682_10000203 3300025893 Bacteria 26888
435 Ga0207642_10014937 3300025899 Bacteria 2880
436 Ga0207642_10032527 3300025899 Bacteria 2197
437 Ga0207688_10000362 3300025901 Bacteria 21159
438 Ga0207680_10073082 3300025903 Bacteria 2131
439 Ga0207680_10160162 3300025903 Bacteria 1508
440 Ga0207680_10316615 3300025903 Bacteria 1090
441 Ga0207647_10000059 3300025904 Bacteria 84337
442 Ga0207645_10006362 3300025907 Bacteria 8484
443 Ga0207645_10039941 3300025907 Bacteria 3005
444 Ga0207645_10097899 3300025907 Bacteria 1891
445 Ga0207643_10000311 3300025908 Bacteria 33638
446 Ga0207643_10071376 3300025908 Bacteria 1999
447 Ga0207705_10050600 3300025909 Bacteria 2991
448 Ga0207705_10073106 3300025909 Bacteria 2487
449 Ga0207654_10006165 3300025911 Bacteria 6026
450 Ga0207654_10065136 3300025911 Bacteria 2145
451 Ga0207707_10000131 3300025912 Bacteria 77593
452 Ga0207695_10000200 3300025913 Bacteria 165896
453 Ga0207695_10017714 3300025913 Bacteria 8271
454 Ga0207695_10055125 3300025913 Bacteria 4145
455 Ga0207695_10071019 3300025913 Bacteria 3557
456 Ga0207671_10002540 3300025914 Bacteria 19429
457 Ga0207671_10022237 3300025914 Bacteria 4797
458 Ga0207671_10048206 3300025914 Bacteria 3153
459 Ga0207671_10106852 3300025914 Bacteria 2125
460 Ga0207671_10165644 3300025914 Bacteria 1714
461 Ga0207663_10017861 3300025916 Bacteria 3962
462 Ga0207663_10069789 3300025916 Bacteria 2262
463 Ga0207660_10268379 3300025917 Bacteria 1351
464 Ga0207662_10007909 3300025918 Bacteria 5790
465 Ga0207662_10059720 3300025918 Bacteria 2286
466 Ga0207657_10026007 3300025919 Bacteria 5387
467 Ga0207657_10080919 3300025919 Bacteria 2729
468 Ga0207657_10157374 3300025919 Bacteria 1847
469 Ga0207649_10104698 3300025920 Bacteria 1879
470 Ga0207649_10117022 3300025920 Bacteria 1791
471 Ga0207649_10201480 3300025920 Bacteria 1406
472 Ga0207649_10219589 3300025920 Bacteria 1353
473 Ga0207652_10063100 3300025921 Bacteria 3203
474 Ga0207681_10004695 3300025923 Bacteria 8405
475 Ga0207694_10000410 3300025924 Bacteria 39885
476 Ga0207694_10002651 3300025924 Bacteria 14515
477 Ga0207650_10000609 3300025925 Bacteria 28609
478 Ga0207650_10002614 3300025925 Bacteria 12468
479 Ga0207650_10279459 3300025925 Bacteria 1359
480 Ga0207659_10156016 3300025926 Bacteria 1787
481 Ga0207687_10009983 3300025927 Bacteria 6214
482 Ga0207687_10171151 3300025927 Bacteria 1675
483 Ga0207687_10410287 3300025927 Bacteria 1116
484 Ga0207700_10098129 3300025928 Bacteria 2330
485 Ga0207644_10012273 3300025931 Bacteria 5686
486 Ga0207644_10181303 3300025931 Bacteria 1651
487 Ga0207644_10244937 3300025931 Bacteria 1428
488 Ga0207644_10464724 3300025931 Bacteria 1041
489 Ga0207690_10077915 3300025932 Bacteria 2305
490 Ga0207706_10000486 3300025933 Bacteria 42324
491 Ga0207706_10004757 3300025933 Bacteria 12714
492 Ga0207706_10004850 3300025933 Bacteria 12595
493 Ga0207706_10401802 3300025933 Bacteria 1188
494 Ga0207706_10532245 3300025933 Bacteria 1013
495 Ga0207686_10000924 3300025934 Bacteria 17599
496 Ga0207686_10027755 3300025934 Bacteria 3318
497 Ga0207686_10524946 3300025934 Bacteria 922
498 Ga0207709_10000972 3300025935 Bacteria 21403
499 Ga0207709_10033646 3300025935 Bacteria 3012
500 Ga0207709_10244807 3300025935 Bacteria 1306
501 Ga0207670_10018217 3300025936 Bacteria 4263
502 Ga0207669_10021865 3300025937 Bacteria 3386
503 Ga0207669_10095764 3300025937 Bacteria 1946
504 Ga0207669_10290839 3300025937 Bacteria 1237
505 Ga0207669_10425175 3300025937 Bacteria 1046
506 Ga0207704_10026697 3300025938 Bacteria 3172
507 Ga0207704_10050596 3300025938 Bacteria 2507
508 Ga0207704_10086969 3300025938 Bacteria 2040
509 Ga0207691_10001393 3300025940 Bacteria 24183
510 Ga0207691_10002722 3300025940 Bacteria 17265
511 Ga0207691_10010119 3300025940 Bacteria 9053
512 Ga0207691_10035685 3300025940 Bacteria 4613
513 Ga0207711_10000452 3300025941 Bacteria 42848
514 Ga0207689_10000468 3300025942 Bacteria 37877
515 Ga0207689_10036079 3300025942 Bacteria 4105
516 Ga0207689_10049180 3300025942 Bacteria 3479
517 Ga0207689_10286557 3300025942 Bacteria 1364
518 Ga0207661_10556815 3300025944 Bacteria 1051
519 Ga0207679_10222139 3300025945 Bacteria 1590
520 Ga0207679_10507161 3300025945 Bacteria 1077
521 Ga0207667_10005719 3300025949 Bacteria 15164
522 Ga0207667_10207884 3300025949 Bacteria 2007
523 Ga0207667_10214107 3300025949 Bacteria 1975
524 Ga0207667_10454497 3300025949 Bacteria 1301
525 Ga0207667_10585215 3300025949 Bacteria 1126
526 Ga0207651_10063544 3300025960 Bacteria 2578
527 Ga0207712_10000056 3300025961 Bacteria 143677
528 Ga0207712_10000105 3300025961 Bacteria 95153
529 Ga0207668_10001556 3300025972 Bacteria 13422
530 Ga0207668_10011242 3300025972 Bacteria 5433
531 Ga0207668_10089355 3300025972 Bacteria 2258
532 Ga0207640_10001637 3300025981 Bacteria 12004
533 Ga0207640_10029914 3300025981 Bacteria 3349
534 Ga0207640_10121144 3300025981 Bacteria 1874
535 Ga0207640_10169162 3300025981 Bacteria 1627
536 Ga0207640_10267010 3300025981 Bacteria 1337
537 Ga0207640_10272365 3300025981 Bacteria 1325
538 Ga0207640_10413960 3300025981 Bacteria 1101
539 Ga0207658_10000172 3300025986 Bacteria 69572
540 Ga0207658_10026092 3300025986 Bacteria 4094
541 Ga0207658_10028173 3300025986 Bacteria 3953
542 Ga0207658_10477471 3300025986 Bacteria 1107
543 Ga0207677_10054798 3300026023 Bacteria 2723
544 Ga0207677_10064315 3300026023 Bacteria 2554
545 Ga0207703_10004936 3300026035 Bacteria 10827
546 Ga0207703_10276911 3300026035 Bacteria 1522
547 Ga0207639_10000731 3300026041 Bacteria 22436
548 Ga0207639_10000786 3300026041 Bacteria 21612
549 Ga0207639_10001821 3300026041 Bacteria 14350
550 Ga0207639_10390576 3300026041 Bacteria 1252
551 Ga0207678_10001759 3300026067 Bacteria 19833
552 Ga0207678_10003513 3300026067 Bacteria 14094
553 Ga0207678_10005412 3300026067 Bacteria 11434
554 Ga0207678_10062037 3300026067 Bacteria 3214
555 Ga0207678_10093233 3300026067 Bacteria 2573
556 Ga0207708_10002933 3300026075 Bacteria 12574
557 Ga0207702_10004915 3300026078 Bacteria 11752
558 Ga0207702_10132908 3300026078 Bacteria 2241
559 Ga0207702_10313812 3300026078 Bacteria 1491
560 Ga0207702_10725708 3300026078 Bacteria 980
561 Ga0207641_10068039 3300026088 Bacteria 3052
562 Ga0207641_10191181 3300026088 Bacteria 1882
563 Ga0207641_10196749 3300026088 Bacteria 1856
564 Ga0207641_10256876 3300026088 Bacteria 1634
565 Ga0207648_10001903 3300026089 Bacteria 22822
566 Ga0207648_10006417 3300026089 Bacteria 11689
567 Ga0207648_10007474 3300026089 Bacteria 10736
568 Ga0207648_10026157 3300026089 Bacteria 5189
569 Ga0207648_10053459 3300026089 Bacteria 3530
570 Ga0207648_10160469 3300026089 Bacteria 1985
571 Ga0207676_10053045 3300026095 Bacteria 3172
572 Ga0207676_10127500 3300026095 Bacteria 2158
573 Ga0207676_10346425 3300026095 Bacteria 1372
574 Ga0207674_10000769 3300026116 Bacteria 41860
575 Ga0207674_10020523 3300026116 Bacteria 7135
576 Ga0207674_10137820 3300026116 Bacteria 2401
577 Ga0207675_100005406 3300026118 Bacteria 12238
578 Ga0207683_10011894 3300026121 Bacteria 7427
579 Ga0207683_10018635 3300026121 Bacteria 5924
580 Ga0207683_10085655 3300026121 Bacteria 2801
581 Ga0207683_10086243 3300026121 Bacteria 2791
582 Ga0207683_10226616 3300026121 Bacteria 1704
583 Ga0207698_10029142 3300026142 Bacteria 3949
584 Ga0207698_10052038 3300026142 Bacteria 3135
585 Ga0207698_10108964 3300026142 Bacteria 2316
586 Ga0207698_10160875 3300026142 Bacteria 1963
587 Ga0207698_10412794 3300026142 Bacteria 1293
588 Ga0209371_1000018 3300027312 Bacteria 614700
589 Ga0209371_1000235 3300027312 Bacteria 69492
590 Ga0209995_1007371 3300027471 Bacteria 1774
591 Ga0209995_1022150 3300027471 Bacteria 1054
592 Ga0209999_1003821 3300027543 Bacteria 2705
593 Ga0209982_1001910 3300027552 Bacteria 2884
594 Ga0209983_1004561 3300027665 Bacteria 2907
595 Ga0209974_10011133 3300027876 Bacteria 3026
596 Ga0268266_10000008 3300028379 Bacteria 1161875
597 Ga0268266_10087866 3300028379 Bacteria 2720
598 Ga0268266_10154982 3300028379 Bacteria 2068
599 Ga0268266_10318779 3300028379 Bacteria 1454
600 Ga0268265_10000137 3300028380 Bacteria 93389
601 Ga0268264_10010997 3300028381 Bacteria 7470
602 Ga0268264_10210088 3300028381 Bacteria 1786
603 Ga0268264_10210321 3300028381 Bacteria 1785
604 Ga0268256_1000016 3300030500 Bacteria 614700
605 Ga0268256_1000196 3300030500 Bacteria 69428
606 Ga0316177_1021597 3300030731 Bacteria 1123
607 Ga0316176_1093929 3300030732 Bacteria 1827
608 Ga0316176_1111454 3300030732 Bacteria 1321
609 Ga0316180_1121751 3300030736 Bacteria 1105
610 Ga0316183_1003565 3300030742 Bacteria 4101
611 Ga0265327_10000881 3300031251 Bacteria 44377
612 Ga0265327_10002076 3300031251 Bacteria 22390
613 Ga0307513_10169102 3300031456 Bacteria 2066
614 Ga0307408_100000709 3300031548 Bacteria 27106
615 Ga0307408_100007413 3300031548 Bacteria 7254
616 Ga0307408_100053244 3300031548 Bacteria 2921
617 Ga0307408_100306775 3300031548 Bacteria 1332
618 Ga0307408_100438478 3300031548 Bacteria 1130
619 Ga0265313_10004333 3300031595 Bacteria 10979
620 Ga0307508_10135808 3300031616 Bacteria 2063
621 Ga0316579_10000239 3300031691 Bacteria 16775
622 Ga0316576_10188261 3300031727 Bacteria 1556
623 Ga0316578_10047880 3300031728 Bacteria 2495
624 Ga0307405_10011866 3300031731 Bacteria 4587
625 Ga0307405_10142167 3300031731 Bacteria 1675
626 Ga0307405_10307256 3300031731 Bacteria 1206
627 Ga0307405_10458274 3300031731 Bacteria 1013
628 Ga0307413_10000613 3300031824 Bacteria 11991
629 Ga0307413_10006231 3300031824 Bacteria 5417
630 Ga0307413_10009959 3300031824 Bacteria 4581
631 Ga0307413_10049419 3300031824 Bacteria 2520
632 Ga0307413_10200765 3300031824 Bacteria 1440
633 Ga0307413_10681358 3300031824 Bacteria 852
634 Ga0307410_10057455 3300031852 Bacteria 2649
635 Ga0307410_10634522 3300031852 Bacteria 894
636 Ga0307406_10002051 3300031901 Bacteria 11004
637 Ga0307406_10013108 3300031901 Bacteria 4741
638 Ga0307407_10004868 3300031903 Bacteria 5763
639 Ga0307412_10011263 3300031911 Bacteria 5174
640 Ga0307412_10015199 3300031911 Bacteria 4556
641 Ga0307412_10019584 3300031911 Bacteria 4102
642 Ga0307412_10167416 3300031911 Bacteria 1640
643 Ga0307409_100017259 3300031995 Bacteria 4805
644 Ga0307409_100068370 3300031995 Bacteria 2809
645 Ga0307409_100071858 3300031995 Bacteria 2753
646 Ga0307409_100117340 3300031995 Bacteria 2245
647 Ga0307416_100004130 3300032002 Bacteria 8699
648 Ga0307416_100014749 3300032002 Bacteria 5370
649 Ga0307416_100017645 3300032002 Bacteria 5002
650 Ga0307414_10020871 3300032004 Bacteria 4092
651 Ga0307414_10025023 3300032004 Bacteria 3816
652 Ga0307414_10052008 3300032004 Bacteria 2848
653 Ga0307414_10065380 3300032004 Bacteria 2594
654 Ga0307414_10082940 3300032004 Bacteria 2352
655 Ga0307414_10115068 3300032004 Bacteria 2056
656 Ga0307414_10142134 3300032004 Bacteria 1880
657 Ga0307414_10159001 3300032004 Bacteria 1792
658 Ga0307414_10310166 3300032004 Bacteria 1339
659 Ga0307411_10004601 3300032005 Bacteria 6638
660 Ga0307411_10069586 3300032005 Bacteria 2377
661 Ga0307415_100141091 3300032126 Bacteria 1840
662 Ga0316583_10035755 3300032133 Bacteria 1763
663 Ga0316583_10109696 3300032133 Bacteria 962
664 Ga0316593_10004218 3300032168 Bacteria 3668
665 Ga0307507_10085590 3300033179 Bacteria 2741
666 Ga0373934_0018985 3300035086 Bacteria 2635
667 Ga0373944_0011910 3300035089 Bacteria 2390
668 Ga0373944_0090056 3300035089 Bacteria 1024
669 Ga0373923_0000862 3300035111 Bacteria 8041
670 Ga0373936_0006714 3300035113 Bacteria 4332
671 Ga0373945_0064419 3300035116 Bacteria 1374
672 Ga0373953_0057597 3300035117 Bacteria 1582
673 Ga0373954_0013189 3300035118 Bacteria 3679
674 Ga0373956_0082759 3300035119 Bacteria 1474
675 Ga0373946_0027835 3300035171 Bacteria 2238
676 Ga0373946_0066824 3300035171 Bacteria 1542
677 Ga0373955_0017355 3300035172 Bacteria 3561
678 Ga0373955_0058072 3300035172 Unclassified 2128
679 Ga0316574_0007439 3300035398 Bacteria 6004
680 Ga0316574_0008096 3300035398 Bacteria 5817
681 Ga0316574_0044244 3300035398 Bacteria 2754
682 Ga0316574_0058879 3300035398 Bacteria 2407
683 Ga0373924_0004079 3300035410 Bacteria 5079
684 Ga0373924_0043403 3300035410 Bacteria 1846
685 Ga0373935_0001624 3300035692 Bacteria 12546
686 Ga0373935_0113894 3300035692 Bacteria 1798
687 Ga0373927_0020861 3300035695 Bacteria 4294
688 Ga0373927_0058015 3300035695 Bacteria 2503
689 Ga0373933_0013890 3300035724 Bacteria 4469
690 Ga0373933_0025647 3300035724 Bacteria 3381
691 Ga0373933_0263119 3300035724 Bacteria 1112
692 Ga0373947_0018130 3300035725 Bacteria 4051
693 Ga0373947_0031055 3300035725 Bacteria 3141
694 Ga0373937_0001723 3300036401 Bacteria 18385
695 Ga0373937_0026868 3300036401 Bacteria 5203
696 Ga0373937_0422825 3300036401 Bacteria 1265
697 Ga0316582_0003730 3300036647 Bacteria 7546
698 Ga0316584_0004914 3300036712 Bacteria 8896
699 Ga0316584_0036119 3300036712 Bacteria 3667
700 Ga0373925_0025815 3300037068 Bacteria 4295
701 Ga0373925_0037459 3300037068 Bacteria 3581
702 Ga0373925_0093747 3300037068 Bacteria 2298
703 Ga0373925_0152278 3300037068 Bacteria 1817
704 Ga0395899_0197906 3300037312 Bacteria 1403
705 Ga0395899_0414180 3300037312 Bacteria 889
706 Ga0395900_0000078 3300037418 Bacteria 179292
707 Ga0395900_0007101 3300037418 Bacteria 11603
708 Ga0395900_0019094 3300037418 Bacteria 6990
709 Ga0395900_0020128 3300037418 Bacteria 6807
710 Ga0395900_0103269 3300037418 Bacteria 2928
711 Ga0395898_0137357 3300037466 Bacteria 2341
712 Ga0395898_0342764 3300037466 Bacteria 1425
713 Ga0395905_0003031 3300037471 Bacteria 18199
714 Ga0395905_0161447 3300037471 Bacteria 2106
715 Ga0395905_0295408 3300037471 Bacteria 1507
716 Ga0395905_0341105 3300037471 Bacteria 1389
717 Ga0395905_0585418 3300037471 Bacteria 1017
718 Ga0316581_0000043 3300037588 Bacteria 13947
719 Ga0395901_0069557 3300038443 Bacteria 3666
720 Ga0395901_0264934 3300038443 Bacteria 1788
721 Ga0237819_00845 3300038705 Bacteria 9641
722 Ga0439436_0001697 3300041404 Bacteria 6439
723 Ga0439436_0040166 3300041404 Bacteria 1342
724 Ga0439439_0038423 3300041406 Bacteria 1236
725 Ga0439447_000747 3300041407 Bacteria 12049
726 Ga0439465_0000276 3300041413 Bacteria 14361
727 Ga0439465_0000407 3300041413 Bacteria 12509
728 Ga0439465_0005883 3300041413 Bacteria 3900
729 Ga0451789_0213010 3300041443 Bacteria 1828
730 Ga0451789_1037216 3300041443 Bacteria 1144
731 Ga0451793_0368728 3300041452 Bacteria 955
732 Ga0451793_0653506 3300041452 Bacteria 2310
733 Ga0451797_0308724 3300041453 Bacteria 1445
734 Ga0451798_0322971 3300041458 Bacteria 1241
735 Ga0451800_0201578 3300041459 Bacteria 1346
736 Ga0451800_0427065 3300041459 Bacteria 2389
737 Ga0451800_1537340 3300041459 Bacteria 1829
738 Ga0451802_0179100 3300041460 Bacteria 11872
739 Ga0451806_242067 3300041462 Bacteria 1906
740 Ga0451804_0395309 3300041463 Bacteria 2030
741 Ga0451807_0556227 3300041486 Bacteria 1956
742 Ga0451807_0792913 3300041486 Bacteria 2265
743 Ga0451807_2500983 3300041486 Bacteria 1498
744 Ga0451833_0176212 3300041491 Bacteria 2262
745 Ga0451837_1596213 3300041494 Bacteria 1823
746 Ga0451843_0097092 3300041509 Bacteria 2375
747 Ga0451853_0954159 3300041512 Bacteria 1002
748 Ga0439441_007285 3300042001 Bacteria 1777
749 Ga0439449_0000005 3300042007 Bacteria 81904
750 Ga0439449_0004340 3300042007 Bacteria 5473
751 Ga0439449_0016831 3300042007 Bacteria 2746
752 Ga0439449_0041954 3300042007 Bacteria 1701
753 Ga0439462_0013511 3300042015 Bacteria 2093
754 Ga0450905_007209 3300042142 Bacteria 1512
755 Ga0439459_0014669 3300042438 Bacteria 1427
756 Ga0451577_0004427 3300042876 Bacteria 14826
757 Ga0451577_0049489 3300042876 Bacteria 3753
758 Ga0451577_0076732 3300042876 Bacteria 2979
759 Ga0453684_0000531 3300044712 Bacteria 145390
760 Ga0453684_0021721 3300044712 Bacteria 9569
761 Ga0453684_0346920 3300044712 Bacteria 1675
762 Ga0453684_0812972 3300044712 Bacteria 1007
763 Ga0466959_0040633 3300045049 Bacteria 3435
764 Ga0451576_0000212 3300045051 Bacteria 145396
765 Ga0495592_0001826 3300046454 Bacteria 14962
766 Ga0495603_0101999 3300046455 Bacteria 1675
767 Ga0495629_0095090 3300046459 Bacteria 2079
768 Ga0495629_0115595 3300046459 Bacteria 1870
769 Ga0495629_0124162 3300046459 Bacteria 1798
770 Ga0495638_0009424 3300046460 Bacteria 6856
771 Ga0495638_0133753 3300046460 Bacteria 1454
772 Ga0495641_0004656 3300046461 Bacteria 9589
773 Ga0495641_0062971 3300046461 Bacteria 1672
774 Ga0495651_0014231 3300046462 Bacteria 6149
775 Ga0495653_0001641 3300046463 Bacteria 17576
776 Ga0495580_0005997 3300046472 Bacteria 9945
777 Ga0495580_0029988 3300046472 Bacteria 3942
778 Ga0495580_0079615 3300046472 Bacteria 2285
779 Ga0495582_0130157 3300046473 Bacteria 1421
780 Ga0495605_0050822 3300046474 Bacteria 2021
781 Ga0495639_0001436 3300046475 Bacteria 10656
782 Ga0495662_0025189 3300046476 Bacteria 2872
783 Ga0495664_0062219 3300046477 Bacteria 2222
784 Ga0495664_0064803 3300046477 Bacteria 2178
785 Ga0495594_0059220 3300046499 Bacteria 2118
786 Ga0495594_0064939 3300046499 Bacteria 2024
787 Ga0495594_0254121 3300046499 Bacteria 1001
788 Ga0495607_0064962 3300046501 Bacteria 2059
789 Ga0495606_0001807 3300046507 Bacteria 27215
790 Ga0495606_0055788 3300046507 Bacteria 2553
791 Ga0495608_0043238 3300046511 Bacteria 3010
792 Ga0495610_0029379 3300046512 Bacteria 2895
793 Ga0495628_0537609 3300046516 Unclassified 840
794 Ga0495630_0025382 3300046517 Bacteria 4381
795 Ga0495630_0401049 3300046517 Bacteria 1051
796 Ga0495631_0006831 3300046518 Bacteria 5856
797 Ga0495632_0068485 3300046519 Bacteria 1710
798 Ga0495643_0001375 3300046522 Bacteria 22762
799 Ga0495663_0002521 3300046525 Bacteria 5488
800 Ga0495666_0032105 3300046526 Bacteria 2571
801 Ga0495652_0085957 3300046529 Bacteria 2583
802 Ga0495652_0139353 3300046529 Bacteria 1909
803 Ga0495665_0003413 3300046531 Bacteria 8627
804 Ga0495665_0051908 3300046531 Bacteria 2171
805 Ga0495586_0083110 3300046535 Bacteria 1761
806 Ga0495587_0005671 3300046536 Bacteria 8138
807 Ga0495587_0142409 3300046536 Bacteria 1368
808 Ga0495598_0022117 3300046537 Bacteria 1698
809 Ga0495598_0071402 3300046537 Unclassified 1094
810 Ga0495645_0018452 3300046543 Bacteria 5010
811 Ga0495645_0030125 3300046543 Bacteria 3952
812 Ga0495622_0107187 3300046557 Bacteria 1280
813 Ga0495633_0020075 3300046558 Bacteria 3366
814 Ga0495667_0109286 3300046559 Bacteria 1786
815 Ga0495656_0005009 3300046615 Bacteria 4562
816 Ga0495656_0284681 3300046615 Bacteria 843
817 Ga0495668_0001829 3300046616 Bacteria 19233
818 Ga0495634_0028244 3300046642 Bacteria 3895
819 Ga0495634_0063082 3300046642 Bacteria 2460
820 Ga0495635_0054362 3300046663 Bacteria 2758
821 Ga0495635_0075813 3300046663 Bacteria 2304
822 Ga0495659_0011041 3300046664 Bacteria 2909
823 Ga0495657_0035685 3300046675 Bacteria 3443
824 Ga0495599_0003119 3300046678 Bacteria 9658
825 Ga0495599_0165056 3300046678 Bacteria 1368
826 Ga0495646_0192039 3300046680 Bacteria 1116
827 Ga0495647_0003192 3300046681 Bacteria 5247
828 Ga0495647_0018318 3300046681 Bacteria 2491
829 Ga0495658_0132707 3300046683 Bacteria 1517
830 Ga0495613_0027013 3300046689 Bacteria 4272
831 Ga0495613_0071176 3300046689 Bacteria 2535
832 Ga0495624_0051172 3300046690 Bacteria 2615
833 Ga0495600_0008978 3300046809 Bacteria 6159
834 Ga0495600_0015163 3300046809 Bacteria 4869
835 Ga0495660_0006133 3300046810 Bacteria 7136
836 Ga0495636_0008534 3300047318 Bacteria 4043
837 Ga0495674_0001688 3300047319 Bacteria 21688
838 Ga0495672_0001550 3300047320 Bacteria 22485
839 Ga0495675_0019631 3300047444 Bacteria 4293
840 Ga0495684_0098846 3300047471 Bacteria 2206
841 Ga0495684_0193947 3300047471 Bacteria 1500
842 Ga0495686_0006050 3300047472 Bacteria 9385
843 Ga0495686_0013648 3300047472 Bacteria 5630
844 Ga0495593_0026356 3300047673 Bacteria 3211
845 Ga0495626_0034998 3300048091 Bacteria 2399
846 Ga0496100_0518618 3300048903 Bacteria 920
847 Ga0496101_0049064 3300048904 Bacteria 3035
848 Ga0496101_0116959 3300048904 Bacteria 2012
849 Ga0496102_0062642 3300048905 Bacteria 3406
850 Ga0496104_0000018 3300048907 Bacteria 258184
851 Ga0496104_0031844 3300048907 Bacteria 4906
852 Ga0496104_0092591 3300048907 Bacteria 2890
853 Ga0496104_0632136 3300048907 Unclassified 980
854 Ga0496105_0000044 3300048908 Bacteria 112155
855 Ga0496105_0274269 3300048908 Bacteria 1361
856 Ga0496106_0020517 3300048909 Bacteria 4905
857 Ga0496107_0009761 3300048910 Bacteria 6657
858 Ga0496108_0167241 3300048911 Bacteria 1902
859 Ga0496109_0009884 3300048912 Bacteria 8147
860 Ga0496109_0039089 3300048912 Bacteria 4293
861 Ga0496110_0040186 3300048913 Bacteria 4076
862 Ga0496113_0056613 3300048916 Bacteria 2944
863 Ga0496113_0091028 3300048916 Bacteria 2351
864 Ga0496114_0000661 3300048917 Bacteria 25558
865 Ga0496115_0004687 3300048918 Bacteria 9909
866 Ga0496115_0183490 3300048918 Bacteria 1729
867 Ga0496116_0002985 3300048919 Bacteria 17200
868 Ga0496116_0009924 3300048919 Bacteria 8051
869 Ga0496116_0021943 3300048919 Bacteria 4801
870 Ga0496116_0077292 3300048919 Bacteria 2080
871 Ga0496117_0002512 3300048920 Bacteria 22989
872 Ga0496117_0002847 3300048920 Bacteria 21034
873 Ga0496117_0003585 3300048920 Bacteria 17909
874 Ga0496117_0004078 3300048920 Bacteria 16401
875 Ga0496117_0020445 3300048920 Bacteria 5395
876 Ga0496117_0021902 3300048920 Bacteria 5148
877 Ga0496117_0026742 3300048920 Bacteria 4508
878 Ga0496118_0000065 3300048921 Bacteria 211750
879 Ga0496118_0000183 3300048921 Bacteria 110206
880 Ga0496118_0003155 3300048921 Bacteria 21078
881 Ga0496118_0011461 3300048921 Bacteria 8649
882 Ga0496118_0014433 3300048921 Bacteria 7399
883 Ga0496118_0023695 3300048921 Bacteria 5322
884 Ga0496118_0099712 3300048921 Bacteria 1967
885 Ga0496119_0004541 3300048922 Bacteria 13758
886 Ga0496119_0005902 3300048922 Bacteria 11551
887 Ga0496119_0068852 3300048922 Bacteria 2082
888 Ga0496120_0000776 3300048923 Bacteria 46146
889 Ga0496120_0001660 3300048923 Bacteria 25701
890 Ga0496121_0000275 3300048924 Bacteria 107073
891 Ga0496121_0003638 3300048924 Bacteria 21702
892 Ga0496121_0009225 3300048924 Bacteria 11395
893 Ga0496121_0016911 3300048924 Bacteria 7496
894 Ga0496121_0022270 3300048924 Bacteria 6162
895 Ga0496121_0038741 3300048924 Bacteria 4213
896 Ga0496121_0095398 3300048924 Bacteria 2312
897 Ga0496121_0228118 3300048924 Bacteria 1306
898 Ga0496122_0000033 3300048925 Bacteria 324104
899 Ga0496122_0000037 3300048925 Bacteria 304495
900 Ga0496122_0000355 3300048925 Bacteria 98786
901 Ga0496122_0000361 3300048925 Bacteria 97861
902 Ga0496122_0004301 3300048925 Bacteria 17841
903 Ga0496122_0027005 3300048925 Bacteria 4926
904 Ga0496122_0027905 3300048925 Bacteria 4811
905 Ga0496123_0000167 3300048926 Bacteria 131151
906 Ga0496123_0000741 3300048926 Bacteria 52871
907 Ga0496123_0001332 3300048926 Bacteria 34880
908 Ga0496123_0002053 3300048926 Bacteria 25986
909 Ga0496123_0004240 3300048926 Bacteria 15273
910 Ga0496123_0016984 3300048926 Bacteria 5876
911 Ga0496123_0025782 3300048926 Bacteria 4422
912 Ga0496124_0000004 3300048927 Bacteria 976131
913 Ga0496124_0000020 3300048927 Bacteria 434107
914 Ga0496124_0002453 3300048927 Bacteria 24263
915 Ga0496124_0003077 3300048927 Bacteria 20780
916 Ga0496124_0021425 3300048927 Bacteria 5955
917 Ga0496124_0045788 3300048927 Bacteria 3750
918 Ga0496124_0050843 3300048927 Bacteria 3528
919 Ga0496124_0079369 3300048927 Bacteria 2703
920 Ga0496124_0087272 3300048927 Bacteria 2551
921 Ga0496124_0184976 3300048927 Bacteria 1599
922 Ga0496125_0000117 3300048928 Bacteria 176766
923 Ga0496125_0013801 3300048928 Bacteria 7914
924 Ga0496125_0015927 3300048928 Bacteria 7241
925 Ga0496125_0021408 3300048928 Bacteria 6033
926 Ga0496125_0023855 3300048928 Bacteria 5638
927 Ga0496125_0025466 3300048928 Bacteria 5416
928 Ga0496125_0027484 3300048928 Bacteria 5155
929 Ga0496125_0027879 3300048928 Bacteria 5110
930 Ga0496125_0178993 3300048928 Bacteria 1415
931 Ga0496126_0002494 3300048929 Bacteria 24732
932 Ga0496126_0008693 3300048929 Bacteria 10905
933 Ga0496126_0108820 3300048929 Bacteria 2416
934 Ga0501290_000868 3300049513 Bacteria 4413
935 Ga0501300_009389 3300049523 Bacteria 1427
936 Ga0501031_0008497 3300049568 Bacteria 6681
937 Ga0501031_0012129 3300049568 Bacteria 5619
938 Ga0501031_0173625 3300049568 Bacteria 1408
939 Ga0501032_0000210 3300049569 Bacteria 48794
940 Ga0501032_0004174 3300049569 Bacteria 10946
941 Ga0501032_0028651 3300049569 Bacteria 3826
942 Ga0501032_0268267 3300049569 Bacteria 1106
943 Ga0501033_0000847 3300049570 Bacteria 27913
944 Ga0501033_0014212 3300049570 Bacteria 6051
945 Ga0501034_0000448 3300049571 Bacteria 68146
946 Ga0501034_0000886 3300049571 Bacteria 43859
947 Ga0501034_0002379 3300049571 Bacteria 22851
948 Ga0501034_0006726 3300049571 Bacteria 12316
949 Ga0501034_0007033 3300049571 Bacteria 12005
950 Ga0501034_0009119 3300049571 Bacteria 10417
951 Ga0501034_0155667 3300049571 Bacteria 2259
952 Ga0501034_0173362 3300049571 Bacteria 2123
953 Ga0501034_0351096 3300049571 Bacteria 1403
954 Ga0501034_0434336 3300049571 Bacteria 1232
955 Ga0501036_0017938 3300049572 Bacteria 5925
956 Ga0501037_0011559 3300049573 Bacteria 6497
957 Ga0501037_0035492 3300049573 Bacteria 3677
958 Ga0501037_0052651 3300049573 Bacteria 2977
959 Ga0501037_0106622 3300049573 Bacteria 2019
960 Ga0501037_0131956 3300049573 Bacteria 1791
961 Ga0501037_0346224 3300049573 Bacteria 1026
962 Ga0501038_0066160 3300049574 Bacteria 3079
963 Ga0501038_0342436 3300049574 Bacteria 1166
964 Ga0501039_0006764 3300049575 Bacteria 8725
965 Ga0501042_0432668 3300049578 Bacteria 954
966 Ga0501043_0002614 3300049579 Bacteria 15190
967 Ga0501043_0056696 3300049579 Bacteria 3077
968 Ga0501046_0001308 3300049580 Bacteria 24120
969 Ga0501046_0037396 3300049580 Bacteria 3900
970 Ga0501046_0046585 3300049580 Bacteria 3441
971 Ga0501047_0000315 3300049581 Bacteria 55857
972 Ga0501047_0013016 3300049581 Bacteria 7878
973 Ga0501047_0031843 3300049581 Bacteria 5088
974 Ga0501047_0305484 3300049581 Bacteria 1432
975 Ga0501047_0389401 3300049581 Bacteria 1227
976 Ga0501048_0030442 3300049582 Bacteria 3905
977 Ga0501067_0000119 3300049583 Bacteria 43944
978 Ga0501067_0231921 3300049583 Bacteria 1027
979 Ga0501068_0001462 3300049584 Bacteria 12571
980 Ga0501069_0003734 3300049585 Bacteria 7827
981 Ga0501070_0004828 3300049586 Bacteria 11520
982 Ga0501070_0029810 3300049586 Bacteria 4571
983 Ga0501070_0077883 3300049586 Bacteria 2744
984 Ga0501070_0350913 3300049586 Bacteria 1197
985 Ga0501072_0001194 3300049588 Bacteria 19378
986 Ga0501072_0003276 3300049588 Bacteria 12165
987 Ga0501072_0455236 3300049588 Bacteria 1013
988 Ga0501073_0000822 3300049589 Bacteria 22076
989 Ga0501073_0003339 3300049589 Bacteria 12062
990 Ga0501073_0014186 3300049589 Bacteria 5787
991 Ga0501073_0045195 3300049589 Bacteria 3102
992 Ga0501073_0082082 3300049589 Bacteria 2242
993 Ga0501073_0102426 3300049589 Bacteria 1988
994 Ga0501074_0014434 3300049590 Bacteria 5748
995 Ga0501074_0163352 3300049590 Bacteria 1590
996 Ga0501074_0163520 3300049590 Bacteria 1589
997 Ga0501227_000994 3300049665 Bacteria 6269
998 Ga0501225_0006023 3300049705 Bacteria 3545
999 Ga0501079_0002546 3300049741 Bacteria 13238
1000 Ga0501080_0002008 3300049742 Bacteria 17577
1001 Ga0501080_0002572 3300049742 Bacteria 15885
1002 Ga0501080_0016726 3300049742 Bacteria 6773
1003 Ga0501080_0042061 3300049742 Bacteria 4257
1004 Ga0501080_0229252 3300049742 Bacteria 1698
1005 Ga0501080_0405593 3300049742 Bacteria 1226
1006 Ga0501083_0000646 3300049744 Bacteria 22541
1007 Ga0501083_0054799 3300049744 Bacteria 2675
1008 Ga0501083_0160747 3300049744 Bacteria 1469
1009 Ga0501265_001300 3300049762 Bacteria 2806
1010 Ga0501279_003974 3300049775 Bacteria 1934
1011 Ga0501279_006861 3300049775 Bacteria 1507
1012 Ga0501035_0018695 3300049822 Bacteria 6382
1013 Ga0501035_0025135 3300049822 Bacteria 5460
1014 Ga0501035_0055447 3300049822 Bacteria 3538
1015 Ga0501035_0209359 3300049822 Bacteria 1669
1016 Ga0501044_0000048 3300049823 Bacteria 145067
1017 Ga0501044_0000956 3300049823 Bacteria 34699
1018 Ga0501044_0013036 3300049823 Bacteria 8995
1019 Ga0501044_0145046 3300049823 Bacteria 2360
1020 Ga0501044_0181306 3300049823 Bacteria 2072
1021 Ga0501044_0314825 3300049823 Bacteria 1491
1022 Ga0501044_0645570 3300049823 Bacteria 948
1023 nmdc:mga00v17_12723_c1 3300050491 Bacteria 4648
1024 nmdc:mga00v17_200_c1 3300050491 Bacteria 36047
1025 nmdc:mga00v17_2327_c1 3300050491 Bacteria 9734
1026 nmdc:mga00v17_359_c1 3300050491 Bacteria 25762
1027 nmdc:mga00v17_48265_c1 3300050491 Bacteria 2580
1028 nmdc:mga00v17_57555_c1 3300050491 Bacteria 2378
1029 nmdc:mga00v17_68063_c1 3300050491 Bacteria 2201
1030 nmdc:mga0yw44_10758_c1 3300050492 Bacteria 4687
1031 nmdc:mga0k408_163538_c1 3300050493 Bacteria 1326
1032 nmdc:mga0n895_760944_c1 3300050512 Bacteria 961
1033 Ga0495601_0009026 3300053077 Bacteria 5886
1034 Ga0495601_0010532 3300053077 Bacteria 5506
1035 Ga0495612_0136830 3300053078 Bacteria 1061
1036 Ga0500610_0001281 3300053079 Bacteria 8436
1037 Ga0495595_0017945 3300053084 Bacteria 3050
1038 Ga0495619_0018702 3300053085 Bacteria 4397
1039 Ga0500559_0048355 3300053136 Bacteria 1870
1040 Ga0500568_0000675 3300053139 Bacteria 24636
1041 Ga0500634_0000582 3300053161 Bacteria 12119
1042 Ga0501084_0271015 3300054114 Bacteria 1433
1043 Ga0501084_0321682 3300054114 Bacteria 1307
1044 Ga0590075_052512 3300059424 Bacteria 1046
1045 Ga0501082_0003553 3300060353 Bacteria 13614
1046 Ga0501082_0005653 3300060353 Bacteria 10848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025931 Ga0207644_10244937 Ga0207644_102449372 210
2 3300046516 Ga0495628_0537609 Ga0495628_0537609_186_824 210
3 3300046537 Ga0495598_0071402 Ga0495598_0071402_398_1081 225
4 3300048924 Ga0496121_0022270 Ga0496121_0022270_10_699 226
5 3300025903 Ga0207680_10160162 Ga0207680_101601622 229
6 3300046557 Ga0495622_0107187 Ga0495622_0107187_524_1228 233
7 3300003794 Ga0055531_10031237 Ga0055531_100312372 234
8 3300025304 Ga0209257_1004223 Ga0209257_10042232 234
9 3300049665 Ga0501227_000994 Ga0501227_000994_993_1703 234
10 3300049775 Ga0501279_006861 Ga0501279_006861_146_856 234
11 3300046507 Ga0495606_0001807 Ga0495606_0001807_21748_22458 235
12 3300049589 Ga0501073_0014186 Ga0501073_0014186_5052_5774 237
13 3300041406 Ga0439439_0038423 Ga0439439_0038423_26_748 238
14 3300031824 Ga0307413_10681358 Ga0307413_106813581 243
15 3300031995 Ga0307409_100017259 Ga0307409_1000172592 243
16 iso_pu_bacteria 2643221554 2643788007 248
17 iso_pu_bacteria 2643221638 2644216393 248
18 iso_pu_bacteria 2524614729 2525557459 250
19 iso_pu_bacteria 2576861471 2578456398 250
20 iso_pu_bacteria 2599185292 2599907337 250
21 iso_pu_bacteria 2627854209 2630649050 250
22 iso_pu_bacteria 2643221559 2643817972 250
23 iso_pu_bacteria 2643221569 2643863051 250
24 iso_pu_bacteria 2643221573 2643880137 250
25 iso_pu_bacteria 2643221579 2643909140 250
26 iso_pu_bacteria 2643221581 2643914481 250
27 iso_pu_bacteria 2643221586 2643937631 250
28 iso_pu_bacteria 2643221593 2643975256 250
29 iso_pu_bacteria 2643221594 2643978473 250
30 iso_pu_bacteria 2643221612 2644078544 250
31 iso_pu_bacteria 2643221720 2644662314 250
32 iso_pu_bacteria 2643221727 2644693321 250
33 iso_pu_bacteria 2643221728 2644698794 250
34 iso_pu_bacteria 2747842428 2747949817 250
35 iso_pu_bacteria 2747842501 2748017740 250
36 iso_pu_bacteria 2765235840 2765581119 250
37 iso_pu_bacteria 2808606395 2809031205 250
38 iso_pu_bacteria 2816332141 2816517899 250
39 iso_pu_bacteria 2818991457 2819661836 250
40 iso_pu_bacteria 2842391507 2842394139 250
41 iso_pu_bacteria 2842757796 2842761231 250
42 iso_pu_bacteria 2842780639 2842784288 250
43 iso_pu_bacteria 2852649853 2852651647 250
44 iso_pu_bacteria 2852684882 2852688501 250
45 iso_pu_bacteria 2855730933 2855731322 250
46 iso_pu_bacteria 2855767633 2855768028 250
47 iso_pu_bacteria 2857442823 2857444616 250
48 iso_pu_bacteria 2857537821 2857539297 250
49 iso_pu_bacteria 2857542790 2857545803 250
50 iso_pu_bacteria 2858950400 2858954895 250
51 iso_pu_bacteria 2874220319 2874223761 250
52 iso_pu_bacteria 2881412998 2881413791 250
53 iso_pu_bacteria 2894023352 2894026736 250
54 iso_pu_bacteria 2894414249 2894417671 250
55 iso_pu_bacteria 2895498888 2895502003 250
56 iso_pu_bacteria 2895511927 2895517044 250
57 iso_pu_bacteria 2895522137 2895524574 250
58 iso_pu_bacteria 2895525241 2895525869 250
59 iso_pu_bacteria 2919089067 2919089312 250
60 iso_pu_bacteria 2919130084 2919133865 250
61 iso_pu_bacteria 2919134579 2919136448 250
62 iso_pu_bacteria 2919513703 2919516070 250
63 iso_pu_bacteria 2919675420 2919677886 250
64 iso_pu_bacteria 2923516293 2923516908 250
65 iso_pu_bacteria 2928496128 2928499307 250
66 iso_pu_bacteria 2929195423 2929199846 250
67 iso_pu_bacteria 2931380184 2931382839 250
68 iso_pu_bacteria 2937610967 2937613765 250
69 iso_pu_bacteria 2939622612 2939626554 250
70 iso_pu_bacteria 2939626828 2939628477 250
71 iso_pu_bacteria 2941475908 2941479571 250
72 iso_pu_bacteria 2941479691 2941480915 250
73 iso_pu_bacteria 2941489479 2941492663 250
74 iso_pu_bacteria 2961047084 2961050525 250
75 iso_pu_bacteria 2961064222 2961064324 250
76 iso_pu_bacteria 2974307012 2974307061 250
77 iso_pu_bacteria 2977247770 2977247805 250
78 iso_pu_bacteria 2984514374 2984517739 250
79 iso_pu_bacteria 2987605356 2987606920 250
80 iso_pu_bacteria 2995948881 2995949148 250
81 iso_pu_bacteria 8002392321 8002394493 250
82 iso_pu_bacteria 8002869464 8002870503 250
83 iso_pu_bacteria 8003014200 8003017880 250
84 iso_pu_bacteria 8021622325 8021622965 250
85 iso_pu_bacteria 8021626552 8021629101 250
86 iso_pu_bacteria 8021648035 8021651212 250
87 iso_pu_bacteria 8055225921 8055228845 250
88 3300031595 Ga0265313_10004333 Ga0265313_1000433310 251
89 3300002739 JGI25158J39367_1000920 JGI25158J39367_10009204 252
90 3300002773 JGI25152J39213_1000193 JGI25152J39213_100019320 252
91 3300002773 JGI25152J39213_1004366 JGI25152J39213_10043665 252
92 3300002774 JGI25150J39212_1000750 JGI25150J39212_10007509 252
93 3300002774 JGI25150J39212_1018475 JGI25150J39212_10184752 252
94 3300002987 JGI25159J45721_1003984 JGI25159J45721_10039843 252
95 3300003215 JGI25153J46596_10030078 JGI25153J46596_100300782 252
96 3300003374 JGI25161J50226_1000297 JGI25161J50226_100029724 252
97 3300003771 Ga0055526_1001727 Ga0055526_10017271 252
98 3300003771 Ga0055526_1010633 Ga0055526_10106333 252
99 3300003773 Ga0055537_1001624 Ga0055537_10016245 252
100 3300003773 Ga0055537_1013448 Ga0055537_10134482 252
101 3300003773 Ga0055537_1014085 Ga0055537_10140852 252
102 3300003775 Ga0055524_1000643 Ga0055524_100064311 252
103 3300003775 Ga0055524_1001633 Ga0055524_10016331 252
104 3300003775 Ga0055524_1002234 Ga0055524_10022347 252
105 3300003784 Ga0055534_1002504 Ga0055534_10025041 252
106 3300003784 Ga0055534_1018663 Ga0055534_10186631 252
107 3300003790 Ga0055528_1015545 Ga0055528_10155452 252
108 3300003791 Ga0055530_10001900 Ga0055530_100019009 252
109 3300003791 Ga0055530_10002434 Ga0055530_100024349 252
110 3300003794 Ga0055531_10000957 Ga0055531_1000095712 252
111 3300004625 Ga0055543_1000252 Ga0055543_100025215 252
112 3300005262 Ga0065165_1001171 Ga0065165_100117124 252
113 3300006195 Ga0075366_10169232 Ga0075366_101692322 252
114 3300025208 Ga0209436_100676 Ga0209436_10067615 252
115 3300025245 Ga0207425_1000017 Ga0207425_1000017378 252
116 3300025245 Ga0207425_1000207 Ga0207425_100020727 252
117 3300025258 Ga0209129_1000039 Ga0209129_100003921 252
118 3300025258 Ga0209129_1000911 Ga0209129_10009116 252
119 3300025263 Ga0209565_1001914 Ga0209565_10019145 252
120 3300025263 Ga0209565_1003744 Ga0209565_10037443 252
121 3300025263 Ga0209565_1006878 Ga0209565_10068783 252
122 3300025273 Ga0209673_1005008 Ga0209673_10050085 252
123 3300025284 Ga0209130_1000491 Ga0209130_100049124 252
124 3300025291 Ga0209675_1001501 Ga0209675_10015014 252
125 3300025295 Ga0209564_1001074 Ga0209564_10010744 252
126 3300025295 Ga0209564_1012232 Ga0209564_10122325 252
127 3300025297 Ga0209758_1000192 Ga0209758_100019221 252
128 3300025298 Ga0209050_1000762 Ga0209050_100076220 252
129 3300025298 Ga0209050_1001013 Ga0209050_100101311 252
130 3300025299 Ga0209256_1000651 Ga0209256_100065120 252
131 3300025299 Ga0209256_1000744 Ga0209256_100074422 252
132 3300025302 Ga0207426_1002252 Ga0207426_10022526 252
133 3300025303 Ga0209051_1024402 Ga0209051_10244022 252
134 3300025304 Ga0209257_1000501 Ga0209257_100050115 252
135 3300031548 Ga0307408_100000709 Ga0307408_1000007095 252
136 3300031548 Ga0307408_100007413 Ga0307408_1000074133 252
137 3300031548 Ga0307408_100053244 Ga0307408_1000532441 252
138 3300031548 Ga0307408_100438478 Ga0307408_1004384782 252
139 3300032002 Ga0307416_100004130 Ga0307416_1000041306 252
140 3300049775 Ga0501279_003974 Ga0501279_003974_38_802 252
141 3300050493 nmdc:mga0k408_163538_c1 nmdc:mga0k408_163538_c1_338_1102 252
142 3300027471 Ga0209995_1022150 Ga0209995_10221501 253
143 3300031456 Ga0307513_10169102 Ga0307513_101691022 253
144 3300031731 Ga0307405_10011866 Ga0307405_100118664 253
145 3300031731 Ga0307405_10142167 Ga0307405_101421672 253
146 3300031731 Ga0307405_10458274 Ga0307405_104582741 253
147 3300031824 Ga0307413_10006231 Ga0307413_100062316 253
148 3300031852 Ga0307410_10057455 Ga0307410_100574552 253
149 3300031903 Ga0307407_10004868 Ga0307407_100048686 253
150 3300031911 Ga0307412_10011263 Ga0307412_100112632 253
151 3300031911 Ga0307412_10015199 Ga0307412_100151996 253
152 3300031995 Ga0307409_100068370 Ga0307409_1000683702 253
153 3300031995 Ga0307409_100071858 Ga0307409_1000718583 253
154 3300031995 Ga0307409_100117340 Ga0307409_1001173403 253
155 3300032002 Ga0307416_100014749 Ga0307416_1000147492 253
156 3300032002 Ga0307416_100017645 Ga0307416_1000176453 253
157 3300032004 Ga0307414_10052008 Ga0307414_100520082 253
158 3300032005 Ga0307411_10004601 Ga0307411_100046012 253
159 3300032005 Ga0307411_10069586 Ga0307411_100695863 253
160 3300032126 Ga0307415_100141091 Ga0307415_1001410912 253
161 3300035089 Ga0373944_0090056 Ga0373944_0090056_182_961 253
162 3300035111 Ga0373923_0000862 Ga0373923_0000862_7087_7866 253
163 3300035113 Ga0373936_0006714 Ga0373936_0006714_3012_3791 253
164 3300035116 Ga0373945_0064419 Ga0373945_0064419_542_1321 253
165 3300035117 Ga0373953_0057597 Ga0373953_0057597_750_1529 253
166 3300035118 Ga0373954_0013189 Ga0373954_0013189_128_907 253
167 3300035171 Ga0373946_0066824 Ga0373946_0066824_392_1171 253
168 3300035172 Ga0373955_0017355 Ga0373955_0017355_1283_2062 253
169 3300035410 Ga0373924_0004079 Ga0373924_0004079_1343_2122 253
170 3300035692 Ga0373935_0001624 Ga0373935_0001624_4675_5454 253
171 3300035695 Ga0373927_0058015 Ga0373927_0058015_219_998 253
172 3300035724 Ga0373933_0025647 Ga0373933_0025647_321_1100 253
173 3300037068 Ga0373925_0093747 Ga0373925_0093747_1350_2129 253
174 3300044712 Ga0453684_0000531 Ga0453684_0000531_108596_109357 253
175 3300045051 Ga0451576_0000212 Ga0451576_0000212_108602_109363 253
176 3300046454 Ga0495592_0001826 Ga0495592_0001826_2193_2972 253
177 3300046459 Ga0495629_0095090 Ga0495629_0095090_361_1140 253
178 3300046461 Ga0495641_0004656 Ga0495641_0004656_6529_7308 253
179 3300046462 Ga0495651_0014231 Ga0495651_0014231_2951_3730 253
180 3300046463 Ga0495653_0001641 Ga0495653_0001641_15298_16077 253
181 3300046472 Ga0495580_0005997 Ga0495580_0005997_8264_9043 253
182 3300046475 Ga0495639_0001436 Ga0495639_0001436_1605_2384 253
183 3300046476 Ga0495662_0025189 Ga0495662_0025189_1325_2104 253
184 3300046477 Ga0495664_0062219 Ga0495664_0062219_1374_2153 253
185 3300046499 Ga0495594_0064939 Ga0495594_0064939_1051_1830 253
186 3300046511 Ga0495608_0043238 Ga0495608_0043238_1469_2248 253
187 3300046517 Ga0495630_0025382 Ga0495630_0025382_2840_3619 253
188 3300046526 Ga0495666_0032105 Ga0495666_0032105_1378_2157 253
189 3300046529 Ga0495652_0085957 Ga0495652_0085957_944_1723 253
190 3300046529 Ga0495652_0139353 Ga0495652_0139353_877_1656 253
191 3300046531 Ga0495665_0003413 Ga0495665_0003413_1571_2350 253
192 3300046535 Ga0495586_0083110 Ga0495586_0083110_220_999 253
193 3300046536 Ga0495587_0005671 Ga0495587_0005671_777_1556 253
194 3300046536 Ga0495587_0142409 Ga0495587_0142409_571_1350 253
195 3300046559 Ga0495667_0109286 Ga0495667_0109286_321_1100 253
196 3300046642 Ga0495634_0028244 Ga0495634_0028244_2190_2969 253
197 3300046675 Ga0495657_0035685 Ga0495657_0035685_1762_2541 253
198 3300046678 Ga0495599_0003119 Ga0495599_0003119_7965_8744 253
199 3300046678 Ga0495599_0165056 Ga0495599_0165056_20_799 253
200 3300046680 Ga0495646_0192039 Ga0495646_0192039_175_954 253
201 3300046681 Ga0495647_0003192 Ga0495647_0003192_2412_3191 253
202 3300046689 Ga0495613_0027013 Ga0495613_0027013_3038_3817 253
203 3300046690 Ga0495624_0051172 Ga0495624_0051172_901_1680 253
204 3300046809 Ga0495600_0015163 Ga0495600_0015163_927_1706 253
205 3300047319 Ga0495674_0001688 Ga0495674_0001688_4725_5504 253
206 3300047444 Ga0495675_0019631 Ga0495675_0019631_1933_2712 253
207 3300047471 Ga0495684_0098846 Ga0495684_0098846_56_835 253
208 3300047673 Ga0495593_0026356 Ga0495593_0026356_924_1703 253
209 3300049573 Ga0501037_0131956 Ga0501037_0131956_975_1748 253
210 3300049580 Ga0501046_0046585 Ga0501046_0046585_1371_2141 253
211 3300049581 Ga0501047_0031843 Ga0501047_0031843_473_1243 253
212 3300049823 Ga0501044_0013036 Ga0501044_0013036_3989_4759 253
213 3300053077 Ga0495601_0009026 Ga0495601_0009026_603_1382 253
214 3300053077 Ga0495601_0010532 Ga0495601_0010532_3747_4526 253
215 3300053084 Ga0495595_0017945 Ga0495595_0017945_1366_2145 253
216 3300059424 Ga0590075_052512 Ga0590075_052512_194_967 253
217 iso_pu_bacteria 8048746797 8048749525 253
218 3300001904 JGI24736J21556_1024077 JGI24736J21556_10240772 254
219 3300001991 JGI24743J22301_10004704 JGI24743J22301_100047041 254
220 3300002773 JGI25152J39213_1000038 JGI25152J39213_10000384 254
221 3300002774 JGI25150J39212_1000853 JGI25150J39212_100085311 254
222 3300003187 JGI25151J46595_10000088 JGI25151J46595_1000008846 254
223 3300003187 JGI25151J46595_10000150 JGI25151J46595_1000015072 254
224 3300003187 JGI25151J46595_10000301 JGI25151J46595_1000030145 254
225 3300003215 JGI25153J46596_10000114 JGI25153J46596_100001144 254
226 3300003320 rootH2_10001820 rootH2_100018205 254
227 3300003763 Ga0055529_1000732 Ga0055529_10007321 254
228 3300003771 Ga0055526_1000004 Ga0055526_1000004268 254
229 3300003771 Ga0055526_1000814 Ga0055526_100081417 254
230 3300003771 Ga0055526_1023336 Ga0055526_10233362 254
231 3300003773 Ga0055537_1000895 Ga0055537_10008957 254
232 3300003773 Ga0055537_1000989 Ga0055537_100098915 254
233 3300003775 Ga0055524_1000004 Ga0055524_1000004268 254
234 3300003775 Ga0055524_1007359 Ga0055524_10073592 254
235 3300003775 Ga0055524_1009812 Ga0055524_10098124 254
236 3300003781 Ga0055536_1001019 Ga0055536_100101915 254
237 3300003781 Ga0055536_1004649 Ga0055536_10046497 254
238 3300003781 Ga0055536_1005039 Ga0055536_10050394 254
239 3300003781 Ga0055536_1005666 Ga0055536_10056663 254
240 3300003784 Ga0055534_1000011 Ga0055534_100001140 254
241 3300003784 Ga0055534_1000307 Ga0055534_100030710 254
242 3300003790 Ga0055528_1000015 Ga0055528_100001540 254
243 3300003790 Ga0055528_1000402 Ga0055528_100040211 254
244 3300003791 Ga0055530_10000735 Ga0055530_1000073518 254
245 3300003791 Ga0055530_10002970 Ga0055530_100029705 254
246 3300003791 Ga0055530_10003788 Ga0055530_100037884 254
247 3300003794 Ga0055531_10004989 Ga0055531_100049898 254
248 3300003794 Ga0055531_10009018 Ga0055531_100090185 254
249 3300003794 Ga0055531_10012636 Ga0055531_100126365 254
250 3300003794 Ga0055531_10018072 Ga0055531_100180722 254
251 3300003856 Ga0058692_1000004 Ga0058692_1000004379 254
252 3300003856 Ga0058692_1000081 Ga0058692_100008152 254
253 3300005289 Ga0065704_10003668 Ga0065704_100036682 254
254 3300005289 Ga0065704_10078390 Ga0065704_100783904 254
255 3300005289 Ga0065704_10108682 Ga0065704_101086822 254
256 3300005289 Ga0065704_10261491 Ga0065704_102614911 254
257 3300005293 Ga0065715_10092369 Ga0065715_100923696 254
258 3300005293 Ga0065715_10176008 Ga0065715_101760083 254
259 3300005327 Ga0070658_10002650 Ga0070658_100026508 254
260 3300005327 Ga0070658_10165102 Ga0070658_101651022 254
261 3300005328 Ga0070676_10001120 Ga0070676_1000112012 254
262 3300005328 Ga0070676_10189132 Ga0070676_101891321 254
263 3300005329 Ga0070683_100285066 Ga0070683_1002850662 254
264 3300005330 Ga0070690_100005180 Ga0070690_1000051806 254
265 3300005331 Ga0070670_100003557 Ga0070670_10000355712 254
266 3300005331 Ga0070670_100003888 Ga0070670_1000038887 254
267 3300005331 Ga0070670_100010975 Ga0070670_1000109753 254
268 3300005331 Ga0070670_100054519 Ga0070670_1000545193 254
269 3300005331 Ga0070670_100151556 Ga0070670_1001515562 254
270 3300005331 Ga0070670_100441955 Ga0070670_1004419551 254
271 3300005334 Ga0068869_100006084 Ga0068869_1000060844 254
272 3300005334 Ga0068869_100040635 Ga0068869_1000406352 254
273 3300005335 Ga0070666_10000577 Ga0070666_100005774 254
274 3300005335 Ga0070666_10020409 Ga0070666_100204092 254
275 3300005336 Ga0070680_100314196 Ga0070680_1003141962 254
276 3300005337 Ga0070682_100443507 Ga0070682_1004435071 254
277 3300005338 Ga0068868_100025585 Ga0068868_1000255852 254
278 3300005338 Ga0068868_100185175 Ga0068868_1001851752 254
279 3300005338 Ga0068868_100278767 Ga0068868_1002787672 254
280 3300005339 Ga0070660_100047843 Ga0070660_1000478433 254
281 3300005340 Ga0070689_100002618 Ga0070689_1000026187 254
282 3300005341 Ga0070691_10025785 Ga0070691_100257851 254
283 3300005343 Ga0070687_100145626 Ga0070687_1001456261 254
284 3300005344 Ga0070661_100005508 Ga0070661_1000055086 254
285 3300005344 Ga0070661_100016100 Ga0070661_1000161003 254
286 3300005344 Ga0070661_100026513 Ga0070661_1000265132 254
287 3300005344 Ga0070661_100043597 Ga0070661_1000435973 254
288 3300005344 Ga0070661_100159092 Ga0070661_1001590922 254
289 3300005345 Ga0070692_10051008 Ga0070692_100510082 254
290 3300005347 Ga0070668_100002646 Ga0070668_10000264612 254
291 3300005347 Ga0070668_100007344 Ga0070668_1000073442 254
292 3300005347 Ga0070668_100093516 Ga0070668_1000935162 254
293 3300005347 Ga0070668_100514772 Ga0070668_1005147721 254
294 3300005353 Ga0070669_100008575 Ga0070669_1000085753 254
295 3300005355 Ga0070671_100297102 Ga0070671_1002971021 254
296 3300005355 Ga0070671_100385743 Ga0070671_1003857431 254
297 3300005356 Ga0070674_100032045 Ga0070674_1000320453 254
298 3300005356 Ga0070674_100061491 Ga0070674_1000614913 254
299 3300005356 Ga0070674_100368122 Ga0070674_1003681222 254
300 3300005364 Ga0070673_100083000 Ga0070673_1000830003 254
301 3300005364 Ga0070673_100134766 Ga0070673_1001347662 254
302 3300005364 Ga0070673_100268745 Ga0070673_1002687452 254
303 3300005365 Ga0070688_100002518 Ga0070688_1000025186 254
304 3300005366 Ga0070659_100058852 Ga0070659_1000588522 254
305 3300005367 Ga0070667_100000093 Ga0070667_10000009326 254
306 3300005367 Ga0070667_100016502 Ga0070667_1000165025 254
307 3300005367 Ga0070667_100021576 Ga0070667_1000215763 254
308 3300005367 Ga0070667_100087528 Ga0070667_1000875282 254
309 3300005367 Ga0070667_100179755 Ga0070667_1001797552 254
310 3300005439 Ga0070711_100135372 Ga0070711_1001353723 254
311 3300005441 Ga0070700_100009560 Ga0070700_1000095605 254
312 3300005455 Ga0070663_100000074 Ga0070663_10000007418 254
313 3300005455 Ga0070663_100007006 Ga0070663_1000070065 254
314 3300005455 Ga0070663_100039692 Ga0070663_1000396922 254
315 3300005455 Ga0070663_100045216 Ga0070663_1000452163 254
316 3300005455 Ga0070663_100063642 Ga0070663_1000636423 254
317 3300005455 Ga0070663_100250283 Ga0070663_1002502832 254
318 3300005456 Ga0070678_100000776 Ga0070678_1000007762 254
319 3300005456 Ga0070678_100011104 Ga0070678_1000111045 254
320 3300005456 Ga0070678_100076617 Ga0070678_1000766172 254
321 3300005456 Ga0070678_100149965 Ga0070678_1001499652 254
322 3300005456 Ga0070678_100175284 Ga0070678_1001752842 254
323 3300005457 Ga0070662_100001663 Ga0070662_1000016638 254
324 3300005457 Ga0070662_100014449 Ga0070662_1000144492 254
325 3300005458 Ga0070681_10000243 Ga0070681_1000024321 254
326 3300005458 Ga0070681_10063074 Ga0070681_100630742 254
327 3300005459 Ga0068867_100077114 Ga0068867_1000771142 254
328 3300005459 Ga0068867_100099611 Ga0068867_1000996113 254
329 3300005459 Ga0068867_100218592 Ga0068867_1002185922 254
330 3300005466 Ga0070685_10003579 Ga0070685_100035792 254
331 3300005530 Ga0070679_100159767 Ga0070679_1001597672 254
332 3300005535 Ga0070684_100133713 Ga0070684_1001337133 254
333 3300005535 Ga0070684_100194648 Ga0070684_1001946481 254
334 3300005535 Ga0070684_100596506 Ga0070684_1005965062 254
335 3300005539 Ga0068853_100000578 Ga0068853_1000005783 254
336 3300005539 Ga0068853_100021814 Ga0068853_1000218142 254
337 3300005539 Ga0068853_100054059 Ga0068853_1000540592 254
338 3300005539 Ga0068853_100129864 Ga0068853_1001298642 254
339 3300005539 Ga0068853_100184051 Ga0068853_1001840512 254
340 3300005539 Ga0068853_100279156 Ga0068853_1002791562 254
341 3300005543 Ga0070672_100003822 Ga0070672_1000038225 254
342 3300005543 Ga0070672_100005243 Ga0070672_1000052434 254
343 3300005543 Ga0070672_100180021 Ga0070672_1001800212 254
344 3300005544 Ga0070686_100055974 Ga0070686_1000559742 254
345 3300005545 Ga0070695_100157790 Ga0070695_1001577901 254
346 3300005546 Ga0070696_100018733 Ga0070696_1000187335 254
347 3300005546 Ga0070696_100132180 Ga0070696_1001321801 254
348 3300005547 Ga0070693_100000509 Ga0070693_1000005098 254
349 3300005547 Ga0070693_100082494 Ga0070693_1000824942 254
350 3300005547 Ga0070693_100100654 Ga0070693_1001006542 254
351 3300005548 Ga0070665_100007229 Ga0070665_1000072297 254
352 3300005548 Ga0070665_100109232 Ga0070665_1001092322 254
353 3300005548 Ga0070665_100111864 Ga0070665_1001118643 254
354 3300005548 Ga0070665_100187628 Ga0070665_1001876282 254
355 3300005548 Ga0070665_100635149 Ga0070665_1006351491 254
356 3300005563 Ga0068855_100004536 Ga0068855_10000453617 254
357 3300005563 Ga0068855_100009173 Ga0068855_1000091733 254
358 3300005563 Ga0068855_100040398 Ga0068855_1000403983 254
359 3300005563 Ga0068855_100313357 Ga0068855_1003133572 254
360 3300005563 Ga0068855_100335328 Ga0068855_1003353282 254
361 3300005563 Ga0068855_100337440 Ga0068855_1003374402 254
362 3300005563 Ga0068855_100379273 Ga0068855_1003792732 254
363 3300005564 Ga0070664_100010274 Ga0070664_1000102743 254
364 3300005564 Ga0070664_100194393 Ga0070664_1001943932 254
365 3300005564 Ga0070664_100209492 Ga0070664_1002094922 254
366 3300005577 Ga0068857_100061469 Ga0068857_1000614694 254
367 3300005578 Ga0068854_100001301 Ga0068854_1000013018 254
368 3300005578 Ga0068854_100011907 Ga0068854_1000119073 254
369 3300005578 Ga0068854_100027976 Ga0068854_1000279762 254
370 3300005578 Ga0068854_100048656 Ga0068854_1000486562 254
371 3300005578 Ga0068854_100277202 Ga0068854_1002772022 254
372 3300005614 Ga0068856_100018818 Ga0068856_1000188183 254
373 3300005614 Ga0068856_100044064 Ga0068856_1000440642 254
374 3300005614 Ga0068856_100129659 Ga0068856_1001296593 254
375 3300005614 Ga0068856_100443287 Ga0068856_1004432872 254
376 3300005615 Ga0070702_100001462 Ga0070702_1000014626 254
377 3300005615 Ga0070702_100066305 Ga0070702_1000663053 254
378 3300005616 Ga0068852_100026922 Ga0068852_1000269223 254
379 3300005616 Ga0068852_100028348 Ga0068852_1000283483 254
380 3300005616 Ga0068852_100118919 Ga0068852_1001189193 254
381 3300005617 Ga0068859_100000070 Ga0068859_10000007020 254
382 3300005617 Ga0068859_100012026 Ga0068859_1000120264 254
383 3300005617 Ga0068859_100190722 Ga0068859_1001907222 254
384 3300005618 Ga0068864_100125069 Ga0068864_1001250692 254
385 3300005618 Ga0068864_100227982 Ga0068864_1002279822 254
386 3300005618 Ga0068864_100292975 Ga0068864_1002929752 254
387 3300005718 Ga0068866_10009679 Ga0068866_100096793 254
388 3300005718 Ga0068866_10071179 Ga0068866_100711792 254
389 3300005718 Ga0068866_10113996 Ga0068866_101139962 254
390 3300005834 Ga0068851_10001563 Ga0068851_100015635 254
391 3300005834 Ga0068851_10006025 Ga0068851_100060255 254
392 3300005834 Ga0068851_10081987 Ga0068851_100819872 254
393 3300005834 Ga0068851_10139577 Ga0068851_101395772 254
394 3300005840 Ga0068870_10291551 Ga0068870_102915512 254
395 3300005841 Ga0068863_100010036 Ga0068863_1000100366 254
396 3300005841 Ga0068863_100164046 Ga0068863_1001640462 254
397 3300005842 Ga0068858_100000804 Ga0068858_10000080424 254
398 3300005842 Ga0068858_100110461 Ga0068858_1001104613 254
399 3300005842 Ga0068858_100260631 Ga0068858_1002606312 254
400 3300005842 Ga0068858_100493402 Ga0068858_1004934021 254
401 3300005843 Ga0068860_100106820 Ga0068860_1001068202 254
402 3300005843 Ga0068860_100197464 Ga0068860_1001974642 254
403 3300005843 Ga0068860_100271980 Ga0068860_1002719802 254
404 3300005843 Ga0068860_100381518 Ga0068860_1003815182 254
405 3300005844 Ga0068862_100000041 Ga0068862_10000004121 254
406 3300005844 Ga0068862_100369154 Ga0068862_1003691542 254
407 3300005937 Ga0081455_10120705 Ga0081455_101207052 254
408 3300006038 Ga0075365_10007996 Ga0075365_100079964 254
409 3300006051 Ga0075364_10000485 Ga0075364_100004857 254
410 3300006051 Ga0075364_10001168 Ga0075364_1000116810 254
411 3300006051 Ga0075364_10022082 Ga0075364_100220823 254
412 3300006051 Ga0075364_10055881 Ga0075364_100558813 254
413 3300006051 Ga0075364_10082547 Ga0075364_100825472 254
414 3300006051 Ga0075364_10179337 Ga0075364_101793372 254
415 3300006177 Ga0075362_10047354 Ga0075362_100473543 254
416 3300006178 Ga0075367_10031717 Ga0075367_100317172 254
417 3300006186 Ga0075369_10054283 Ga0075369_100542832 254
418 3300006237 Ga0097621_100007318 Ga0097621_1000073183 254
419 3300006237 Ga0097621_100151269 Ga0097621_1001512692 254
420 3300006358 Ga0068871_100013081 Ga0068871_1000130814 254
421 3300006358 Ga0068871_100119672 Ga0068871_1001196722 254
422 3300006358 Ga0068871_100165938 Ga0068871_1001659382 254
423 3300006358 Ga0068871_100266055 Ga0068871_1002660552 254
424 3300006844 Ga0075428_100019227 Ga0075428_1000192273 254
425 3300006881 Ga0068865_100011567 Ga0068865_1000115672 254
426 3300006881 Ga0068865_100044347 Ga0068865_1000443473 254
427 3300006881 Ga0068865_100113766 Ga0068865_1001137662 254
428 3300006931 Ga0097620_100000070 Ga0097620_10000007020 254
429 3300006931 Ga0097620_100012024 Ga0097620_1000120246 254
430 3300006931 Ga0097620_100190723 Ga0097620_1001907232 254
431 3300009011 Ga0105251_10000008 Ga0105251_1000000878 254
432 3300009011 Ga0105251_10002580 Ga0105251_100025805 254
433 3300009036 Ga0105244_10021705 Ga0105244_100217052 254
434 3300009093 Ga0105240_10000992 Ga0105240_1000099231 254
435 3300009093 Ga0105240_10001714 Ga0105240_100017145 254
436 3300009093 Ga0105240_10014134 Ga0105240_100141345 254
437 3300009093 Ga0105240_10769215 Ga0105240_107692152 254
438 3300009094 Ga0111539_10006771 Ga0111539_100067715 254
439 3300009094 Ga0111539_10827245 Ga0111539_108272451 254
440 3300009098 Ga0105245_10019996 Ga0105245_100199964 254
441 3300009098 Ga0105245_10034912 Ga0105245_100349124 254
442 3300009098 Ga0105245_10202139 Ga0105245_102021392 254
443 3300009098 Ga0105245_10369068 Ga0105245_103690682 254
444 3300009101 Ga0105247_10027332 Ga0105247_100273323 254
445 3300009148 Ga0105243_10061151 Ga0105243_100611515 254
446 3300009148 Ga0105243_10116950 Ga0105243_101169502 254
447 3300009174 Ga0105241_10072522 Ga0105241_100725222 254
448 3300009174 Ga0105241_10435173 Ga0105241_104351732 254
449 3300009176 Ga0105242_10009006 Ga0105242_100090065 254
450 3300009176 Ga0105242_10024319 Ga0105242_100243193 254
451 3300009176 Ga0105242_10188148 Ga0105242_101881482 254
452 3300009176 Ga0105242_10292505 Ga0105242_102925052 254
453 3300009177 Ga0105248_10000248 Ga0105248_1000024811 254
454 3300009177 Ga0105248_10006632 Ga0105248_100066327 254
455 3300009177 Ga0105248_10069552 Ga0105248_100695522 254
456 3300009177 Ga0105248_10120284 Ga0105248_101202842 254
457 3300009177 Ga0105248_10149591 Ga0105248_101495912 254
458 3300009177 Ga0105248_10552135 Ga0105248_105521351 254
459 3300009545 Ga0105237_10002027 Ga0105237_100020275 254
460 3300009545 Ga0105237_10011873 Ga0105237_100118737 254
461 3300009545 Ga0105237_10012838 Ga0105237_100128388 254
462 3300009545 Ga0105237_10159926 Ga0105237_101599262 254
463 3300009551 Ga0105238_10131137 Ga0105238_101311372 254
464 3300009551 Ga0105238_10684490 Ga0105238_106844901 254
465 3300009553 Ga0105249_10000461 Ga0105249_1000046120 254
466 3300009553 Ga0105249_10002353 Ga0105249_100023539 254
467 3300009553 Ga0105249_10313365 Ga0105249_103133652 254
468 3300009553 Ga0105249_10347126 Ga0105249_103471261 254
469 3300009979 Ga0105032_100625 Ga0105032_1006253 254
470 3300009993 Ga0105028_100958 Ga0105028_1009582 254
471 3300010375 Ga0105239_10003209 Ga0105239_100032093 254
472 3300010375 Ga0105239_10011170 Ga0105239_100111703 254
473 3300010375 Ga0105239_10037420 Ga0105239_100374202 254
474 3300010375 Ga0105239_10564802 Ga0105239_105648022 254
475 3300011119 Ga0105246_10043071 Ga0105246_100430712 254
476 3300011119 Ga0105246_10102369 Ga0105246_101023692 254
477 3300011119 Ga0105246_10734917 Ga0105246_107349171 254
478 3300012506 Ga0157324_1005182 Ga0157324_10051821 254
479 3300013100 Ga0157373_10007795 Ga0157373_100077952 254
480 3300013100 Ga0157373_10059492 Ga0157373_100594924 254
481 3300013100 Ga0157373_10222618 Ga0157373_102226182 254
482 3300013102 Ga0157371_10009777 Ga0157371_100097775 254
483 3300013102 Ga0157371_10059570 Ga0157371_100595703 254
484 3300013104 Ga0157370_10005233 Ga0157370_1000523315 254
485 3300013104 Ga0157370_10026814 Ga0157370_100268143 254
486 3300013104 Ga0157370_10072516 Ga0157370_100725162 254
487 3300013104 Ga0157370_10135275 Ga0157370_101352753 254
488 3300013104 Ga0157370_10295486 Ga0157370_102954862 254
489 3300013104 Ga0157370_10803634 Ga0157370_108036341 254
490 3300013105 Ga0157369_10157246 Ga0157369_101572462 254
491 3300013105 Ga0157369_10165287 Ga0157369_101652872 254
492 3300013105 Ga0157369_10231428 Ga0157369_102314282 254
493 3300013296 Ga0157374_10024579 Ga0157374_100245793 254
494 3300013296 Ga0157374_10089761 Ga0157374_100897613 254
495 3300013297 Ga0157378_10000266 Ga0157378_1000026630 254
496 3300013297 Ga0157378_10018161 Ga0157378_100181614 254
497 3300013306 Ga0163162_10026275 Ga0163162_100262753 254
498 3300013306 Ga0163162_10030151 Ga0163162_100301512 254
499 3300013306 Ga0163162_10283861 Ga0163162_102838612 254
500 3300013306 Ga0163162_10801224 Ga0163162_108012241 254
501 3300013307 Ga0157372_10125621 Ga0157372_101256213 254
502 3300013307 Ga0157372_10172357 Ga0157372_101723573 254
503 3300013307 Ga0157372_10179320 Ga0157372_101793203 254
504 3300013307 Ga0157372_10215953 Ga0157372_102159532 254
505 3300013307 Ga0157372_10344230 Ga0157372_103442302 254
506 3300013307 Ga0157372_10483589 Ga0157372_104835892 254
507 3300013307 Ga0157372_10622088 Ga0157372_106220882 254
508 3300013308 Ga0157375_10000590 Ga0157375_1000059026 254
509 3300013308 Ga0157375_10125276 Ga0157375_101252761 254
510 3300013308 Ga0157375_10205533 Ga0157375_102055333 254
511 3300013308 Ga0157375_10293737 Ga0157375_102937372 254
512 3300013308 Ga0157375_10330217 Ga0157375_103302173 254
513 3300013308 Ga0157375_10396353 Ga0157375_103963533 254
514 3300013308 Ga0157375_10660075 Ga0157375_106600752 254
515 3300014326 Ga0157380_10004314 Ga0157380_100043142 254
516 3300014326 Ga0157380_10385809 Ga0157380_103858092 254
517 3300014497 Ga0182008_10000913 Ga0182008_100009134 254
518 3300014497 Ga0182008_10006499 Ga0182008_100064992 254
519 3300014745 Ga0157377_10084001 Ga0157377_100840013 254
520 3300014745 Ga0157377_10404001 Ga0157377_104040011 254
521 3300014968 Ga0157379_10015085 Ga0157379_100150855 254
522 3300014968 Ga0157379_10189035 Ga0157379_101890352 254
523 3300014968 Ga0157379_10295181 Ga0157379_102951812 254
524 3300014969 Ga0157376_10002766 Ga0157376_100027668 254
525 3300014969 Ga0157376_10006265 Ga0157376_100062654 254
526 3300014969 Ga0157376_10070955 Ga0157376_100709553 254
527 3300014969 Ga0157376_10156788 Ga0157376_101567882 254
528 3300015261 Ga0182006_1002721 Ga0182006_10027214 254
529 3300015261 Ga0182006_1039260 Ga0182006_10392602 254
530 3300015261 Ga0182006_1065963 Ga0182006_10659632 254
531 3300015261 Ga0182006_1069303 Ga0182006_10693032 254
532 3300015262 Ga0182007_10000019 Ga0182007_100000193 254
533 3300015265 Ga0182005_1004719 Ga0182005_10047193 254
534 3300015265 Ga0182005_1025595 Ga0182005_10255952 254
535 3300015265 Ga0182005_1084766 Ga0182005_10847661 254
536 3300015689 Ga0183360_10004 Ga0183360_10004156 254
537 3300017792 Ga0163161_10022996 Ga0163161_100229962 254
538 3300017792 Ga0163161_10044710 Ga0163161_100447102 254
539 3300017792 Ga0163161_10079211 Ga0163161_100792112 254
540 3300025228 Ga0209672_102702 Ga0209672_1027021 254
541 3300025245 Ga0207425_1000029 Ga0207425_1000029182 254
542 3300025258 Ga0209129_1000073 Ga0209129_100007353 254
543 3300025261 Ga0209233_1001467 Ga0209233_10014673 254
544 3300025263 Ga0209565_1000002 Ga0209565_10000021135 254
545 3300025263 Ga0209565_1000113 Ga0209565_100011362 254
546 3300025272 Ga0209455_1001143 Ga0209455_10011438 254
547 3300025273 Ga0209673_1000002 Ga0209673_10000021135 254
548 3300025273 Ga0209673_1000369 Ga0209673_100036926 254
549 3300025273 Ga0209673_1045019 Ga0209673_10450192 254
550 3300025284 Ga0209130_1004985 Ga0209130_10049855 254
551 3300025291 Ga0209675_1000002 Ga0209675_10000021135 254
552 3300025291 Ga0209675_1000007 Ga0209675_100000740 254
553 3300025291 Ga0209675_1008509 Ga0209675_10085094 254
554 3300025292 Ga0209676_1000018 Ga0209676_1000018505 254
555 3300025292 Ga0209676_1000063 Ga0209676_100006387 254
556 3300025292 Ga0209676_1000143 Ga0209676_1000143163 254
557 3300025292 Ga0209676_1001214 Ga0209676_100121424 254
558 3300025292 Ga0209676_1001361 Ga0209676_10013614 254
559 3300025292 Ga0209676_1001572 Ga0209676_10015723 254
560 3300025292 Ga0209676_1001849 Ga0209676_100184912 254
561 3300025292 Ga0209676_1003463 Ga0209676_10034632 254
562 3300025292 Ga0209676_1004197 Ga0209676_10041975 254
563 3300025292 Ga0209676_1008023 Ga0209676_10080232 254
564 3300025292 Ga0209676_1055337 Ga0209676_10553372 254
565 3300025294 Ga0209025_1000003 Ga0209025_10000031211 254
566 3300025294 Ga0209025_1000076 Ga0209025_1000076186 254
567 3300025294 Ga0209025_1000134 Ga0209025_100013461 254
568 3300025294 Ga0209025_1001794 Ga0209025_100179415 254
569 3300025294 Ga0209025_1020240 Ga0209025_10202402 254
570 3300025294 Ga0209025_1040287 Ga0209025_10402873 254
571 3300025295 Ga0209564_1000004 Ga0209564_10000041136 254
572 3300025295 Ga0209564_1000333 Ga0209564_100033339 254
573 3300025295 Ga0209564_1006121 Ga0209564_10061212 254
574 3300025297 Ga0209758_1000112 Ga0209758_1000112122 254
575 3300025297 Ga0209758_1015301 Ga0209758_10153011 254
576 3300025298 Ga0209050_1000396 Ga0209050_100039635 254
577 3300025298 Ga0209050_1001391 Ga0209050_100139111 254
578 3300025298 Ga0209050_1001430 Ga0209050_100143016 254
579 3300025298 Ga0209050_1001743 Ga0209050_100174310 254
580 3300025298 Ga0209050_1029071 Ga0209050_10290712 254
581 3300025299 Ga0209256_1000004 Ga0209256_10000041136 254
582 3300025299 Ga0209256_1002151 Ga0209256_100215110 254
583 3300025299 Ga0209256_1005124 Ga0209256_10051245 254
584 3300025303 Ga0209051_1000449 Ga0209051_100044911 254
585 3300025303 Ga0209051_1019788 Ga0209051_10197882 254
586 3300025303 Ga0209051_1028554 Ga0209051_10285542 254
587 3300025304 Ga0209257_1000035 Ga0209257_1000035505 254
588 3300025304 Ga0209257_1000240 Ga0209257_100024052 254
589 3300025304 Ga0209257_1000474 Ga0209257_10004745 254
590 3300025304 Ga0209257_1000568 Ga0209257_100056811 254
591 3300025304 Ga0209257_1000861 Ga0209257_100086117 254
592 3300025304 Ga0209257_1002284 Ga0209257_100228419 254
593 3300025304 Ga0209257_1002512 Ga0209257_100251218 254
594 3300025304 Ga0209257_1002921 Ga0209257_100292110 254
595 3300025304 Ga0209257_1010545 Ga0209257_10105453 254
596 3300025315 Ga0207697_10000237 Ga0207697_100002378 254
597 3300025321 Ga0207656_10000534 Ga0207656_1000053410 254
598 3300025321 Ga0207656_10031968 Ga0207656_100319683 254
599 3300025321 Ga0207656_10076576 Ga0207656_100765762 254
600 3300025728 Ga0207655_1022247 Ga0207655_10222472 254
601 3300025735 Ga0207713_1000170 Ga0207713_100017053 254
602 3300025735 Ga0207713_1015181 Ga0207713_10151815 254
603 3300025893 Ga0207682_10000203 Ga0207682_1000020318 254
604 3300025899 Ga0207642_10014937 Ga0207642_100149372 254
605 3300025899 Ga0207642_10032527 Ga0207642_100325272 254
606 3300025901 Ga0207688_10000362 Ga0207688_100003625 254
607 3300025903 Ga0207680_10073082 Ga0207680_100730822 254
608 3300025903 Ga0207680_10316615 Ga0207680_103166152 254
609 3300025904 Ga0207647_10000059 Ga0207647_1000005938 254
610 3300025907 Ga0207645_10006362 Ga0207645_100063623 254
611 3300025907 Ga0207645_10039941 Ga0207645_100399412 254
612 3300025907 Ga0207645_10097899 Ga0207645_100978991 254
613 3300025908 Ga0207643_10000311 Ga0207643_100003116 254
614 3300025908 Ga0207643_10071376 Ga0207643_100713763 254
615 3300025909 Ga0207705_10050600 Ga0207705_100506002 254
616 3300025909 Ga0207705_10073106 Ga0207705_100731061 254
617 3300025911 Ga0207654_10006165 Ga0207654_100061654 254
618 3300025911 Ga0207654_10065136 Ga0207654_100651363 254
619 3300025912 Ga0207707_10000131 Ga0207707_1000013126 254
620 3300025913 Ga0207695_10000200 Ga0207695_1000020031 254
621 3300025913 Ga0207695_10017714 Ga0207695_100177144 254
622 3300025913 Ga0207695_10055125 Ga0207695_100551252 254
623 3300025913 Ga0207695_10071019 Ga0207695_100710193 254
624 3300025914 Ga0207671_10002540 Ga0207671_100025409 254
625 3300025914 Ga0207671_10022237 Ga0207671_100222374 254
626 3300025914 Ga0207671_10048206 Ga0207671_100482063 254
627 3300025914 Ga0207671_10106852 Ga0207671_101068523 254
628 3300025914 Ga0207671_10165644 Ga0207671_101656442 254
629 3300025916 Ga0207663_10017861 Ga0207663_100178614 254
630 3300025916 Ga0207663_10069789 Ga0207663_100697893 254
631 3300025917 Ga0207660_10268379 Ga0207660_102683792 254
632 3300025918 Ga0207662_10007909 Ga0207662_100079096 254
633 3300025918 Ga0207662_10059720 Ga0207662_100597202 254
634 3300025919 Ga0207657_10026007 Ga0207657_100260073 254
635 3300025919 Ga0207657_10080919 Ga0207657_100809193 254
636 3300025919 Ga0207657_10157374 Ga0207657_101573742 254
637 3300025920 Ga0207649_10104698 Ga0207649_101046982 254
638 3300025920 Ga0207649_10117022 Ga0207649_101170222 254
639 3300025920 Ga0207649_10201480 Ga0207649_102014801 254
640 3300025920 Ga0207649_10219589 Ga0207649_102195892 254
641 3300025921 Ga0207652_10063100 Ga0207652_100631003 254
642 3300025923 Ga0207681_10004695 Ga0207681_100046955 254
643 3300025924 Ga0207694_10000410 Ga0207694_1000041038 254
644 3300025924 Ga0207694_10002651 Ga0207694_100026519 254
645 3300025925 Ga0207650_10000609 Ga0207650_1000060924 254
646 3300025925 Ga0207650_10002614 Ga0207650_100026145 254
647 3300025925 Ga0207650_10279459 Ga0207650_102794591 254
648 3300025926 Ga0207659_10156016 Ga0207659_101560162 254
649 3300025927 Ga0207687_10009983 Ga0207687_100099835 254
650 3300025927 Ga0207687_10171151 Ga0207687_101711512 254
651 3300025927 Ga0207687_10410287 Ga0207687_104102872 254
652 3300025928 Ga0207700_10098129 Ga0207700_100981293 254
653 3300025931 Ga0207644_10012273 Ga0207644_100122733 254
654 3300025931 Ga0207644_10181303 Ga0207644_101813032 254
655 3300025931 Ga0207644_10464724 Ga0207644_104647241 254
656 3300025932 Ga0207690_10077915 Ga0207690_100779151 254
657 3300025933 Ga0207706_10000486 Ga0207706_100004865 254
658 3300025933 Ga0207706_10004757 Ga0207706_100047576 254
659 3300025933 Ga0207706_10004850 Ga0207706_100048507 254
660 3300025933 Ga0207706_10401802 Ga0207706_104018022 254
661 3300025933 Ga0207706_10532245 Ga0207706_105322451 254
662 3300025934 Ga0207686_10000924 Ga0207686_1000092411 254
663 3300025934 Ga0207686_10027755 Ga0207686_100277552 254
664 3300025934 Ga0207686_10524946 Ga0207686_105249461 254
665 3300025935 Ga0207709_10000972 Ga0207709_1000097210 254
666 3300025935 Ga0207709_10033646 Ga0207709_100336462 254
667 3300025935 Ga0207709_10244807 Ga0207709_102448072 254
668 3300025936 Ga0207670_10018217 Ga0207670_100182174 254
669 3300025937 Ga0207669_10021865 Ga0207669_100218653 254
670 3300025937 Ga0207669_10095764 Ga0207669_100957642 254
671 3300025937 Ga0207669_10290839 Ga0207669_102908392 254
672 3300025937 Ga0207669_10425175 Ga0207669_104251751 254
673 3300025938 Ga0207704_10026697 Ga0207704_100266972 254
674 3300025938 Ga0207704_10050596 Ga0207704_100505961 254
675 3300025938 Ga0207704_10086969 Ga0207704_100869692 254
676 3300025940 Ga0207691_10001393 Ga0207691_100013936 254
677 3300025940 Ga0207691_10002722 Ga0207691_100027228 254
678 3300025940 Ga0207691_10010119 Ga0207691_100101194 254
679 3300025940 Ga0207691_10035685 Ga0207691_100356856 254
680 3300025941 Ga0207711_10000452 Ga0207711_1000045222 254
681 3300025942 Ga0207689_10000468 Ga0207689_1000046829 254
682 3300025942 Ga0207689_10036079 Ga0207689_100360793 254
683 3300025942 Ga0207689_10049180 Ga0207689_100491803 254
684 3300025942 Ga0207689_10286557 Ga0207689_102865572 254
685 3300025944 Ga0207661_10556815 Ga0207661_105568152 254
686 3300025945 Ga0207679_10222139 Ga0207679_102221391 254
687 3300025945 Ga0207679_10507161 Ga0207679_105071611 254
688 3300025949 Ga0207667_10005719 Ga0207667_100057194 254
689 3300025949 Ga0207667_10207884 Ga0207667_102078842 254
690 3300025949 Ga0207667_10214107 Ga0207667_102141072 254
691 3300025949 Ga0207667_10454497 Ga0207667_104544972 254
692 3300025949 Ga0207667_10585215 Ga0207667_105852152 254
693 3300025960 Ga0207651_10063544 Ga0207651_100635442 254
694 3300025961 Ga0207712_10000056 Ga0207712_1000005650 254
695 3300025961 Ga0207712_10000105 Ga0207712_1000010553 254
696 3300025972 Ga0207668_10001556 Ga0207668_100015562 254
697 3300025972 Ga0207668_10011242 Ga0207668_100112421 254
698 3300025972 Ga0207668_10089355 Ga0207668_100893552 254
699 3300025981 Ga0207640_10001637 Ga0207640_100016374 254
700 3300025981 Ga0207640_10029914 Ga0207640_100299143 254
701 3300025981 Ga0207640_10121144 Ga0207640_101211441 254
702 3300025981 Ga0207640_10169162 Ga0207640_101691622 254
703 3300025981 Ga0207640_10267010 Ga0207640_102670102 254
704 3300025981 Ga0207640_10272365 Ga0207640_102723652 254
705 3300025981 Ga0207640_10413960 Ga0207640_104139601 254
706 3300025986 Ga0207658_10000172 Ga0207658_1000017226 254
707 3300025986 Ga0207658_10026092 Ga0207658_100260923 254
708 3300025986 Ga0207658_10028173 Ga0207658_100281732 254
709 3300025986 Ga0207658_10477471 Ga0207658_104774711 254
710 3300026023 Ga0207677_10054798 Ga0207677_100547982 254
711 3300026023 Ga0207677_10064315 Ga0207677_100643152 254
712 3300026035 Ga0207703_10004936 Ga0207703_100049363 254
713 3300026035 Ga0207703_10276911 Ga0207703_102769112 254
714 3300026041 Ga0207639_10000731 Ga0207639_100007319 254
715 3300026041 Ga0207639_10000786 Ga0207639_1000078614 254
716 3300026041 Ga0207639_10001821 Ga0207639_100018217 254
717 3300026041 Ga0207639_10390576 Ga0207639_103905762 254
718 3300026067 Ga0207678_10001759 Ga0207678_100017595 254
719 3300026067 Ga0207678_10003513 Ga0207678_100035136 254
720 3300026067 Ga0207678_10005412 Ga0207678_100054126 254
721 3300026067 Ga0207678_10062037 Ga0207678_100620373 254
722 3300026067 Ga0207678_10093233 Ga0207678_100932332 254
723 3300026075 Ga0207708_10002933 Ga0207708_100029338 254
724 3300026078 Ga0207702_10004915 Ga0207702_100049158 254
725 3300026078 Ga0207702_10132908 Ga0207702_101329082 254
726 3300026078 Ga0207702_10313812 Ga0207702_103138122 254
727 3300026078 Ga0207702_10725708 Ga0207702_107257081 254
728 3300026088 Ga0207641_10068039 Ga0207641_100680393 254
729 3300026088 Ga0207641_10191181 Ga0207641_101911812 254
730 3300026088 Ga0207641_10196749 Ga0207641_101967492 254
731 3300026088 Ga0207641_10256876 Ga0207641_102568762 254
732 3300026089 Ga0207648_10001903 Ga0207648_1000190320 254
733 3300026089 Ga0207648_10006417 Ga0207648_100064173 254
734 3300026089 Ga0207648_10007474 Ga0207648_100074746 254
735 3300026089 Ga0207648_10026157 Ga0207648_100261573 254
736 3300026089 Ga0207648_10053459 Ga0207648_100534593 254
737 3300026089 Ga0207648_10160469 Ga0207648_101604692 254
738 3300026095 Ga0207676_10053045 Ga0207676_100530452 254
739 3300026095 Ga0207676_10127500 Ga0207676_101275002 254
740 3300026095 Ga0207676_10346425 Ga0207676_103464252 254
741 3300026116 Ga0207674_10000769 Ga0207674_1000076930 254
742 3300026116 Ga0207674_10020523 Ga0207674_100205231 254
743 3300026116 Ga0207674_10137820 Ga0207674_101378202 254
744 3300026118 Ga0207675_100005406 Ga0207675_1000054062 254
745 3300026121 Ga0207683_10011894 Ga0207683_100118943 254
746 3300026121 Ga0207683_10018635 Ga0207683_100186353 254
747 3300026121 Ga0207683_10085655 Ga0207683_100856552 254
748 3300026121 Ga0207683_10086243 Ga0207683_100862432 254
749 3300026121 Ga0207683_10226616 Ga0207683_102266162 254
750 3300026142 Ga0207698_10029142 Ga0207698_100291423 254
751 3300026142 Ga0207698_10052038 Ga0207698_100520382 254
752 3300026142 Ga0207698_10108964 Ga0207698_101089642 254
753 3300026142 Ga0207698_10160875 Ga0207698_101608751 254
754 3300026142 Ga0207698_10412794 Ga0207698_104127942 254
755 3300027312 Ga0209371_1000018 Ga0209371_100001824 254
756 3300027312 Ga0209371_1000235 Ga0209371_100023552 254
757 3300027471 Ga0209995_1007371 Ga0209995_10073712 254
758 3300027543 Ga0209999_1003821 Ga0209999_10038213 254
759 3300027552 Ga0209982_1001910 Ga0209982_10019102 254
760 3300027665 Ga0209983_1004561 Ga0209983_10045613 254
761 3300027876 Ga0209974_10011133 Ga0209974_100111334 254
762 3300028379 Ga0268266_10000008 Ga0268266_1000000896 254
763 3300028379 Ga0268266_10087866 Ga0268266_100878661 254
764 3300028379 Ga0268266_10154982 Ga0268266_101549822 254
765 3300028379 Ga0268266_10318779 Ga0268266_103187792 254
766 3300028380 Ga0268265_10000137 Ga0268265_1000013760 254
767 3300028381 Ga0268264_10010997 Ga0268264_100109972 254
768 3300028381 Ga0268264_10210088 Ga0268264_102100882 254
769 3300028381 Ga0268264_10210321 Ga0268264_102103212 254
770 3300030500 Ga0268256_1000016 Ga0268256_100001624 254
771 3300030500 Ga0268256_1000196 Ga0268256_100019611 254
772 3300030731 Ga0316177_1021597 Ga0316177_10215972 254
773 3300030732 Ga0316176_1093929 Ga0316176_10939291 254
774 3300030732 Ga0316176_1111454 Ga0316176_11114542 254
775 3300030736 Ga0316180_1121751 Ga0316180_11217512 254
776 3300030742 Ga0316183_1003565 Ga0316183_10035655 254
777 3300031251 Ga0265327_10000881 Ga0265327_1000088135 254
778 3300031251 Ga0265327_10002076 Ga0265327_1000207614 254
779 3300031548 Ga0307408_100306775 Ga0307408_1003067752 254
780 3300031616 Ga0307508_10135808 Ga0307508_101358082 254
781 3300031691 Ga0316579_10000239 Ga0316579_1000023913 254
782 3300031727 Ga0316576_10188261 Ga0316576_101882611 254
783 3300031728 Ga0316578_10047880 Ga0316578_100478802 254
784 3300031731 Ga0307405_10307256 Ga0307405_103072562 254
785 3300031824 Ga0307413_10000613 Ga0307413_100006132 254
786 3300031824 Ga0307413_10009959 Ga0307413_100099596 254
787 3300031824 Ga0307413_10049419 Ga0307413_100494193 254
788 3300031824 Ga0307413_10200765 Ga0307413_102007651 254
789 3300031852 Ga0307410_10634522 Ga0307410_106345221 254
790 3300031901 Ga0307406_10002051 Ga0307406_100020517 254
791 3300031901 Ga0307406_10013108 Ga0307406_100131083 254
792 3300031911 Ga0307412_10019584 Ga0307412_100195844 254
793 3300031911 Ga0307412_10167416 Ga0307412_101674162 254
794 3300032004 Ga0307414_10020871 Ga0307414_100208712 254
795 3300032004 Ga0307414_10025023 Ga0307414_100250233 254
796 3300032004 Ga0307414_10065380 Ga0307414_100653803 254
797 3300032004 Ga0307414_10082940 Ga0307414_100829403 254
798 3300032004 Ga0307414_10115068 Ga0307414_101150684 254
799 3300032004 Ga0307414_10142134 Ga0307414_101421342 254
800 3300032004 Ga0307414_10159001 Ga0307414_101590011 254
801 3300032004 Ga0307414_10310166 Ga0307414_103101662 254
802 3300032133 Ga0316583_10035755 Ga0316583_100357551 254
803 3300032133 Ga0316583_10109696 Ga0316583_101096962 254
804 3300032168 Ga0316593_10004218 Ga0316593_100042182 254
805 3300033179 Ga0307507_10085590 Ga0307507_100855903 254
806 3300035086 Ga0373934_0018985 Ga0373934_0018985_305_1081 254
807 3300035089 Ga0373944_0011910 Ga0373944_0011910_1333_2097 254
808 3300035119 Ga0373956_0082759 Ga0373956_0082759_217_993 254
809 3300035171 Ga0373946_0027835 Ga0373946_0027835_1426_2202 254
810 3300035172 Ga0373955_0058072 Ga0373955_0058072_450_1226 254
811 3300035398 Ga0316574_0007439 Ga0316574_0007439_3577_4347 254
812 3300035398 Ga0316574_0008096 Ga0316574_0008096_1512_2297 254
813 3300035398 Ga0316574_0044244 Ga0316574_0044244_1084_1851 254
814 3300035398 Ga0316574_0058879 Ga0316574_0058879_29_799 254
815 3300035410 Ga0373924_0043403 Ga0373924_0043403_301_1077 254
816 3300035692 Ga0373935_0113894 Ga0373935_0113894_625_1401 254
817 3300035695 Ga0373927_0020861 Ga0373927_0020861_1644_2420 254
818 3300035724 Ga0373933_0013890 Ga0373933_0013890_2860_3636 254
819 3300035724 Ga0373933_0263119 Ga0373933_0263119_179_955 254
820 3300035725 Ga0373947_0018130 Ga0373947_0018130_1293_2069 254
821 3300035725 Ga0373947_0031055 Ga0373947_0031055_1891_2667 254
822 3300036401 Ga0373937_0001723 Ga0373937_0001723_1793_2557 254
823 3300036401 Ga0373937_0026868 Ga0373937_0026868_1508_2284 254
824 3300036401 Ga0373937_0422825 Ga0373937_0422825_237_1001 254
825 3300036647 Ga0316582_0003730 Ga0316582_0003730_4695_5459 254
826 3300036712 Ga0316584_0004914 Ga0316584_0004914_5482_6246 254
827 3300036712 Ga0316584_0036119 Ga0316584_0036119_339_1127 254
828 3300037068 Ga0373925_0025815 Ga0373925_0025815_2582_3358 254
829 3300037068 Ga0373925_0037459 Ga0373925_0037459_89_865 254
830 3300037068 Ga0373925_0152278 Ga0373925_0152278_841_1608 254
831 3300037312 Ga0395899_0197906 Ga0395899_0197906_223_1005 254
832 3300037312 Ga0395899_0414180 Ga0395899_0414180_38_808 254
833 3300037418 Ga0395900_0000078 Ga0395900_0000078_128856_129650 254
834 3300037418 Ga0395900_0007101 Ga0395900_0007101_4491_5270 254
835 3300037418 Ga0395900_0019094 Ga0395900_0019094_472_1254 254
836 3300037418 Ga0395900_0020128 Ga0395900_0020128_5826_6596 254
837 3300037418 Ga0395900_0103269 Ga0395900_0103269_1828_2598 254
838 3300037466 Ga0395898_0137357 Ga0395898_0137357_1008_1778 254
839 3300037466 Ga0395898_0342764 Ga0395898_0342764_128_910 254
840 3300037471 Ga0395905_0003031 Ga0395905_0003031_3535_4305 254
841 3300037471 Ga0395905_0161447 Ga0395905_0161447_1027_1860 254
842 3300037471 Ga0395905_0295408 Ga0395905_0295408_642_1412 254
843 3300037471 Ga0395905_0341105 Ga0395905_0341105_125_895 254
844 3300037471 Ga0395905_0585418 Ga0395905_0585418_184_954 254
845 3300037588 Ga0316581_0000043 Ga0316581_0000043_10817_11581 254
846 3300038443 Ga0395901_0069557 Ga0395901_0069557_1206_1976 254
847 3300038443 Ga0395901_0264934 Ga0395901_0264934_340_1110 254
848 3300038705 Ga0237819_00845 Ga0237819_00845_6846_7616 254
849 3300041404 Ga0439436_0001697 Ga0439436_0001697_5004_5771 254
850 3300041404 Ga0439436_0040166 Ga0439436_0040166_130_948 254
851 3300041407 Ga0439447_000747 Ga0439447_000747_9841_10611 254
852 3300041413 Ga0439465_0000276 Ga0439465_0000276_1331_2101 254
853 3300041413 Ga0439465_0000407 Ga0439465_0000407_3238_4005 254
854 3300041413 Ga0439465_0005883 Ga0439465_0005883_516_1334 254
855 3300041443 Ga0451789_0213010 Ga0451789_0213010_15_800 254
856 3300041443 Ga0451789_1037216 Ga0451789_1037216_117_905 254
857 3300041452 Ga0451793_0368728 Ga0451793_0368728_120_890 254
858 3300041452 Ga0451793_0653506 Ga0451793_0653506_437_1210 254
859 3300041453 Ga0451797_0308724 Ga0451797_0308724_517_1290 254
860 3300041458 Ga0451798_0322971 Ga0451798_0322971_322_1107 254
861 3300041459 Ga0451800_0201578 Ga0451800_0201578_416_1297 254
862 3300041459 Ga0451800_0427065 Ga0451800_0427065_1041_1826 254
863 3300041459 Ga0451800_1537340 Ga0451800_1537340_272_1045 254
864 3300041460 Ga0451802_0179100 Ga0451802_0179100_7693_8466 254
865 3300041462 Ga0451806_242067 Ga0451806_242067_229_1014 254
866 3300041463 Ga0451804_0395309 Ga0451804_0395309_260_1045 254
867 3300041486 Ga0451807_0556227 Ga0451807_0556227_944_1729 254
868 3300041486 Ga0451807_0792913 Ga0451807_0792913_654_1427 254
869 3300041486 Ga0451807_2500983 Ga0451807_2500983_269_1042 254
870 3300041491 Ga0451833_0176212 Ga0451833_0176212_1165_1938 254
871 3300041494 Ga0451837_1596213 Ga0451837_1596213_460_1233 254
872 3300041509 Ga0451843_0097092 Ga0451843_0097092_1044_1817 254
873 3300041512 Ga0451853_0954159 Ga0451853_0954159_157_942 254
874 3300042001 Ga0439441_007285 Ga0439441_007285_922_1686 254
875 3300042007 Ga0439449_0000005 Ga0439449_0000005_10255_11022 254
876 3300042007 Ga0439449_0004340 Ga0439449_0004340_2767_3585 254
877 3300042007 Ga0439449_0016831 Ga0439449_0016831_1667_2434 254
878 3300042007 Ga0439449_0041954 Ga0439449_0041954_382_1152 254
879 3300042015 Ga0439462_0013511 Ga0439462_0013511_282_1100 254
880 3300042142 Ga0450905_007209 Ga0450905_007209_323_1093 254
881 3300042438 Ga0439459_0014669 Ga0439459_0014669_36_803 254
882 3300042876 Ga0451577_0004427 Ga0451577_0004427_6807_7580 254
883 3300042876 Ga0451577_0049489 Ga0451577_0049489_920_1732 254
884 3300042876 Ga0451577_0076732 Ga0451577_0076732_96_863 254
885 3300044712 Ga0453684_0021721 Ga0453684_0021721_6145_6951 254
886 3300044712 Ga0453684_0346920 Ga0453684_0346920_812_1585 254
887 3300044712 Ga0453684_0812972 Ga0453684_0812972_50_814 254
888 3300045049 Ga0466959_0040633 Ga0466959_0040633_611_1384 254
889 3300046455 Ga0495603_0101999 Ga0495603_0101999_305_1069 254
890 3300046459 Ga0495629_0115595 Ga0495629_0115595_397_1161 254
891 3300046459 Ga0495629_0124162 Ga0495629_0124162_180_956 254
892 3300046460 Ga0495638_0009424 Ga0495638_0009424_2737_3513 254
893 3300046460 Ga0495638_0133753 Ga0495638_0133753_324_1094 254
894 3300046461 Ga0495641_0062971 Ga0495641_0062971_779_1555 254
895 3300046472 Ga0495580_0029988 Ga0495580_0029988_1046_1822 254
896 3300046472 Ga0495580_0079615 Ga0495580_0079615_852_1616 254
897 3300046473 Ga0495582_0130157 Ga0495582_0130157_558_1334 254
898 3300046474 Ga0495605_0050822 Ga0495605_0050822_1006_1773 254
899 3300046477 Ga0495664_0064803 Ga0495664_0064803_975_1751 254
900 3300046499 Ga0495594_0059220 Ga0495594_0059220_1099_1875 254
901 3300046499 Ga0495594_0254121 Ga0495594_0254121_202_966 254
902 3300046501 Ga0495607_0064962 Ga0495607_0064962_56_823 254
903 3300046507 Ga0495606_0055788 Ga0495606_0055788_180_947 254
904 3300046512 Ga0495610_0029379 Ga0495610_0029379_1709_2476 254
905 3300046517 Ga0495630_0401049 Ga0495630_0401049_139_915 254
906 3300046518 Ga0495631_0006831 Ga0495631_0006831_1944_2711 254
907 3300046519 Ga0495632_0068485 Ga0495632_0068485_647_1414 254
908 3300046522 Ga0495643_0001375 Ga0495643_0001375_4543_5310 254
909 3300046525 Ga0495663_0002521 Ga0495663_0002521_4094_4861 254
910 3300046531 Ga0495665_0051908 Ga0495665_0051908_966_1730 254
911 3300046537 Ga0495598_0022117 Ga0495598_0022117_808_1578 254
912 3300046543 Ga0495645_0018452 Ga0495645_0018452_3351_4127 254
913 3300046543 Ga0495645_0030125 Ga0495645_0030125_2651_3415 254
914 3300046558 Ga0495633_0020075 Ga0495633_0020075_1877_2743 254
915 3300046615 Ga0495656_0005009 Ga0495656_0005009_2389_3156 254
916 3300046615 Ga0495656_0284681 Ga0495656_0284681_32_802 254
917 3300046616 Ga0495668_0001829 Ga0495668_0001829_7163_7933 254
918 3300046642 Ga0495634_0063082 Ga0495634_0063082_507_1283 254
919 3300046663 Ga0495635_0054362 Ga0495635_0054362_1425_2201 254
920 3300046663 Ga0495635_0075813 Ga0495635_0075813_714_1478 254
921 3300046664 Ga0495659_0011041 Ga0495659_0011041_31_807 254
922 3300046681 Ga0495647_0018318 Ga0495647_0018318_954_1718 254
923 3300046683 Ga0495658_0132707 Ga0495658_0132707_161_937 254
924 3300046689 Ga0495613_0071176 Ga0495613_0071176_1638_2414 254
925 3300046809 Ga0495600_0008978 Ga0495600_0008978_2630_3406 254
926 3300046810 Ga0495660_0006133 Ga0495660_0006133_4094_4861 254
927 3300047318 Ga0495636_0008534 Ga0495636_0008534_2427_3194 254
928 3300047320 Ga0495672_0001550 Ga0495672_0001550_17121_17888 254
929 3300047471 Ga0495684_0193947 Ga0495684_0193947_359_1135 254
930 3300047472 Ga0495686_0006050 Ga0495686_0006050_5306_6073 254
931 3300047472 Ga0495686_0013648 Ga0495686_0013648_4606_5376 254
932 3300048091 Ga0495626_0034998 Ga0495626_0034998_1316_2095 254
933 3300048903 Ga0496100_0518618 Ga0496100_0518618_67_843 254
934 3300048904 Ga0496101_0049064 Ga0496101_0049064_786_1556 254
935 3300048904 Ga0496101_0116959 Ga0496101_0116959_56_826 254
936 3300048905 Ga0496102_0062642 Ga0496102_0062642_457_1227 254
937 3300048907 Ga0496104_0000018 Ga0496104_0000018_189728_190492 254
938 3300048907 Ga0496104_0031844 Ga0496104_0031844_559_1329 254
939 3300048907 Ga0496104_0092591 Ga0496104_0092591_22_798 254
940 3300048907 Ga0496104_0632136 Ga0496104_0632136_61_831 254
941 3300048908 Ga0496105_0000044 Ga0496105_0000044_44216_44980 254
942 3300048908 Ga0496105_0274269 Ga0496105_0274269_10_780 254
943 3300048909 Ga0496106_0020517 Ga0496106_0020517_3113_3883 254
944 3300048910 Ga0496107_0009761 Ga0496107_0009761_4362_5132 254
945 3300048911 Ga0496108_0167241 Ga0496108_0167241_1072_1842 254
946 3300048912 Ga0496109_0009884 Ga0496109_0009884_6905_7675 254
947 3300048912 Ga0496109_0039089 Ga0496109_0039089_2552_3322 254
948 3300048913 Ga0496110_0040186 Ga0496110_0040186_2046_2816 254
949 3300048916 Ga0496113_0056613 Ga0496113_0056613_728_1498 254
950 3300048916 Ga0496113_0091028 Ga0496113_0091028_1339_2109 254
951 3300048917 Ga0496114_0000661 Ga0496114_0000661_19849_20619 254
952 3300048918 Ga0496115_0004687 Ga0496115_0004687_8530_9294 254
953 3300048918 Ga0496115_0183490 Ga0496115_0183490_618_1394 254
954 3300048919 Ga0496116_0002985 Ga0496116_0002985_2479_3312 254
955 3300048919 Ga0496116_0009924 Ga0496116_0009924_1750_2517 254
956 3300048919 Ga0496116_0021943 Ga0496116_0021943_2057_2827 254
957 3300048919 Ga0496116_0077292 Ga0496116_0077292_162_944 254
958 3300048920 Ga0496117_0002512 Ga0496117_0002512_6090_6875 254
959 3300048920 Ga0496117_0002847 Ga0496117_0002847_17496_18272 254
960 3300048920 Ga0496117_0003585 Ga0496117_0003585_9990_10763 254
961 3300048920 Ga0496117_0004078 Ga0496117_0004078_8849_9631 254
962 3300048920 Ga0496117_0020445 Ga0496117_0020445_2268_3044 254
963 3300048920 Ga0496117_0021902 Ga0496117_0021902_2404_3171 254
964 3300048920 Ga0496117_0026742 Ga0496117_0026742_2123_2890 254
965 3300048921 Ga0496118_0000065 Ga0496118_0000065_127888_128658 254
966 3300048921 Ga0496118_0000183 Ga0496118_0000183_6408_7181 254
967 3300048921 Ga0496118_0003155 Ga0496118_0003155_2777_3553 254
968 3300048921 Ga0496118_0011461 Ga0496118_0011461_5894_6661 254
969 3300048921 Ga0496118_0014433 Ga0496118_0014433_2710_3492 254
970 3300048921 Ga0496118_0023695 Ga0496118_0023695_2229_3005 254
971 3300048921 Ga0496118_0099712 Ga0496118_0099712_909_1673 254
972 3300048922 Ga0496119_0004541 Ga0496119_0004541_4172_4957 254
973 3300048922 Ga0496119_0005902 Ga0496119_0005902_6469_7251 254
974 3300048922 Ga0496119_0068852 Ga0496119_0068852_1130_1912 254
975 3300048923 Ga0496120_0000776 Ga0496120_0000776_3585_4361 254
976 3300048923 Ga0496120_0001660 Ga0496120_0001660_16108_16893 254
977 3300048924 Ga0496121_0000275 Ga0496121_0000275_14187_14969 254
978 3300048924 Ga0496121_0003638 Ga0496121_0003638_20302_21069 254
979 3300048924 Ga0496121_0009225 Ga0496121_0009225_8360_9136 254
980 3300048924 Ga0496121_0016911 Ga0496121_0016911_5544_6311 254
981 3300048924 Ga0496121_0038741 Ga0496121_0038741_1284_2051 254
982 3300048924 Ga0496121_0095398 Ga0496121_0095398_488_1267 254
983 3300048924 Ga0496121_0228118 Ga0496121_0228118_225_1058 254
984 3300048925 Ga0496122_0000033 Ga0496122_0000033_129526_130359 254
985 3300048925 Ga0496122_0000037 Ga0496122_0000037_17234_18007 254
986 3300048925 Ga0496122_0000355 Ga0496122_0000355_16378_17151 254
987 3300048925 Ga0496122_0000361 Ga0496122_0000361_16304_17089 254
988 3300048925 Ga0496122_0004301 Ga0496122_0004301_2561_3328 254
989 3300048925 Ga0496122_0027005 Ga0496122_0027005_2758_3534 254
990 3300048925 Ga0496122_0027905 Ga0496122_0027905_2127_2897 254
991 3300048926 Ga0496123_0000167 Ga0496123_0000167_69094_69867 254
992 3300048926 Ga0496123_0000741 Ga0496123_0000741_8911_9744 254
993 3300048926 Ga0496123_0001332 Ga0496123_0001332_17734_18507 254
994 3300048926 Ga0496123_0002053 Ga0496123_0002053_8834_9619 254
995 3300048926 Ga0496123_0004240 Ga0496123_0004240_10275_11042 254
996 3300048926 Ga0496123_0016984 Ga0496123_0016984_4993_5775 254
997 3300048926 Ga0496123_0025782 Ga0496123_0025782_1380_2156 254
998 3300048927 Ga0496124_0000004 Ga0496124_0000004_273261_274040 254
999 3300048927 Ga0496124_0000020 Ga0496124_0000020_249327_250103 254
1000 3300048927 Ga0496124_0002453 Ga0496124_0002453_14667_15452 254
1001 3300048927 Ga0496124_0003077 Ga0496124_0003077_2613_3380 254
1002 3300048927 Ga0496124_0021425 Ga0496124_0021425_2853_3629 254
1003 3300048927 Ga0496124_0045788 Ga0496124_0045788_2772_3548 254
1004 3300048927 Ga0496124_0050843 Ga0496124_0050843_381_1157 254
1005 3300048927 Ga0496124_0079369 Ga0496124_0079369_1157_1939 254
1006 3300048927 Ga0496124_0087272 Ga0496124_0087272_1054_1824 254
1007 3300048927 Ga0496124_0184976 Ga0496124_0184976_418_1185 254
1008 3300048928 Ga0496125_0000117 Ga0496125_0000117_133992_134774 254
1009 3300048928 Ga0496125_0013801 Ga0496125_0013801_4884_5660 254
1010 3300048928 Ga0496125_0015927 Ga0496125_0015927_2497_3330 254
1011 3300048928 Ga0496125_0021408 Ga0496125_0021408_1919_2692 254
1012 3300048928 Ga0496125_0023855 Ga0496125_0023855_1617_2399 254
1013 3300048928 Ga0496125_0025466 Ga0496125_0025466_18_785 254
1014 3300048928 Ga0496125_0027484 Ga0496125_0027484_1942_2709 254
1015 3300048928 Ga0496125_0027879 Ga0496125_0027879_1944_2720 254
1016 3300048928 Ga0496125_0178993 Ga0496125_0178993_242_1009 254
1017 3300048929 Ga0496126_0002494 Ga0496126_0002494_20394_21170 254
1018 3300048929 Ga0496126_0008693 Ga0496126_0008693_6361_7128 254
1019 3300048929 Ga0496126_0108820 Ga0496126_0108820_1124_1957 254
1020 3300049513 Ga0501290_000868 Ga0501290_000868_1856_2626 254
1021 3300049523 Ga0501300_009389 Ga0501300_009389_624_1394 254
1022 3300049568 Ga0501031_0008497 Ga0501031_0008497_1337_2128 254
1023 3300049568 Ga0501031_0012129 Ga0501031_0012129_3521_4327 254
1024 3300049568 Ga0501031_0173625 Ga0501031_0173625_380_1147 254
1025 3300049569 Ga0501032_0000210 Ga0501032_0000210_34683_35474 254
1026 3300049569 Ga0501032_0004174 Ga0501032_0004174_1964_2734 254
1027 3300049569 Ga0501032_0028651 Ga0501032_0028651_84_851 254
1028 3300049569 Ga0501032_0268267 Ga0501032_0268267_81_863 254
1029 3300049570 Ga0501033_0000847 Ga0501033_0000847_10584_11354 254
1030 3300049570 Ga0501033_0014212 Ga0501033_0014212_4537_5328 254
1031 3300049571 Ga0501034_0000448 Ga0501034_0000448_62299_63072 254
1032 3300049571 Ga0501034_0000886 Ga0501034_0000886_14870_15640 254
1033 3300049571 Ga0501034_0002379 Ga0501034_0002379_10010_10780 254
1034 3300049571 Ga0501034_0006726 Ga0501034_0006726_5267_6049 254
1035 3300049571 Ga0501034_0007033 Ga0501034_0007033_852_1643 254
1036 3300049571 Ga0501034_0009119 Ga0501034_0009119_2208_2972 254
1037 3300049571 Ga0501034_0155667 Ga0501034_0155667_523_1290 254
1038 3300049571 Ga0501034_0173362 Ga0501034_0173362_782_1546 254
1039 3300049571 Ga0501034_0351096 Ga0501034_0351096_584_1354 254
1040 3300049571 Ga0501034_0434336 Ga0501034_0434336_216_989 254
1041 3300049572 Ga0501036_0017938 Ga0501036_0017938_2643_3434 254
1042 3300049573 Ga0501037_0011559 Ga0501037_0011559_713_1504 254
1043 3300049573 Ga0501037_0035492 Ga0501037_0035492_1871_2653 254
1044 3300049573 Ga0501037_0052651 Ga0501037_0052651_2190_2957 254
1045 3300049573 Ga0501037_0106622 Ga0501037_0106622_1026_1796 254
1046 3300049573 Ga0501037_0346224 Ga0501037_0346224_118_894 254
1047 3300049574 Ga0501038_0066160 Ga0501038_0066160_1819_2604 254
1048 3300049574 Ga0501038_0342436 Ga0501038_0342436_251_1027 254
1049 3300049575 Ga0501039_0006764 Ga0501039_0006764_3969_4760 254
1050 3300049578 Ga0501042_0432668 Ga0501042_0432668_141_920 254
1051 3300049579 Ga0501043_0002614 Ga0501043_0002614_8254_9021 254
1052 3300049579 Ga0501043_0056696 Ga0501043_0056696_873_1640 254
1053 3300049580 Ga0501046_0001308 Ga0501046_0001308_18552_19343 254
1054 3300049580 Ga0501046_0037396 Ga0501046_0037396_649_1425 254
1055 3300049581 Ga0501047_0000315 Ga0501047_0000315_44833_45603 254
1056 3300049581 Ga0501047_0013016 Ga0501047_0013016_328_1101 254
1057 3300049581 Ga0501047_0305484 Ga0501047_0305484_180_956 254
1058 3300049581 Ga0501047_0389401 Ga0501047_0389401_326_1108 254
1059 3300049582 Ga0501048_0030442 Ga0501048_0030442_356_1147 254
1060 3300049583 Ga0501067_0000119 Ga0501067_0000119_9583_10353 254
1061 3300049583 Ga0501067_0231921 Ga0501067_0231921_194_967 254
1062 3300049584 Ga0501068_0001462 Ga0501068_0001462_10534_11304 254
1063 3300049585 Ga0501069_0003734 Ga0501069_0003734_5334_6104 254
1064 3300049586 Ga0501070_0004828 Ga0501070_0004828_1841_2611 254
1065 3300049586 Ga0501070_0029810 Ga0501070_0029810_291_1064 254
1066 3300049586 Ga0501070_0077883 Ga0501070_0077883_162_953 254
1067 3300049586 Ga0501070_0350913 Ga0501070_0350913_200_970 254
1068 3300049588 Ga0501072_0001194 Ga0501072_0001194_17048_17812 254
1069 3300049588 Ga0501072_0003276 Ga0501072_0003276_10149_10919 254
1070 3300049588 Ga0501072_0455236 Ga0501072_0455236_80_853 254
1071 3300049589 Ga0501073_0000822 Ga0501073_0000822_6390_7181 254
1072 3300049589 Ga0501073_0003339 Ga0501073_0003339_1136_1906 254
1073 3300049589 Ga0501073_0045195 Ga0501073_0045195_802_1578 254
1074 3300049589 Ga0501073_0082082 Ga0501073_0082082_1113_1889 254
1075 3300049589 Ga0501073_0102426 Ga0501073_0102426_216_980 254
1076 3300049590 Ga0501074_0014434 Ga0501074_0014434_2820_3590 254
1077 3300049590 Ga0501074_0163352 Ga0501074_0163352_85_861 254
1078 3300049590 Ga0501074_0163520 Ga0501074_0163520_466_1239 254
1079 3300049705 Ga0501225_0006023 Ga0501225_0006023_1476_2243 254
1080 3300049741 Ga0501079_0002546 Ga0501079_0002546_2492_3262 254
1081 3300049742 Ga0501080_0002008 Ga0501080_0002008_6845_7615 254
1082 3300049742 Ga0501080_0002572 Ga0501080_0002572_9523_10296 254
1083 3300049742 Ga0501080_0016726 Ga0501080_0016726_4973_5764 254
1084 3300049742 Ga0501080_0042061 Ga0501080_0042061_2591_3355 254
1085 3300049742 Ga0501080_0229252 Ga0501080_0229252_387_1163 254
1086 3300049742 Ga0501080_0405593 Ga0501080_0405593_413_1177 254
1087 3300049744 Ga0501083_0000646 Ga0501083_0000646_9815_10585 254
1088 3300049744 Ga0501083_0054799 Ga0501083_0054799_295_1068 254
1089 3300049744 Ga0501083_0160747 Ga0501083_0160747_80_853 254
1090 3300049762 Ga0501265_001300 Ga0501265_001300_1985_2755 254
1091 3300049822 Ga0501035_0018695 Ga0501035_0018695_3889_4680 254
1092 3300049822 Ga0501035_0025135 Ga0501035_0025135_3009_3791 254
1093 3300049822 Ga0501035_0055447 Ga0501035_0055447_1789_2571 254
1094 3300049822 Ga0501035_0209359 Ga0501035_0209359_617_1387 254
1095 3300049823 Ga0501044_0000048 Ga0501044_0000048_101703_102485 254
1096 3300049823 Ga0501044_0000956 Ga0501044_0000956_2111_2881 254
1097 3300049823 Ga0501044_0145046 Ga0501044_0145046_287_1069 254
1098 3300049823 Ga0501044_0181306 Ga0501044_0181306_1239_2006 254
1099 3300049823 Ga0501044_0314825 Ga0501044_0314825_474_1250 254
1100 3300049823 Ga0501044_0645570 Ga0501044_0645570_47_874 254
1101 3300050491 nmdc:mga00v17_12723_c1 nmdc:mga00v17_12723_c1_165_941 254
1102 3300050491 nmdc:mga00v17_200_c1 nmdc:mga00v17_200_c1_12489_13259 254
1103 3300050491 nmdc:mga00v17_2327_c1 nmdc:mga00v17_2327_c1_529_1314 254
1104 3300050491 nmdc:mga00v17_359_c1 nmdc:mga00v17_359_c1_6410_7300 254
1105 3300050491 nmdc:mga00v17_48265_c1 nmdc:mga00v17_48265_c1_1569_2336 254
1106 3300050491 nmdc:mga00v17_57555_c1 nmdc:mga00v17_57555_c1_264_1037 254
1107 3300050491 nmdc:mga00v17_68063_c1 nmdc:mga00v17_68063_c1_1086_1865 254
1108 3300050492 nmdc:mga0yw44_10758_c1 nmdc:mga0yw44_10758_c1_2440_3216 254
1109 3300050512 nmdc:mga0n895_760944_c1 nmdc:mga0n895_760944_c1_75_851 254
1110 3300053078 Ga0495612_0136830 Ga0495612_0136830_211_987 254
1111 3300053079 Ga0500610_0001281 Ga0500610_0001281_4029_4802 254
1112 3300053085 Ga0495619_0018702 Ga0495619_0018702_2198_2974 254
1113 3300053136 Ga0500559_0048355 Ga0500559_0048355_142_918 254
1114 3300053139 Ga0500568_0000675 Ga0500568_0000675_7365_8141 254
1115 3300053161 Ga0500634_0000582 Ga0500634_0000582_2549_3415 254
1116 3300054114 Ga0501084_0271015 Ga0501084_0271015_239_1012 254
1117 3300054114 Ga0501084_0321682 Ga0501084_0321682_482_1252 254
1118 3300060353 Ga0501082_0003553 Ga0501082_0003553_5950_6726 254
1119 3300060353 Ga0501082_0005653 Ga0501082_0005653_3611_4381 254
1120 iso_pu_bacteria 2643221621 2644124048 254
1121 iso_pu_bacteria 2738543009 2739228015 254
1122 iso_pu_bacteria 2939589442 2939590359 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

56

299

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9865 1 254
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9833 1 254
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9827 1 254
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9795 1 254
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9507 1 254
ID Description Score Start End Superfamily
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.986 1 254 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9821 1 254 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9507 1 254 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.947 1 254 3.60.10.10
af_P96273_24_289_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9466 1 254 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A523JTZ4-F1-model_v4 Exodeoxyribonuclease III 0.9989 1 70 GO:0003677
GO:0004519
GO:0006281
GO:0008311
AF-A0A3N4VDP9-F1-model_v4 Exodeoxyribonuclease III 0.9934 1 254 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A2T5LDC3-F1-model_v4 Exodeoxyribonuclease III 0.9931 1 254 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A4Q3IVF8-F1-model_v4 deleted 0.9927 1 178
AF-A0A2W5LCF8-F1-model_v4 deleted 0.9908 27 253

Feature Viewer

pLDDT pTM Quality
95.92 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map