F490345
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1118 | 501 | 1070 | 277 |
Family's Representative Sequence
| Representative Sequence | 3300039450|Ga0436363_0877931|Ga0436363_0877931_1469_2506 |
| Length | 325 |
| Sequence | VAVVSIDATAVLPATGVPGEVIFLSLTVKEKNAARKTEDGFSSKARDRADFRESVMDQPDDYSRYTRLKFDRPQPKVLRLTMDNGPMNAADHALHRELSEVWRQIDTDPSVNAAILTGSGPNFSAGGDFALIKDMIADFQTRARVWKEASDLVYNVINCSKPIVSAMRGVPVGAGLVAGLLADVSIATKDCRIIDGHTRLGVAAGDHAAIIWPLLCGMAKAKYYLLLCEPVRGEEAERIGLIALAVDDAELDDRAIEIASRLAEGAQTAIRWTKYALNNWLRQMGPTFDASLALEFMGFSSADVQEGLASHLKKRKPQFSPSSPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 3 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 4 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 5 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 6 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 7 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 8 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 9 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 10 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 11 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 12 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 13 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 14 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 15 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 16 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 17 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 18 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 19 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 20 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 21 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 22 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 23 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 24 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 25 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 26 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 27 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 28 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 29 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 30 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 31 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 32 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 33 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 34 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 35 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 36 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 37 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 38 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 39 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 40 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 41 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 42 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 43 | 2941479691 | |||
| 44 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 45 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 46 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 47 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 48 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 49 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 50 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 51 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 52 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 55 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 56 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 57 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 62 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 65 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 87 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 95 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 97 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 99 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 100 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 101 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 102 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 103 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 104 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 111 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 112 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 113 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 115 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 116 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 120 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 121 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 122 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 123 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 124 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 125 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 126 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 129 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 130 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 159 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 160 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 161 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 236 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 241 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 242 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 243 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 244 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 245 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 249 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 250 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 254 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 255 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 256 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 257 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 258 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 266 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 268 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 270 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 274 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 275 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 278 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 279 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 280 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 282 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 283 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 284 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 285 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 286 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 287 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 288 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 289 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 290 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 291 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 292 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 293 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 294 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 295 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 296 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 297 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 298 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 299 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 300 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 301 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 302 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 303 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 304 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 305 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 306 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 307 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 308 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 309 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 310 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 311 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 312 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 313 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 314 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 315 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 316 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 317 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 318 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 319 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 320 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 321 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 322 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 323 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 324 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 325 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 326 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 327 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 328 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 329 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 330 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 331 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 332 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 333 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 334 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 335 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 336 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 337 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 338 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 413 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 414 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 415 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 416 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 417 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 418 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 421 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 422 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 423 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 424 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 425 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 426 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 427 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 428 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 429 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 430 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 431 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 432 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 433 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 434 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 435 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 436 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 437 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 467 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 471 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 472 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 473 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 480 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 482 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 483 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 484 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 485 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 486 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 487 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 489 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 490 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 491 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 492 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 493 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 496 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 497 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 498 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 499 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 500 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 501 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.26 |
| Metatranscriptomes | 0.45 |
| Isolates | 4.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.9 |
| Nodule | 1.61 |
| Rhizoplane | 3.49 |
| Rhizosphere | 79.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000002 | 3300001915 | Bacteria | 64630 |
| 2 | JGI24752J21851_1001132 | 3300001976 | Bacteria | 3630 |
| 3 | JGI24740J21852_10000005 | 3300001979 | Bacteria | 87250 |
| 4 | JGI24739J22299_10033113 | 3300001989 | Bacteria | 1771 |
| 5 | JGI24737J22298_10000184 | 3300001990 | Bacteria | 20107 |
| 6 | JGI24751J29686_10002622 | 3300002459 | Bacteria | 3613 |
| 7 | JGI25156J39149_1001067 | 3300002705 | Bacteria | 12660 |
| 8 | JGI25160J50197_1000186 | 3300003354 | Bacteria | 52582 |
| 9 | Ga0055530_10000014 | 3300003791 | Bacteria | 151346 |
| 10 | Ga0055531_10001911 | 3300003794 | Bacteria | 14576 |
| 11 | Ga0065165_1000589 | 3300005262 | Bacteria | 53322 |
| 12 | Ga0065165_1041657 | 3300005262 | Bacteria | 1361 |
| 13 | Ga0065704_10099041 | 3300005289 | Bacteria | 2327 |
| 14 | Ga0065707_10084019 | 3300005295 | Bacteria | 7816 |
| 15 | Ga0065707_10109259 | 3300005295 | Bacteria | 2475 |
| 16 | Ga0070658_10000738 | 3300005327 | Bacteria | 28029 |
| 17 | Ga0070658_10001208 | 3300005327 | Bacteria | 22135 |
| 18 | Ga0070683_100423591 | 3300005329 | Bacteria | 1270 |
| 19 | Ga0070690_100057056 | 3300005330 | Bacteria | 2506 |
| 20 | Ga0070670_100168692 | 3300005331 | Bacteria | 1898 |
| 21 | Ga0070670_100413473 | 3300005331 | Bacteria | 1192 |
| 22 | Ga0068869_100071159 | 3300005334 | Bacteria | 2575 |
| 23 | Ga0068869_100111490 | 3300005334 | Bacteria | 2082 |
| 24 | Ga0070666_10135206 | 3300005335 | Bacteria | 1715 |
| 25 | Ga0070680_100001985 | 3300005336 | Bacteria | 15054 |
| 26 | Ga0068868_100100841 | 3300005338 | Bacteria | 2336 |
| 27 | Ga0070660_100007378 | 3300005339 | Bacteria | 7659 |
| 28 | Ga0070661_100002371 | 3300005344 | Bacteria | 12927 |
| 29 | Ga0070668_100309442 | 3300005347 | Bacteria | 1327 |
| 30 | Ga0070669_100139936 | 3300005353 | Bacteria | 1865 |
| 31 | Ga0070671_100000108 | 3300005355 | Bacteria | 52691 |
| 32 | Ga0070671_100000116 | 3300005355 | Bacteria | 51559 |
| 33 | Ga0070671_100002267 | 3300005355 | Bacteria | 14841 |
| 34 | Ga0070671_100205104 | 3300005355 | Bacteria | 1672 |
| 35 | Ga0070671_100527875 | 3300005355 | Bacteria | 1017 |
| 36 | Ga0070673_100152392 | 3300005364 | Bacteria | 1959 |
| 37 | Ga0070688_100012466 | 3300005365 | Bacteria | 4765 |
| 38 | Ga0070659_100001817 | 3300005366 | Bacteria | 15365 |
| 39 | Ga0070667_100002350 | 3300005367 | Bacteria | 16565 |
| 40 | Ga0070709_10120664 | 3300005434 | Bacteria | 1776 |
| 41 | Ga0070714_100015447 | 3300005435 | Bacteria | 6144 |
| 42 | Ga0070714_100781640 | 3300005435 | Bacteria | 924 |
| 43 | Ga0070713_100051144 | 3300005436 | Bacteria | 3417 |
| 44 | Ga0070713_100146241 | 3300005436 | Bacteria | 2098 |
| 45 | Ga0070710_10052399 | 3300005437 | Bacteria | 2294 |
| 46 | Ga0070710_10214560 | 3300005437 | Bacteria | 1221 |
| 47 | Ga0070711_100058759 | 3300005439 | Bacteria | 2668 |
| 48 | Ga0070711_100078820 | 3300005439 | Bacteria | 2341 |
| 49 | Ga0070711_100152938 | 3300005439 | Bacteria | 1742 |
| 50 | Ga0070705_100167200 | 3300005440 | Bacteria | 1476 |
| 51 | Ga0070700_100142279 | 3300005441 | Bacteria | 1632 |
| 52 | Ga0070708_100000811 | 3300005445 | Bacteria | 23595 |
| 53 | Ga0070708_100005199 | 3300005445 | Bacteria | 10299 |
| 54 | Ga0070708_100006423 | 3300005445 | Bacteria | 9361 |
| 55 | Ga0070708_100340258 | 3300005445 | Bacteria | 1414 |
| 56 | Ga0070708_100503186 | 3300005445 | Bacteria | 1143 |
| 57 | Ga0070663_100002745 | 3300005455 | Bacteria | 9977 |
| 58 | Ga0070678_100169474 | 3300005456 | Bacteria | 1777 |
| 59 | Ga0070662_100116823 | 3300005457 | Bacteria | 2040 |
| 60 | Ga0070681_10003664 | 3300005458 | Bacteria | 14404 |
| 61 | Ga0070681_10144789 | 3300005458 | Bacteria | 2306 |
| 62 | Ga0068867_100314202 | 3300005459 | Bacteria | 1296 |
| 63 | Ga0070706_100001584 | 3300005467 | Bacteria | 23710 |
| 64 | Ga0070706_100003747 | 3300005467 | Bacteria | 14858 |
| 65 | Ga0070706_100068870 | 3300005467 | Bacteria | 3273 |
| 66 | Ga0070706_100277452 | 3300005467 | Bacteria | 1564 |
| 67 | Ga0070706_100280170 | 3300005467 | Bacteria | 1556 |
| 68 | Ga0070707_100001089 | 3300005468 | Bacteria | 26861 |
| 69 | Ga0070707_100002122 | 3300005468 | Bacteria | 18983 |
| 70 | Ga0070707_100022766 | 3300005468 | Bacteria | 5925 |
| 71 | Ga0070707_100101597 | 3300005468 | Bacteria | 2787 |
| 72 | Ga0070698_100000587 | 3300005471 | Bacteria | 39046 |
| 73 | Ga0070698_100054589 | 3300005471 | Bacteria | 4055 |
| 74 | Ga0070698_100068270 | 3300005471 | Bacteria | 3573 |
| 75 | Ga0070698_100140405 | 3300005471 | Bacteria | 2367 |
| 76 | Ga0070699_100000149 | 3300005518 | Bacteria | 66121 |
| 77 | Ga0070699_100000865 | 3300005518 | Bacteria | 28175 |
| 78 | Ga0070679_100048869 | 3300005530 | Bacteria | 4214 |
| 79 | Ga0070679_100126789 | 3300005530 | Bacteria | 2535 |
| 80 | Ga0070684_100176235 | 3300005535 | Bacteria | 1943 |
| 81 | Ga0070684_100321873 | 3300005535 | Bacteria | 1420 |
| 82 | Ga0070697_100000222 | 3300005536 | Bacteria | 46798 |
| 83 | Ga0070697_100000856 | 3300005536 | Bacteria | 22876 |
| 84 | Ga0068853_100047725 | 3300005539 | Bacteria | 3675 |
| 85 | Ga0068853_100194311 | 3300005539 | Bacteria | 1844 |
| 86 | Ga0070665_100004342 | 3300005548 | Bacteria | 14911 |
| 87 | Ga0070665_100005505 | 3300005548 | Bacteria | 13037 |
| 88 | Ga0070665_100192006 | 3300005548 | Bacteria | 2043 |
| 89 | Ga0070665_100298724 | 3300005548 | Bacteria | 1613 |
| 90 | Ga0068855_100000794 | 3300005563 | Bacteria | 39088 |
| 91 | Ga0068855_100037073 | 3300005563 | Bacteria | 5801 |
| 92 | Ga0068855_100075781 | 3300005563 | Bacteria | 3905 |
| 93 | Ga0068855_100187895 | 3300005563 | Bacteria | 2332 |
| 94 | Ga0070664_100052359 | 3300005564 | Bacteria | 3457 |
| 95 | Ga0068857_100005815 | 3300005577 | Bacteria | 10538 |
| 96 | Ga0068857_100053144 | 3300005577 | Bacteria | 3594 |
| 97 | Ga0068857_100073716 | 3300005577 | Bacteria | 3042 |
| 98 | Ga0068857_100104335 | 3300005577 | Bacteria | 2545 |
| 99 | Ga0068857_100296440 | 3300005577 | Bacteria | 1490 |
| 100 | Ga0068857_100578711 | 3300005577 | Bacteria | 1060 |
| 101 | Ga0068854_100000322 | 3300005578 | Bacteria | 31553 |
| 102 | Ga0068854_100054275 | 3300005578 | Bacteria | 2881 |
| 103 | Ga0068856_100004551 | 3300005614 | Bacteria | 13781 |
| 104 | Ga0068856_100034764 | 3300005614 | Bacteria | 4938 |
| 105 | Ga0068856_100260922 | 3300005614 | Bacteria | 1748 |
| 106 | Ga0068852_100002126 | 3300005616 | Bacteria | 13576 |
| 107 | Ga0068852_100002464 | 3300005616 | Bacteria | 12742 |
| 108 | Ga0068852_100013111 | 3300005616 | Bacteria | 6332 |
| 109 | Ga0068852_100020571 | 3300005616 | Bacteria | 5250 |
| 110 | Ga0068852_100033295 | 3300005616 | Bacteria | 4277 |
| 111 | Ga0068859_100000143 | 3300005617 | Bacteria | 67438 |
| 112 | Ga0068859_100330267 | 3300005617 | Bacteria | 1619 |
| 113 | Ga0068859_100364670 | 3300005617 | Bacteria | 1540 |
| 114 | Ga0068859_100492521 | 3300005617 | Bacteria | 1321 |
| 115 | Ga0068864_100007552 | 3300005618 | Bacteria | 8958 |
| 116 | Ga0068864_100055380 | 3300005618 | Bacteria | 3424 |
| 117 | Ga0068861_100400239 | 3300005719 | Bacteria | 1218 |
| 118 | Ga0068863_100000014 | 3300005841 | Bacteria | 216135 |
| 119 | Ga0068863_100055235 | 3300005841 | Bacteria | 3761 |
| 120 | Ga0068863_100148142 | 3300005841 | Bacteria | 2246 |
| 121 | Ga0068863_100271392 | 3300005841 | Bacteria | 1642 |
| 122 | Ga0068858_100000451 | 3300005842 | Bacteria | 43046 |
| 123 | Ga0068858_100016746 | 3300005842 | Bacteria | 6884 |
| 124 | Ga0068858_100036714 | 3300005842 | Bacteria | 4544 |
| 125 | Ga0068858_100047848 | 3300005842 | Bacteria | 3964 |
| 126 | Ga0068858_100063744 | 3300005842 | Bacteria | 3410 |
| 127 | Ga0068858_100686047 | 3300005842 | Bacteria | 996 |
| 128 | Ga0068860_100000007 | 3300005843 | Bacteria | 429329 |
| 129 | Ga0068860_100031345 | 3300005843 | Bacteria | 5110 |
| 130 | Ga0068860_100117391 | 3300005843 | Bacteria | 2546 |
| 131 | Ga0068862_100012958 | 3300005844 | Bacteria | 6898 |
| 132 | Ga0068862_100299001 | 3300005844 | Bacteria | 1480 |
| 133 | Ga0081455_10002011 | 3300005937 | Bacteria | 24306 |
| 134 | Ga0081455_10008960 | 3300005937 | Bacteria | 10340 |
| 135 | Ga0081455_10233157 | 3300005937 | Bacteria | 1357 |
| 136 | Ga0081538_10041488 | 3300005981 | Bacteria | 2920 |
| 137 | Ga0081538_10073583 | 3300005981 | Bacteria | 1866 |
| 138 | Ga0081540_1002176 | 3300005983 | Bacteria | 16229 |
| 139 | Ga0081540_1004082 | 3300005983 | Bacteria | 11301 |
| 140 | Ga0081540_1011818 | 3300005983 | Bacteria | 5801 |
| 141 | Ga0081540_1019729 | 3300005983 | Bacteria | 4083 |
| 142 | Ga0081540_1021183 | 3300005983 | Bacteria | 3882 |
| 143 | Ga0081540_1058979 | 3300005983 | Bacteria | 1845 |
| 144 | Ga0081539_10000086 | 3300005985 | Bacteria | 217801 |
| 145 | Ga0081539_10009839 | 3300005985 | Bacteria | 7895 |
| 146 | Ga0070717_10005151 | 3300006028 | Bacteria | 9530 |
| 147 | Ga0070717_10013624 | 3300006028 | Bacteria | 6239 |
| 148 | Ga0070717_10023926 | 3300006028 | Bacteria | 4846 |
| 149 | Ga0070717_10025226 | 3300006028 | Bacteria | 4726 |
| 150 | Ga0070717_10047005 | 3300006028 | Bacteria | 3534 |
| 151 | Ga0070717_10316430 | 3300006028 | Bacteria | 1390 |
| 152 | Ga0075365_10001147 | 3300006038 | Bacteria | 11597 |
| 153 | Ga0075368_10019969 | 3300006042 | Bacteria | 2533 |
| 154 | Ga0070715_10054017 | 3300006163 | Bacteria | 1738 |
| 155 | Ga0070716_100170113 | 3300006173 | Bacteria | 1421 |
| 156 | Ga0070716_100177972 | 3300006173 | Bacteria | 1394 |
| 157 | Ga0070712_100093484 | 3300006175 | Bacteria | 2207 |
| 158 | Ga0070712_100287344 | 3300006175 | Bacteria | 1326 |
| 159 | Ga0075362_10007481 | 3300006177 | Bacteria | 4139 |
| 160 | Ga0075362_10029001 | 3300006177 | Bacteria | 2381 |
| 161 | Ga0075362_10037872 | 3300006177 | Bacteria | 2116 |
| 162 | Ga0075367_10001011 | 3300006178 | Bacteria | 11560 |
| 163 | Ga0075367_10036329 | 3300006178 | Bacteria | 2856 |
| 164 | Ga0075367_10065828 | 3300006178 | Bacteria | 2171 |
| 165 | Ga0075369_10002056 | 3300006186 | Bacteria | 7096 |
| 166 | Ga0075366_10001326 | 3300006195 | Bacteria | 12359 |
| 167 | Ga0075366_10030068 | 3300006195 | Bacteria | 3192 |
| 168 | Ga0075366_10080222 | 3300006195 | Bacteria | 1948 |
| 169 | Ga0075370_10000739 | 3300006353 | Bacteria | 13026 |
| 170 | Ga0075370_10004418 | 3300006353 | Bacteria | 6825 |
| 171 | Ga0075370_10050113 | 3300006353 | Bacteria | 2368 |
| 172 | Ga0075370_10145161 | 3300006353 | Bacteria | 1388 |
| 173 | Ga0075370_10147046 | 3300006353 | Bacteria | 1380 |
| 174 | Ga0075428_100004344 | 3300006844 | Bacteria | 15629 |
| 175 | Ga0075428_100036276 | 3300006844 | Bacteria | 5432 |
| 176 | Ga0075431_100248864 | 3300006847 | Bacteria | 1806 |
| 177 | Ga0075429_100022391 | 3300006880 | Bacteria | 5480 |
| 178 | Ga0075429_100352675 | 3300006880 | Bacteria | 1288 |
| 179 | Ga0097620_100000143 | 3300006931 | Bacteria | 67438 |
| 180 | Ga0097620_100330302 | 3300006931 | Bacteria | 1619 |
| 181 | Ga0097620_100364653 | 3300006931 | Bacteria | 1540 |
| 182 | Ga0097620_100492472 | 3300006931 | Bacteria | 1321 |
| 183 | Ga0099794_10170411 | 3300007265 | Bacteria | 1109 |
| 184 | Ga0099795_10052977 | 3300007788 | Bacteria | 1484 |
| 185 | Ga0099795_10091523 | 3300007788 | Bacteria | 1180 |
| 186 | Ga0105251_10164882 | 3300009011 | Bacteria | 999 |
| 187 | Ga0105240_10023389 | 3300009093 | Bacteria | 8172 |
| 188 | Ga0105240_10027768 | 3300009093 | Bacteria | 7406 |
| 189 | Ga0105240_10047592 | 3300009093 | Bacteria | 5426 |
| 190 | Ga0105240_10084950 | 3300009093 | Bacteria | 3879 |
| 191 | Ga0105240_10094883 | 3300009093 | Bacteria | 3638 |
| 192 | Ga0105240_10279136 | 3300009093 | Bacteria | 1920 |
| 193 | Ga0105240_10352537 | 3300009093 | Bacteria | 1669 |
| 194 | Ga0105240_10492903 | 3300009093 | Bacteria | 1364 |
| 195 | Ga0105240_10874790 | 3300009093 | Bacteria | 968 |
| 196 | Ga0111539_10002094 | 3300009094 | Bacteria | 26666 |
| 197 | Ga0111539_10107858 | 3300009094 | Bacteria | 3268 |
| 198 | Ga0105247_10168835 | 3300009101 | Bacteria | 1453 |
| 199 | Ga0105247_10281234 | 3300009101 | Bacteria | 1148 |
| 200 | Ga0114129_10001077 | 3300009147 | Bacteria | 35894 |
| 201 | Ga0114129_10216271 | 3300009147 | Bacteria | 2588 |
| 202 | Ga0105243_10505515 | 3300009148 | Bacteria | 1146 |
| 203 | Ga0105243_10587666 | 3300009148 | Bacteria | 1070 |
| 204 | Ga0105241_10000339 | 3300009174 | Bacteria | 35461 |
| 205 | Ga0105241_10068257 | 3300009174 | Bacteria | 2754 |
| 206 | Ga0105241_10172352 | 3300009174 | Bacteria | 1788 |
| 207 | Ga0105241_10202966 | 3300009174 | Bacteria | 1657 |
| 208 | Ga0105242_10406871 | 3300009176 | Bacteria | 1271 |
| 209 | Ga0105248_10050024 | 3300009177 | Bacteria | 4687 |
| 210 | Ga0105248_10087893 | 3300009177 | Bacteria | 3498 |
| 211 | Ga0105248_10229572 | 3300009177 | Bacteria | 2089 |
| 212 | Ga0105248_10559668 | 3300009177 | Bacteria | 1290 |
| 213 | Ga0105237_10006725 | 3300009545 | Bacteria | 12702 |
| 214 | Ga0105237_10018482 | 3300009545 | Bacteria | 7214 |
| 215 | Ga0105238_10005126 | 3300009551 | Bacteria | 12952 |
| 216 | Ga0105238_10006388 | 3300009551 | Bacteria | 11726 |
| 217 | Ga0105238_10009753 | 3300009551 | Bacteria | 9616 |
| 218 | Ga0105238_10025641 | 3300009551 | Bacteria | 6010 |
| 219 | Ga0105238_10133623 | 3300009551 | Bacteria | 2459 |
| 220 | Ga0105238_10180200 | 3300009551 | Bacteria | 2090 |
| 221 | Ga0105238_10195413 | 3300009551 | Bacteria | 1999 |
| 222 | Ga0105249_10008804 | 3300009553 | Bacteria | 8810 |
| 223 | Ga0105030_107549 | 3300009987 | Bacteria | 924 |
| 224 | Ga0105239_10008802 | 3300010375 | Bacteria | 11423 |
| 225 | Ga0105239_10025558 | 3300010375 | Bacteria | 6500 |
| 226 | Ga0105239_10166198 | 3300010375 | Bacteria | 2467 |
| 227 | Ga0105239_10184028 | 3300010375 | Bacteria | 2338 |
| 228 | Ga0105239_10204393 | 3300010375 | Bacteria | 2213 |
| 229 | Ga0105239_10304977 | 3300010375 | Bacteria | 1794 |
| 230 | Ga0105239_10545953 | 3300010375 | Bacteria | 1320 |
| 231 | Ga0105239_10790882 | 3300010375 | Bacteria | 1087 |
| 232 | Ga0105239_10809552 | 3300010375 | Bacteria | 1073 |
| 233 | Ga0157373_10047529 | 3300013100 | Bacteria | 3061 |
| 234 | Ga0157371_10000111 | 3300013102 | Bacteria | 123977 |
| 235 | Ga0157370_10030067 | 3300013104 | Bacteria | 5324 |
| 236 | Ga0157369_10000198 | 3300013105 | Bacteria | 84274 |
| 237 | Ga0157369_10000547 | 3300013105 | Bacteria | 49435 |
| 238 | Ga0157369_10016581 | 3300013105 | Bacteria | 8281 |
| 239 | Ga0157369_10036200 | 3300013105 | Bacteria | 5409 |
| 240 | Ga0157369_10242129 | 3300013105 | Bacteria | 1884 |
| 241 | Ga0157369_10418597 | 3300013105 | Bacteria | 1389 |
| 242 | Ga0157369_10429614 | 3300013105 | Bacteria | 1369 |
| 243 | Ga0157369_10845726 | 3300013105 | Bacteria | 939 |
| 244 | Ga0163162_10029661 | 3300013306 | Bacteria | 5416 |
| 245 | Ga0163162_10070034 | 3300013306 | Bacteria | 3559 |
| 246 | Ga0163162_10514409 | 3300013306 | Bacteria | 1327 |
| 247 | Ga0163162_10877805 | 3300013306 | Bacteria | 1011 |
| 248 | Ga0157372_10831096 | 3300013307 | Bacteria | 1073 |
| 249 | Ga0163163_10009652 | 3300014325 | Bacteria | 8632 |
| 250 | Ga0163163_10051764 | 3300014325 | Bacteria | 4048 |
| 251 | Ga0163163_10073929 | 3300014325 | Bacteria | 3399 |
| 252 | Ga0163163_10353821 | 3300014325 | Bacteria | 1525 |
| 253 | Ga0157380_10000486 | 3300014326 | Bacteria | 24146 |
| 254 | Ga0157380_10494064 | 3300014326 | Bacteria | 1187 |
| 255 | Ga0182008_10004538 | 3300014497 | Bacteria | 8102 |
| 256 | Ga0157379_10000433 | 3300014968 | Bacteria | 33887 |
| 257 | Ga0157379_10013089 | 3300014968 | Bacteria | 7265 |
| 258 | Ga0157379_10405517 | 3300014968 | Bacteria | 1254 |
| 259 | Ga0163161_10199378 | 3300017792 | Bacteria | 1542 |
| 260 | Ga0197907_10093668 | 3300020069 | Bacteria | 1879 |
| 261 | Ga0206354_10117369 | 3300020081 | Bacteria | 1625 |
| 262 | Ga0206353_10353987 | 3300020082 | Bacteria | 6015 |
| 263 | Ga0206353_11308596 | 3300020082 | Bacteria | 1120 |
| 264 | Ga0213876_10001894 | 3300021384 | Bacteria | 12588 |
| 265 | Ga0213875_10000174 | 3300021388 | Bacteria | 67979 |
| 266 | Ga0213875_10000232 | 3300021388 | Bacteria | 56352 |
| 267 | Ga0213875_10015157 | 3300021388 | Bacteria | 3753 |
| 268 | Ga0213871_10000400 | 3300021441 | Bacteria | 5764 |
| 269 | Ga0213871_10035768 | 3300021441 | Bacteria | 1315 |
| 270 | Ga0224712_10000029 | 3300022467 | Bacteria | 21520 |
| 271 | Ga0209026_1001238 | 3300025250 | Bacteria | 11686 |
| 272 | Ga0209759_1000200 | 3300025256 | Bacteria | 94590 |
| 273 | Ga0209676_1006255 | 3300025292 | Bacteria | 5927 |
| 274 | Ga0209564_1007173 | 3300025295 | Bacteria | 5809 |
| 275 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 276 | Ga0209758_1005611 | 3300025297 | Bacteria | 9533 |
| 277 | Ga0209050_1000034 | 3300025298 | Bacteria | 433906 |
| 278 | Ga0209050_1006150 | 3300025298 | Bacteria | 7224 |
| 279 | Ga0207426_1000007 | 3300025302 | Bacteria | 971011 |
| 280 | Ga0209051_1008353 | 3300025303 | Bacteria | 5491 |
| 281 | Ga0209257_1000052 | 3300025304 | Bacteria | 430947 |
| 282 | Ga0209257_1000100 | 3300025304 | Bacteria | 253399 |
| 283 | Ga0207697_10106647 | 3300025315 | Bacteria | 1197 |
| 284 | Ga0207656_10001030 | 3300025321 | Bacteria | 9097 |
| 285 | Ga0207713_1000089 | 3300025735 | Bacteria | 152927 |
| 286 | Ga0207713_1000106 | 3300025735 | Bacteria | 137911 |
| 287 | Ga0207713_1106991 | 3300025735 | Bacteria | 956 |
| 288 | Ga0207692_10355258 | 3300025898 | Bacteria | 904 |
| 289 | Ga0207710_10000319 | 3300025900 | Bacteria | 36927 |
| 290 | Ga0207680_10022475 | 3300025903 | Bacteria | 3430 |
| 291 | Ga0207680_10047043 | 3300025903 | Bacteria | 2554 |
| 292 | Ga0207680_10057382 | 3300025903 | Bacteria | 2355 |
| 293 | Ga0207647_10003157 | 3300025904 | Bacteria | 12363 |
| 294 | Ga0207647_10003676 | 3300025904 | Bacteria | 11480 |
| 295 | Ga0207647_10011500 | 3300025904 | Bacteria | 6205 |
| 296 | Ga0207647_10047293 | 3300025904 | Bacteria | 2677 |
| 297 | Ga0207685_10027520 | 3300025905 | Bacteria | 1991 |
| 298 | Ga0207699_10019984 | 3300025906 | Bacteria | 3581 |
| 299 | Ga0207645_10100473 | 3300025907 | Bacteria | 1866 |
| 300 | Ga0207705_10000007 | 3300025909 | Bacteria | 597387 |
| 301 | Ga0207705_10002837 | 3300025909 | Bacteria | 13262 |
| 302 | Ga0207705_10010305 | 3300025909 | Bacteria | 6798 |
| 303 | Ga0207705_10135889 | 3300025909 | Bacteria | 1833 |
| 304 | Ga0207684_10001662 | 3300025910 | Bacteria | 23646 |
| 305 | Ga0207684_10004845 | 3300025910 | Bacteria | 12593 |
| 306 | Ga0207684_10025209 | 3300025910 | Bacteria | 5069 |
| 307 | Ga0207654_10001428 | 3300025911 | Bacteria | 12679 |
| 308 | Ga0207654_10040325 | 3300025911 | Bacteria | 2631 |
| 309 | Ga0207654_10084065 | 3300025911 | Bacteria | 1923 |
| 310 | Ga0207654_10182706 | 3300025911 | Bacteria | 1369 |
| 311 | Ga0207654_10211128 | 3300025911 | Bacteria | 1283 |
| 312 | Ga0207707_10088306 | 3300025912 | Bacteria | 2708 |
| 313 | Ga0207707_10094095 | 3300025912 | Bacteria | 2618 |
| 314 | Ga0207695_10001225 | 3300025913 | Bacteria | 43972 |
| 315 | Ga0207695_10009783 | 3300025913 | Bacteria | 11789 |
| 316 | Ga0207695_10015634 | 3300025913 | Bacteria | 8926 |
| 317 | Ga0207695_10017841 | 3300025913 | Bacteria | 8227 |
| 318 | Ga0207695_10021230 | 3300025913 | Bacteria | 7415 |
| 319 | Ga0207695_10332928 | 3300025913 | Bacteria | 1407 |
| 320 | Ga0207671_10000676 | 3300025914 | Bacteria | 44438 |
| 321 | Ga0207671_10004835 | 3300025914 | Bacteria | 12685 |
| 322 | Ga0207671_10047020 | 3300025914 | Bacteria | 3193 |
| 323 | Ga0207671_10256642 | 3300025914 | Bacteria | 1375 |
| 324 | Ga0207693_10002285 | 3300025915 | Bacteria | 16669 |
| 325 | Ga0207693_10003067 | 3300025915 | Bacteria | 14409 |
| 326 | Ga0207693_10003289 | 3300025915 | Bacteria | 13837 |
| 327 | Ga0207693_10043926 | 3300025915 | Bacteria | 3512 |
| 328 | Ga0207693_10087320 | 3300025915 | Bacteria | 2444 |
| 329 | Ga0207693_10139029 | 3300025915 | Bacteria | 1910 |
| 330 | Ga0207693_10371239 | 3300025915 | Bacteria | 1119 |
| 331 | Ga0207663_10025128 | 3300025916 | Bacteria | 3439 |
| 332 | Ga0207663_10160007 | 3300025916 | Bacteria | 1588 |
| 333 | Ga0207663_10161026 | 3300025916 | Bacteria | 1584 |
| 334 | Ga0207663_10372360 | 3300025916 | Bacteria | 1086 |
| 335 | Ga0207660_10031804 | 3300025917 | Bacteria | 3638 |
| 336 | Ga0207660_10074211 | 3300025917 | Bacteria | 2482 |
| 337 | Ga0207657_10000074 | 3300025919 | Bacteria | 93185 |
| 338 | Ga0207649_10000887 | 3300025920 | Bacteria | 18902 |
| 339 | Ga0207649_10232619 | 3300025920 | Bacteria | 1319 |
| 340 | Ga0207649_10399980 | 3300025920 | Bacteria | 1027 |
| 341 | Ga0207652_10082928 | 3300025921 | Bacteria | 2806 |
| 342 | Ga0207652_10227755 | 3300025921 | Bacteria | 1680 |
| 343 | Ga0207652_10406166 | 3300025921 | Bacteria | 1229 |
| 344 | Ga0207646_10001152 | 3300025922 | Bacteria | 33668 |
| 345 | Ga0207646_10007222 | 3300025922 | Bacteria | 11334 |
| 346 | Ga0207646_10011833 | 3300025922 | Bacteria | 8422 |
| 347 | Ga0207681_10084247 | 3300025923 | Bacteria | 2253 |
| 348 | Ga0207681_10184892 | 3300025923 | Bacteria | 1590 |
| 349 | Ga0207694_10005711 | 3300025924 | Bacteria | 9536 |
| 350 | Ga0207694_10023461 | 3300025924 | Bacteria | 4683 |
| 351 | Ga0207694_10032894 | 3300025924 | Bacteria | 3972 |
| 352 | Ga0207694_10051497 | 3300025924 | Bacteria | 3191 |
| 353 | Ga0207694_10342879 | 3300025924 | Bacteria | 1236 |
| 354 | Ga0207650_10200910 | 3300025925 | Bacteria | 1597 |
| 355 | Ga0207650_10363604 | 3300025925 | Bacteria | 1192 |
| 356 | Ga0207650_10371411 | 3300025925 | Bacteria | 1180 |
| 357 | Ga0207687_10006212 | 3300025927 | Bacteria | 7912 |
| 358 | Ga0207700_10031095 | 3300025928 | Bacteria | 3789 |
| 359 | Ga0207700_10115729 | 3300025928 | Bacteria | 2166 |
| 360 | Ga0207700_10140905 | 3300025928 | Bacteria | 1981 |
| 361 | Ga0207700_10298719 | 3300025928 | Bacteria | 1390 |
| 362 | Ga0207664_10103574 | 3300025929 | Bacteria | 2355 |
| 363 | Ga0207664_10385054 | 3300025929 | Bacteria | 1245 |
| 364 | Ga0207644_10005965 | 3300025931 | Bacteria | 7942 |
| 365 | Ga0207644_10060702 | 3300025931 | Bacteria | 2736 |
| 366 | Ga0207644_10272837 | 3300025931 | Bacteria | 1356 |
| 367 | Ga0207690_10000840 | 3300025932 | Bacteria | 19665 |
| 368 | Ga0207706_10097255 | 3300025933 | Bacteria | 2589 |
| 369 | Ga0207706_10201795 | 3300025933 | Bacteria | 1744 |
| 370 | Ga0207709_10351115 | 3300025935 | Bacteria | 1113 |
| 371 | Ga0207665_10315194 | 3300025939 | Bacteria | 1172 |
| 372 | Ga0207711_10086634 | 3300025941 | Bacteria | 2747 |
| 373 | Ga0207711_10149795 | 3300025941 | Bacteria | 2105 |
| 374 | Ga0207711_10151905 | 3300025941 | Bacteria | 2090 |
| 375 | Ga0207711_10186561 | 3300025941 | Bacteria | 1888 |
| 376 | Ga0207689_10548658 | 3300025942 | Bacteria | 971 |
| 377 | Ga0207661_10045130 | 3300025944 | Bacteria | 3486 |
| 378 | Ga0207667_10000004 | 3300025949 | Bacteria | 737718 |
| 379 | Ga0207667_10016679 | 3300025949 | Bacteria | 8290 |
| 380 | Ga0207667_10039999 | 3300025949 | Bacteria | 4992 |
| 381 | Ga0207667_10044253 | 3300025949 | Bacteria | 4719 |
| 382 | Ga0207651_10303898 | 3300025960 | Bacteria | 1328 |
| 383 | Ga0207712_10015813 | 3300025961 | Bacteria | 4874 |
| 384 | Ga0207712_10165948 | 3300025961 | Bacteria | 1721 |
| 385 | Ga0207712_10565026 | 3300025961 | Bacteria | 980 |
| 386 | Ga0207668_10353311 | 3300025972 | Bacteria | 1230 |
| 387 | Ga0207668_10518562 | 3300025972 | Bacteria | 1028 |
| 388 | Ga0207640_10000501 | 3300025981 | Bacteria | 23670 |
| 389 | Ga0207640_10002751 | 3300025981 | Bacteria | 9410 |
| 390 | Ga0207640_10170383 | 3300025981 | Bacteria | 1622 |
| 391 | Ga0207658_10002723 | 3300025986 | Bacteria | 12767 |
| 392 | Ga0207658_10003671 | 3300025986 | Bacteria | 10821 |
| 393 | Ga0207658_10019163 | 3300025986 | Bacteria | 4731 |
| 394 | Ga0207658_10098964 | 3300025986 | Bacteria | 2280 |
| 395 | Ga0207658_10131844 | 3300025986 | Bacteria | 2009 |
| 396 | Ga0207658_10439171 | 3300025986 | Bacteria | 1154 |
| 397 | Ga0207677_10195743 | 3300026023 | Bacteria | 1602 |
| 398 | Ga0207703_10009191 | 3300026035 | Bacteria | 7775 |
| 399 | Ga0207703_10025731 | 3300026035 | Bacteria | 4630 |
| 400 | Ga0207703_10030722 | 3300026035 | Bacteria | 4245 |
| 401 | Ga0207703_10050958 | 3300026035 | Bacteria | 3353 |
| 402 | Ga0207703_10628927 | 3300026035 | Bacteria | 1017 |
| 403 | Ga0207639_10012292 | 3300026041 | Bacteria | 5961 |
| 404 | Ga0207639_10261753 | 3300026041 | Bacteria | 1513 |
| 405 | Ga0207678_10000056 | 3300026067 | Bacteria | 86903 |
| 406 | Ga0207708_10010222 | 3300026075 | Bacteria | 6967 |
| 407 | Ga0207708_10211392 | 3300026075 | Bacteria | 1551 |
| 408 | Ga0207702_10000087 | 3300026078 | Bacteria | 105856 |
| 409 | Ga0207702_10040449 | 3300026078 | Bacteria | 3908 |
| 410 | Ga0207702_10569186 | 3300026078 | Bacteria | 1110 |
| 411 | Ga0207641_10000126 | 3300026088 | Bacteria | 112607 |
| 412 | Ga0207641_10017244 | 3300026088 | Bacteria | 5911 |
| 413 | Ga0207641_10018234 | 3300026088 | Bacteria | 5753 |
| 414 | Ga0207641_10038781 | 3300026088 | Bacteria | 3984 |
| 415 | Ga0207641_10061761 | 3300026088 | Bacteria | 3196 |
| 416 | Ga0207641_10558868 | 3300026088 | Bacteria | 1117 |
| 417 | Ga0207648_10395532 | 3300026089 | Bacteria | 1251 |
| 418 | Ga0207648_10437349 | 3300026089 | Bacteria | 1189 |
| 419 | Ga0207676_10025201 | 3300026095 | Bacteria | 4412 |
| 420 | Ga0207676_10243871 | 3300026095 | Bacteria | 1614 |
| 421 | Ga0207674_10000121 | 3300026116 | Bacteria | 90479 |
| 422 | Ga0207674_10039575 | 3300026116 | Bacteria | 4886 |
| 423 | Ga0207674_10091441 | 3300026116 | Bacteria | 3033 |
| 424 | Ga0207674_10104804 | 3300026116 | Bacteria | 2806 |
| 425 | Ga0207675_100071634 | 3300026118 | Bacteria | 3241 |
| 426 | Ga0207675_100308679 | 3300026118 | Bacteria | 1542 |
| 427 | Ga0207683_10157769 | 3300026121 | Bacteria | 2050 |
| 428 | Ga0207698_10000305 | 3300026142 | Bacteria | 29478 |
| 429 | Ga0207698_10003375 | 3300026142 | Bacteria | 9621 |
| 430 | Ga0207698_10009101 | 3300026142 | Bacteria | 6310 |
| 431 | Ga0207698_10041936 | 3300026142 | Bacteria | 3415 |
| 432 | Ga0209371_1004269 | 3300027312 | Bacteria | 6343 |
| 433 | Ga0209813_10069741 | 3300027866 | Bacteria | 1140 |
| 434 | Ga0207428_10004927 | 3300027907 | Bacteria | 12576 |
| 435 | Ga0268266_10011284 | 3300028379 | Bacteria | 7776 |
| 436 | Ga0268266_10090088 | 3300028379 | Bacteria | 2688 |
| 437 | Ga0268266_10138059 | 3300028379 | Bacteria | 2185 |
| 438 | Ga0268266_10150346 | 3300028379 | Bacteria | 2098 |
| 439 | Ga0268266_10239784 | 3300028379 | Bacteria | 1673 |
| 440 | Ga0268266_10629968 | 3300028379 | Bacteria | 1031 |
| 441 | Ga0268265_10008961 | 3300028380 | Bacteria | 6767 |
| 442 | Ga0268265_10068124 | 3300028380 | Bacteria | 2758 |
| 443 | Ga0268265_10344328 | 3300028380 | Bacteria | 1359 |
| 444 | Ga0268264_10000077 | 3300028381 | Bacteria | 252597 |
| 445 | Ga0268264_10015126 | 3300028381 | Bacteria | 6329 |
| 446 | Ga0268264_10033435 | 3300028381 | Bacteria | 4224 |
| 447 | Ga0265337_1042720 | 3300028556 | Bacteria | 1299 |
| 448 | Ga0265334_10033254 | 3300028573 | Bacteria | 2053 |
| 449 | Ga0307515_10000572 | 3300028794 | Bacteria | 86935 |
| 450 | Ga0307515_10112782 | 3300028794 | Bacteria | 3159 |
| 451 | Ga0307515_10176873 | 3300028794 | Bacteria | 2101 |
| 452 | Ga0265338_10000335 | 3300028800 | Bacteria | 85548 |
| 453 | Ga0265338_10000344 | 3300028800 | Bacteria | 84742 |
| 454 | Ga0265338_10025382 | 3300028800 | Bacteria | 6015 |
| 455 | Ga0265338_10097071 | 3300028800 | Bacteria | 2415 |
| 456 | Ga0265324_10065890 | 3300029957 | Bacteria | 1236 |
| 457 | Ga0268256_1002337 | 3300030500 | Bacteria | 9777 |
| 458 | Ga0265332_10009960 | 3300031238 | Bacteria | 4235 |
| 459 | Ga0265325_10000379 | 3300031241 | Bacteria | 31331 |
| 460 | Ga0265325_10002671 | 3300031241 | Bacteria | 11936 |
| 461 | Ga0265340_10105954 | 3300031247 | Bacteria | 1303 |
| 462 | Ga0265339_10003924 | 3300031249 | Bacteria | 10292 |
| 463 | Ga0265327_10001877 | 3300031251 | Bacteria | 24307 |
| 464 | Ga0265316_10057905 | 3300031344 | Bacteria | 3020 |
| 465 | Ga0265316_10093549 | 3300031344 | Bacteria | 2291 |
| 466 | Ga0307513_10008709 | 3300031456 | Bacteria | 12925 |
| 467 | Ga0307513_10077630 | 3300031456 | Bacteria | 3438 |
| 468 | Ga0307513_10102556 | 3300031456 | Bacteria | 2880 |
| 469 | Ga0307513_10259565 | 3300031456 | Bacteria | 1528 |
| 470 | Ga0307408_100000381 | 3300031548 | Bacteria | 40487 |
| 471 | Ga0307408_100251625 | 3300031548 | Bacteria | 1457 |
| 472 | Ga0265313_10000678 | 3300031595 | Bacteria | 35090 |
| 473 | Ga0265313_10011566 | 3300031595 | Bacteria | 5473 |
| 474 | Ga0265342_10086380 | 3300031712 | Bacteria | 1804 |
| 475 | Ga0307516_10000363 | 3300031730 | Bacteria | 59029 |
| 476 | Ga0307516_10007858 | 3300031730 | Bacteria | 12157 |
| 477 | Ga0307405_10085526 | 3300031731 | Bacteria | 2073 |
| 478 | Ga0307406_10003961 | 3300031901 | Bacteria | 8049 |
| 479 | Ga0307412_10002104 | 3300031911 | Bacteria | 11059 |
| 480 | Ga0307412_10003319 | 3300031911 | Bacteria | 8939 |
| 481 | Ga0307412_10011660 | 3300031911 | Bacteria | 5098 |
| 482 | Ga0307412_10013244 | 3300031911 | Bacteria | 4828 |
| 483 | Ga0307409_100474572 | 3300031995 | Bacteria | 1212 |
| 484 | Ga0307416_100037381 | 3300032002 | Bacteria | 3735 |
| 485 | Ga0307414_10000185 | 3300032004 | Bacteria | 42230 |
| 486 | Ga0307411_10030158 | 3300032005 | Bacteria | 3322 |
| 487 | Ga0307411_10080833 | 3300032005 | Bacteria | 2236 |
| 488 | Ga0307411_10256427 | 3300032005 | Bacteria | 1378 |
| 489 | Ga0307415_100121409 | 3300032126 | Bacteria | 1960 |
| 490 | Ga0373928_0027165 | 3300035084 | Bacteria | 1244 |
| 491 | Ga0373934_0090841 | 3300035086 | Bacteria | 1231 |
| 492 | Ga0373940_0002375 | 3300035088 | Bacteria | 3648 |
| 493 | Ga0373944_0000063 | 3300035089 | Bacteria | 17796 |
| 494 | Ga0373923_0060121 | 3300035111 | Bacteria | 1612 |
| 495 | Ga0373932_0005235 | 3300035112 | Bacteria | 3049 |
| 496 | Ga0373936_0000095 | 3300035113 | Bacteria | 32094 |
| 497 | Ga0373939_0003794 | 3300035114 | Bacteria | 3565 |
| 498 | Ga0373945_0000118 | 3300035116 | Bacteria | 19368 |
| 499 | Ga0373957_0099795 | 3300035120 | Bacteria | 1161 |
| 500 | Ga0373960_0015609 | 3300035121 | Bacteria | 1941 |
| 501 | Ga0373943_0000007 | 3300035170 | Bacteria | 72018 |
| 502 | Ga0373946_0000003 | 3300035171 | Bacteria | 72620 |
| 503 | Ga0373955_0018262 | 3300035172 | Bacteria | 3485 |
| 504 | Ga0373955_0050854 | 3300035172 | Bacteria | 2255 |
| 505 | Ga0373955_0221080 | 3300035172 | Bacteria | 1131 |
| 506 | Ga0373961_0004204 | 3300035241 | Bacteria | 3495 |
| 507 | Ga0316574_0114321 | 3300035398 | Bacteria | 1731 |
| 508 | Ga0373924_0134631 | 3300035410 | Bacteria | 1076 |
| 509 | Ga0373931_0016291 | 3300035691 | Bacteria | 3657 |
| 510 | Ga0373935_0000016 | 3300035692 | Bacteria | 71558 |
| 511 | Ga0373927_0000211 | 3300035695 | Bacteria | 46349 |
| 512 | Ga0373927_0073526 | 3300035695 | Bacteria | 2213 |
| 513 | Ga0373933_0114817 | 3300035724 | Bacteria | 1682 |
| 514 | Ga0373933_0125223 | 3300035724 | Bacteria | 1612 |
| 515 | Ga0373933_0209356 | 3300035724 | Bacteria | 1249 |
| 516 | Ga0373933_0265132 | 3300035724 | Bacteria | 1108 |
| 517 | Ga0373947_0000043 | 3300035725 | Bacteria | 62167 |
| 518 | Ga0373937_0001887 | 3300036401 | Bacteria | 17603 |
| 519 | Ga0373937_0181016 | 3300036401 | Bacteria | 1979 |
| 520 | Ga0373937_0385446 | 3300036401 | Bacteria | 1329 |
| 521 | Ga0373925_0001599 | 3300037068 | Bacteria | 19132 |
| 522 | Ga0373925_0022030 | 3300037068 | Bacteria | 4644 |
| 523 | Ga0373925_0208373 | 3300037068 | Bacteria | 1557 |
| 524 | Ga0373925_0420146 | 3300037068 | Bacteria | 1092 |
| 525 | Ga0395899_0001978 | 3300037312 | Bacteria | 16855 |
| 526 | Ga0395899_0039445 | 3300037312 | Bacteria | 3534 |
| 527 | Ga0395899_0099922 | 3300037312 | Bacteria | 2095 |
| 528 | Ga0395899_0140119 | 3300037312 | Bacteria | 1721 |
| 529 | Ga0395900_0000057 | 3300037418 | Bacteria | 212535 |
| 530 | Ga0395900_0044617 | 3300037418 | Bacteria | 4567 |
| 531 | Ga0395900_0063627 | 3300037418 | Bacteria | 3792 |
| 532 | Ga0395900_0064451 | 3300037418 | Bacteria | 3765 |
| 533 | Ga0395900_0131844 | 3300037418 | Bacteria | 2561 |
| 534 | Ga0395900_0400164 | 3300037418 | Bacteria | 1337 |
| 535 | Ga0395898_0006875 | 3300037466 | Bacteria | 12100 |
| 536 | Ga0395898_0014912 | 3300037466 | Bacteria | 7979 |
| 537 | Ga0395898_0022982 | 3300037466 | Bacteria | 6305 |
| 538 | Ga0395898_0153086 | 3300037466 | Bacteria | 2206 |
| 539 | Ga0395898_0154961 | 3300037466 | Bacteria | 2191 |
| 540 | Ga0395898_0434618 | 3300037466 | Bacteria | 1251 |
| 541 | Ga0395905_0000014 | 3300037471 | Bacteria | 394209 |
| 542 | Ga0395905_0015473 | 3300037471 | Bacteria | 7252 |
| 543 | Ga0395905_0070355 | 3300037471 | Bacteria | 3278 |
| 544 | Ga0395905_0121573 | 3300037471 | Bacteria | 2454 |
| 545 | Ga0395905_0270759 | 3300037471 | Bacteria | 1584 |
| 546 | Ga0395905_0598262 | 3300037471 | Bacteria | 1005 |
| 547 | Ga0436364_0025729 | 3300037853 | Bacteria | 1159 |
| 548 | Ga0436364_0676163 | 3300037853 | Bacteria | 64006 |
| 549 | Ga0436364_0990344 | 3300037853 | Bacteria | 56392 |
| 550 | Ga0436364_1004440 | 3300037853 | Bacteria | 13846 |
| 551 | Ga0436364_1213864 | 3300037853 | Bacteria | 5463 |
| 552 | Ga0436364_1238375 | 3300037853 | Bacteria | 10591 |
| 553 | Ga0395901_0000002 | 3300038443 | Bacteria | 761045 |
| 554 | Ga0395901_0000113 | 3300038443 | Bacteria | 110398 |
| 555 | Ga0395901_0000177 | 3300038443 | Bacteria | 82539 |
| 556 | Ga0395901_0001952 | 3300038443 | Bacteria | 21231 |
| 557 | Ga0395901_0010068 | 3300038443 | Bacteria | 9581 |
| 558 | Ga0395901_0010514 | 3300038443 | Bacteria | 9372 |
| 559 | Ga0395901_0019615 | 3300038443 | Bacteria | 6911 |
| 560 | Ga0395901_0021996 | 3300038443 | Bacteria | 6536 |
| 561 | Ga0395901_0064667 | 3300038443 | Bacteria | 3807 |
| 562 | Ga0395901_0475085 | 3300038443 | Bacteria | 1276 |
| 563 | Ga0436365_0145774 | 3300039437 | Bacteria | 9949 |
| 564 | Ga0436365_0473069 | 3300039437 | Bacteria | 25772 |
| 565 | Ga0436365_0785175 | 3300039437 | Bacteria | 2765 |
| 566 | Ga0436365_0885104 | 3300039437 | Bacteria | 3802 |
| 567 | Ga0436365_1254597 | 3300039437 | Bacteria | 1638 |
| 568 | Ga0436360_0148685 | 3300039438 | Bacteria | 1862 |
| 569 | Ga0436360_0315794 | 3300039438 | Bacteria | 2765 |
| 570 | Ga0436360_0415711 | 3300039438 | Bacteria | 1119 |
| 571 | Ga0436360_0777953 | 3300039438 | Bacteria | 5974 |
| 572 | Ga0436360_1255737 | 3300039438 | Bacteria | 4195 |
| 573 | Ga0436360_1340002 | 3300039438 | Bacteria | 2063 |
| 574 | Ga0436360_1356287 | 3300039438 | Bacteria | 2491 |
| 575 | Ga0436361_0221853 | 3300039447 | Bacteria | 1255 |
| 576 | Ga0436361_0460638 | 3300039447 | Bacteria | 1781 |
| 577 | Ga0436361_0662945 | 3300039447 | Bacteria | 966 |
| 578 | Ga0436361_0740576 | 3300039447 | Bacteria | 4062 |
| 579 | Ga0436361_0912408 | 3300039447 | Bacteria | 896 |
| 580 | Ga0436361_1010833 | 3300039447 | Bacteria | 2438 |
| 581 | Ga0436363_0150078 | 3300039450 | Bacteria | 3393 |
| 582 | Ga0436363_0274442 | 3300039450 | Bacteria | 2346 |
| 583 | Ga0436363_0692852 | 3300039450 | Bacteria | 2097 |
| 584 | Ga0436363_0877931 | 3300039450 | Bacteria | 3589 |
| 585 | Ga0436363_1479055 | 3300039450 | Bacteria | 1669 |
| 586 | Ga0436363_1498526 | 3300039450 | Bacteria | 2959 |
| 587 | Ga0436362_0557887 | 3300039453 | Bacteria | 2601 |
| 588 | Ga0436362_0783295 | 3300039453 | Bacteria | 4917 |
| 589 | Ga0436362_0992540 | 3300039453 | Bacteria | 1395 |
| 590 | Ga0436362_1084147 | 3300039453 | Bacteria | 1364 |
| 591 | Ga0439436_0000964 | 3300041404 | Bacteria | 7952 |
| 592 | Ga0439436_0006549 | 3300041404 | Bacteria | 3577 |
| 593 | Ga0439438_016077 | 3300041405 | Bacteria | 2183 |
| 594 | Ga0439439_0004111 | 3300041406 | Bacteria | 3254 |
| 595 | Ga0439447_000125 | 3300041407 | Bacteria | 26154 |
| 596 | Ga0439453_0035731 | 3300041408 | Bacteria | 958 |
| 597 | Ga0439466_0010789 | 3300041411 | Bacteria | 3392 |
| 598 | Ga0451833_1041486 | 3300041491 | Bacteria | 2699 |
| 599 | Ga0451839_0251557 | 3300041496 | Bacteria | 1773 |
| 600 | Ga0451841_0086406 | 3300041498 | Bacteria | 3211 |
| 601 | Ga0451843_1359299 | 3300041509 | Bacteria | 1338 |
| 602 | Ga0451853_0230220 | 3300041512 | Bacteria | 1603 |
| 603 | Ga0439431_0017259 | 3300041997 | Bacteria | 1695 |
| 604 | Ga0439433_0004061 | 3300041999 | Bacteria | 3145 |
| 605 | Ga0439448_0136916 | 3300042005 | Bacteria | 846 |
| 606 | Ga0439449_0000112 | 3300042007 | Bacteria | 26557 |
| 607 | Ga0439449_0002521 | 3300042007 | Bacteria | 7153 |
| 608 | Ga0439452_006772 | 3300042010 | Bacteria | 3562 |
| 609 | Ga0439454_009380 | 3300042011 | Bacteria | 1269 |
| 610 | Ga0439456_001624 | 3300042013 | Bacteria | 4537 |
| 611 | Ga0439462_0025976 | 3300042015 | Bacteria | 1542 |
| 612 | Ga0450923_011270 | 3300042125 | Bacteria | 1605 |
| 613 | Ga0450897_005192 | 3300042128 | Bacteria | 1120 |
| 614 | Ga0450894_001878 | 3300042131 | Bacteria | 2910 |
| 615 | Ga0450896_006912 | 3300042133 | Bacteria | 1561 |
| 616 | Ga0450903_002830 | 3300042138 | Bacteria | 3041 |
| 617 | Ga0450904_004984 | 3300042139 | Bacteria | 1360 |
| 618 | Ga0450906_006297 | 3300042145 | Bacteria | 2402 |
| 619 | Ga0439446_0008817 | 3300042156 | Bacteria | 2689 |
| 620 | Ga0439446_0013665 | 3300042156 | Bacteria | 2231 |
| 621 | Ga0439446_0032048 | 3300042156 | Bacteria | 1523 |
| 622 | Ga0439458_0063612 | 3300042157 | Bacteria | 924 |
| 623 | Ga0450909_005880 | 3300042185 | Bacteria | 1769 |
| 624 | Ga0439434_0005729 | 3300042435 | Bacteria | 3627 |
| 625 | Ga0439434_0026127 | 3300042435 | Bacteria | 1763 |
| 626 | Ga0439434_0050534 | 3300042435 | Bacteria | 1288 |
| 627 | Ga0439464_0001842 | 3300042439 | Bacteria | 5120 |
| 628 | Ga0450893_0005053 | 3300042532 | Bacteria | 2108 |
| 629 | Ga0451577_0640608 | 3300042876 | Bacteria | 964 |
| 630 | Ga0466969_0012592 | 3300044656 | Bacteria | 4458 |
| 631 | Ga0466969_0051183 | 3300044656 | Bacteria | 2033 |
| 632 | Ga0466972_0021071 | 3300044658 | Bacteria | 3254 |
| 633 | Ga0466965_0030838 | 3300044683 | Bacteria | 2613 |
| 634 | Ga0466966_0000006 | 3300044684 | Bacteria | 179770 |
| 635 | Ga0466966_0001397 | 3300044684 | Bacteria | 15522 |
| 636 | Ga0466966_0005729 | 3300044684 | Bacteria | 8177 |
| 637 | Ga0466966_0026838 | 3300044684 | Bacteria | 3758 |
| 638 | Ga0466966_0064567 | 3300044684 | Bacteria | 2304 |
| 639 | Ga0466966_0147501 | 3300044684 | Bacteria | 1436 |
| 640 | Ga0466961_0000799 | 3300044693 | Bacteria | 19647 |
| 641 | Ga0466961_0046823 | 3300044693 | Bacteria | 2765 |
| 642 | Ga0466963_0000688 | 3300044694 | Bacteria | 16430 |
| 643 | Ga0466963_0031591 | 3300044694 | Bacteria | 3424 |
| 644 | Ga0466963_0035811 | 3300044694 | Bacteria | 3234 |
| 645 | Ga0466964_0000862 | 3300044706 | Bacteria | 9932 |
| 646 | Ga0466971_0003183 | 3300044719 | Bacteria | 7007 |
| 647 | Ga0466971_0093519 | 3300044719 | Bacteria | 1378 |
| 648 | Ga0466957_0042055 | 3300044842 | Bacteria | 2764 |
| 649 | Ga0466957_0049190 | 3300044842 | Bacteria | 2563 |
| 650 | Ga0466957_0052427 | 3300044842 | Bacteria | 2484 |
| 651 | Ga0466957_0162002 | 3300044842 | Bacteria | 1453 |
| 652 | Ga0466959_0056076 | 3300045049 | Bacteria | 2875 |
| 653 | Ga0466959_0085002 | 3300045049 | Bacteria | 2277 |
| 654 | Ga0466959_0192552 | 3300045049 | Bacteria | 1422 |
| 655 | Ga0466958_0008929 | 3300045836 | Bacteria | 5569 |
| 656 | Ga0466967_0032091 | 3300045976 | Bacteria | 4431 |
| 657 | Ga0466967_0040743 | 3300045976 | Bacteria | 4000 |
| 658 | Ga0466967_0050170 | 3300045976 | Bacteria | 3653 |
| 659 | Ga0466967_0631021 | 3300045976 | Bacteria | 1059 |
| 660 | Ga0495592_0020483 | 3300046454 | Bacteria | 5030 |
| 661 | Ga0495592_0115372 | 3300046454 | Bacteria | 1896 |
| 662 | Ga0495603_0044634 | 3300046455 | Bacteria | 2644 |
| 663 | Ga0495603_0172096 | 3300046455 | Bacteria | 1254 |
| 664 | Ga0495590_0050981 | 3300046457 | Bacteria | 1445 |
| 665 | Ga0495591_000634 | 3300046458 | Bacteria | 26050 |
| 666 | Ga0495629_0000041 | 3300046459 | Bacteria | 115135 |
| 667 | Ga0495629_0002085 | 3300046459 | Bacteria | 15511 |
| 668 | Ga0495629_0006466 | 3300046459 | Bacteria | 8679 |
| 669 | Ga0495629_0020326 | 3300046459 | Bacteria | 4742 |
| 670 | Ga0495629_0023121 | 3300046459 | Bacteria | 4429 |
| 671 | Ga0495638_0001336 | 3300046460 | Bacteria | 22627 |
| 672 | Ga0495638_0009586 | 3300046460 | Bacteria | 6778 |
| 673 | Ga0495641_0003952 | 3300046461 | Bacteria | 10770 |
| 674 | Ga0495641_0013087 | 3300046461 | Bacteria | 4587 |
| 675 | Ga0495651_0059416 | 3300046462 | Bacteria | 2932 |
| 676 | Ga0495651_0069388 | 3300046462 | Bacteria | 2685 |
| 677 | Ga0495651_0112435 | 3300046462 | Bacteria | 2012 |
| 678 | Ga0495651_0159935 | 3300046462 | Bacteria | 1615 |
| 679 | Ga0495653_0000217 | 3300046463 | Bacteria | 46686 |
| 680 | Ga0495653_0001593 | 3300046463 | Bacteria | 17817 |
| 681 | Ga0495653_0002973 | 3300046463 | Bacteria | 13572 |
| 682 | Ga0495653_0009568 | 3300046463 | Bacteria | 7927 |
| 683 | Ga0495653_0083664 | 3300046463 | Bacteria | 2352 |
| 684 | Ga0495650_0010210 | 3300046471 | Bacteria | 5255 |
| 685 | Ga0495650_0017107 | 3300046471 | Bacteria | 3647 |
| 686 | Ga0495580_0000292 | 3300046472 | Bacteria | 40782 |
| 687 | Ga0495580_0001078 | 3300046472 | Bacteria | 23945 |
| 688 | Ga0495580_0002641 | 3300046472 | Bacteria | 15569 |
| 689 | Ga0495580_0003482 | 3300046472 | Bacteria | 13402 |
| 690 | Ga0495580_0030630 | 3300046472 | Bacteria | 3894 |
| 691 | Ga0495580_0057182 | 3300046472 | Bacteria | 2745 |
| 692 | Ga0495580_0167103 | 3300046472 | Bacteria | 1521 |
| 693 | Ga0495582_0002227 | 3300046473 | Bacteria | 10858 |
| 694 | Ga0495582_0211155 | 3300046473 | Bacteria | 1109 |
| 695 | Ga0495605_0017241 | 3300046474 | Bacteria | 3892 |
| 696 | Ga0495605_0044902 | 3300046474 | Bacteria | 2181 |
| 697 | Ga0495605_0103109 | 3300046474 | Bacteria | 1309 |
| 698 | Ga0495639_0004269 | 3300046475 | Bacteria | 6130 |
| 699 | Ga0495639_0078147 | 3300046475 | Bacteria | 1537 |
| 700 | Ga0495662_0008395 | 3300046476 | Bacteria | 5080 |
| 701 | Ga0495662_0020078 | 3300046476 | Bacteria | 3233 |
| 702 | Ga0495662_0095520 | 3300046476 | Bacteria | 1452 |
| 703 | Ga0495664_0000109 | 3300046477 | Bacteria | 40957 |
| 704 | Ga0495664_0049115 | 3300046477 | Bacteria | 2505 |
| 705 | Ga0495664_0053210 | 3300046477 | Bacteria | 2407 |
| 706 | Ga0495664_0061462 | 3300046477 | Bacteria | 2236 |
| 707 | Ga0495584_0023741 | 3300046491 | Bacteria | 3109 |
| 708 | Ga0495584_0139920 | 3300046491 | Bacteria | 1229 |
| 709 | Ga0495594_0068921 | 3300046499 | Bacteria | 1965 |
| 710 | Ga0495596_0001846 | 3300046500 | Bacteria | 11754 |
| 711 | Ga0495596_0053225 | 3300046500 | Bacteria | 1584 |
| 712 | Ga0495596_0070611 | 3300046500 | Bacteria | 1357 |
| 713 | Ga0495583_0000481 | 3300046506 | Bacteria | 58360 |
| 714 | Ga0495583_0003634 | 3300046506 | Bacteria | 11523 |
| 715 | Ga0495606_0004722 | 3300046507 | Bacteria | 13426 |
| 716 | Ga0495608_0005018 | 3300046511 | Bacteria | 9470 |
| 717 | Ga0495608_0018548 | 3300046511 | Bacteria | 4797 |
| 718 | Ga0495616_0069622 | 3300046513 | Bacteria | 1705 |
| 719 | Ga0495618_0002705 | 3300046514 | Bacteria | 11297 |
| 720 | Ga0495618_0025581 | 3300046514 | Bacteria | 3663 |
| 721 | Ga0495618_0267306 | 3300046514 | Bacteria | 1070 |
| 722 | Ga0495628_0010428 | 3300046516 | Bacteria | 7894 |
| 723 | Ga0495628_0086625 | 3300046516 | Bacteria | 2428 |
| 724 | Ga0495628_0094397 | 3300046516 | Bacteria | 2312 |
| 725 | Ga0495630_0004630 | 3300046517 | Bacteria | 9648 |
| 726 | Ga0495630_0006315 | 3300046517 | Bacteria | 8418 |
| 727 | Ga0495630_0039120 | 3300046517 | Bacteria | 3547 |
| 728 | Ga0495630_0041362 | 3300046517 | Bacteria | 3441 |
| 729 | Ga0495630_0048964 | 3300046517 | Bacteria | 3163 |
| 730 | Ga0495630_0467579 | 3300046517 | Bacteria | 966 |
| 731 | Ga0495630_0589678 | 3300046517 | Bacteria | 852 |
| 732 | Ga0495644_0029101 | 3300046523 | Bacteria | 2088 |
| 733 | Ga0495648_0008757 | 3300046524 | Bacteria | 7922 |
| 734 | Ga0495648_0013472 | 3300046524 | Bacteria | 6040 |
| 735 | Ga0495648_0068281 | 3300046524 | Bacteria | 2074 |
| 736 | Ga0495666_0002166 | 3300046526 | Bacteria | 9767 |
| 737 | Ga0495666_0003060 | 3300046526 | Bacteria | 8407 |
| 738 | Ga0495666_0011032 | 3300046526 | Bacteria | 4508 |
| 739 | Ga0495652_0001202 | 3300046529 | Bacteria | 28975 |
| 740 | Ga0495652_0004403 | 3300046529 | Bacteria | 13464 |
| 741 | Ga0495652_0048754 | 3300046529 | Bacteria | 3627 |
| 742 | Ga0495652_0353452 | 3300046529 | Bacteria | 1052 |
| 743 | Ga0495665_0000102 | 3300046531 | Bacteria | 39799 |
| 744 | Ga0495665_0014425 | 3300046531 | Bacteria | 4262 |
| 745 | Ga0495665_0018926 | 3300046531 | Bacteria | 3701 |
| 746 | Ga0495665_0025941 | 3300046531 | Bacteria | 3147 |
| 747 | Ga0495665_0081594 | 3300046531 | Bacteria | 1700 |
| 748 | Ga0495665_0099712 | 3300046531 | Bacteria | 1524 |
| 749 | Ga0495640_0001811 | 3300046533 | Bacteria | 16954 |
| 750 | Ga0495640_0014737 | 3300046533 | Bacteria | 5905 |
| 751 | Ga0495640_0259715 | 3300046533 | Bacteria | 1086 |
| 752 | Ga0495586_0019191 | 3300046535 | Bacteria | 3637 |
| 753 | Ga0495586_0084649 | 3300046535 | Bacteria | 1746 |
| 754 | Ga0495587_0003529 | 3300046536 | Bacteria | 10412 |
| 755 | Ga0495609_0045483 | 3300046538 | Bacteria | 1967 |
| 756 | Ga0495609_0151274 | 3300046538 | Bacteria | 987 |
| 757 | Ga0495645_0001558 | 3300046543 | Bacteria | 15523 |
| 758 | Ga0495645_0062903 | 3300046543 | Bacteria | 2687 |
| 759 | Ga0495645_0078600 | 3300046543 | Bacteria | 2371 |
| 760 | Ga0495645_0145426 | 3300046543 | Bacteria | 1651 |
| 761 | Ga0495622_0000222 | 3300046557 | Bacteria | 44989 |
| 762 | Ga0495667_0002040 | 3300046559 | Bacteria | 13389 |
| 763 | Ga0495667_0026878 | 3300046559 | Bacteria | 3878 |
| 764 | Ga0495634_0004254 | 3300046642 | Bacteria | 11290 |
| 765 | Ga0495634_0008269 | 3300046642 | Bacteria | 7757 |
| 766 | Ga0495634_0051889 | 3300046642 | Bacteria | 2751 |
| 767 | Ga0495634_0216778 | 3300046642 | Bacteria | 1183 |
| 768 | Ga0495611_0028429 | 3300046648 | Bacteria | 2448 |
| 769 | Ga0495625_0019320 | 3300046660 | Bacteria | 5290 |
| 770 | Ga0495625_0067078 | 3300046660 | Bacteria | 2526 |
| 771 | Ga0495625_0106321 | 3300046660 | Bacteria | 1922 |
| 772 | Ga0495635_0000852 | 3300046663 | Bacteria | 19966 |
| 773 | Ga0495635_0001046 | 3300046663 | Bacteria | 18351 |
| 774 | Ga0495635_0003763 | 3300046663 | Bacteria | 10531 |
| 775 | Ga0495635_0009347 | 3300046663 | Bacteria | 6851 |
| 776 | Ga0495635_0009844 | 3300046663 | Bacteria | 6683 |
| 777 | Ga0495661_0001184 | 3300046665 | Bacteria | 22639 |
| 778 | Ga0495661_0003822 | 3300046665 | Bacteria | 11017 |
| 779 | Ga0495661_0094341 | 3300046665 | Bacteria | 1696 |
| 780 | Ga0495588_0008163 | 3300046674 | Bacteria | 4793 |
| 781 | Ga0495588_0079984 | 3300046674 | Bacteria | 1706 |
| 782 | Ga0495588_0181920 | 3300046674 | Bacteria | 1111 |
| 783 | Ga0495657_0086894 | 3300046675 | Bacteria | 2013 |
| 784 | Ga0495657_0096914 | 3300046675 | Bacteria | 1884 |
| 785 | Ga0495599_0007923 | 3300046678 | Bacteria | 6444 |
| 786 | Ga0495599_0032059 | 3300046678 | Bacteria | 3298 |
| 787 | Ga0495599_0067451 | 3300046678 | Bacteria | 2234 |
| 788 | Ga0495599_0101840 | 3300046678 | Bacteria | 1790 |
| 789 | Ga0495623_0029735 | 3300046679 | Bacteria | 3515 |
| 790 | Ga0495623_0049423 | 3300046679 | Bacteria | 2665 |
| 791 | Ga0495623_0097012 | 3300046679 | Bacteria | 1800 |
| 792 | Ga0495646_0000546 | 3300046680 | Bacteria | 20295 |
| 793 | Ga0495646_0003447 | 3300046680 | Bacteria | 9840 |
| 794 | Ga0495646_0011537 | 3300046680 | Bacteria | 5610 |
| 795 | Ga0495646_0046302 | 3300046680 | Bacteria | 2652 |
| 796 | Ga0495646_0155539 | 3300046680 | Bacteria | 1269 |
| 797 | Ga0495647_0107770 | 3300046681 | Bacteria | 1160 |
| 798 | Ga0495613_0007648 | 3300046689 | Bacteria | 8041 |
| 799 | Ga0495613_0019016 | 3300046689 | Bacteria | 5118 |
| 800 | Ga0495613_0124455 | 3300046689 | Bacteria | 1850 |
| 801 | Ga0495613_0126889 | 3300046689 | Bacteria | 1829 |
| 802 | Ga0495624_0000067 | 3300046690 | Bacteria | 66836 |
| 803 | Ga0495624_0002416 | 3300046690 | Bacteria | 14187 |
| 804 | Ga0495624_0008750 | 3300046690 | Bacteria | 7044 |
| 805 | Ga0495624_0019355 | 3300046690 | Bacteria | 4546 |
| 806 | Ga0495671_0021569 | 3300046692 | Bacteria | 3381 |
| 807 | Ga0495671_0080716 | 3300046692 | Bacteria | 1594 |
| 808 | Ga0495671_0102524 | 3300046692 | Bacteria | 1398 |
| 809 | Ga0495649_0030084 | 3300046694 | Bacteria | 2999 |
| 810 | Ga0495649_0068173 | 3300046694 | Bacteria | 1909 |
| 811 | Ga0495589_0006991 | 3300046794 | Bacteria | 5919 |
| 812 | Ga0495589_0026849 | 3300046794 | Bacteria | 2916 |
| 813 | Ga0495600_0003130 | 3300046809 | Bacteria | 9689 |
| 814 | Ga0495600_0017324 | 3300046809 | Bacteria | 4581 |
| 815 | Ga0495581_0000839 | 3300047315 | Bacteria | 16361 |
| 816 | Ga0495581_0006036 | 3300047315 | Bacteria | 7021 |
| 817 | Ga0495604_0003897 | 3300047317 | Bacteria | 11882 |
| 818 | Ga0495604_0004803 | 3300047317 | Bacteria | 10713 |
| 819 | Ga0495604_0006820 | 3300047317 | Bacteria | 9050 |
| 820 | Ga0495604_0007926 | 3300047317 | Bacteria | 8413 |
| 821 | Ga0495604_0046122 | 3300047317 | Bacteria | 3398 |
| 822 | Ga0495604_0179777 | 3300047317 | Bacteria | 1480 |
| 823 | Ga0495674_0000035 | 3300047319 | Bacteria | 104643 |
| 824 | Ga0495674_0000088 | 3300047319 | Bacteria | 64974 |
| 825 | Ga0495674_0002312 | 3300047319 | Bacteria | 18701 |
| 826 | Ga0495674_0009692 | 3300047319 | Bacteria | 9143 |
| 827 | Ga0495674_0012457 | 3300047319 | Bacteria | 8012 |
| 828 | Ga0495674_0015386 | 3300047319 | Bacteria | 7153 |
| 829 | Ga0495674_0021311 | 3300047319 | Bacteria | 5995 |
| 830 | Ga0495674_0087871 | 3300047319 | Bacteria | 2660 |
| 831 | Ga0495674_0257142 | 3300047319 | Bacteria | 1435 |
| 832 | Ga0495674_0378264 | 3300047319 | Bacteria | 1146 |
| 833 | Ga0495672_0004625 | 3300047320 | Bacteria | 11170 |
| 834 | Ga0495672_0030969 | 3300047320 | Bacteria | 3345 |
| 835 | Ga0495672_0031420 | 3300047320 | Bacteria | 3314 |
| 836 | Ga0495672_0033056 | 3300047320 | Bacteria | 3209 |
| 837 | Ga0495676_0000511 | 3300047321 | Bacteria | 31710 |
| 838 | Ga0495676_0005872 | 3300047321 | Bacteria | 11266 |
| 839 | Ga0495676_0035586 | 3300047321 | Bacteria | 4163 |
| 840 | Ga0495676_0132102 | 3300047321 | Bacteria | 1800 |
| 841 | Ga0495676_0199669 | 3300047321 | Bacteria | 1390 |
| 842 | Ga0495680_0001707 | 3300047322 | Bacteria | 23335 |
| 843 | Ga0495680_0006288 | 3300047322 | Bacteria | 11061 |
| 844 | Ga0495680_0007830 | 3300047322 | Bacteria | 9755 |
| 845 | Ga0495680_0020726 | 3300047322 | Bacteria | 5520 |
| 846 | Ga0495680_0042069 | 3300047322 | Bacteria | 3628 |
| 847 | Ga0495680_0063050 | 3300047322 | Bacteria | 2847 |
| 848 | Ga0495680_0064818 | 3300047322 | Bacteria | 2800 |
| 849 | Ga0495683_0002967 | 3300047323 | Bacteria | 10017 |
| 850 | Ga0495687_000094 | 3300047443 | Bacteria | 136181 |
| 851 | Ga0495687_008249 | 3300047443 | Bacteria | 5994 |
| 852 | Ga0495687_079565 | 3300047443 | Bacteria | 1288 |
| 853 | Ga0495675_0009422 | 3300047444 | Bacteria | 6076 |
| 854 | Ga0495675_0054447 | 3300047444 | Bacteria | 2538 |
| 855 | Ga0495675_0136490 | 3300047444 | Bacteria | 1522 |
| 856 | Ga0495679_000007 | 3300047446 | Bacteria | 401482 |
| 857 | Ga0495679_002567 | 3300047446 | Bacteria | 9156 |
| 858 | Ga0495679_004234 | 3300047446 | Bacteria | 6674 |
| 859 | Ga0495673_0028533 | 3300047469 | Bacteria | 2642 |
| 860 | Ga0495673_0053773 | 3300047469 | Bacteria | 1754 |
| 861 | Ga0495673_0066611 | 3300047469 | Bacteria | 1526 |
| 862 | Ga0495684_0001171 | 3300047471 | Bacteria | 21114 |
| 863 | Ga0495684_0004657 | 3300047471 | Bacteria | 10702 |
| 864 | Ga0495686_0000014 | 3300047472 | Bacteria | 474014 |
| 865 | Ga0495686_0032897 | 3300047472 | Bacteria | 3352 |
| 866 | Ga0495593_0001588 | 3300047673 | Bacteria | 13409 |
| 867 | Ga0495593_0002189 | 3300047673 | Bacteria | 11689 |
| 868 | Ga0495593_0004823 | 3300047673 | Bacteria | 8001 |
| 869 | Ga0495593_0010395 | 3300047673 | Bacteria | 5380 |
| 870 | Ga0495602_0000761 | 3300048088 | Bacteria | 30659 |
| 871 | Ga0495602_0033575 | 3300048088 | Bacteria | 4811 |
| 872 | Ga0495602_0066166 | 3300048088 | Bacteria | 3115 |
| 873 | Ga0495602_0087263 | 3300048088 | Bacteria | 2601 |
| 874 | Ga0495602_0110321 | 3300048088 | Bacteria | 2236 |
| 875 | Ga0495602_0110779 | 3300048088 | Bacteria | 2230 |
| 876 | Ga0495614_0002155 | 3300048089 | Bacteria | 8714 |
| 877 | Ga0495614_0002482 | 3300048089 | Bacteria | 8207 |
| 878 | Ga0495614_0006922 | 3300048089 | Bacteria | 5071 |
| 879 | Ga0495614_0009506 | 3300048089 | Bacteria | 4298 |
| 880 | Ga0495626_0008973 | 3300048091 | Bacteria | 5427 |
| 881 | Ga0496100_0003525 | 3300048903 | Bacteria | 8171 |
| 882 | Ga0496100_0015657 | 3300048903 | Bacteria | 4432 |
| 883 | Ga0496100_0101051 | 3300048903 | Bacteria | 1987 |
| 884 | Ga0496100_0410692 | 3300048903 | Bacteria | 1033 |
| 885 | Ga0496101_0004588 | 3300048904 | Bacteria | 8727 |
| 886 | Ga0496102_0001490 | 3300048905 | Bacteria | 20686 |
| 887 | Ga0496102_0014399 | 3300048905 | Bacteria | 6872 |
| 888 | Ga0496102_0210892 | 3300048905 | Unclassified | 1831 |
| 889 | Ga0496102_0273317 | 3300048905 | Bacteria | 1593 |
| 890 | Ga0496103_0001870 | 3300048906 | Bacteria | 13679 |
| 891 | Ga0496103_0009502 | 3300048906 | Bacteria | 5757 |
| 892 | Ga0496103_0109443 | 3300048906 | Bacteria | 1754 |
| 893 | Ga0496104_0004872 | 3300048907 | Bacteria | 11701 |
| 894 | Ga0496104_0022590 | 3300048907 | Bacteria | 5777 |
| 895 | Ga0496104_0046279 | 3300048907 | Bacteria | 4096 |
| 896 | Ga0496104_0046592 | 3300048907 | Bacteria | 4083 |
| 897 | Ga0496104_0129292 | 3300048907 | Bacteria | 2426 |
| 898 | Ga0496104_0158075 | 3300048907 | Bacteria | 2175 |
| 899 | Ga0496104_0574544 | 3300048907 | Bacteria | 1038 |
| 900 | Ga0496105_0004419 | 3300048908 | Bacteria | 10585 |
| 901 | Ga0496105_0021301 | 3300048908 | Bacteria | 5245 |
| 902 | Ga0496105_0325955 | 3300048908 | Bacteria | 1230 |
| 903 | Ga0496106_0000392 | 3300048909 | Bacteria | 31231 |
| 904 | Ga0496107_0003945 | 3300048910 | Bacteria | 9979 |
| 905 | Ga0496108_0090903 | 3300048911 | Bacteria | 2595 |
| 906 | Ga0496109_0003262 | 3300048912 | Bacteria | 13533 |
| 907 | Ga0496109_0082126 | 3300048912 | Bacteria | 2970 |
| 908 | Ga0496109_0165496 | 3300048912 | Bacteria | 2073 |
| 909 | Ga0496110_0088630 | 3300048913 | Bacteria | 2764 |
| 910 | Ga0496110_0182288 | 3300048913 | Bacteria | 1907 |
| 911 | Ga0496111_0124109 | 3300048914 | Bacteria | 1908 |
| 912 | Ga0496112_0000224 | 3300048915 | Bacteria | 36869 |
| 913 | Ga0496112_0035759 | 3300048915 | Bacteria | 4840 |
| 914 | Ga0496112_0057636 | 3300048915 | Bacteria | 3825 |
| 915 | Ga0496113_0000540 | 3300048916 | Bacteria | 18687 |
| 916 | Ga0496113_0027595 | 3300048916 | Bacteria | 4072 |
| 917 | Ga0496114_0041487 | 3300048917 | Bacteria | 3814 |
| 918 | Ga0496115_0131344 | 3300048918 | Bacteria | 2064 |
| 919 | Ga0496116_0009863 | 3300048919 | Bacteria | 8081 |
| 920 | Ga0496116_0158874 | 3300048919 | Bacteria | 1243 |
| 921 | Ga0496117_0007461 | 3300048920 | Bacteria | 10672 |
| 922 | Ga0496117_0010428 | 3300048920 | Bacteria | 8475 |
| 923 | Ga0496117_0018653 | 3300048920 | Bacteria | 5735 |
| 924 | Ga0496117_0025338 | 3300048920 | Bacteria | 4666 |
| 925 | Ga0496117_0035649 | 3300048920 | Bacteria | 3732 |
| 926 | Ga0496117_0036399 | 3300048920 | Bacteria | 3683 |
| 927 | Ga0496118_0000603 | 3300048921 | Bacteria | 59380 |
| 928 | Ga0496118_0001810 | 3300048921 | Bacteria | 30800 |
| 929 | Ga0496118_0005819 | 3300048921 | Bacteria | 13819 |
| 930 | Ga0496118_0016638 | 3300048921 | Bacteria | 6738 |
| 931 | Ga0496118_0024742 | 3300048921 | Bacteria | 5172 |
| 932 | Ga0496118_0038955 | 3300048921 | Bacteria | 3801 |
| 933 | Ga0496118_0083663 | 3300048921 | Bacteria | 2230 |
| 934 | Ga0496119_0037641 | 3300048922 | Bacteria | 3139 |
| 935 | Ga0496119_0060402 | 3300048922 | Bacteria | 2269 |
| 936 | Ga0496119_0063362 | 3300048922 | Bacteria | 2199 |
| 937 | Ga0496119_0087762 | 3300048922 | Bacteria | 1775 |
| 938 | Ga0496120_0000122 | 3300048923 | Bacteria | 130209 |
| 939 | Ga0496120_0000197 | 3300048923 | Bacteria | 103378 |
| 940 | Ga0496120_0082644 | 3300048923 | Bacteria | 1735 |
| 941 | Ga0496121_0000747 | 3300048924 | Bacteria | 59731 |
| 942 | Ga0496121_0003287 | 3300048924 | Bacteria | 23207 |
| 943 | Ga0496121_0013905 | 3300048924 | Bacteria | 8603 |
| 944 | Ga0496121_0020006 | 3300048924 | Bacteria | 6657 |
| 945 | Ga0496121_0041765 | 3300048924 | Bacteria | 4003 |
| 946 | Ga0496121_0050582 | 3300048924 | Bacteria | 3509 |
| 947 | Ga0496121_0066000 | 3300048924 | Bacteria | 2941 |
| 948 | Ga0496121_0084256 | 3300048924 | Bacteria | 2507 |
| 949 | Ga0496121_0262294 | 3300048924 | Bacteria | 1192 |
| 950 | Ga0496122_0000497 | 3300048925 | Bacteria | 81763 |
| 951 | Ga0496122_0047438 | 3300048925 | Bacteria | 3316 |
| 952 | Ga0496122_0271464 | 3300048925 | Bacteria | 934 |
| 953 | Ga0496123_0001884 | 3300048926 | Bacteria | 27381 |
| 954 | Ga0496124_0000007 | 3300048927 | Bacteria | 883534 |
| 955 | Ga0496125_0000166 | 3300048928 | Bacteria | 147432 |
| 956 | Ga0496125_0004601 | 3300048928 | Bacteria | 15768 |
| 957 | Ga0496125_0022365 | 3300048928 | Bacteria | 5873 |
| 958 | Ga0496125_0029114 | 3300048928 | Bacteria | 4971 |
| 959 | Ga0496125_0034773 | 3300048928 | Bacteria | 4435 |
| 960 | Ga0496125_0103357 | 3300048928 | Bacteria | 2091 |
| 961 | Ga0496126_0001259 | 3300048929 | Bacteria | 40861 |
| 962 | Ga0496126_0006922 | 3300048929 | Bacteria | 12560 |
| 963 | Ga0496126_0018649 | 3300048929 | Bacteria | 6868 |
| 964 | Ga0496126_0064839 | 3300048929 | Bacteria | 3271 |
| 965 | Ga0496126_0080480 | 3300048929 | Bacteria | 2883 |
| 966 | Ga0496126_0128990 | 3300048929 | Bacteria | 2187 |
| 967 | Ga0496126_0233949 | 3300048929 | Bacteria | 1538 |
| 968 | Ga0495682_0014349 | 3300049460 | Bacteria | 3006 |
| 969 | Ga0495682_0017668 | 3300049460 | Bacteria | 2688 |
| 970 | Ga0495682_0038574 | 3300049460 | Bacteria | 1755 |
| 971 | Ga0495682_0040460 | 3300049460 | Bacteria | 1709 |
| 972 | Ga0501031_0315137 | 3300049568 | Bacteria | 1013 |
| 973 | Ga0501032_0043691 | 3300049569 | Bacteria | 3033 |
| 974 | Ga0501033_0034822 | 3300049570 | Bacteria | 3775 |
| 975 | Ga0501033_0110486 | 3300049570 | Bacteria | 2001 |
| 976 | Ga0501034_0001140 | 3300049571 | Bacteria | 37002 |
| 977 | Ga0501034_0001685 | 3300049571 | Bacteria | 28484 |
| 978 | Ga0501034_0037950 | 3300049571 | Bacteria | 4879 |
| 979 | Ga0501034_0045339 | 3300049571 | Bacteria | 4443 |
| 980 | Ga0501034_0054151 | 3300049571 | Bacteria | 4039 |
| 981 | Ga0501034_0088095 | 3300049571 | Bacteria | 3103 |
| 982 | Ga0501034_0149937 | 3300049571 | Bacteria | 2308 |
| 983 | Ga0501034_0175420 | 3300049571 | Bacteria | 2109 |
| 984 | Ga0501036_0010427 | 3300049572 | Bacteria | 7673 |
| 985 | Ga0501036_0566040 | 3300049572 | Bacteria | 944 |
| 986 | Ga0501036_0588219 | 3300049572 | Bacteria | 924 |
| 987 | Ga0501037_0023645 | 3300049573 | Bacteria | 4543 |
| 988 | Ga0501037_0320784 | 3300049573 | Bacteria | 1073 |
| 989 | Ga0501038_0006734 | 3300049574 | Bacteria | 10616 |
| 990 | Ga0501038_0058696 | 3300049574 | Bacteria | 3298 |
| 991 | Ga0501039_0007774 | 3300049575 | Bacteria | 8178 |
| 992 | Ga0501040_0025342 | 3300049576 | Bacteria | 3987 |
| 993 | Ga0501041_0051080 | 3300049577 | Bacteria | 2519 |
| 994 | Ga0501042_0088991 | 3300049578 | Bacteria | 2215 |
| 995 | Ga0501043_0014175 | 3300049579 | Bacteria | 6237 |
| 996 | Ga0501043_0017944 | 3300049579 | Bacteria | 5549 |
| 997 | Ga0501046_0011523 | 3300049580 | Bacteria | 7560 |
| 998 | Ga0501046_0127658 | 3300049580 | Bacteria | 1931 |
| 999 | Ga0501047_0085650 | 3300049581 | Bacteria | 3028 |
| 1000 | Ga0501047_0119893 | 3300049581 | Bacteria | 2513 |
| 1001 | Ga0501047_0167594 | 3300049581 | Bacteria | 2067 |
| 1002 | Ga0501047_0201794 | 3300049581 | Bacteria | 1850 |
| 1003 | Ga0501048_0056505 | 3300049582 | Bacteria | 2784 |
| 1004 | Ga0501048_0059441 | 3300049582 | Bacteria | 2709 |
| 1005 | Ga0501067_0012016 | 3300049583 | Bacteria | 4799 |
| 1006 | Ga0501068_0005551 | 3300049584 | Bacteria | 6910 |
| 1007 | Ga0501070_0099916 | 3300049586 | Bacteria | 2400 |
| 1008 | Ga0501070_0146296 | 3300049586 | Bacteria | 1950 |
| 1009 | Ga0501070_0362206 | 3300049586 | Bacteria | 1176 |
| 1010 | Ga0501071_0009643 | 3300049587 | Bacteria | 6445 |
| 1011 | Ga0501072_0009667 | 3300049588 | Bacteria | 7335 |
| 1012 | Ga0501074_0245567 | 3300049590 | Bacteria | 1273 |
| 1013 | Ga0501076_0046193 | 3300049592 | Bacteria | 3440 |
| 1014 | Ga0501077_0004702 | 3300049593 | Bacteria | 8300 |
| 1015 | Ga0501077_0033984 | 3300049593 | Bacteria | 3245 |
| 1016 | Ga0501079_0285049 | 3300049741 | Bacteria | 1291 |
| 1017 | Ga0501081_0048092 | 3300049743 | Bacteria | 2935 |
| 1018 | Ga0501081_0072230 | 3300049743 | Bacteria | 2406 |
| 1019 | Ga0501035_0008018 | 3300049822 | Bacteria | 9844 |
| 1020 | Ga0501035_0125934 | 3300049822 | Bacteria | 2236 |
| 1021 | Ga0501044_0055019 | 3300049823 | Bacteria | 4088 |
| 1022 | Ga0501044_0095456 | 3300049823 | Bacteria | 2996 |
| 1023 | Ga0501044_0287403 | 3300049823 | Bacteria | 1577 |
| 1024 | Ga0501045_0012436 | 3300049824 | Bacteria | 5993 |
| 1025 | nmdc:mga03683_16511_c1 | 3300050489 | Bacteria | 2775 |
| 1026 | nmdc:mga03n38_92293_c1 | 3300050490 | Bacteria | 1444 |
| 1027 | nmdc:mga00v17_4840_c1 | 3300050491 | Bacteria | 7052 |
| 1028 | nmdc:mga0yw44_130987_c1 | 3300050492 | Bacteria | 1624 |
| 1029 | nmdc:mga0yw44_817_c1 | 3300050492 | Bacteria | 11605 |
| 1030 | nmdc:mga0k408_16518_c1 | 3300050493 | Bacteria | 4097 |
| 1031 | nmdc:mga0k408_353_c1 | 3300050493 | Bacteria | 25220 |
| 1032 | nmdc:mga0k408_85365_c1 | 3300050493 | Bacteria | 1853 |
| 1033 | nmdc:mga06z11_173654_c1 | 3300050494 | Bacteria | 1239 |
| 1034 | nmdc:mga06z11_283900_c1 | 3300050494 | Bacteria | 981 |
| 1035 | nmdc:mga06z11_791_c1 | 3300050494 | Bacteria | 11560 |
| 1036 | nmdc:mga04h51_5107_c1 | 3300050495 | Bacteria | 3325 |
| 1037 | nmdc:mga07m45_23686_c1 | 3300050496 | Bacteria | 3357 |
| 1038 | nmdc:mga07m45_2716_c1 | 3300050496 | Bacteria | 8340 |
| 1039 | nmdc:mga07m45_28324_c1 | 3300050496 | Bacteria | 3092 |
| 1040 | nmdc:mga07m45_43155_c1 | 3300050496 | Bacteria | 2528 |
| 1041 | nmdc:mga07m45_60928_c1 | 3300050496 | Bacteria | 2137 |
| 1042 | nmdc:mga07m45_88_c1 | 3300050496 | Bacteria | 34971 |
| 1043 | nmdc:mga05p37_463939_c1 | 3300050507 | Bacteria | 1463 |
| 1044 | nmdc:mga05p37_85493_c1 | 3300050507 | Bacteria | 3887 |
| 1045 | nmdc:mga09592_38642_c1 | 3300050508 | Bacteria | 4007 |
| 1046 | nmdc:mga06r32_26484_c1 | 3300050510 | Bacteria | 5407 |
| 1047 | nmdc:mga08y16_24351_c1 | 3300050511 | Bacteria | 6389 |
| 1048 | nmdc:mga08y16_6662_c1 | 3300050511 | Bacteria | 12112 |
| 1049 | nmdc:mga0a205_592920_c1 | 3300050515 | Bacteria | 961 |
| 1050 | nmdc:mga0sz30_922_c1 | 3300050516 | Bacteria | 10588 |
| 1051 | Ga0495601_0234603 | 3300053077 | Bacteria | 1198 |
| 1052 | Ga0500643_032523 | 3300053087 | Bacteria | 1583 |
| 1053 | Ga0500644_0110418 | 3300053088 | Bacteria | 1058 |
| 1054 | Ga0500651_0036271 | 3300053093 | Bacteria | 3107 |
| 1055 | Ga0500641_0004206 | 3300053096 | Bacteria | 5079 |
| 1056 | Ga0500562_000203 | 3300053108 | Bacteria | 16106 |
| 1057 | Ga0500562_010790 | 3300053108 | Bacteria | 2317 |
| 1058 | Ga0500562_018737 | 3300053108 | Bacteria | 1788 |
| 1059 | Ga0500595_024835 | 3300053119 | Bacteria | 2086 |
| 1060 | Ga0500658_0133854 | 3300053134 | Bacteria | 1108 |
| 1061 | Ga0500568_0008733 | 3300053139 | Bacteria | 4860 |
| 1062 | Ga0500577_0005383 | 3300053142 | Bacteria | 3444 |
| 1063 | Ga0500616_0001986 | 3300053153 | Bacteria | 18171 |
| 1064 | Ga0500634_0070488 | 3300053161 | Bacteria | 1830 |
| 1065 | Ga0500637_0047407 | 3300053178 | Bacteria | 2440 |
| 1066 | Ga0501084_0158021 | 3300054114 | Bacteria | 1912 |
| 1067 | Ga0501082_0212370 | 3300060353 | Bacteria | 1683 |
| 1068 | Ga0466962_0000903 | 3300061719 | Bacteria | 13476 |
| 1069 | Ga0466962_0011578 | 3300061719 | Bacteria | 4249 |
| 1070 | Ga0530510_0080158 | 3300061734 | Bacteria | 2375 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025925 | Ga0207650_10200910 | Ga0207650_102009102 | 249 |
| 2 | 3300037471 | Ga0395905_0121573 | Ga0395905_0121573_658_1476 | 256 |
| 3 | 3300041408 | Ga0439453_0035731 | Ga0439453_0035731_12_830 | 256 |
| 4 | 3300042138 | Ga0450903_002830 | Ga0450903_002830_410_1228 | 256 |
| 5 | 3300042139 | Ga0450904_004984 | Ga0450904_004984_26_844 | 256 |
| 6 | 3300042157 | Ga0439458_0063612 | Ga0439458_0063612_65_883 | 256 |
| 7 | 3300042439 | Ga0439464_0001842 | Ga0439464_0001842_2203_3021 | 256 |
| 8 | 3300046538 | Ga0495609_0151274 | Ga0495609_0151274_134_964 | 256 |
| 9 | 3300005445 | Ga0070708_100340258 | Ga0070708_1003402581 | 257 |
| 10 | 3300025292 | Ga0209676_1006255 | Ga0209676_10062554 | 257 |
| 11 | 3300025298 | Ga0209050_1006150 | Ga0209050_10061505 | 257 |
| 12 | 3300025303 | Ga0209051_1008353 | Ga0209051_10083535 | 257 |
| 13 | 3300031911 | Ga0307412_10002104 | Ga0307412_100021046 | 257 |
| 14 | 3300042156 | Ga0439446_0032048 | Ga0439446_0032048_39_857 | 257 |
| 15 | 3300048919 | Ga0496116_0009863 | Ga0496116_0009863_1507_2340 | 257 |
| 16 | 3300048919 | Ga0496116_0158874 | Ga0496116_0158874_110_943 | 257 |
| 17 | 3300048920 | Ga0496117_0018653 | Ga0496117_0018653_3262_4095 | 257 |
| 18 | 3300048920 | Ga0496117_0035649 | Ga0496117_0035649_28_861 | 257 |
| 19 | 3300048921 | Ga0496118_0005819 | Ga0496118_0005819_3108_3941 | 257 |
| 20 | 3300048921 | Ga0496118_0038955 | Ga0496118_0038955_1685_2518 | 257 |
| 21 | 3300048922 | Ga0496119_0037641 | Ga0496119_0037641_750_1583 | 257 |
| 22 | 3300048922 | Ga0496119_0060402 | Ga0496119_0060402_260_1093 | 257 |
| 23 | 3300048923 | Ga0496120_0082644 | Ga0496120_0082644_809_1642 | 257 |
| 24 | 3300048924 | Ga0496121_0003287 | Ga0496121_0003287_8314_9147 | 257 |
| 25 | 3300048924 | Ga0496121_0084256 | Ga0496121_0084256_1435_2268 | 257 |
| 26 | 3300048925 | Ga0496122_0000497 | Ga0496122_0000497_26439_27272 | 257 |
| 27 | 3300048925 | Ga0496122_0047438 | Ga0496122_0047438_755_1588 | 257 |
| 28 | 3300048926 | Ga0496123_0001884 | Ga0496123_0001884_12914_13747 | 257 |
| 29 | 3300048928 | Ga0496125_0000166 | Ga0496125_0000166_60855_61688 | 257 |
| 30 | 3300048928 | Ga0496125_0029114 | Ga0496125_0029114_2566_3399 | 257 |
| 31 | 3300048928 | Ga0496125_0034773 | Ga0496125_0034773_562_1395 | 257 |
| 32 | 3300048929 | Ga0496126_0064839 | Ga0496126_0064839_733_1566 | 257 |
| 33 | 3300039450 | Ga0436363_0692852 | Ga0436363_0692852_161_946 | 259 |
| 34 | 3300039453 | Ga0436362_0992540 | Ga0436362_0992540_317_1111 | 259 |
| 35 | 3300044842 | Ga0466957_0052427 | Ga0466957_0052427_927_1709 | 259 |
| 36 | 3300046642 | Ga0495634_0216778 | Ga0495634_0216778_237_1022 | 259 |
| 37 | 3300005434 | Ga0070709_10120664 | Ga0070709_101206642 | 260 |
| 38 | 3300005437 | Ga0070710_10052399 | Ga0070710_100523992 | 260 |
| 39 | 3300005440 | Ga0070705_100167200 | Ga0070705_1001672001 | 260 |
| 40 | 3300005445 | Ga0070708_100005199 | Ga0070708_1000051996 | 260 |
| 41 | 3300005467 | Ga0070706_100068870 | Ga0070706_1000688704 | 260 |
| 42 | 3300005468 | Ga0070707_100002122 | Ga0070707_10000212211 | 260 |
| 43 | 3300005471 | Ga0070698_100054589 | Ga0070698_1000545894 | 260 |
| 44 | 3300005518 | Ga0070699_100000865 | Ga0070699_10000086527 | 260 |
| 45 | 3300005536 | Ga0070697_100000222 | Ga0070697_10000022211 | 260 |
| 46 | 3300006028 | Ga0070717_10047005 | Ga0070717_100470053 | 260 |
| 47 | 3300006175 | Ga0070712_100093484 | Ga0070712_1000934842 | 260 |
| 48 | 3300025906 | Ga0207699_10019984 | Ga0207699_100199843 | 260 |
| 49 | 3300025910 | Ga0207684_10004845 | Ga0207684_100048454 | 260 |
| 50 | 3300025915 | Ga0207693_10003289 | Ga0207693_100032899 | 260 |
| 51 | 3300025916 | Ga0207663_10025128 | Ga0207663_100251283 | 260 |
| 52 | 3300025917 | Ga0207660_10074211 | Ga0207660_100742112 | 260 |
| 53 | 3300025921 | Ga0207652_10082928 | Ga0207652_100829283 | 260 |
| 54 | 3300025922 | Ga0207646_10001152 | Ga0207646_1000115217 | 260 |
| 55 | 3300025929 | Ga0207664_10103574 | Ga0207664_101035743 | 260 |
| 56 | 3300025942 | Ga0207689_10548658 | Ga0207689_105486581 | 260 |
| 57 | 3300032126 | Ga0307415_100121409 | Ga0307415_1001214092 | 260 |
| 58 | 3300037853 | Ga0436364_0025729 | Ga0436364_0025729_73_864 | 260 |
| 59 | 3300039447 | Ga0436361_0460638 | Ga0436361_0460638_85_876 | 260 |
| 60 | 3300039450 | Ga0436363_0150078 | Ga0436363_0150078_1686_2477 | 260 |
| 61 | 3300042005 | Ga0439448_0136916 | Ga0439448_0136916_24_809 | 260 |
| 62 | 3300044684 | Ga0466966_0026838 | Ga0466966_0026838_1846_2631 | 260 |
| 63 | 3300044693 | Ga0466961_0046823 | Ga0466961_0046823_727_1512 | 260 |
| 64 | 3300044719 | Ga0466971_0093519 | Ga0466971_0093519_334_1119 | 260 |
| 65 | 3300045976 | Ga0466967_0040743 | Ga0466967_0040743_771_1556 | 260 |
| 66 | 3300048907 | Ga0496104_0158075 | Ga0496104_0158075_356_1147 | 260 |
| 67 | 3300048908 | Ga0496105_0325955 | Ga0496105_0325955_28_819 | 260 |
| 68 | 3300048912 | Ga0496109_0003262 | Ga0496109_0003262_3545_4336 | 260 |
| 69 | 3300048914 | Ga0496111_0124109 | Ga0496111_0124109_421_1212 | 260 |
| 70 | 3300048915 | Ga0496112_0035759 | Ga0496112_0035759_833_1624 | 260 |
| 71 | 3300048929 | Ga0496126_0080480 | Ga0496126_0080480_303_1094 | 260 |
| 72 | 3300003791 | Ga0055530_10000014 | Ga0055530_1000001459 | 261 |
| 73 | 3300003794 | Ga0055531_10001911 | Ga0055531_100019112 | 261 |
| 74 | 3300005262 | Ga0065165_1041657 | Ga0065165_10416572 | 261 |
| 75 | 3300009174 | Ga0105241_10172352 | Ga0105241_101723522 | 261 |
| 76 | 3300009551 | Ga0105238_10025641 | Ga0105238_100256414 | 261 |
| 77 | 3300025250 | Ga0209026_1001238 | Ga0209026_10012386 | 261 |
| 78 | 3300025297 | Ga0209758_1005611 | Ga0209758_10056114 | 261 |
| 79 | 3300025298 | Ga0209050_1000034 | Ga0209050_100003487 | 261 |
| 80 | 3300025304 | Ga0209257_1000052 | Ga0209257_1000052323 | 261 |
| 81 | 3300025304 | Ga0209257_1000100 | Ga0209257_1000100188 | 261 |
| 82 | 3300025911 | Ga0207654_10040325 | Ga0207654_100403253 | 261 |
| 83 | 3300025924 | Ga0207694_10051497 | Ga0207694_100514972 | 261 |
| 84 | 3300049581 | Ga0501047_0167594 | Ga0501047_0167594_1094_1888 | 261 |
| 85 | 3300049582 | Ga0501048_0059441 | Ga0501048_0059441_146_940 | 261 |
| 86 | 3300005563 | Ga0068855_100037073 | Ga0068855_1000370737 | 262 |
| 87 | 3300005616 | Ga0068852_100013111 | Ga0068852_1000131114 | 262 |
| 88 | 3300005617 | Ga0068859_100330267 | Ga0068859_1003302672 | 262 |
| 89 | 3300005844 | Ga0068862_100299001 | Ga0068862_1002990012 | 262 |
| 90 | 3300006931 | Ga0097620_100330302 | Ga0097620_1003303022 | 262 |
| 91 | 3300009093 | Ga0105240_10874790 | Ga0105240_108747901 | 262 |
| 92 | 3300009987 | Ga0105030_107549 | Ga0105030_1075491 | 262 |
| 93 | 3300025928 | Ga0207700_10298719 | Ga0207700_102987191 | 262 |
| 94 | 3300025949 | Ga0207667_10044253 | Ga0207667_100442531 | 262 |
| 95 | 3300026142 | Ga0207698_10009101 | Ga0207698_100091014 | 262 |
| 96 | 3300037068 | Ga0373925_0208373 | Ga0373925_0208373_286_1080 | 262 |
| 97 | 3300039453 | Ga0436362_0557887 | Ga0436362_0557887_1030_1827 | 262 |
| 98 | iso_pu_bacteria | 2721755763 | 2723876163 | 262 |
| 99 | iso_pu_bacteria | 2808606404 | 2809079954 | 262 |
| 100 | iso_pu_bacteria | 2808606405 | 2809084319 | 262 |
| 101 | iso_pu_bacteria | 2862507626 | 2862516581 | 262 |
| 102 | iso_pu_bacteria | 2880518877 | 2880522873 | 262 |
| 103 | 3300005329 | Ga0070683_100423591 | Ga0070683_1004235911 | 263 |
| 104 | 3300047319 | Ga0495674_0378264 | Ga0495674_0378264_322_1131 | 263 |
| 105 | 3300053087 | Ga0500643_032523 | Ga0500643_032523_288_1091 | 263 |
| 106 | 3300053108 | Ga0500562_000203 | Ga0500562_000203_11692_12495 | 263 |
| 107 | iso_pu_bacteria | 2508501039 | 2508673181 | 263 |
| 108 | iso_pu_bacteria | 2687453737 | 2689963099 | 263 |
| 109 | 3300001989 | JGI24739J22299_10033113 | JGI24739J22299_100331133 | 264 |
| 110 | 3300005327 | Ga0070658_10001208 | Ga0070658_100012085 | 264 |
| 111 | 3300005331 | Ga0070670_100413473 | Ga0070670_1004134731 | 264 |
| 112 | 3300005336 | Ga0070680_100001985 | Ga0070680_1000019854 | 264 |
| 113 | 3300005355 | Ga0070671_100527875 | Ga0070671_1005278751 | 264 |
| 114 | 3300005365 | Ga0070688_100012466 | Ga0070688_1000124665 | 264 |
| 115 | 3300005456 | Ga0070678_100169474 | Ga0070678_1001694742 | 264 |
| 116 | 3300005458 | Ga0070681_10003664 | Ga0070681_100036642 | 264 |
| 117 | 3300005467 | Ga0070706_100277452 | Ga0070706_1002774522 | 264 |
| 118 | 3300005468 | Ga0070707_100101597 | Ga0070707_1001015972 | 264 |
| 119 | 3300005471 | Ga0070698_100000587 | Ga0070698_10000058731 | 264 |
| 120 | 3300005471 | Ga0070698_100068270 | Ga0070698_1000682702 | 264 |
| 121 | 3300005530 | Ga0070679_100048869 | Ga0070679_1000488695 | 264 |
| 122 | 3300005535 | Ga0070684_100321873 | Ga0070684_1003218731 | 264 |
| 123 | 3300005548 | Ga0070665_100004342 | Ga0070665_1000043428 | 264 |
| 124 | 3300005563 | Ga0068855_100075781 | Ga0068855_1000757812 | 264 |
| 125 | 3300005563 | Ga0068855_100187895 | Ga0068855_1001878952 | 264 |
| 126 | 3300005577 | Ga0068857_100073716 | Ga0068857_1000737162 | 264 |
| 127 | 3300005577 | Ga0068857_100578711 | Ga0068857_1005787112 | 264 |
| 128 | 3300005614 | Ga0068856_100260922 | Ga0068856_1002609222 | 264 |
| 129 | 3300005843 | Ga0068860_100117391 | Ga0068860_1001173911 | 264 |
| 130 | 3300005937 | Ga0081455_10002011 | Ga0081455_1000201116 | 264 |
| 131 | 3300005981 | Ga0081538_10073583 | Ga0081538_100735832 | 264 |
| 132 | 3300005983 | Ga0081540_1058979 | Ga0081540_10589792 | 264 |
| 133 | 3300005985 | Ga0081539_10009839 | Ga0081539_100098394 | 264 |
| 134 | 3300006038 | Ga0075365_10001147 | Ga0075365_100011478 | 264 |
| 135 | 3300006042 | Ga0075368_10019969 | Ga0075368_100199692 | 264 |
| 136 | 3300006177 | Ga0075362_10029001 | Ga0075362_100290012 | 264 |
| 137 | 3300006177 | Ga0075362_10037872 | Ga0075362_100378722 | 264 |
| 138 | 3300006178 | Ga0075367_10001011 | Ga0075367_100010118 | 264 |
| 139 | 3300006178 | Ga0075367_10036329 | Ga0075367_100363292 | 264 |
| 140 | 3300006186 | Ga0075369_10002056 | Ga0075369_100020566 | 264 |
| 141 | 3300006195 | Ga0075366_10001326 | Ga0075366_1000132610 | 264 |
| 142 | 3300006195 | Ga0075366_10080222 | Ga0075366_100802222 | 264 |
| 143 | 3300006353 | Ga0075370_10000739 | Ga0075370_100007399 | 264 |
| 144 | 3300006353 | Ga0075370_10145161 | Ga0075370_101451612 | 264 |
| 145 | 3300006353 | Ga0075370_10147046 | Ga0075370_101470462 | 264 |
| 146 | 3300007265 | Ga0099794_10170411 | Ga0099794_101704112 | 264 |
| 147 | 3300007788 | Ga0099795_10091523 | Ga0099795_100915232 | 264 |
| 148 | 3300009093 | Ga0105240_10027768 | Ga0105240_100277683 | 264 |
| 149 | 3300010375 | Ga0105239_10184028 | Ga0105239_101840282 | 264 |
| 150 | 3300010375 | Ga0105239_10545953 | Ga0105239_105459531 | 264 |
| 151 | 3300013104 | Ga0157370_10030067 | Ga0157370_100300672 | 264 |
| 152 | 3300013105 | Ga0157369_10429614 | Ga0157369_104296142 | 264 |
| 153 | 3300014326 | Ga0157380_10494064 | Ga0157380_104940641 | 264 |
| 154 | 3300014968 | Ga0157379_10405517 | Ga0157379_104055172 | 264 |
| 155 | 3300021384 | Ga0213876_10001894 | Ga0213876_1000189411 | 264 |
| 156 | 3300025315 | Ga0207697_10106647 | Ga0207697_101066472 | 264 |
| 157 | 3300025909 | Ga0207705_10010305 | Ga0207705_100103057 | 264 |
| 158 | 3300025911 | Ga0207654_10211128 | Ga0207654_102111282 | 264 |
| 159 | 3300025912 | Ga0207707_10088306 | Ga0207707_100883064 | 264 |
| 160 | 3300025913 | Ga0207695_10015634 | Ga0207695_100156348 | 264 |
| 161 | 3300025915 | Ga0207693_10371239 | Ga0207693_103712391 | 264 |
| 162 | 3300025916 | Ga0207663_10161026 | Ga0207663_101610262 | 264 |
| 163 | 3300025917 | Ga0207660_10031804 | Ga0207660_100318043 | 264 |
| 164 | 3300025920 | Ga0207649_10399980 | Ga0207649_103999802 | 264 |
| 165 | 3300025921 | Ga0207652_10227755 | Ga0207652_102277552 | 264 |
| 166 | 3300025923 | Ga0207681_10184892 | Ga0207681_101848922 | 264 |
| 167 | 3300025924 | Ga0207694_10023461 | Ga0207694_100234615 | 264 |
| 168 | 3300025925 | Ga0207650_10363604 | Ga0207650_103636041 | 264 |
| 169 | 3300025928 | Ga0207700_10031095 | Ga0207700_100310953 | 264 |
| 170 | 3300025939 | Ga0207665_10315194 | Ga0207665_103151942 | 264 |
| 171 | 3300025944 | Ga0207661_10045130 | Ga0207661_100451305 | 264 |
| 172 | 3300025961 | Ga0207712_10565026 | Ga0207712_105650261 | 264 |
| 173 | 3300025972 | Ga0207668_10353311 | Ga0207668_103533112 | 264 |
| 174 | 3300025981 | Ga0207640_10170383 | Ga0207640_101703832 | 264 |
| 175 | 3300025986 | Ga0207658_10439171 | Ga0207658_104391711 | 264 |
| 176 | 3300026023 | Ga0207677_10195743 | Ga0207677_101957432 | 264 |
| 177 | 3300026041 | Ga0207639_10261753 | Ga0207639_102617532 | 264 |
| 178 | 3300026075 | Ga0207708_10211392 | Ga0207708_102113921 | 264 |
| 179 | 3300026078 | Ga0207702_10040449 | Ga0207702_100404492 | 264 |
| 180 | 3300026088 | Ga0207641_10558868 | Ga0207641_105588682 | 264 |
| 181 | 3300026089 | Ga0207648_10395532 | Ga0207648_103955322 | 264 |
| 182 | 3300026116 | Ga0207674_10091441 | Ga0207674_100914415 | 264 |
| 183 | 3300026116 | Ga0207674_10104804 | Ga0207674_101048042 | 264 |
| 184 | 3300026118 | Ga0207675_100308679 | Ga0207675_1003086792 | 264 |
| 185 | 3300026121 | Ga0207683_10157769 | Ga0207683_101577692 | 264 |
| 186 | 3300027866 | Ga0209813_10069741 | Ga0209813_100697412 | 264 |
| 187 | 3300028379 | Ga0268266_10011284 | Ga0268266_100112846 | 264 |
| 188 | 3300028379 | Ga0268266_10150346 | Ga0268266_101503462 | 264 |
| 189 | 3300028380 | Ga0268265_10344328 | Ga0268265_103443282 | 264 |
| 190 | 3300028573 | Ga0265334_10033254 | Ga0265334_100332542 | 264 |
| 191 | 3300031241 | Ga0265325_10002671 | Ga0265325_100026714 | 264 |
| 192 | 3300031247 | Ga0265340_10105954 | Ga0265340_101059541 | 264 |
| 193 | 3300031249 | Ga0265339_10003924 | Ga0265339_100039241 | 264 |
| 194 | 3300031344 | Ga0265316_10057905 | Ga0265316_100579054 | 264 |
| 195 | 3300031595 | Ga0265313_10011566 | Ga0265313_100115665 | 264 |
| 196 | 3300031712 | Ga0265342_10086380 | Ga0265342_100863802 | 264 |
| 197 | 3300035084 | Ga0373928_0027165 | Ga0373928_0027165_49_861 | 264 |
| 198 | 3300035724 | Ga0373933_0125223 | Ga0373933_0125223_89_901 | 264 |
| 199 | 3300037312 | Ga0395899_0001978 | Ga0395899_0001978_1110_1922 | 264 |
| 200 | 3300037312 | Ga0395899_0140119 | Ga0395899_0140119_849_1661 | 264 |
| 201 | 3300037418 | Ga0395900_0044617 | Ga0395900_0044617_1809_2621 | 264 |
| 202 | 3300037418 | Ga0395900_0063627 | Ga0395900_0063627_2246_3058 | 264 |
| 203 | 3300037418 | Ga0395900_0131844 | Ga0395900_0131844_208_1011 | 264 |
| 204 | 3300037418 | Ga0395900_0400164 | Ga0395900_0400164_18_830 | 264 |
| 205 | 3300037466 | Ga0395898_0014912 | Ga0395898_0014912_4512_5324 | 264 |
| 206 | 3300037466 | Ga0395898_0022982 | Ga0395898_0022982_5081_5893 | 264 |
| 207 | 3300037466 | Ga0395898_0153086 | Ga0395898_0153086_550_1401 | 264 |
| 208 | 3300038443 | Ga0395901_0001952 | Ga0395901_0001952_4889_5701 | 264 |
| 209 | 3300038443 | Ga0395901_0010068 | Ga0395901_0010068_5178_6029 | 264 |
| 210 | 3300038443 | Ga0395901_0010514 | Ga0395901_0010514_5052_5864 | 264 |
| 211 | 3300038443 | Ga0395901_0021996 | Ga0395901_0021996_2406_3218 | 264 |
| 212 | 3300038443 | Ga0395901_0064667 | Ga0395901_0064667_361_1173 | 264 |
| 213 | 3300039437 | Ga0436365_0473069 | Ga0436365_0473069_10782_11594 | 264 |
| 214 | 3300039437 | Ga0436365_0885104 | Ga0436365_0885104_2758_3570 | 264 |
| 215 | 3300039438 | Ga0436360_0315794 | Ga0436360_0315794_365_1177 | 264 |
| 216 | 3300039438 | Ga0436360_0415711 | Ga0436360_0415711_65_877 | 264 |
| 217 | 3300039453 | Ga0436362_0783295 | Ga0436362_0783295_352_1155 | 264 |
| 218 | 3300042435 | Ga0439434_0050534 | Ga0439434_0050534_179_982 | 264 |
| 219 | 3300044694 | Ga0466963_0031591 | Ga0466963_0031591_1737_2549 | 264 |
| 220 | 3300044842 | Ga0466957_0049190 | Ga0466957_0049190_177_989 | 264 |
| 221 | 3300045976 | Ga0466967_0050170 | Ga0466967_0050170_2387_3199 | 264 |
| 222 | 3300046674 | Ga0495588_0181920 | Ga0495588_0181920_108_908 | 264 |
| 223 | 3300048089 | Ga0495614_0006922 | Ga0495614_0006922_938_1744 | 264 |
| 224 | 3300049571 | Ga0501034_0001140 | Ga0501034_0001140_33546_34358 | 264 |
| 225 | 3300049571 | Ga0501034_0001685 | Ga0501034_0001685_19929_20741 | 264 |
| 226 | 3300049571 | Ga0501034_0045339 | Ga0501034_0045339_3570_4382 | 264 |
| 227 | 3300049573 | Ga0501037_0320784 | Ga0501037_0320784_202_1014 | 264 |
| 228 | 3300049579 | Ga0501043_0017944 | Ga0501043_0017944_1817_2638 | 264 |
| 229 | 3300049580 | Ga0501046_0127658 | Ga0501046_0127658_77_889 | 264 |
| 230 | 3300049581 | Ga0501047_0119893 | Ga0501047_0119893_1143_1955 | 264 |
| 231 | 3300049584 | Ga0501068_0005551 | Ga0501068_0005551_827_1639 | 264 |
| 232 | 3300049823 | Ga0501044_0287403 | Ga0501044_0287403_22_834 | 264 |
| 233 | 3300050492 | nmdc:mga0yw44_130987_c1 | nmdc:mga0yw44_130987_c1_654_1466 | 264 |
| 234 | 3300050492 | nmdc:mga0yw44_817_c1 | nmdc:mga0yw44_817_c1_6936_7739 | 264 |
| 235 | 3300050493 | nmdc:mga0k408_353_c1 | nmdc:mga0k408_353_c1_3680_4483 | 264 |
| 236 | 3300050494 | nmdc:mga06z11_283900_c1 | nmdc:mga06z11_283900_c1_72_884 | 264 |
| 237 | 3300050494 | nmdc:mga06z11_791_c1 | nmdc:mga06z11_791_c1_6891_7694 | 264 |
| 238 | 3300050495 | nmdc:mga04h51_5107_c1 | nmdc:mga04h51_5107_c1_141_944 | 264 |
| 239 | 3300050496 | nmdc:mga07m45_43155_c1 | nmdc:mga07m45_43155_c1_1240_2043 | 264 |
| 240 | 3300050496 | nmdc:mga07m45_88_c1 | nmdc:mga07m45_88_c1_15399_16202 | 264 |
| 241 | 3300050515 | nmdc:mga0a205_592920_c1 | nmdc:mga0a205_592920_c1_98_910 | 264 |
| 242 | 3300050516 | nmdc:mga0sz30_922_c1 | nmdc:mga0sz30_922_c1_5167_5979 | 264 |
| 243 | 3300053093 | Ga0500651_0036271 | Ga0500651_0036271_1923_2735 | 264 |
| 244 | 3300053096 | Ga0500641_0004206 | Ga0500641_0004206_4184_4996 | 264 |
| 245 | 3300053134 | Ga0500658_0133854 | Ga0500658_0133854_150_962 | 264 |
| 246 | 3300053139 | Ga0500568_0008733 | Ga0500568_0008733_364_1176 | 264 |
| 247 | 3300053153 | Ga0500616_0001986 | Ga0500616_0001986_10351_11163 | 264 |
| 248 | iso_pu_bacteria | 2739367655 | 2739613673 | 264 |
| 249 | iso_pu_bacteria | 2857542790 | 2857544433 | 264 |
| 250 | iso_pu_bacteria | 2887375801 | 2887377500 | 264 |
| 251 | 3300005355 | Ga0070671_100002267 | Ga0070671_1000022675 | 265 |
| 252 | 3300005435 | Ga0070714_100781640 | Ga0070714_1007816401 | 265 |
| 253 | 3300005439 | Ga0070711_100078820 | Ga0070711_1000788202 | 265 |
| 254 | 3300005445 | Ga0070708_100000811 | Ga0070708_1000008117 | 265 |
| 255 | 3300005445 | Ga0070708_100006423 | Ga0070708_1000064235 | 265 |
| 256 | 3300005467 | Ga0070706_100001584 | Ga0070706_10000158424 | 265 |
| 257 | 3300005467 | Ga0070706_100003747 | Ga0070706_1000037474 | 265 |
| 258 | 3300005468 | Ga0070707_100001089 | Ga0070707_10000108915 | 265 |
| 259 | 3300005468 | Ga0070707_100022766 | Ga0070707_1000227665 | 265 |
| 260 | 3300005518 | Ga0070699_100000149 | Ga0070699_10000014927 | 265 |
| 261 | 3300005536 | Ga0070697_100000856 | Ga0070697_10000085614 | 265 |
| 262 | 3300005842 | Ga0068858_100063744 | Ga0068858_1000637443 | 265 |
| 263 | 3300005981 | Ga0081538_10041488 | Ga0081538_100414882 | 265 |
| 264 | 3300005985 | Ga0081539_10000086 | Ga0081539_10000086135 | 265 |
| 265 | 3300006028 | Ga0070717_10013624 | Ga0070717_100136244 | 265 |
| 266 | 3300006028 | Ga0070717_10025226 | Ga0070717_100252266 | 265 |
| 267 | 3300006844 | Ga0075428_100004344 | Ga0075428_10000434414 | 265 |
| 268 | 3300006847 | Ga0075431_100248864 | Ga0075431_1002488641 | 265 |
| 269 | 3300006880 | Ga0075429_100022391 | Ga0075429_1000223912 | 265 |
| 270 | 3300006880 | Ga0075429_100352675 | Ga0075429_1003526752 | 265 |
| 271 | 3300009094 | Ga0111539_10002094 | Ga0111539_1000209420 | 265 |
| 272 | 3300009147 | Ga0114129_10001077 | Ga0114129_1000107710 | 265 |
| 273 | 3300009174 | Ga0105241_10068257 | Ga0105241_100682572 | 265 |
| 274 | 3300010375 | Ga0105239_10790882 | Ga0105239_107908822 | 265 |
| 275 | 3300014325 | Ga0163163_10353821 | Ga0163163_103538212 | 265 |
| 276 | 3300021388 | Ga0213875_10000174 | Ga0213875_1000017443 | 265 |
| 277 | 3300021388 | Ga0213875_10015157 | Ga0213875_100151573 | 265 |
| 278 | 3300025898 | Ga0207692_10355258 | Ga0207692_103552581 | 265 |
| 279 | 3300025910 | Ga0207684_10001662 | Ga0207684_1000166222 | 265 |
| 280 | 3300025910 | Ga0207684_10025209 | Ga0207684_100252095 | 265 |
| 281 | 3300025911 | Ga0207654_10182706 | Ga0207654_101827062 | 265 |
| 282 | 3300025915 | Ga0207693_10003067 | Ga0207693_100030676 | 265 |
| 283 | 3300025916 | Ga0207663_10160007 | Ga0207663_101600072 | 265 |
| 284 | 3300025922 | Ga0207646_10007222 | Ga0207646_1000722211 | 265 |
| 285 | 3300025922 | Ga0207646_10011833 | Ga0207646_100118332 | 265 |
| 286 | 3300025925 | Ga0207650_10371411 | Ga0207650_103714112 | 265 |
| 287 | 3300025927 | Ga0207687_10006212 | Ga0207687_100062123 | 265 |
| 288 | 3300025928 | Ga0207700_10140905 | Ga0207700_101409052 | 265 |
| 289 | 3300025929 | Ga0207664_10385054 | Ga0207664_103850542 | 265 |
| 290 | 3300025931 | Ga0207644_10060702 | Ga0207644_100607023 | 265 |
| 291 | 3300025972 | Ga0207668_10518562 | Ga0207668_105185621 | 265 |
| 292 | 3300026035 | Ga0207703_10050958 | Ga0207703_100509583 | 265 |
| 293 | 3300027907 | Ga0207428_10004927 | Ga0207428_100049279 | 265 |
| 294 | 3300028381 | Ga0268264_10033435 | Ga0268264_100334353 | 265 |
| 295 | 3300028794 | Ga0307515_10176873 | Ga0307515_101768732 | 265 |
| 296 | 3300035086 | Ga0373934_0090841 | Ga0373934_0090841_42_845 | 265 |
| 297 | 3300035089 | Ga0373944_0000063 | Ga0373944_0000063_1136_1987 | 265 |
| 298 | 3300035111 | Ga0373923_0060121 | Ga0373923_0060121_25_876 | 265 |
| 299 | 3300035113 | Ga0373936_0000095 | Ga0373936_0000095_11809_12660 | 265 |
| 300 | 3300035116 | Ga0373945_0000118 | Ga0373945_0000118_6514_7365 | 265 |
| 301 | 3300035120 | Ga0373957_0099795 | Ga0373957_0099795_211_1023 | 265 |
| 302 | 3300035170 | Ga0373943_0000007 | Ga0373943_0000007_20342_21193 | 265 |
| 303 | 3300035171 | Ga0373946_0000003 | Ga0373946_0000003_52337_53188 | 265 |
| 304 | 3300035172 | Ga0373955_0018262 | Ga0373955_0018262_1530_2381 | 265 |
| 305 | 3300035692 | Ga0373935_0000016 | Ga0373935_0000016_50452_51303 | 265 |
| 306 | 3300035695 | Ga0373927_0000211 | Ga0373927_0000211_15939_16790 | 265 |
| 307 | 3300035695 | Ga0373927_0073526 | Ga0373927_0073526_307_1110 | 265 |
| 308 | 3300035724 | Ga0373933_0114817 | Ga0373933_0114817_661_1512 | 265 |
| 309 | 3300035725 | Ga0373947_0000043 | Ga0373947_0000043_52202_53053 | 265 |
| 310 | 3300036401 | Ga0373937_0181016 | Ga0373937_0181016_32_883 | 265 |
| 311 | 3300036401 | Ga0373937_0385446 | Ga0373937_0385446_443_1246 | 265 |
| 312 | 3300037068 | Ga0373925_0001599 | Ga0373925_0001599_11767_12618 | 265 |
| 313 | 3300037853 | Ga0436364_0676163 | Ga0436364_0676163_23517_24332 | 265 |
| 314 | 3300037853 | Ga0436364_1238375 | Ga0436364_1238375_3771_4583 | 265 |
| 315 | 3300039438 | Ga0436360_0148685 | Ga0436360_0148685_145_948 | 265 |
| 316 | 3300039438 | Ga0436360_1255737 | Ga0436360_1255737_320_1129 | 265 |
| 317 | 3300039447 | Ga0436361_0912408 | Ga0436361_0912408_32_841 | 265 |
| 318 | 3300039447 | Ga0436361_1010833 | Ga0436361_1010833_369_1172 | 265 |
| 319 | 3300039450 | Ga0436363_1479055 | Ga0436363_1479055_532_1344 | 265 |
| 320 | 3300041512 | Ga0451853_0230220 | Ga0451853_0230220_724_1530 | 265 |
| 321 | 3300045976 | Ga0466967_0032091 | Ga0466967_0032091_2859_3683 | 265 |
| 322 | 3300045976 | Ga0466967_0631021 | Ga0466967_0631021_83_913 | 265 |
| 323 | 3300046454 | Ga0495592_0115372 | Ga0495592_0115372_835_1686 | 265 |
| 324 | 3300046461 | Ga0495641_0003952 | Ga0495641_0003952_3091_3942 | 265 |
| 325 | 3300046463 | Ga0495653_0000217 | Ga0495653_0000217_26413_27264 | 265 |
| 326 | 3300046472 | Ga0495580_0167103 | Ga0495580_0167103_141_944 | 265 |
| 327 | 3300046475 | Ga0495639_0078147 | Ga0495639_0078147_157_1008 | 265 |
| 328 | 3300046476 | Ga0495662_0020078 | Ga0495662_0020078_669_1520 | 265 |
| 329 | 3300046477 | Ga0495664_0000109 | Ga0495664_0000109_32903_33754 | 265 |
| 330 | 3300046511 | Ga0495608_0018548 | Ga0495608_0018548_714_1565 | 265 |
| 331 | 3300046529 | Ga0495652_0001202 | Ga0495652_0001202_19105_19956 | 265 |
| 332 | 3300046531 | Ga0495665_0099712 | Ga0495665_0099712_647_1498 | 265 |
| 333 | 3300046543 | Ga0495645_0078600 | Ga0495645_0078600_856_1677 | 265 |
| 334 | 3300046559 | Ga0495667_0002040 | Ga0495667_0002040_680_1531 | 265 |
| 335 | 3300046642 | Ga0495634_0051889 | Ga0495634_0051889_812_1663 | 265 |
| 336 | 3300046663 | Ga0495635_0000852 | Ga0495635_0000852_12601_13452 | 265 |
| 337 | 3300046678 | Ga0495599_0007923 | Ga0495599_0007923_3275_4126 | 265 |
| 338 | 3300046681 | Ga0495647_0107770 | Ga0495647_0107770_36_941 | 265 |
| 339 | 3300046689 | Ga0495613_0126889 | Ga0495613_0126889_495_1301 | 265 |
| 340 | 3300047319 | Ga0495674_0000088 | Ga0495674_0000088_43868_44719 | 265 |
| 341 | 3300047319 | Ga0495674_0002312 | Ga0495674_0002312_16095_16916 | 265 |
| 342 | 3300047321 | Ga0495676_0000511 | Ga0495676_0000511_19410_20261 | 265 |
| 343 | 3300047322 | Ga0495680_0001707 | Ga0495680_0001707_11660_12511 | 265 |
| 344 | 3300047471 | Ga0495684_0001171 | Ga0495684_0001171_829_1680 | 265 |
| 345 | 3300048907 | Ga0496104_0129292 | Ga0496104_0129292_847_1671 | 265 |
| 346 | 3300048913 | Ga0496110_0088630 | Ga0496110_0088630_1434_2258 | 265 |
| 347 | 3300048917 | Ga0496114_0041487 | Ga0496114_0041487_1697_2521 | 265 |
| 348 | 3300048918 | Ga0496115_0131344 | Ga0496115_0131344_653_1477 | 265 |
| 349 | 3300048928 | Ga0496125_0022365 | Ga0496125_0022365_488_1312 | 265 |
| 350 | 3300048929 | Ga0496126_0001259 | Ga0496126_0001259_19338_20162 | 265 |
| 351 | 3300049568 | Ga0501031_0315137 | Ga0501031_0315137_188_994 | 265 |
| 352 | 3300049570 | Ga0501033_0110486 | Ga0501033_0110486_1173_1979 | 265 |
| 353 | 3300049571 | Ga0501034_0054151 | Ga0501034_0054151_3164_3979 | 265 |
| 354 | 3300049572 | Ga0501036_0010427 | Ga0501036_0010427_3701_4507 | 265 |
| 355 | 3300049574 | Ga0501038_0058696 | Ga0501038_0058696_1485_2291 | 265 |
| 356 | 3300049575 | Ga0501039_0007774 | Ga0501039_0007774_92_898 | 265 |
| 357 | 3300049576 | Ga0501040_0025342 | Ga0501040_0025342_582_1388 | 265 |
| 358 | 3300049577 | Ga0501041_0051080 | Ga0501041_0051080_989_1795 | 265 |
| 359 | 3300049578 | Ga0501042_0088991 | Ga0501042_0088991_516_1322 | 265 |
| 360 | 3300049580 | Ga0501046_0011523 | Ga0501046_0011523_4387_5193 | 265 |
| 361 | 3300049582 | Ga0501048_0056505 | Ga0501048_0056505_1930_2736 | 265 |
| 362 | 3300049583 | Ga0501067_0012016 | Ga0501067_0012016_2785_3591 | 265 |
| 363 | 3300049587 | Ga0501071_0009643 | Ga0501071_0009643_4371_5177 | 265 |
| 364 | 3300049588 | Ga0501072_0009667 | Ga0501072_0009667_3363_4169 | 265 |
| 365 | 3300049590 | Ga0501074_0245567 | Ga0501074_0245567_175_981 | 265 |
| 366 | 3300049592 | Ga0501076_0046193 | Ga0501076_0046193_1762_2568 | 265 |
| 367 | 3300049593 | Ga0501077_0004702 | Ga0501077_0004702_7135_7941 | 265 |
| 368 | 3300049741 | Ga0501079_0285049 | Ga0501079_0285049_260_1066 | 265 |
| 369 | 3300049743 | Ga0501081_0048092 | Ga0501081_0048092_22_828 | 265 |
| 370 | 3300049824 | Ga0501045_0012436 | Ga0501045_0012436_2495_3301 | 265 |
| 371 | 3300050491 | nmdc:mga00v17_4840_c1 | nmdc:mga00v17_4840_c1_1991_2797 | 265 |
| 372 | 3300050507 | nmdc:mga05p37_85493_c1 | nmdc:mga05p37_85493_c1_898_1710 | 265 |
| 373 | 3300050508 | nmdc:mga09592_38642_c1 | nmdc:mga09592_38642_c1_2555_3367 | 265 |
| 374 | 3300050510 | nmdc:mga06r32_26484_c1 | nmdc:mga06r32_26484_c1_2806_3618 | 265 |
| 375 | 3300050511 | nmdc:mga08y16_6662_c1 | nmdc:mga08y16_6662_c1_1610_2419 | 265 |
| 376 | 3300053077 | Ga0495601_0234603 | Ga0495601_0234603_65_886 | 265 |
| 377 | 3300053142 | Ga0500577_0005383 | Ga0500577_0005383_921_1730 | 265 |
| 378 | 3300054114 | Ga0501084_0158021 | Ga0501084_0158021_495_1301 | 265 |
| 379 | 3300060353 | Ga0501082_0212370 | Ga0501082_0212370_261_1067 | 265 |
| 380 | 3300061734 | Ga0530510_0080158 | Ga0530510_0080158_102_908 | 265 |
| 381 | iso_pu_bacteria | 2856287931 | 2856293180 | 265 |
| 382 | iso_pu_bacteria | 2857357740 | 2857366703 | 265 |
| 383 | iso_pu_bacteria | 2881101125 | 2881101382 | 265 |
| 384 | 3300001976 | JGI24752J21851_1001132 | JGI24752J21851_10011323 | 266 |
| 385 | 3300005289 | Ga0065704_10099041 | Ga0065704_100990412 | 266 |
| 386 | 3300005295 | Ga0065707_10084019 | Ga0065707_100840196 | 266 |
| 387 | 3300005295 | Ga0065707_10109259 | Ga0065707_101092593 | 266 |
| 388 | 3300005330 | Ga0070690_100057056 | Ga0070690_1000570561 | 266 |
| 389 | 3300005331 | Ga0070670_100168692 | Ga0070670_1001686921 | 266 |
| 390 | 3300005334 | Ga0068869_100111490 | Ga0068869_1001114902 | 266 |
| 391 | 3300005353 | Ga0070669_100139936 | Ga0070669_1001399362 | 266 |
| 392 | 3300005355 | Ga0070671_100000116 | Ga0070671_10000011652 | 266 |
| 393 | 3300005355 | Ga0070671_100205104 | Ga0070671_1002051042 | 266 |
| 394 | 3300005435 | Ga0070714_100015447 | Ga0070714_1000154477 | 266 |
| 395 | 3300005436 | Ga0070713_100051144 | Ga0070713_1000511443 | 266 |
| 396 | 3300005436 | Ga0070713_100146241 | Ga0070713_1001462412 | 266 |
| 397 | 3300005437 | Ga0070710_10214560 | Ga0070710_102145602 | 266 |
| 398 | 3300005439 | Ga0070711_100152938 | Ga0070711_1001529382 | 266 |
| 399 | 3300005441 | Ga0070700_100142279 | Ga0070700_1001422793 | 266 |
| 400 | 3300005458 | Ga0070681_10144789 | Ga0070681_101447891 | 266 |
| 401 | 3300005471 | Ga0070698_100140405 | Ga0070698_1001404051 | 266 |
| 402 | 3300005530 | Ga0070679_100126789 | Ga0070679_1001267894 | 266 |
| 403 | 3300005539 | Ga0068853_100194311 | Ga0068853_1001943111 | 266 |
| 404 | 3300005548 | Ga0070665_100192006 | Ga0070665_1001920062 | 266 |
| 405 | 3300005577 | Ga0068857_100104335 | Ga0068857_1001043351 | 266 |
| 406 | 3300005578 | Ga0068854_100000322 | Ga0068854_10000032219 | 266 |
| 407 | 3300005614 | Ga0068856_100004551 | Ga0068856_1000045516 | 266 |
| 408 | 3300005616 | Ga0068852_100002126 | Ga0068852_1000021267 | 266 |
| 409 | 3300005719 | Ga0068861_100400239 | Ga0068861_1004002392 | 266 |
| 410 | 3300005841 | Ga0068863_100055235 | Ga0068863_1000552353 | 266 |
| 411 | 3300005841 | Ga0068863_100148142 | Ga0068863_1001481422 | 266 |
| 412 | 3300005841 | Ga0068863_100271392 | Ga0068863_1002713922 | 266 |
| 413 | 3300005842 | Ga0068858_100036714 | Ga0068858_1000367142 | 266 |
| 414 | 3300005843 | Ga0068860_100031345 | Ga0068860_1000313456 | 266 |
| 415 | 3300005937 | Ga0081455_10233157 | Ga0081455_102331571 | 266 |
| 416 | 3300006028 | Ga0070717_10023926 | Ga0070717_100239264 | 266 |
| 417 | 3300006028 | Ga0070717_10316430 | Ga0070717_103164301 | 266 |
| 418 | 3300006163 | Ga0070715_10054017 | Ga0070715_100540173 | 266 |
| 419 | 3300006173 | Ga0070716_100170113 | Ga0070716_1001701132 | 266 |
| 420 | 3300006173 | Ga0070716_100177972 | Ga0070716_1001779722 | 266 |
| 421 | 3300006175 | Ga0070712_100287344 | Ga0070712_1002873441 | 266 |
| 422 | 3300006353 | Ga0075370_10004418 | Ga0075370_100044182 | 266 |
| 423 | 3300006844 | Ga0075428_100036276 | Ga0075428_1000362766 | 266 |
| 424 | 3300007788 | Ga0099795_10052977 | Ga0099795_100529771 | 266 |
| 425 | 3300009011 | Ga0105251_10164882 | Ga0105251_101648821 | 266 |
| 426 | 3300009093 | Ga0105240_10023389 | Ga0105240_100233896 | 266 |
| 427 | 3300009093 | Ga0105240_10352537 | Ga0105240_103525371 | 266 |
| 428 | 3300009093 | Ga0105240_10492903 | Ga0105240_104929031 | 266 |
| 429 | 3300009094 | Ga0111539_10107858 | Ga0111539_101078582 | 266 |
| 430 | 3300009101 | Ga0105247_10168835 | Ga0105247_101688352 | 266 |
| 431 | 3300009147 | Ga0114129_10216271 | Ga0114129_102162712 | 266 |
| 432 | 3300009148 | Ga0105243_10587666 | Ga0105243_105876661 | 266 |
| 433 | 3300009176 | Ga0105242_10406871 | Ga0105242_104068712 | 266 |
| 434 | 3300009177 | Ga0105248_10050024 | Ga0105248_100500243 | 266 |
| 435 | 3300009177 | Ga0105248_10559668 | Ga0105248_105596682 | 266 |
| 436 | 3300009551 | Ga0105238_10006388 | Ga0105238_100063884 | 266 |
| 437 | 3300009551 | Ga0105238_10180200 | Ga0105238_101802002 | 266 |
| 438 | 3300009553 | Ga0105249_10008804 | Ga0105249_100088047 | 266 |
| 439 | 3300010375 | Ga0105239_10204393 | Ga0105239_102043933 | 266 |
| 440 | 3300010375 | Ga0105239_10304977 | Ga0105239_103049773 | 266 |
| 441 | 3300013105 | Ga0157369_10418597 | Ga0157369_104185972 | 266 |
| 442 | 3300013105 | Ga0157369_10845726 | Ga0157369_108457261 | 266 |
| 443 | 3300013306 | Ga0163162_10029661 | Ga0163162_100296612 | 266 |
| 444 | 3300013306 | Ga0163162_10877805 | Ga0163162_108778052 | 266 |
| 445 | 3300014325 | Ga0163163_10073929 | Ga0163163_100739292 | 266 |
| 446 | 3300014326 | Ga0157380_10000486 | Ga0157380_1000048610 | 266 |
| 447 | 3300014497 | Ga0182008_10004538 | Ga0182008_100045389 | 266 |
| 448 | 3300014968 | Ga0157379_10000433 | Ga0157379_1000043317 | 266 |
| 449 | 3300017792 | Ga0163161_10199378 | Ga0163161_101993781 | 266 |
| 450 | 3300021388 | Ga0213875_10000232 | Ga0213875_1000023213 | 266 |
| 451 | 3300021441 | Ga0213871_10000400 | Ga0213871_100004005 | 266 |
| 452 | 3300021441 | Ga0213871_10035768 | Ga0213871_100357682 | 266 |
| 453 | 3300025735 | Ga0207713_1106991 | Ga0207713_11069911 | 266 |
| 454 | 3300025903 | Ga0207680_10022475 | Ga0207680_100224751 | 266 |
| 455 | 3300025904 | Ga0207647_10003676 | Ga0207647_100036766 | 266 |
| 456 | 3300025905 | Ga0207685_10027520 | Ga0207685_100275202 | 266 |
| 457 | 3300025909 | Ga0207705_10000007 | Ga0207705_10000007459 | 266 |
| 458 | 3300025912 | Ga0207707_10094095 | Ga0207707_100940952 | 266 |
| 459 | 3300025913 | Ga0207695_10009783 | Ga0207695_100097838 | 266 |
| 460 | 3300025913 | Ga0207695_10332928 | Ga0207695_103329282 | 266 |
| 461 | 3300025915 | Ga0207693_10002285 | Ga0207693_1000228516 | 266 |
| 462 | 3300025915 | Ga0207693_10043926 | Ga0207693_100439264 | 266 |
| 463 | 3300025915 | Ga0207693_10087320 | Ga0207693_100873202 | 266 |
| 464 | 3300025915 | Ga0207693_10139029 | Ga0207693_101390293 | 266 |
| 465 | 3300025916 | Ga0207663_10372360 | Ga0207663_103723601 | 266 |
| 466 | 3300025920 | Ga0207649_10232619 | Ga0207649_102326192 | 266 |
| 467 | 3300025921 | Ga0207652_10406166 | Ga0207652_104061661 | 266 |
| 468 | 3300025923 | Ga0207681_10084247 | Ga0207681_100842472 | 266 |
| 469 | 3300025924 | Ga0207694_10032894 | Ga0207694_100328943 | 266 |
| 470 | 3300025924 | Ga0207694_10342879 | Ga0207694_103428792 | 266 |
| 471 | 3300025928 | Ga0207700_10115729 | Ga0207700_101157292 | 266 |
| 472 | 3300025931 | Ga0207644_10005965 | Ga0207644_100059654 | 266 |
| 473 | 3300025931 | Ga0207644_10272837 | Ga0207644_102728372 | 266 |
| 474 | 3300025933 | Ga0207706_10201795 | Ga0207706_102017952 | 266 |
| 475 | 3300025941 | Ga0207711_10186561 | Ga0207711_101865613 | 266 |
| 476 | 3300025949 | Ga0207667_10039999 | Ga0207667_100399992 | 266 |
| 477 | 3300025960 | Ga0207651_10303898 | Ga0207651_103038982 | 266 |
| 478 | 3300025961 | Ga0207712_10015813 | Ga0207712_100158134 | 266 |
| 479 | 3300025981 | Ga0207640_10000501 | Ga0207640_1000050120 | 266 |
| 480 | 3300025986 | Ga0207658_10098964 | Ga0207658_100989642 | 266 |
| 481 | 3300026075 | Ga0207708_10010222 | Ga0207708_100102226 | 266 |
| 482 | 3300026078 | Ga0207702_10569186 | Ga0207702_105691862 | 266 |
| 483 | 3300026088 | Ga0207641_10017244 | Ga0207641_100172445 | 266 |
| 484 | 3300026088 | Ga0207641_10038781 | Ga0207641_100387812 | 266 |
| 485 | 3300026095 | Ga0207676_10243871 | Ga0207676_102438712 | 266 |
| 486 | 3300026118 | Ga0207675_100071634 | Ga0207675_1000716342 | 266 |
| 487 | 3300026142 | Ga0207698_10000305 | Ga0207698_1000030514 | 266 |
| 488 | 3300028379 | Ga0268266_10090088 | Ga0268266_100900882 | 266 |
| 489 | 3300028379 | Ga0268266_10629968 | Ga0268266_106299681 | 266 |
| 490 | 3300028556 | Ga0265337_1042720 | Ga0265337_10427201 | 266 |
| 491 | 3300028800 | Ga0265338_10097071 | Ga0265338_100970711 | 266 |
| 492 | 3300031456 | Ga0307513_10008709 | Ga0307513_1000870911 | 266 |
| 493 | 3300031548 | Ga0307408_100251625 | Ga0307408_1002516252 | 266 |
| 494 | 3300031731 | Ga0307405_10085526 | Ga0307405_100855263 | 266 |
| 495 | 3300031911 | Ga0307412_10011660 | Ga0307412_100116606 | 266 |
| 496 | 3300035088 | Ga0373940_0002375 | Ga0373940_0002375_58_867 | 266 |
| 497 | 3300035112 | Ga0373932_0005235 | Ga0373932_0005235_1405_2214 | 266 |
| 498 | 3300035114 | Ga0373939_0003794 | Ga0373939_0003794_711_1520 | 266 |
| 499 | 3300035121 | Ga0373960_0015609 | Ga0373960_0015609_522_1331 | 266 |
| 500 | 3300035172 | Ga0373955_0050854 | Ga0373955_0050854_860_1666 | 266 |
| 501 | 3300035241 | Ga0373961_0004204 | Ga0373961_0004204_1835_2644 | 266 |
| 502 | 3300035410 | Ga0373924_0134631 | Ga0373924_0134631_134_940 | 266 |
| 503 | 3300035691 | Ga0373931_0016291 | Ga0373931_0016291_319_1128 | 266 |
| 504 | 3300035724 | Ga0373933_0209356 | Ga0373933_0209356_301_1107 | 266 |
| 505 | 3300037068 | Ga0373925_0420146 | Ga0373925_0420146_60_872 | 266 |
| 506 | 3300037471 | Ga0395905_0015473 | Ga0395905_0015473_1877_2686 | 266 |
| 507 | 3300037853 | Ga0436364_0990344 | Ga0436364_0990344_46681_47490 | 266 |
| 508 | 3300037853 | Ga0436364_1213864 | Ga0436364_1213864_2414_3226 | 266 |
| 509 | 3300038443 | Ga0395901_0475085 | Ga0395901_0475085_144_953 | 266 |
| 510 | 3300039437 | Ga0436365_0145774 | Ga0436365_0145774_4470_5279 | 266 |
| 511 | 3300039437 | Ga0436365_1254597 | Ga0436365_1254597_656_1465 | 266 |
| 512 | 3300039438 | Ga0436360_0777953 | Ga0436360_0777953_3865_4671 | 266 |
| 513 | 3300039438 | Ga0436360_1356287 | Ga0436360_1356287_744_1550 | 266 |
| 514 | 3300039447 | Ga0436361_0221853 | Ga0436361_0221853_196_1002 | 266 |
| 515 | 3300039447 | Ga0436361_0662945 | Ga0436361_0662945_32_841 | 266 |
| 516 | 3300039447 | Ga0436361_0740576 | Ga0436361_0740576_1102_1908 | 266 |
| 517 | 3300039450 | Ga0436363_0274442 | Ga0436363_0274442_401_1267 | 266 |
| 518 | 3300039453 | Ga0436362_1084147 | Ga0436362_1084147_406_1215 | 266 |
| 519 | 3300041404 | Ga0439436_0000964 | Ga0439436_0000964_94_909 | 266 |
| 520 | 3300041406 | Ga0439439_0004111 | Ga0439439_0004111_108_923 | 266 |
| 521 | 3300041491 | Ga0451833_1041486 | Ga0451833_1041486_1436_2245 | 266 |
| 522 | 3300041496 | Ga0451839_0251557 | Ga0451839_0251557_788_1597 | 266 |
| 523 | 3300041498 | Ga0451841_0086406 | Ga0451841_0086406_800_1609 | 266 |
| 524 | 3300041509 | Ga0451843_1359299 | Ga0451843_1359299_229_1038 | 266 |
| 525 | 3300041997 | Ga0439431_0017259 | Ga0439431_0017259_411_1226 | 266 |
| 526 | 3300042007 | Ga0439449_0000112 | Ga0439449_0000112_8657_9472 | 266 |
| 527 | 3300042010 | Ga0439452_006772 | Ga0439452_006772_1196_2011 | 266 |
| 528 | 3300042011 | Ga0439454_009380 | Ga0439454_009380_300_1115 | 266 |
| 529 | 3300042015 | Ga0439462_0025976 | Ga0439462_0025976_249_1064 | 266 |
| 530 | 3300042125 | Ga0450923_011270 | Ga0450923_011270_561_1376 | 266 |
| 531 | 3300042128 | Ga0450897_005192 | Ga0450897_005192_174_989 | 266 |
| 532 | 3300042133 | Ga0450896_006912 | Ga0450896_006912_546_1361 | 266 |
| 533 | 3300042145 | Ga0450906_006297 | Ga0450906_006297_680_1495 | 266 |
| 534 | 3300042156 | Ga0439446_0008817 | Ga0439446_0008817_412_1227 | 266 |
| 535 | 3300042185 | Ga0450909_005880 | Ga0450909_005880_226_1041 | 266 |
| 536 | 3300042435 | Ga0439434_0005729 | Ga0439434_0005729_1691_2506 | 266 |
| 537 | 3300042876 | Ga0451577_0640608 | Ga0451577_0640608_48_854 | 266 |
| 538 | 3300046533 | Ga0495640_0259715 | Ga0495640_0259715_258_1070 | 266 |
| 539 | 3300048903 | Ga0496100_0015657 | Ga0496100_0015657_2446_3255 | 266 |
| 540 | 3300048903 | Ga0496100_0410692 | Ga0496100_0410692_165_968 | 266 |
| 541 | 3300048905 | Ga0496102_0014399 | Ga0496102_0014399_3609_4418 | 266 |
| 542 | 3300048907 | Ga0496104_0022590 | Ga0496104_0022590_2659_3468 | 266 |
| 543 | 3300048908 | Ga0496105_0021301 | Ga0496105_0021301_3753_4562 | 266 |
| 544 | 3300048909 | Ga0496106_0000392 | Ga0496106_0000392_2846_3655 | 266 |
| 545 | 3300048910 | Ga0496107_0003945 | Ga0496107_0003945_6935_7744 | 266 |
| 546 | 3300048911 | Ga0496108_0090903 | Ga0496108_0090903_1056_1865 | 266 |
| 547 | 3300048912 | Ga0496109_0082126 | Ga0496109_0082126_1487_2293 | 266 |
| 548 | 3300048912 | Ga0496109_0165496 | Ga0496109_0165496_1124_1933 | 266 |
| 549 | 3300048913 | Ga0496110_0182288 | Ga0496110_0182288_73_882 | 266 |
| 550 | 3300048915 | Ga0496112_0000224 | Ga0496112_0000224_23761_24570 | 266 |
| 551 | 3300048916 | Ga0496113_0000540 | Ga0496113_0000540_13545_14354 | 266 |
| 552 | 3300048921 | Ga0496118_0083663 | Ga0496118_0083663_862_1671 | 266 |
| 553 | 3300048923 | Ga0496120_0000122 | Ga0496120_0000122_4722_5531 | 266 |
| 554 | 3300048924 | Ga0496121_0041765 | Ga0496121_0041765_362_1171 | 266 |
| 555 | 3300048925 | Ga0496122_0271464 | Ga0496122_0271464_84_905 | 266 |
| 556 | 3300048927 | Ga0496124_0000007 | Ga0496124_0000007_749528_750349 | 266 |
| 557 | 3300048929 | Ga0496126_0018649 | Ga0496126_0018649_2162_2968 | 266 |
| 558 | 3300049572 | Ga0501036_0588219 | Ga0501036_0588219_94_903 | 266 |
| 559 | 3300049581 | Ga0501047_0085650 | Ga0501047_0085650_1959_2768 | 266 |
| 560 | 3300049586 | Ga0501070_0146296 | Ga0501070_0146296_571_1380 | 266 |
| 561 | 3300049586 | Ga0501070_0362206 | Ga0501070_0362206_301_1107 | 266 |
| 562 | 3300049593 | Ga0501077_0033984 | Ga0501077_0033984_502_1311 | 266 |
| 563 | 3300049743 | Ga0501081_0072230 | Ga0501081_0072230_1461_2270 | 266 |
| 564 | 3300049822 | Ga0501035_0008018 | Ga0501035_0008018_6244_7053 | 266 |
| 565 | 3300049822 | Ga0501035_0125934 | Ga0501035_0125934_568_1377 | 266 |
| 566 | 3300049823 | Ga0501044_0055019 | Ga0501044_0055019_128_937 | 266 |
| 567 | 3300050489 | nmdc:mga03683_16511_c1 | nmdc:mga03683_16511_c1_1886_2701 | 266 |
| 568 | 3300050490 | nmdc:mga03n38_92293_c1 | nmdc:mga03n38_92293_c1_35_850 | 266 |
| 569 | 3300050493 | nmdc:mga0k408_85365_c1 | nmdc:mga0k408_85365_c1_857_1672 | 266 |
| 570 | 3300050496 | nmdc:mga07m45_60928_c1 | nmdc:mga07m45_60928_c1_845_1660 | 266 |
| 571 | 3300050507 | nmdc:mga05p37_463939_c1 | nmdc:mga05p37_463939_c1_485_1294 | 266 |
| 572 | 3300050511 | nmdc:mga08y16_24351_c1 | nmdc:mga08y16_24351_c1_2469_3278 | 266 |
| 573 | iso_pu_bacteria | 2599185292 | 2599904139 | 266 |
| 574 | iso_pu_bacteria | 2643221569 | 2643861336 | 266 |
| 575 | iso_pu_bacteria | 2643221594 | 2643983123 | 266 |
| 576 | iso_pu_bacteria | 2643221621 | 2644120534 | 266 |
| 577 | iso_pu_bacteria | 2808606395 | 2809032894 | 266 |
| 578 | iso_pu_bacteria | 2857537821 | 2857537828 | 266 |
| 579 | iso_pu_bacteria | 2941479691 | 2941482884 | 266 |
| 580 | 3300002459 | JGI24751J29686_10002622 | JGI24751J29686_100026221 | 267 |
| 581 | 3300005335 | Ga0070666_10135206 | Ga0070666_101352061 | 267 |
| 582 | 3300005347 | Ga0070668_100309442 | Ga0070668_1003094422 | 267 |
| 583 | 3300005355 | Ga0070671_100000108 | Ga0070671_1000001085 | 267 |
| 584 | 3300005367 | Ga0070667_100002350 | Ga0070667_1000023506 | 267 |
| 585 | 3300005548 | Ga0070665_100005505 | Ga0070665_1000055056 | 267 |
| 586 | 3300005563 | Ga0068855_100000794 | Ga0068855_1000007949 | 267 |
| 587 | 3300005577 | Ga0068857_100296440 | Ga0068857_1002964402 | 267 |
| 588 | 3300005614 | Ga0068856_100034764 | Ga0068856_1000347643 | 267 |
| 589 | 3300005617 | Ga0068859_100000143 | Ga0068859_10000014337 | 267 |
| 590 | 3300005617 | Ga0068859_100364670 | Ga0068859_1003646702 | 267 |
| 591 | 3300005617 | Ga0068859_100492521 | Ga0068859_1004925212 | 267 |
| 592 | 3300005618 | Ga0068864_100007552 | Ga0068864_1000075525 | 267 |
| 593 | 3300005618 | Ga0068864_100055380 | Ga0068864_1000553804 | 267 |
| 594 | 3300005841 | Ga0068863_100000014 | Ga0068863_10000001457 | 267 |
| 595 | 3300005842 | Ga0068858_100000451 | Ga0068858_1000004515 | 267 |
| 596 | 3300005842 | Ga0068858_100016746 | Ga0068858_1000167463 | 267 |
| 597 | 3300005842 | Ga0068858_100047848 | Ga0068858_1000478482 | 267 |
| 598 | 3300005842 | Ga0068858_100686047 | Ga0068858_1006860471 | 267 |
| 599 | 3300005843 | Ga0068860_100000007 | Ga0068860_100000007178 | 267 |
| 600 | 3300005844 | Ga0068862_100012958 | Ga0068862_1000129587 | 267 |
| 601 | 3300006177 | Ga0075362_10007481 | Ga0075362_100074815 | 267 |
| 602 | 3300006353 | Ga0075370_10050113 | Ga0075370_100501131 | 267 |
| 603 | 3300006931 | Ga0097620_100000143 | Ga0097620_10000014337 | 267 |
| 604 | 3300006931 | Ga0097620_100364653 | Ga0097620_1003646531 | 267 |
| 605 | 3300006931 | Ga0097620_100492472 | Ga0097620_1004924722 | 267 |
| 606 | 3300009177 | Ga0105248_10229572 | Ga0105248_102295722 | 267 |
| 607 | 3300009551 | Ga0105238_10009753 | Ga0105238_100097534 | 267 |
| 608 | 3300013306 | Ga0163162_10070034 | Ga0163162_100700345 | 267 |
| 609 | 3300014325 | Ga0163163_10009652 | Ga0163163_100096523 | 267 |
| 610 | 3300014325 | Ga0163163_10051764 | Ga0163163_100517643 | 267 |
| 611 | 3300014968 | Ga0157379_10013089 | Ga0157379_100130895 | 267 |
| 612 | 3300025900 | Ga0207710_10000319 | Ga0207710_1000031926 | 267 |
| 613 | 3300025903 | Ga0207680_10047043 | Ga0207680_100470433 | 267 |
| 614 | 3300025903 | Ga0207680_10057382 | Ga0207680_100573822 | 267 |
| 615 | 3300025941 | Ga0207711_10149795 | Ga0207711_101497951 | 267 |
| 616 | 3300025941 | Ga0207711_10151905 | Ga0207711_101519052 | 267 |
| 617 | 3300025949 | Ga0207667_10016679 | Ga0207667_100166797 | 267 |
| 618 | 3300025961 | Ga0207712_10165948 | Ga0207712_101659482 | 267 |
| 619 | 3300025986 | Ga0207658_10003671 | Ga0207658_100036719 | 267 |
| 620 | 3300025986 | Ga0207658_10019163 | Ga0207658_100191634 | 267 |
| 621 | 3300026035 | Ga0207703_10009191 | Ga0207703_100091915 | 267 |
| 622 | 3300026035 | Ga0207703_10025731 | Ga0207703_100257314 | 267 |
| 623 | 3300026035 | Ga0207703_10030722 | Ga0207703_100307222 | 267 |
| 624 | 3300026035 | Ga0207703_10628927 | Ga0207703_106289271 | 267 |
| 625 | 3300026088 | Ga0207641_10000126 | Ga0207641_1000012646 | 267 |
| 626 | 3300026088 | Ga0207641_10018234 | Ga0207641_100182345 | 267 |
| 627 | 3300026088 | Ga0207641_10061761 | Ga0207641_100617613 | 267 |
| 628 | 3300026095 | Ga0207676_10025201 | Ga0207676_100252014 | 267 |
| 629 | 3300028379 | Ga0268266_10138059 | Ga0268266_101380592 | 267 |
| 630 | 3300028380 | Ga0268265_10008961 | Ga0268265_100089612 | 267 |
| 631 | 3300028380 | Ga0268265_10068124 | Ga0268265_100681243 | 267 |
| 632 | 3300028381 | Ga0268264_10000077 | Ga0268264_1000007761 | 267 |
| 633 | 3300028381 | Ga0268264_10015126 | Ga0268264_100151262 | 267 |
| 634 | 3300028794 | Ga0307515_10000572 | Ga0307515_1000057277 | 267 |
| 635 | 3300028794 | Ga0307515_10112782 | Ga0307515_101127822 | 267 |
| 636 | 3300028800 | Ga0265338_10000335 | Ga0265338_1000033522 | 267 |
| 637 | 3300028800 | Ga0265338_10000344 | Ga0265338_1000034456 | 267 |
| 638 | 3300031238 | Ga0265332_10009960 | Ga0265332_100099603 | 267 |
| 639 | 3300031251 | Ga0265327_10001877 | Ga0265327_1000187714 | 267 |
| 640 | 3300031456 | Ga0307513_10077630 | Ga0307513_100776303 | 267 |
| 641 | 3300031456 | Ga0307513_10102556 | Ga0307513_101025562 | 267 |
| 642 | 3300031730 | Ga0307516_10000363 | Ga0307516_1000036312 | 267 |
| 643 | 3300031911 | Ga0307412_10013244 | Ga0307412_100132442 | 267 |
| 644 | 3300032005 | Ga0307411_10256427 | Ga0307411_102564272 | 267 |
| 645 | 3300035398 | Ga0316574_0114321 | Ga0316574_0114321_70_879 | 267 |
| 646 | 3300037471 | Ga0395905_0070355 | Ga0395905_0070355_48_857 | 267 |
| 647 | 3300037853 | Ga0436364_1004440 | Ga0436364_1004440_3694_4497 | 267 |
| 648 | 3300038443 | Ga0395901_0000002 | Ga0395901_0000002_11741_12586 | 267 |
| 649 | 3300041404 | Ga0439436_0006549 | Ga0439436_0006549_2628_3455 | 267 |
| 650 | 3300041405 | Ga0439438_016077 | Ga0439438_016077_137_964 | 267 |
| 651 | 3300041411 | Ga0439466_0010789 | Ga0439466_0010789_349_1176 | 267 |
| 652 | 3300041999 | Ga0439433_0004061 | Ga0439433_0004061_1330_2157 | 267 |
| 653 | 3300042007 | Ga0439449_0002521 | Ga0439449_0002521_1287_2114 | 267 |
| 654 | 3300042131 | Ga0450894_001878 | Ga0450894_001878_570_1397 | 267 |
| 655 | 3300042156 | Ga0439446_0013665 | Ga0439446_0013665_70_897 | 267 |
| 656 | 3300042435 | Ga0439434_0026127 | Ga0439434_0026127_206_1033 | 267 |
| 657 | 3300044656 | Ga0466969_0051183 | Ga0466969_0051183_484_1293 | 267 |
| 658 | 3300044684 | Ga0466966_0001397 | Ga0466966_0001397_2061_2870 | 267 |
| 659 | 3300044684 | Ga0466966_0147501 | Ga0466966_0147501_342_1169 | 267 |
| 660 | 3300045049 | Ga0466959_0192552 | Ga0466959_0192552_554_1363 | 267 |
| 661 | 3300046460 | Ga0495638_0001336 | Ga0495638_0001336_15844_16653 | 267 |
| 662 | 3300046474 | Ga0495605_0103109 | Ga0495605_0103109_157_984 | 267 |
| 663 | 3300046477 | Ga0495664_0049115 | Ga0495664_0049115_1350_2177 | 267 |
| 664 | 3300046491 | Ga0495584_0023741 | Ga0495584_0023741_106_921 | 267 |
| 665 | 3300046506 | Ga0495583_0000481 | Ga0495583_0000481_27871_28686 | 267 |
| 666 | 3300046516 | Ga0495628_0094397 | Ga0495628_0094397_559_1386 | 267 |
| 667 | 3300046535 | Ga0495586_0084649 | Ga0495586_0084649_221_1048 | 267 |
| 668 | 3300046543 | Ga0495645_0062903 | Ga0495645_0062903_582_1409 | 267 |
| 669 | 3300046660 | Ga0495625_0019320 | Ga0495625_0019320_3169_3978 | 267 |
| 670 | 3300046678 | Ga0495599_0101840 | Ga0495599_0101840_851_1678 | 267 |
| 671 | 3300046692 | Ga0495671_0102524 | Ga0495671_0102524_189_1016 | 267 |
| 672 | 3300047319 | Ga0495674_0021311 | Ga0495674_0021311_4197_5024 | 267 |
| 673 | 3300047320 | Ga0495672_0004625 | Ga0495672_0004625_8895_9722 | 267 |
| 674 | 3300047469 | Ga0495673_0028533 | Ga0495673_0028533_703_1530 | 267 |
| 675 | 3300047472 | Ga0495686_0000014 | Ga0495686_0000014_67528_68355 | 267 |
| 676 | 3300048905 | Ga0496102_0210892 | Ga0496102_0210892_571_1395 | 267 |
| 677 | 3300048905 | Ga0496102_0273317 | Ga0496102_0273317_123_935 | 267 |
| 678 | 3300048907 | Ga0496104_0046592 | Ga0496104_0046592_3214_4026 | 267 |
| 679 | 3300048908 | Ga0496105_0004419 | Ga0496105_0004419_5561_6373 | 267 |
| 680 | 3300048915 | Ga0496112_0057636 | Ga0496112_0057636_2976_3800 | 267 |
| 681 | 3300048922 | Ga0496119_0087762 | Ga0496119_0087762_690_1502 | 267 |
| 682 | 3300048923 | Ga0496120_0000197 | Ga0496120_0000197_45911_46723 | 267 |
| 683 | 3300048924 | Ga0496121_0000747 | Ga0496121_0000747_49309_50133 | 267 |
| 684 | 3300048924 | Ga0496121_0020006 | Ga0496121_0020006_1590_2399 | 267 |
| 685 | 3300048924 | Ga0496121_0262294 | Ga0496121_0262294_317_1129 | 267 |
| 686 | 3300048928 | Ga0496125_0004601 | Ga0496125_0004601_14279_15103 | 267 |
| 687 | 3300049569 | Ga0501032_0043691 | Ga0501032_0043691_515_1330 | 267 |
| 688 | 3300049570 | Ga0501033_0034822 | Ga0501033_0034822_2885_3694 | 267 |
| 689 | 3300049571 | Ga0501034_0037950 | Ga0501034_0037950_291_1121 | 267 |
| 690 | 3300049571 | Ga0501034_0149937 | Ga0501034_0149937_1382_2197 | 267 |
| 691 | 3300049572 | Ga0501036_0566040 | Ga0501036_0566040_43_852 | 267 |
| 692 | 3300049573 | Ga0501037_0023645 | Ga0501037_0023645_3693_4508 | 267 |
| 693 | 3300049574 | Ga0501038_0006734 | Ga0501038_0006734_2256_3071 | 267 |
| 694 | 3300049579 | Ga0501043_0014175 | Ga0501043_0014175_2161_2976 | 267 |
| 695 | 3300049581 | Ga0501047_0201794 | Ga0501047_0201794_875_1690 | 267 |
| 696 | 3300049586 | Ga0501070_0099916 | Ga0501070_0099916_20_835 | 267 |
| 697 | 3300049823 | Ga0501044_0095456 | Ga0501044_0095456_341_1156 | 267 |
| 698 | 3300050496 | nmdc:mga07m45_2716_c1 | nmdc:mga07m45_2716_c1_305_1132 | 267 |
| 699 | 3300053119 | Ga0500595_024835 | Ga0500595_024835_1169_1978 | 267 |
| 700 | 3300053178 | Ga0500637_0047407 | Ga0500637_0047407_1587_2396 | 267 |
| 701 | iso_pu_bacteria | 2513237151 | 2513959144 | 267 |
| 702 | iso_pu_bacteria | 2513237166 | 2514048847 | 267 |
| 703 | iso_pu_bacteria | 2562617112 | 2563055192 | 267 |
| 704 | iso_pu_bacteria | 2711768613 | 2713479167 | 267 |
| 705 | iso_pu_bacteria | 2744054900 | 2746086444 | 267 |
| 706 | iso_pu_bacteria | 2744054901 | 2746093444 | 267 |
| 707 | iso_pu_bacteria | 2791355137 | 2792834769 | 267 |
| 708 | iso_pu_bacteria | 2818991450 | 2819623854 | 267 |
| 709 | iso_pu_bacteria | 2842324504 | 2842331745 | 267 |
| 710 | iso_pu_bacteria | 2842348783 | 2842356058 | 267 |
| 711 | iso_pu_bacteria | 2842454564 | 2842459257 | 267 |
| 712 | iso_pu_bacteria | 2900634093 | 2900636490 | 267 |
| 713 | iso_pu_bacteria | 2904615490 | 2904619156 | 267 |
| 714 | iso_pu_bacteria | 2921643360 | 2921646655 | 267 |
| 715 | iso_pu_bacteria | 2928108538 | 2928109420 | 267 |
| 716 | iso_pu_bacteria | 2928135762 | 2928137126 | 267 |
| 717 | iso_pu_bacteria | 2928503688 | 2928506653 | 267 |
| 718 | iso_pu_bacteria | 2935694250 | 2935699114 | 267 |
| 719 | iso_pu_bacteria | 2935769743 | 2935776704 | 267 |
| 720 | iso_pu_bacteria | 2935785616 | 2935792606 | 267 |
| 721 | iso_pu_bacteria | 2935793552 | 2935800598 | 267 |
| 722 | iso_pu_bacteria | 2935810662 | 2935816376 | 267 |
| 723 | iso_pu_bacteria | 2936037263 | 2936042671 | 267 |
| 724 | iso_pu_bacteria | 642555113 | 642620048 | 267 |
| 725 | iso_pu_bacteria | 8019555841 | 8019556450 | 267 |
| 726 | iso_pu_bacteria | 8019565922 | 8019568858 | 267 |
| 727 | iso_pu_bacteria | 8055266321 | 8055268085 | 267 |
| 728 | 3300001915 | JGI24741J21665_1000002 | JGI24741J21665_100000248 | 268 |
| 729 | 3300001979 | JGI24740J21852_10000005 | JGI24740J21852_1000000568 | 268 |
| 730 | 3300001990 | JGI24737J22298_10000184 | JGI24737J22298_100001844 | 268 |
| 731 | 3300002705 | JGI25156J39149_1001067 | JGI25156J39149_100106711 | 268 |
| 732 | 3300003354 | JGI25160J50197_1000186 | JGI25160J50197_100018632 | 268 |
| 733 | 3300005262 | Ga0065165_1000589 | Ga0065165_100058933 | 268 |
| 734 | 3300005327 | Ga0070658_10000738 | Ga0070658_1000073813 | 268 |
| 735 | 3300005334 | Ga0068869_100071159 | Ga0068869_1000711593 | 268 |
| 736 | 3300005338 | Ga0068868_100100841 | Ga0068868_1001008413 | 268 |
| 737 | 3300005339 | Ga0070660_100007378 | Ga0070660_1000073784 | 268 |
| 738 | 3300005344 | Ga0070661_100002371 | Ga0070661_1000023719 | 268 |
| 739 | 3300005364 | Ga0070673_100152392 | Ga0070673_1001523922 | 268 |
| 740 | 3300005366 | Ga0070659_100001817 | Ga0070659_1000018174 | 268 |
| 741 | 3300005439 | Ga0070711_100058759 | Ga0070711_1000587592 | 268 |
| 742 | 3300005445 | Ga0070708_100503186 | Ga0070708_1005031861 | 268 |
| 743 | 3300005455 | Ga0070663_100002745 | Ga0070663_1000027456 | 268 |
| 744 | 3300005457 | Ga0070662_100116823 | Ga0070662_1001168231 | 268 |
| 745 | 3300005459 | Ga0068867_100314202 | Ga0068867_1003142021 | 268 |
| 746 | 3300005467 | Ga0070706_100280170 | Ga0070706_1002801702 | 268 |
| 747 | 3300005535 | Ga0070684_100176235 | Ga0070684_1001762352 | 268 |
| 748 | 3300005539 | Ga0068853_100047725 | Ga0068853_1000477252 | 268 |
| 749 | 3300005548 | Ga0070665_100298724 | Ga0070665_1002987241 | 268 |
| 750 | 3300005564 | Ga0070664_100052359 | Ga0070664_1000523594 | 268 |
| 751 | 3300005577 | Ga0068857_100005815 | Ga0068857_1000058154 | 268 |
| 752 | 3300005577 | Ga0068857_100053144 | Ga0068857_1000531442 | 268 |
| 753 | 3300005578 | Ga0068854_100054275 | Ga0068854_1000542752 | 268 |
| 754 | 3300005616 | Ga0068852_100002464 | Ga0068852_1000024646 | 268 |
| 755 | 3300005616 | Ga0068852_100020571 | Ga0068852_1000205713 | 268 |
| 756 | 3300005616 | Ga0068852_100033295 | Ga0068852_1000332951 | 268 |
| 757 | 3300005937 | Ga0081455_10008960 | Ga0081455_100089605 | 268 |
| 758 | 3300005983 | Ga0081540_1002176 | Ga0081540_100217612 | 268 |
| 759 | 3300005983 | Ga0081540_1004082 | Ga0081540_100408211 | 268 |
| 760 | 3300005983 | Ga0081540_1011818 | Ga0081540_10118184 | 268 |
| 761 | 3300005983 | Ga0081540_1019729 | Ga0081540_10197294 | 268 |
| 762 | 3300005983 | Ga0081540_1021183 | Ga0081540_10211833 | 268 |
| 763 | 3300006028 | Ga0070717_10005151 | Ga0070717_100051512 | 268 |
| 764 | 3300006178 | Ga0075367_10065828 | Ga0075367_100658284 | 268 |
| 765 | 3300006195 | Ga0075366_10030068 | Ga0075366_100300684 | 268 |
| 766 | 3300009093 | Ga0105240_10047592 | Ga0105240_100475923 | 268 |
| 767 | 3300009093 | Ga0105240_10084950 | Ga0105240_100849502 | 268 |
| 768 | 3300009093 | Ga0105240_10094883 | Ga0105240_100948832 | 268 |
| 769 | 3300009093 | Ga0105240_10279136 | Ga0105240_102791362 | 268 |
| 770 | 3300009101 | Ga0105247_10281234 | Ga0105247_102812342 | 268 |
| 771 | 3300009148 | Ga0105243_10505515 | Ga0105243_105055151 | 268 |
| 772 | 3300009174 | Ga0105241_10000339 | Ga0105241_1000033918 | 268 |
| 773 | 3300009174 | Ga0105241_10202966 | Ga0105241_102029662 | 268 |
| 774 | 3300009177 | Ga0105248_10087893 | Ga0105248_100878932 | 268 |
| 775 | 3300009545 | Ga0105237_10006725 | Ga0105237_100067255 | 268 |
| 776 | 3300009545 | Ga0105237_10018482 | Ga0105237_100184828 | 268 |
| 777 | 3300009551 | Ga0105238_10005126 | Ga0105238_1000512610 | 268 |
| 778 | 3300009551 | Ga0105238_10133623 | Ga0105238_101336231 | 268 |
| 779 | 3300009551 | Ga0105238_10195413 | Ga0105238_101954131 | 268 |
| 780 | 3300010375 | Ga0105239_10008802 | Ga0105239_100088025 | 268 |
| 781 | 3300010375 | Ga0105239_10025558 | Ga0105239_100255584 | 268 |
| 782 | 3300010375 | Ga0105239_10166198 | Ga0105239_101661984 | 268 |
| 783 | 3300010375 | Ga0105239_10809552 | Ga0105239_108095522 | 268 |
| 784 | 3300013100 | Ga0157373_10047529 | Ga0157373_100475292 | 268 |
| 785 | 3300013102 | Ga0157371_10000111 | Ga0157371_1000011168 | 268 |
| 786 | 3300013105 | Ga0157369_10000198 | Ga0157369_1000019847 | 268 |
| 787 | 3300013105 | Ga0157369_10000547 | Ga0157369_100005479 | 268 |
| 788 | 3300013105 | Ga0157369_10016581 | Ga0157369_100165817 | 268 |
| 789 | 3300013105 | Ga0157369_10036200 | Ga0157369_100362004 | 268 |
| 790 | 3300013105 | Ga0157369_10242129 | Ga0157369_102421292 | 268 |
| 791 | 3300013306 | Ga0163162_10514409 | Ga0163162_105144091 | 268 |
| 792 | 3300013307 | Ga0157372_10831096 | Ga0157372_108310961 | 268 |
| 793 | 3300020069 | Ga0197907_10093668 | Ga0197907_100936681 | 268 |
| 794 | 3300020081 | Ga0206354_10117369 | Ga0206354_101173692 | 268 |
| 795 | 3300020082 | Ga0206353_10353987 | Ga0206353_103539873 | 268 |
| 796 | 3300020082 | Ga0206353_11308596 | Ga0206353_113085961 | 268 |
| 797 | 3300022467 | Ga0224712_10000029 | Ga0224712_1000002913 | 268 |
| 798 | 3300025256 | Ga0209759_1000200 | Ga0209759_100020076 | 268 |
| 799 | 3300025295 | Ga0209564_1007173 | Ga0209564_10071735 | 268 |
| 800 | 3300025297 | Ga0209758_1000015 | Ga0209758_1000015502 | 268 |
| 801 | 3300025302 | Ga0207426_1000007 | Ga0207426_1000007365 | 268 |
| 802 | 3300025321 | Ga0207656_10001030 | Ga0207656_100010303 | 268 |
| 803 | 3300025735 | Ga0207713_1000089 | Ga0207713_100008930 | 268 |
| 804 | 3300025735 | Ga0207713_1000106 | Ga0207713_1000106123 | 268 |
| 805 | 3300025904 | Ga0207647_10003157 | Ga0207647_1000315712 | 268 |
| 806 | 3300025904 | Ga0207647_10011500 | Ga0207647_100115004 | 268 |
| 807 | 3300025904 | Ga0207647_10047293 | Ga0207647_100472932 | 268 |
| 808 | 3300025907 | Ga0207645_10100473 | Ga0207645_101004734 | 268 |
| 809 | 3300025909 | Ga0207705_10002837 | Ga0207705_100028379 | 268 |
| 810 | 3300025909 | Ga0207705_10135889 | Ga0207705_101358892 | 268 |
| 811 | 3300025911 | Ga0207654_10001428 | Ga0207654_100014286 | 268 |
| 812 | 3300025911 | Ga0207654_10084065 | Ga0207654_100840652 | 268 |
| 813 | 3300025913 | Ga0207695_10001225 | Ga0207695_1000122538 | 268 |
| 814 | 3300025913 | Ga0207695_10017841 | Ga0207695_100178415 | 268 |
| 815 | 3300025913 | Ga0207695_10021230 | Ga0207695_100212307 | 268 |
| 816 | 3300025914 | Ga0207671_10000676 | Ga0207671_1000067642 | 268 |
| 817 | 3300025914 | Ga0207671_10004835 | Ga0207671_100048359 | 268 |
| 818 | 3300025914 | Ga0207671_10047020 | Ga0207671_100470203 | 268 |
| 819 | 3300025914 | Ga0207671_10256642 | Ga0207671_102566422 | 268 |
| 820 | 3300025919 | Ga0207657_10000074 | Ga0207657_1000007418 | 268 |
| 821 | 3300025920 | Ga0207649_10000887 | Ga0207649_1000088710 | 268 |
| 822 | 3300025924 | Ga0207694_10005711 | Ga0207694_100057115 | 268 |
| 823 | 3300025932 | Ga0207690_10000840 | Ga0207690_1000084020 | 268 |
| 824 | 3300025933 | Ga0207706_10097255 | Ga0207706_100972551 | 268 |
| 825 | 3300025935 | Ga0207709_10351115 | Ga0207709_103511151 | 268 |
| 826 | 3300025941 | Ga0207711_10086634 | Ga0207711_100866342 | 268 |
| 827 | 3300025949 | Ga0207667_10000004 | Ga0207667_10000004570 | 268 |
| 828 | 3300025981 | Ga0207640_10002751 | Ga0207640_100027518 | 268 |
| 829 | 3300025986 | Ga0207658_10002723 | Ga0207658_100027235 | 268 |
| 830 | 3300025986 | Ga0207658_10131844 | Ga0207658_101318442 | 268 |
| 831 | 3300026041 | Ga0207639_10012292 | Ga0207639_100122926 | 268 |
| 832 | 3300026067 | Ga0207678_10000056 | Ga0207678_1000005667 | 268 |
| 833 | 3300026078 | Ga0207702_10000087 | Ga0207702_1000008739 | 268 |
| 834 | 3300026089 | Ga0207648_10437349 | Ga0207648_104373492 | 268 |
| 835 | 3300026116 | Ga0207674_10000121 | Ga0207674_1000012118 | 268 |
| 836 | 3300026116 | Ga0207674_10039575 | Ga0207674_100395754 | 268 |
| 837 | 3300026142 | Ga0207698_10003375 | Ga0207698_100033755 | 268 |
| 838 | 3300026142 | Ga0207698_10041936 | Ga0207698_100419365 | 268 |
| 839 | 3300027312 | Ga0209371_1004269 | Ga0209371_10042693 | 268 |
| 840 | 3300028379 | Ga0268266_10239784 | Ga0268266_102397842 | 268 |
| 841 | 3300028800 | Ga0265338_10025382 | Ga0265338_100253827 | 268 |
| 842 | 3300029957 | Ga0265324_10065890 | Ga0265324_100658901 | 268 |
| 843 | 3300030500 | Ga0268256_1002337 | Ga0268256_10023373 | 268 |
| 844 | 3300031241 | Ga0265325_10000379 | Ga0265325_100003796 | 268 |
| 845 | 3300031344 | Ga0265316_10093549 | Ga0265316_100935492 | 268 |
| 846 | 3300031456 | Ga0307513_10259565 | Ga0307513_102595652 | 268 |
| 847 | 3300031548 | Ga0307408_100000381 | Ga0307408_10000038135 | 268 |
| 848 | 3300031595 | Ga0265313_10000678 | Ga0265313_1000067817 | 268 |
| 849 | 3300031730 | Ga0307516_10007858 | Ga0307516_1000785810 | 268 |
| 850 | 3300031901 | Ga0307406_10003961 | Ga0307406_100039615 | 268 |
| 851 | 3300031911 | Ga0307412_10003319 | Ga0307412_100033195 | 268 |
| 852 | 3300031995 | Ga0307409_100474572 | Ga0307409_1004745721 | 268 |
| 853 | 3300032002 | Ga0307416_100037381 | Ga0307416_1000373812 | 268 |
| 854 | 3300032004 | Ga0307414_10000185 | Ga0307414_1000018528 | 268 |
| 855 | 3300032005 | Ga0307411_10030158 | Ga0307411_100301583 | 268 |
| 856 | 3300032005 | Ga0307411_10080833 | Ga0307411_100808333 | 268 |
| 857 | 3300035172 | Ga0373955_0221080 | Ga0373955_0221080_33_845 | 268 |
| 858 | 3300035724 | Ga0373933_0265132 | Ga0373933_0265132_92_904 | 268 |
| 859 | 3300036401 | Ga0373937_0001887 | Ga0373937_0001887_16599_17411 | 268 |
| 860 | 3300037068 | Ga0373925_0022030 | Ga0373925_0022030_145_963 | 268 |
| 861 | 3300037312 | Ga0395899_0039445 | Ga0395899_0039445_204_1055 | 268 |
| 862 | 3300037312 | Ga0395899_0099922 | Ga0395899_0099922_1020_1868 | 268 |
| 863 | 3300037418 | Ga0395900_0000057 | Ga0395900_0000057_124922_125770 | 268 |
| 864 | 3300037418 | Ga0395900_0064451 | Ga0395900_0064451_415_1266 | 268 |
| 865 | 3300037466 | Ga0395898_0006875 | Ga0395898_0006875_10559_11428 | 268 |
| 866 | 3300037466 | Ga0395898_0154961 | Ga0395898_0154961_1210_2061 | 268 |
| 867 | 3300037466 | Ga0395898_0434618 | Ga0395898_0434618_177_1025 | 268 |
| 868 | 3300037471 | Ga0395905_0000014 | Ga0395905_0000014_280401_281252 | 268 |
| 869 | 3300037471 | Ga0395905_0270759 | Ga0395905_0270759_206_1057 | 268 |
| 870 | 3300037471 | Ga0395905_0598262 | Ga0395905_0598262_163_993 | 268 |
| 871 | 3300038443 | Ga0395901_0000113 | Ga0395901_0000113_93625_94473 | 268 |
| 872 | 3300038443 | Ga0395901_0000177 | Ga0395901_0000177_73191_74042 | 268 |
| 873 | 3300038443 | Ga0395901_0019615 | Ga0395901_0019615_3837_4706 | 268 |
| 874 | 3300039437 | Ga0436365_0785175 | Ga0436365_0785175_81_926 | 268 |
| 875 | 3300039438 | Ga0436360_1340002 | Ga0436360_1340002_649_1461 | 268 |
| 876 | 3300039450 | Ga0436363_0877931 | Ga0436363_0877931_1469_2506 | 268 |
| 877 | 3300039450 | Ga0436363_1498526 | Ga0436363_1498526_1225_2070 | 268 |
| 878 | 3300041407 | Ga0439447_000125 | Ga0439447_000125_15040_15876 | 268 |
| 879 | 3300042013 | Ga0439456_001624 | Ga0439456_001624_3471_4307 | 268 |
| 880 | 3300042532 | Ga0450893_0005053 | Ga0450893_0005053_996_1814 | 268 |
| 881 | 3300044656 | Ga0466969_0012592 | Ga0466969_0012592_708_1556 | 268 |
| 882 | 3300044658 | Ga0466972_0021071 | Ga0466972_0021071_1017_1868 | 268 |
| 883 | 3300044683 | Ga0466965_0030838 | Ga0466965_0030838_1471_2319 | 268 |
| 884 | 3300044684 | Ga0466966_0000006 | Ga0466966_0000006_34472_35320 | 268 |
| 885 | 3300044684 | Ga0466966_0005729 | Ga0466966_0005729_1053_1904 | 268 |
| 886 | 3300044684 | Ga0466966_0064567 | Ga0466966_0064567_162_1010 | 268 |
| 887 | 3300044693 | Ga0466961_0000799 | Ga0466961_0000799_15260_16108 | 268 |
| 888 | 3300044694 | Ga0466963_0000688 | Ga0466963_0000688_4175_5026 | 268 |
| 889 | 3300044694 | Ga0466963_0035811 | Ga0466963_0035811_572_1420 | 268 |
| 890 | 3300044706 | Ga0466964_0000862 | Ga0466964_0000862_786_1634 | 268 |
| 891 | 3300044719 | Ga0466971_0003183 | Ga0466971_0003183_2236_3084 | 268 |
| 892 | 3300044842 | Ga0466957_0042055 | Ga0466957_0042055_1801_2649 | 268 |
| 893 | 3300044842 | Ga0466957_0162002 | Ga0466957_0162002_36_887 | 268 |
| 894 | 3300045049 | Ga0466959_0056076 | Ga0466959_0056076_130_978 | 268 |
| 895 | 3300045049 | Ga0466959_0085002 | Ga0466959_0085002_668_1516 | 268 |
| 896 | 3300045836 | Ga0466958_0008929 | Ga0466958_0008929_3287_4135 | 268 |
| 897 | 3300046454 | Ga0495592_0020483 | Ga0495592_0020483_2123_2974 | 268 |
| 898 | 3300046455 | Ga0495603_0044634 | Ga0495603_0044634_1433_2368 | 268 |
| 899 | 3300046455 | Ga0495603_0172096 | Ga0495603_0172096_326_1213 | 268 |
| 900 | 3300046457 | Ga0495590_0050981 | Ga0495590_0050981_317_1162 | 268 |
| 901 | 3300046458 | Ga0495591_000634 | Ga0495591_000634_15631_16575 | 268 |
| 902 | 3300046459 | Ga0495629_0000041 | Ga0495629_0000041_29196_30083 | 268 |
| 903 | 3300046459 | Ga0495629_0002085 | Ga0495629_0002085_1749_2669 | 268 |
| 904 | 3300046459 | Ga0495629_0006466 | Ga0495629_0006466_3834_4778 | 268 |
| 905 | 3300046459 | Ga0495629_0020326 | Ga0495629_0020326_1860_2705 | 268 |
| 906 | 3300046459 | Ga0495629_0023121 | Ga0495629_0023121_775_1626 | 268 |
| 907 | 3300046460 | Ga0495638_0009586 | Ga0495638_0009586_3348_4235 | 268 |
| 908 | 3300046461 | Ga0495641_0013087 | Ga0495641_0013087_1899_2819 | 268 |
| 909 | 3300046462 | Ga0495651_0059416 | Ga0495651_0059416_357_1301 | 268 |
| 910 | 3300046462 | Ga0495651_0069388 | Ga0495651_0069388_186_1106 | 268 |
| 911 | 3300046462 | Ga0495651_0112435 | Ga0495651_0112435_960_1847 | 268 |
| 912 | 3300046462 | Ga0495651_0159935 | Ga0495651_0159935_750_1568 | 268 |
| 913 | 3300046463 | Ga0495653_0001593 | Ga0495653_0001593_10035_10922 | 268 |
| 914 | 3300046463 | Ga0495653_0002973 | Ga0495653_0002973_5472_6317 | 268 |
| 915 | 3300046463 | Ga0495653_0009568 | Ga0495653_0009568_3096_4016 | 268 |
| 916 | 3300046463 | Ga0495653_0083664 | Ga0495653_0083664_1273_2184 | 268 |
| 917 | 3300046471 | Ga0495650_0010210 | Ga0495650_0010210_3213_4076 | 268 |
| 918 | 3300046471 | Ga0495650_0017107 | Ga0495650_0017107_1535_2470 | 268 |
| 919 | 3300046472 | Ga0495580_0000292 | Ga0495580_0000292_31152_32072 | 268 |
| 920 | 3300046472 | Ga0495580_0001078 | Ga0495580_0001078_18329_19225 | 268 |
| 921 | 3300046472 | Ga0495580_0002641 | Ga0495580_0002641_1557_2444 | 268 |
| 922 | 3300046472 | Ga0495580_0003482 | Ga0495580_0003482_1053_1988 | 268 |
| 923 | 3300046472 | Ga0495580_0030630 | Ga0495580_0030630_2801_3652 | 268 |
| 924 | 3300046472 | Ga0495580_0057182 | Ga0495580_0057182_118_1062 | 268 |
| 925 | 3300046473 | Ga0495582_0002227 | Ga0495582_0002227_3780_4700 | 268 |
| 926 | 3300046473 | Ga0495582_0211155 | Ga0495582_0211155_133_984 | 268 |
| 927 | 3300046474 | Ga0495605_0017241 | Ga0495605_0017241_2658_3584 | 268 |
| 928 | 3300046474 | Ga0495605_0044902 | Ga0495605_0044902_1041_1928 | 268 |
| 929 | 3300046475 | Ga0495639_0004269 | Ga0495639_0004269_4615_5433 | 268 |
| 930 | 3300046476 | Ga0495662_0008395 | Ga0495662_0008395_85_1005 | 268 |
| 931 | 3300046476 | Ga0495662_0095520 | Ga0495662_0095520_559_1410 | 268 |
| 932 | 3300046477 | Ga0495664_0053210 | Ga0495664_0053210_654_1598 | 268 |
| 933 | 3300046477 | Ga0495664_0061462 | Ga0495664_0061462_832_1683 | 268 |
| 934 | 3300046491 | Ga0495584_0139920 | Ga0495584_0139920_250_1095 | 268 |
| 935 | 3300046499 | Ga0495594_0068921 | Ga0495594_0068921_302_1222 | 268 |
| 936 | 3300046500 | Ga0495596_0001846 | Ga0495596_0001846_1551_2495 | 268 |
| 937 | 3300046500 | Ga0495596_0053225 | Ga0495596_0053225_287_1138 | 268 |
| 938 | 3300046500 | Ga0495596_0070611 | Ga0495596_0070611_176_1021 | 268 |
| 939 | 3300046506 | Ga0495583_0003634 | Ga0495583_0003634_7712_8599 | 268 |
| 940 | 3300046507 | Ga0495606_0004722 | Ga0495606_0004722_1629_2474 | 268 |
| 941 | 3300046511 | Ga0495608_0005018 | Ga0495608_0005018_4258_5109 | 268 |
| 942 | 3300046513 | Ga0495616_0069622 | Ga0495616_0069622_337_1272 | 268 |
| 943 | 3300046514 | Ga0495618_0002705 | Ga0495618_0002705_5807_6658 | 268 |
| 944 | 3300046514 | Ga0495618_0025581 | Ga0495618_0025581_1101_2045 | 268 |
| 945 | 3300046514 | Ga0495618_0267306 | Ga0495618_0267306_178_1008 | 268 |
| 946 | 3300046516 | Ga0495628_0010428 | Ga0495628_0010428_1049_1936 | 268 |
| 947 | 3300046516 | Ga0495628_0086625 | Ga0495628_0086625_512_1456 | 268 |
| 948 | 3300046517 | Ga0495630_0004630 | Ga0495630_0004630_8579_9499 | 268 |
| 949 | 3300046517 | Ga0495630_0006315 | Ga0495630_0006315_2478_3323 | 268 |
| 950 | 3300046517 | Ga0495630_0039120 | Ga0495630_0039120_871_1806 | 268 |
| 951 | 3300046517 | Ga0495630_0041362 | Ga0495630_0041362_411_1355 | 268 |
| 952 | 3300046517 | Ga0495630_0048964 | Ga0495630_0048964_1128_1958 | 268 |
| 953 | 3300046517 | Ga0495630_0467579 | Ga0495630_0467579_21_908 | 268 |
| 954 | 3300046517 | Ga0495630_0589678 | Ga0495630_0589678_23_841 | 268 |
| 955 | 3300046523 | Ga0495644_0029101 | Ga0495644_0029101_740_1594 | 268 |
| 956 | 3300046524 | Ga0495648_0008757 | Ga0495648_0008757_1954_2784 | 268 |
| 957 | 3300046524 | Ga0495648_0013472 | Ga0495648_0013472_2067_2993 | 268 |
| 958 | 3300046524 | Ga0495648_0068281 | Ga0495648_0068281_619_1563 | 268 |
| 959 | 3300046526 | Ga0495666_0002166 | Ga0495666_0002166_8184_9128 | 268 |
| 960 | 3300046526 | Ga0495666_0003060 | Ga0495666_0003060_1179_2099 | 268 |
| 961 | 3300046526 | Ga0495666_0011032 | Ga0495666_0011032_1849_2700 | 268 |
| 962 | 3300046529 | Ga0495652_0004403 | Ga0495652_0004403_3702_4547 | 268 |
| 963 | 3300046529 | Ga0495652_0048754 | Ga0495652_0048754_2032_2883 | 268 |
| 964 | 3300046529 | Ga0495652_0353452 | Ga0495652_0353452_72_890 | 268 |
| 965 | 3300046531 | Ga0495665_0000102 | Ga0495665_0000102_14760_15605 | 268 |
| 966 | 3300046531 | Ga0495665_0014425 | Ga0495665_0014425_2017_2868 | 268 |
| 967 | 3300046531 | Ga0495665_0018926 | Ga0495665_0018926_2138_2968 | 268 |
| 968 | 3300046531 | Ga0495665_0025941 | Ga0495665_0025941_929_1873 | 268 |
| 969 | 3300046531 | Ga0495665_0081594 | Ga0495665_0081594_97_1032 | 268 |
| 970 | 3300046533 | Ga0495640_0001811 | Ga0495640_0001811_9989_10933 | 268 |
| 971 | 3300046533 | Ga0495640_0014737 | Ga0495640_0014737_3206_4057 | 268 |
| 972 | 3300046535 | Ga0495586_0019191 | Ga0495586_0019191_2292_3143 | 268 |
| 973 | 3300046536 | Ga0495587_0003529 | Ga0495587_0003529_3331_4251 | 268 |
| 974 | 3300046538 | Ga0495609_0045483 | Ga0495609_0045483_218_1063 | 268 |
| 975 | 3300046543 | Ga0495645_0001558 | Ga0495645_0001558_6075_6995 | 268 |
| 976 | 3300046543 | Ga0495645_0145426 | Ga0495645_0145426_455_1300 | 268 |
| 977 | 3300046557 | Ga0495622_0000222 | Ga0495622_0000222_34657_35604 | 268 |
| 978 | 3300046559 | Ga0495667_0026878 | Ga0495667_0026878_2754_3605 | 268 |
| 979 | 3300046642 | Ga0495634_0004254 | Ga0495634_0004254_8652_9572 | 268 |
| 980 | 3300046642 | Ga0495634_0008269 | Ga0495634_0008269_4989_5840 | 268 |
| 981 | 3300046648 | Ga0495611_0028429 | Ga0495611_0028429_36_881 | 268 |
| 982 | 3300046660 | Ga0495625_0067078 | Ga0495625_0067078_1321_2139 | 268 |
| 983 | 3300046660 | Ga0495625_0106321 | Ga0495625_0106321_279_1124 | 268 |
| 984 | 3300046663 | Ga0495635_0001046 | Ga0495635_0001046_16088_16933 | 268 |
| 985 | 3300046663 | Ga0495635_0003763 | Ga0495635_0003763_3303_4223 | 268 |
| 986 | 3300046663 | Ga0495635_0009347 | Ga0495635_0009347_2342_3193 | 268 |
| 987 | 3300046663 | Ga0495635_0009844 | Ga0495635_0009844_3981_4925 | 268 |
| 988 | 3300046665 | Ga0495661_0001184 | Ga0495661_0001184_18804_19724 | 268 |
| 989 | 3300046665 | Ga0495661_0003822 | Ga0495661_0003822_8542_9486 | 268 |
| 990 | 3300046665 | Ga0495661_0094341 | Ga0495661_0094341_512_1399 | 268 |
| 991 | 3300046674 | Ga0495588_0008163 | Ga0495588_0008163_1997_2917 | 268 |
| 992 | 3300046674 | Ga0495588_0079984 | Ga0495588_0079984_342_1193 | 268 |
| 993 | 3300046675 | Ga0495657_0086894 | Ga0495657_0086894_396_1247 | 268 |
| 994 | 3300046675 | Ga0495657_0096914 | Ga0495657_0096914_525_1469 | 268 |
| 995 | 3300046678 | Ga0495599_0032059 | Ga0495599_0032059_310_1230 | 268 |
| 996 | 3300046678 | Ga0495599_0067451 | Ga0495599_0067451_185_1072 | 268 |
| 997 | 3300046679 | Ga0495623_0029735 | Ga0495623_0029735_1044_1988 | 268 |
| 998 | 3300046679 | Ga0495623_0049423 | Ga0495623_0049423_1702_2646 | 268 |
| 999 | 3300046679 | Ga0495623_0097012 | Ga0495623_0097012_412_1263 | 268 |
| 1000 | 3300046680 | Ga0495646_0000546 | Ga0495646_0000546_18412_19263 | 268 |
| 1001 | 3300046680 | Ga0495646_0003447 | Ga0495646_0003447_512_1456 | 268 |
| 1002 | 3300046680 | Ga0495646_0011537 | Ga0495646_0011537_1686_2606 | 268 |
| 1003 | 3300046680 | Ga0495646_0046302 | Ga0495646_0046302_79_966 | 268 |
| 1004 | 3300046680 | Ga0495646_0155539 | Ga0495646_0155539_10_876 | 268 |
| 1005 | 3300046689 | Ga0495613_0007648 | Ga0495613_0007648_130_1050 | 268 |
| 1006 | 3300046689 | Ga0495613_0019016 | Ga0495613_0019016_648_1592 | 268 |
| 1007 | 3300046689 | Ga0495613_0124455 | Ga0495613_0124455_994_1812 | 268 |
| 1008 | 3300046690 | Ga0495624_0000067 | Ga0495624_0000067_11548_12378 | 268 |
| 1009 | 3300046690 | Ga0495624_0002416 | Ga0495624_0002416_11743_12630 | 268 |
| 1010 | 3300046690 | Ga0495624_0008750 | Ga0495624_0008750_426_1244 | 268 |
| 1011 | 3300046690 | Ga0495624_0019355 | Ga0495624_0019355_90_941 | 268 |
| 1012 | 3300046692 | Ga0495671_0021569 | Ga0495671_0021569_716_1588 | 268 |
| 1013 | 3300046692 | Ga0495671_0080716 | Ga0495671_0080716_130_975 | 268 |
| 1014 | 3300046694 | Ga0495649_0030084 | Ga0495649_0030084_886_1773 | 268 |
| 1015 | 3300046694 | Ga0495649_0068173 | Ga0495649_0068173_454_1299 | 268 |
| 1016 | 3300046794 | Ga0495589_0006991 | Ga0495589_0006991_1059_2003 | 268 |
| 1017 | 3300046794 | Ga0495589_0026849 | Ga0495589_0026849_1380_2231 | 268 |
| 1018 | 3300046809 | Ga0495600_0003130 | Ga0495600_0003130_3844_4695 | 268 |
| 1019 | 3300046809 | Ga0495600_0017324 | Ga0495600_0017324_1048_1992 | 268 |
| 1020 | 3300047315 | Ga0495581_0000839 | Ga0495581_0000839_1877_2797 | 268 |
| 1021 | 3300047315 | Ga0495581_0006036 | Ga0495581_0006036_2480_3331 | 268 |
| 1022 | 3300047317 | Ga0495604_0003897 | Ga0495604_0003897_8956_9801 | 268 |
| 1023 | 3300047317 | Ga0495604_0004803 | Ga0495604_0004803_1251_2171 | 268 |
| 1024 | 3300047317 | Ga0495604_0006820 | Ga0495604_0006820_1375_2319 | 268 |
| 1025 | 3300047317 | Ga0495604_0007926 | Ga0495604_0007926_7389_8333 | 268 |
| 1026 | 3300047317 | Ga0495604_0046122 | Ga0495604_0046122_2216_3103 | 268 |
| 1027 | 3300047317 | Ga0495604_0179777 | Ga0495604_0179777_218_1069 | 268 |
| 1028 | 3300047319 | Ga0495674_0000035 | Ga0495674_0000035_11679_12509 | 268 |
| 1029 | 3300047319 | Ga0495674_0009692 | Ga0495674_0009692_6542_7408 | 268 |
| 1030 | 3300047319 | Ga0495674_0012457 | Ga0495674_0012457_4025_4969 | 268 |
| 1031 | 3300047319 | Ga0495674_0015386 | Ga0495674_0015386_3228_4148 | 268 |
| 1032 | 3300047319 | Ga0495674_0087871 | Ga0495674_0087871_1491_2378 | 268 |
| 1033 | 3300047319 | Ga0495674_0257142 | Ga0495674_0257142_173_1024 | 268 |
| 1034 | 3300047320 | Ga0495672_0030969 | Ga0495672_0030969_1148_2074 | 268 |
| 1035 | 3300047320 | Ga0495672_0031420 | Ga0495672_0031420_2031_2918 | 268 |
| 1036 | 3300047320 | Ga0495672_0033056 | Ga0495672_0033056_494_1414 | 268 |
| 1037 | 3300047321 | Ga0495676_0005872 | Ga0495676_0005872_6434_7354 | 268 |
| 1038 | 3300047321 | Ga0495676_0035586 | Ga0495676_0035586_1108_1926 | 268 |
| 1039 | 3300047321 | Ga0495676_0132102 | Ga0495676_0132102_538_1389 | 268 |
| 1040 | 3300047321 | Ga0495676_0199669 | Ga0495676_0199669_29_859 | 268 |
| 1041 | 3300047322 | Ga0495680_0006288 | Ga0495680_0006288_7341_8285 | 268 |
| 1042 | 3300047322 | Ga0495680_0007830 | Ga0495680_0007830_780_1625 | 268 |
| 1043 | 3300047322 | Ga0495680_0020726 | Ga0495680_0020726_3901_4752 | 268 |
| 1044 | 3300047322 | Ga0495680_0042069 | Ga0495680_0042069_970_1914 | 268 |
| 1045 | 3300047322 | Ga0495680_0063050 | Ga0495680_0063050_1749_2669 | 268 |
| 1046 | 3300047322 | Ga0495680_0064818 | Ga0495680_0064818_1300_2187 | 268 |
| 1047 | 3300047323 | Ga0495683_0002967 | Ga0495683_0002967_8242_9186 | 268 |
| 1048 | 3300047443 | Ga0495687_000094 | Ga0495687_000094_19891_20709 | 268 |
| 1049 | 3300047443 | Ga0495687_008249 | Ga0495687_008249_1406_2341 | 268 |
| 1050 | 3300047443 | Ga0495687_079565 | Ga0495687_079565_191_1021 | 268 |
| 1051 | 3300047444 | Ga0495675_0009422 | Ga0495675_0009422_1576_2427 | 268 |
| 1052 | 3300047444 | Ga0495675_0054447 | Ga0495675_0054447_1014_1958 | 268 |
| 1053 | 3300047444 | Ga0495675_0136490 | Ga0495675_0136490_498_1442 | 268 |
| 1054 | 3300047446 | Ga0495679_000007 | Ga0495679_000007_226800_227735 | 268 |
| 1055 | 3300047446 | Ga0495679_002567 | Ga0495679_002567_6488_7408 | 268 |
| 1056 | 3300047446 | Ga0495679_004234 | Ga0495679_004234_2696_3640 | 268 |
| 1057 | 3300047469 | Ga0495673_0053773 | Ga0495673_0053773_358_1206 | 268 |
| 1058 | 3300047469 | Ga0495673_0066611 | Ga0495673_0066611_255_1142 | 268 |
| 1059 | 3300047471 | Ga0495684_0004657 | Ga0495684_0004657_2717_3637 | 268 |
| 1060 | 3300047472 | Ga0495686_0032897 | Ga0495686_0032897_502_1389 | 268 |
| 1061 | 3300047673 | Ga0495593_0001588 | Ga0495593_0001588_4585_5472 | 268 |
| 1062 | 3300047673 | Ga0495593_0002189 | Ga0495593_0002189_1370_2200 | 268 |
| 1063 | 3300047673 | Ga0495593_0004823 | Ga0495593_0004823_1619_2563 | 268 |
| 1064 | 3300047673 | Ga0495593_0010395 | Ga0495593_0010395_2781_3626 | 268 |
| 1065 | 3300048088 | Ga0495602_0000761 | Ga0495602_0000761_21554_22399 | 268 |
| 1066 | 3300048088 | Ga0495602_0033575 | Ga0495602_0033575_412_1323 | 268 |
| 1067 | 3300048088 | Ga0495602_0066166 | Ga0495602_0066166_1632_2576 | 268 |
| 1068 | 3300048088 | Ga0495602_0087263 | Ga0495602_0087263_145_1080 | 268 |
| 1069 | 3300048088 | Ga0495602_0110321 | Ga0495602_0110321_218_1069 | 268 |
| 1070 | 3300048088 | Ga0495602_0110779 | Ga0495602_0110779_186_1130 | 268 |
| 1071 | 3300048089 | Ga0495614_0002155 | Ga0495614_0002155_1179_2099 | 268 |
| 1072 | 3300048089 | Ga0495614_0002482 | Ga0495614_0002482_986_1837 | 268 |
| 1073 | 3300048089 | Ga0495614_0009506 | Ga0495614_0009506_1269_2213 | 268 |
| 1074 | 3300048091 | Ga0495626_0008973 | Ga0495626_0008973_4341_5276 | 268 |
| 1075 | 3300048903 | Ga0496100_0003525 | Ga0496100_0003525_6734_7666 | 268 |
| 1076 | 3300048903 | Ga0496100_0101051 | Ga0496100_0101051_799_1734 | 268 |
| 1077 | 3300048904 | Ga0496101_0004588 | Ga0496101_0004588_6164_7096 | 268 |
| 1078 | 3300048905 | Ga0496102_0001490 | Ga0496102_0001490_13981_14913 | 268 |
| 1079 | 3300048906 | Ga0496103_0001870 | Ga0496103_0001870_6626_7558 | 268 |
| 1080 | 3300048906 | Ga0496103_0009502 | Ga0496103_0009502_2075_3019 | 268 |
| 1081 | 3300048906 | Ga0496103_0109443 | Ga0496103_0109443_576_1421 | 268 |
| 1082 | 3300048907 | Ga0496104_0004872 | Ga0496104_0004872_8061_8996 | 268 |
| 1083 | 3300048907 | Ga0496104_0046279 | Ga0496104_0046279_1569_2414 | 268 |
| 1084 | 3300048907 | Ga0496104_0574544 | Ga0496104_0574544_10_852 | 268 |
| 1085 | 3300048916 | Ga0496113_0027595 | Ga0496113_0027595_685_1620 | 268 |
| 1086 | 3300048920 | Ga0496117_0007461 | Ga0496117_0007461_7870_8802 | 268 |
| 1087 | 3300048920 | Ga0496117_0010428 | Ga0496117_0010428_5969_6865 | 268 |
| 1088 | 3300048920 | Ga0496117_0025338 | Ga0496117_0025338_2628_3572 | 268 |
| 1089 | 3300048920 | Ga0496117_0036399 | Ga0496117_0036399_1530_2417 | 268 |
| 1090 | 3300048921 | Ga0496118_0000603 | Ga0496118_0000603_53788_54684 | 268 |
| 1091 | 3300048921 | Ga0496118_0001810 | Ga0496118_0001810_1909_2841 | 268 |
| 1092 | 3300048921 | Ga0496118_0016638 | Ga0496118_0016638_3621_4556 | 268 |
| 1093 | 3300048921 | Ga0496118_0024742 | Ga0496118_0024742_2595_3539 | 268 |
| 1094 | 3300048922 | Ga0496119_0063362 | Ga0496119_0063362_348_1280 | 268 |
| 1095 | 3300048924 | Ga0496121_0013905 | Ga0496121_0013905_5803_6735 | 268 |
| 1096 | 3300048924 | Ga0496121_0050582 | Ga0496121_0050582_1554_2441 | 268 |
| 1097 | 3300048924 | Ga0496121_0066000 | Ga0496121_0066000_1910_2755 | 268 |
| 1098 | 3300048928 | Ga0496125_0103357 | Ga0496125_0103357_992_1837 | 268 |
| 1099 | 3300048929 | Ga0496126_0006922 | Ga0496126_0006922_9614_10501 | 268 |
| 1100 | 3300048929 | Ga0496126_0128990 | Ga0496126_0128990_158_1003 | 268 |
| 1101 | 3300048929 | Ga0496126_0233949 | Ga0496126_0233949_229_1074 | 268 |
| 1102 | 3300049460 | Ga0495682_0014349 | Ga0495682_0014349_1262_2092 | 268 |
| 1103 | 3300049460 | Ga0495682_0017668 | Ga0495682_0017668_1192_2079 | 268 |
| 1104 | 3300049460 | Ga0495682_0038574 | Ga0495682_0038574_622_1557 | 268 |
| 1105 | 3300049460 | Ga0495682_0040460 | Ga0495682_0040460_433_1329 | 268 |
| 1106 | 3300049571 | Ga0501034_0088095 | Ga0501034_0088095_108_995 | 268 |
| 1107 | 3300049571 | Ga0501034_0175420 | Ga0501034_0175420_827_1657 | 268 |
| 1108 | 3300050493 | nmdc:mga0k408_16518_c1 | nmdc:mga0k408_16518_c1_1338_2156 | 268 |
| 1109 | 3300050494 | nmdc:mga06z11_173654_c1 | nmdc:mga06z11_173654_c1_332_1150 | 268 |
| 1110 | 3300050496 | nmdc:mga07m45_23686_c1 | nmdc:mga07m45_23686_c1_1608_2438 | 268 |
| 1111 | 3300050496 | nmdc:mga07m45_28324_c1 | nmdc:mga07m45_28324_c1_440_1258 | 268 |
| 1112 | 3300053088 | Ga0500644_0110418 | Ga0500644_0110418_25_843 | 268 |
| 1113 | 3300053108 | Ga0500562_010790 | Ga0500562_010790_1408_2226 | 268 |
| 1114 | 3300053108 | Ga0500562_018737 | Ga0500562_018737_335_1180 | 268 |
| 1115 | 3300053161 | Ga0500634_0070488 | Ga0500634_0070488_173_1018 | 268 |
| 1116 | 3300061719 | Ga0466962_0000903 | Ga0466962_0000903_5319_6170 | 268 |
| 1117 | 3300061719 | Ga0466962_0011578 | Ga0466962_0011578_898_1746 | 268 |
| 1118 | iso_pu_bacteria | 642555112 | 642591960 | 268 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qk8-assembly1.cif.gz_D | crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand | 0.9891 | 5 | 261 |
| 3q1t-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase from mycobacterium avium | 0.9881 | 5 | 252 |
| 7m3w-assembly1.cif.gz_B | crystal structure of enoyl-coa hydratase echa15 protein from mycolicibacterium paratuberculosis | 0.988 | 5 | 263 |
| 3qk8-assembly1.cif.gz_B | crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand | 0.9875 | 4 | 262 |
| 3qk8-assembly1.cif.gz_B | crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand | 0.98 | 4 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wz8A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9671 | 1 | 206 | 3.90.226.10 |
| 1wz8A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9625 | 1 | 206 | 3.90.226.10 |
| 3rrvD00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9486 | 7 | 253 | 3.90.226.10 |
| 3rrvD00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9375 | 7 | 253 | 3.90.226.10 |
| 5wydE01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9339 | 9 | 206 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I1JS87-F1-model_v4 | Enoyl-CoA hydratase | 0.9934 | 1 | 268 |
GO:0005524
GO:0016887 |
| AF-A0A7W0HPM6-F1-model_v4 | Enoyl-CoA hydratase (EC 4.2.1.17) | 0.9929 | 12 | 262 |
GO:0004300
|
| AF-A0A7Z9Y011-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9919 | 5 | 241 |
GO:0016853
|
| AF-A0A1M6R1R1-F1-model_v4 | Enoyl-CoA hydratase | 0.9915 | 3 | 263 |
GO:0003824
|
| AF-J5E830-F1-model_v4 | Enoyl-CoA hydratase (EC 4.2.1.17) | 0.9912 | 20 | 263 |
GO:0004300
GO:0006631 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar