F490345

General Info

Members Datasets Scaffolds Average Seq Length
1118 501 1070 277

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0877931|Ga0436363_0877931_1469_2506
Length 325
Sequence VAVVSIDATAVLPATGVPGEVIFLSLTVKEKNAARKTEDGFSSKARDRADFRESVMDQPDDYSRYTRLKFDRPQPKVLRLTMDNGPMNAADHALHRELSEVWRQIDTDPSVNAAILTGSGPNFSAGGDFALIKDMIADFQTRARVWKEASDLVYNVINCSKPIVSAMRGVPVGAGLVAGLLADVSIATKDCRIIDGHTRLGVAAGDHAAIIWPLLCGMAKAKYYLLLCEPVRGEEAERIGLIALAVDDAELDDRAIEIASRLAEGAQTAIRWTKYALNNWLRQMGPTFDASLALEFMGFSSADVQEGLASHLKKRKPQFSPSSPF

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
3 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
4 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
5 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
6 2643221569 Achromobacter sp. Root565 Isolate Unclassified
7 2643221594 Achromobacter sp. Root170 Isolate Unclassified
8 2643221621 Achromobacter sp. Root83 Isolate Unclassified
9 2687453737 Frankia sp. BMG5.36 Isolate Nodule
10 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
11 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
12 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
13 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
14 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
15 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
16 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
17 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
18 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
19 2818991450 Burkholderia sp. 604 Isolate Unclassified
20 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
21 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
22 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
23 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
24 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
25 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
26 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
27 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
28 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
29 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
30 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
31 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
32 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
33 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
34 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
35 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
36 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
37 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
38 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
39 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
40 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
41 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
42 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
43 2941479691
44 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
45 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
46 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
47 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
48 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
49 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
50 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
51 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
52 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
53 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
54 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
55 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
56 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
60 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
61 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
62 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
63 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
75 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
76 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
77 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
78 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
79 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
80 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
81 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
82 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
83 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
88 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
89 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
90 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
91 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
92 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
93 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
94 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
97 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
98 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
99 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
104 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
111 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
112 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
113 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
114 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
115 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
116 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
117 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
118 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
119 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
120 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
121 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
122 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
129 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
130 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
159 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
160 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
161 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
163 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
164 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
169 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
234 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
235 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
236 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
237 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
238 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
239 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
240 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
241 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
242 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
243 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
244 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
245 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
248 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
249 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
250 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
255 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
256 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
257 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
258 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
259 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
260 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
261 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
262 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
264 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
266 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
267 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
268 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
269 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
270 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
271 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
272 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
273 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
274 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
275 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
276 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
278 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
279 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
280 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
283 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
284 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
285 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
286 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
287 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
288 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
289 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
290 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
291 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
292 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
293 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
294 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
295 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
296 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
297 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
298 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
299 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
300 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
301 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
302 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
303 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
304 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
305 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
306 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
307 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
308 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
309 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
310 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
311 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
312 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
313 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
314 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
315 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
316 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
317 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
318 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
319 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
320 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
321 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
322 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
323 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
324 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
325 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
326 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
327 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
328 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
329 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
330 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
331 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
332 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
333 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
334 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
335 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
336 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
337 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
338 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
339 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
340 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
341 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
342 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
343 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
344 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
345 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
346 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
347 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
348 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
349 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
350 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
351 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
352 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
353 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
354 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
355 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
356 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
357 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
358 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
359 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
360 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
361 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
362 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
363 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
364 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
365 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
366 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
367 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
368 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
369 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
370 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
371 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
372 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
373 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
374 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
375 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
376 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
377 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
378 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
379 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
380 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
381 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
382 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
383 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
384 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
385 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
386 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
387 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
388 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
389 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
390 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
391 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
392 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
393 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
394 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
395 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
396 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
397 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
398 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
399 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
400 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
401 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
402 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
403 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
404 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
405 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
406 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
407 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
408 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
409 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
410 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
411 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
412 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
413 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
414 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
415 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
416 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
417 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
418 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
419 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
420 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
421 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
422 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
423 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
424 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
425 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
426 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
427 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
428 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
429 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
430 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
431 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
432 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
433 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
434 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
435 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
436 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
437 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
438 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
454 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
455 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
456 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
457 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
458 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
459 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
460 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
461 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
462 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
463 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
466 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
467 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
468 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
469 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
470 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
471 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
472 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
473 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
474 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
475 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
476 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
477 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
478 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
479 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
480 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
481 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
482 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
483 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
484 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
485 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
486 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
487 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
488 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
489 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
490 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
491 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
492 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
493 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
494 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
495 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
496 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
497 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
498 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
499 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
500 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
501 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.26
Metatranscriptomes 0.45
Isolates 4.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.9
Nodule 1.61
Rhizoplane 3.49
Rhizosphere 79.7
Stem 0
Stem Tuber 0
Unclassified 9.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000002 3300001915 Bacteria 64630
2 JGI24752J21851_1001132 3300001976 Bacteria 3630
3 JGI24740J21852_10000005 3300001979 Bacteria 87250
4 JGI24739J22299_10033113 3300001989 Bacteria 1771
5 JGI24737J22298_10000184 3300001990 Bacteria 20107
6 JGI24751J29686_10002622 3300002459 Bacteria 3613
7 JGI25156J39149_1001067 3300002705 Bacteria 12660
8 JGI25160J50197_1000186 3300003354 Bacteria 52582
9 Ga0055530_10000014 3300003791 Bacteria 151346
10 Ga0055531_10001911 3300003794 Bacteria 14576
11 Ga0065165_1000589 3300005262 Bacteria 53322
12 Ga0065165_1041657 3300005262 Bacteria 1361
13 Ga0065704_10099041 3300005289 Bacteria 2327
14 Ga0065707_10084019 3300005295 Bacteria 7816
15 Ga0065707_10109259 3300005295 Bacteria 2475
16 Ga0070658_10000738 3300005327 Bacteria 28029
17 Ga0070658_10001208 3300005327 Bacteria 22135
18 Ga0070683_100423591 3300005329 Bacteria 1270
19 Ga0070690_100057056 3300005330 Bacteria 2506
20 Ga0070670_100168692 3300005331 Bacteria 1898
21 Ga0070670_100413473 3300005331 Bacteria 1192
22 Ga0068869_100071159 3300005334 Bacteria 2575
23 Ga0068869_100111490 3300005334 Bacteria 2082
24 Ga0070666_10135206 3300005335 Bacteria 1715
25 Ga0070680_100001985 3300005336 Bacteria 15054
26 Ga0068868_100100841 3300005338 Bacteria 2336
27 Ga0070660_100007378 3300005339 Bacteria 7659
28 Ga0070661_100002371 3300005344 Bacteria 12927
29 Ga0070668_100309442 3300005347 Bacteria 1327
30 Ga0070669_100139936 3300005353 Bacteria 1865
31 Ga0070671_100000108 3300005355 Bacteria 52691
32 Ga0070671_100000116 3300005355 Bacteria 51559
33 Ga0070671_100002267 3300005355 Bacteria 14841
34 Ga0070671_100205104 3300005355 Bacteria 1672
35 Ga0070671_100527875 3300005355 Bacteria 1017
36 Ga0070673_100152392 3300005364 Bacteria 1959
37 Ga0070688_100012466 3300005365 Bacteria 4765
38 Ga0070659_100001817 3300005366 Bacteria 15365
39 Ga0070667_100002350 3300005367 Bacteria 16565
40 Ga0070709_10120664 3300005434 Bacteria 1776
41 Ga0070714_100015447 3300005435 Bacteria 6144
42 Ga0070714_100781640 3300005435 Bacteria 924
43 Ga0070713_100051144 3300005436 Bacteria 3417
44 Ga0070713_100146241 3300005436 Bacteria 2098
45 Ga0070710_10052399 3300005437 Bacteria 2294
46 Ga0070710_10214560 3300005437 Bacteria 1221
47 Ga0070711_100058759 3300005439 Bacteria 2668
48 Ga0070711_100078820 3300005439 Bacteria 2341
49 Ga0070711_100152938 3300005439 Bacteria 1742
50 Ga0070705_100167200 3300005440 Bacteria 1476
51 Ga0070700_100142279 3300005441 Bacteria 1632
52 Ga0070708_100000811 3300005445 Bacteria 23595
53 Ga0070708_100005199 3300005445 Bacteria 10299
54 Ga0070708_100006423 3300005445 Bacteria 9361
55 Ga0070708_100340258 3300005445 Bacteria 1414
56 Ga0070708_100503186 3300005445 Bacteria 1143
57 Ga0070663_100002745 3300005455 Bacteria 9977
58 Ga0070678_100169474 3300005456 Bacteria 1777
59 Ga0070662_100116823 3300005457 Bacteria 2040
60 Ga0070681_10003664 3300005458 Bacteria 14404
61 Ga0070681_10144789 3300005458 Bacteria 2306
62 Ga0068867_100314202 3300005459 Bacteria 1296
63 Ga0070706_100001584 3300005467 Bacteria 23710
64 Ga0070706_100003747 3300005467 Bacteria 14858
65 Ga0070706_100068870 3300005467 Bacteria 3273
66 Ga0070706_100277452 3300005467 Bacteria 1564
67 Ga0070706_100280170 3300005467 Bacteria 1556
68 Ga0070707_100001089 3300005468 Bacteria 26861
69 Ga0070707_100002122 3300005468 Bacteria 18983
70 Ga0070707_100022766 3300005468 Bacteria 5925
71 Ga0070707_100101597 3300005468 Bacteria 2787
72 Ga0070698_100000587 3300005471 Bacteria 39046
73 Ga0070698_100054589 3300005471 Bacteria 4055
74 Ga0070698_100068270 3300005471 Bacteria 3573
75 Ga0070698_100140405 3300005471 Bacteria 2367
76 Ga0070699_100000149 3300005518 Bacteria 66121
77 Ga0070699_100000865 3300005518 Bacteria 28175
78 Ga0070679_100048869 3300005530 Bacteria 4214
79 Ga0070679_100126789 3300005530 Bacteria 2535
80 Ga0070684_100176235 3300005535 Bacteria 1943
81 Ga0070684_100321873 3300005535 Bacteria 1420
82 Ga0070697_100000222 3300005536 Bacteria 46798
83 Ga0070697_100000856 3300005536 Bacteria 22876
84 Ga0068853_100047725 3300005539 Bacteria 3675
85 Ga0068853_100194311 3300005539 Bacteria 1844
86 Ga0070665_100004342 3300005548 Bacteria 14911
87 Ga0070665_100005505 3300005548 Bacteria 13037
88 Ga0070665_100192006 3300005548 Bacteria 2043
89 Ga0070665_100298724 3300005548 Bacteria 1613
90 Ga0068855_100000794 3300005563 Bacteria 39088
91 Ga0068855_100037073 3300005563 Bacteria 5801
92 Ga0068855_100075781 3300005563 Bacteria 3905
93 Ga0068855_100187895 3300005563 Bacteria 2332
94 Ga0070664_100052359 3300005564 Bacteria 3457
95 Ga0068857_100005815 3300005577 Bacteria 10538
96 Ga0068857_100053144 3300005577 Bacteria 3594
97 Ga0068857_100073716 3300005577 Bacteria 3042
98 Ga0068857_100104335 3300005577 Bacteria 2545
99 Ga0068857_100296440 3300005577 Bacteria 1490
100 Ga0068857_100578711 3300005577 Bacteria 1060
101 Ga0068854_100000322 3300005578 Bacteria 31553
102 Ga0068854_100054275 3300005578 Bacteria 2881
103 Ga0068856_100004551 3300005614 Bacteria 13781
104 Ga0068856_100034764 3300005614 Bacteria 4938
105 Ga0068856_100260922 3300005614 Bacteria 1748
106 Ga0068852_100002126 3300005616 Bacteria 13576
107 Ga0068852_100002464 3300005616 Bacteria 12742
108 Ga0068852_100013111 3300005616 Bacteria 6332
109 Ga0068852_100020571 3300005616 Bacteria 5250
110 Ga0068852_100033295 3300005616 Bacteria 4277
111 Ga0068859_100000143 3300005617 Bacteria 67438
112 Ga0068859_100330267 3300005617 Bacteria 1619
113 Ga0068859_100364670 3300005617 Bacteria 1540
114 Ga0068859_100492521 3300005617 Bacteria 1321
115 Ga0068864_100007552 3300005618 Bacteria 8958
116 Ga0068864_100055380 3300005618 Bacteria 3424
117 Ga0068861_100400239 3300005719 Bacteria 1218
118 Ga0068863_100000014 3300005841 Bacteria 216135
119 Ga0068863_100055235 3300005841 Bacteria 3761
120 Ga0068863_100148142 3300005841 Bacteria 2246
121 Ga0068863_100271392 3300005841 Bacteria 1642
122 Ga0068858_100000451 3300005842 Bacteria 43046
123 Ga0068858_100016746 3300005842 Bacteria 6884
124 Ga0068858_100036714 3300005842 Bacteria 4544
125 Ga0068858_100047848 3300005842 Bacteria 3964
126 Ga0068858_100063744 3300005842 Bacteria 3410
127 Ga0068858_100686047 3300005842 Bacteria 996
128 Ga0068860_100000007 3300005843 Bacteria 429329
129 Ga0068860_100031345 3300005843 Bacteria 5110
130 Ga0068860_100117391 3300005843 Bacteria 2546
131 Ga0068862_100012958 3300005844 Bacteria 6898
132 Ga0068862_100299001 3300005844 Bacteria 1480
133 Ga0081455_10002011 3300005937 Bacteria 24306
134 Ga0081455_10008960 3300005937 Bacteria 10340
135 Ga0081455_10233157 3300005937 Bacteria 1357
136 Ga0081538_10041488 3300005981 Bacteria 2920
137 Ga0081538_10073583 3300005981 Bacteria 1866
138 Ga0081540_1002176 3300005983 Bacteria 16229
139 Ga0081540_1004082 3300005983 Bacteria 11301
140 Ga0081540_1011818 3300005983 Bacteria 5801
141 Ga0081540_1019729 3300005983 Bacteria 4083
142 Ga0081540_1021183 3300005983 Bacteria 3882
143 Ga0081540_1058979 3300005983 Bacteria 1845
144 Ga0081539_10000086 3300005985 Bacteria 217801
145 Ga0081539_10009839 3300005985 Bacteria 7895
146 Ga0070717_10005151 3300006028 Bacteria 9530
147 Ga0070717_10013624 3300006028 Bacteria 6239
148 Ga0070717_10023926 3300006028 Bacteria 4846
149 Ga0070717_10025226 3300006028 Bacteria 4726
150 Ga0070717_10047005 3300006028 Bacteria 3534
151 Ga0070717_10316430 3300006028 Bacteria 1390
152 Ga0075365_10001147 3300006038 Bacteria 11597
153 Ga0075368_10019969 3300006042 Bacteria 2533
154 Ga0070715_10054017 3300006163 Bacteria 1738
155 Ga0070716_100170113 3300006173 Bacteria 1421
156 Ga0070716_100177972 3300006173 Bacteria 1394
157 Ga0070712_100093484 3300006175 Bacteria 2207
158 Ga0070712_100287344 3300006175 Bacteria 1326
159 Ga0075362_10007481 3300006177 Bacteria 4139
160 Ga0075362_10029001 3300006177 Bacteria 2381
161 Ga0075362_10037872 3300006177 Bacteria 2116
162 Ga0075367_10001011 3300006178 Bacteria 11560
163 Ga0075367_10036329 3300006178 Bacteria 2856
164 Ga0075367_10065828 3300006178 Bacteria 2171
165 Ga0075369_10002056 3300006186 Bacteria 7096
166 Ga0075366_10001326 3300006195 Bacteria 12359
167 Ga0075366_10030068 3300006195 Bacteria 3192
168 Ga0075366_10080222 3300006195 Bacteria 1948
169 Ga0075370_10000739 3300006353 Bacteria 13026
170 Ga0075370_10004418 3300006353 Bacteria 6825
171 Ga0075370_10050113 3300006353 Bacteria 2368
172 Ga0075370_10145161 3300006353 Bacteria 1388
173 Ga0075370_10147046 3300006353 Bacteria 1380
174 Ga0075428_100004344 3300006844 Bacteria 15629
175 Ga0075428_100036276 3300006844 Bacteria 5432
176 Ga0075431_100248864 3300006847 Bacteria 1806
177 Ga0075429_100022391 3300006880 Bacteria 5480
178 Ga0075429_100352675 3300006880 Bacteria 1288
179 Ga0097620_100000143 3300006931 Bacteria 67438
180 Ga0097620_100330302 3300006931 Bacteria 1619
181 Ga0097620_100364653 3300006931 Bacteria 1540
182 Ga0097620_100492472 3300006931 Bacteria 1321
183 Ga0099794_10170411 3300007265 Bacteria 1109
184 Ga0099795_10052977 3300007788 Bacteria 1484
185 Ga0099795_10091523 3300007788 Bacteria 1180
186 Ga0105251_10164882 3300009011 Bacteria 999
187 Ga0105240_10023389 3300009093 Bacteria 8172
188 Ga0105240_10027768 3300009093 Bacteria 7406
189 Ga0105240_10047592 3300009093 Bacteria 5426
190 Ga0105240_10084950 3300009093 Bacteria 3879
191 Ga0105240_10094883 3300009093 Bacteria 3638
192 Ga0105240_10279136 3300009093 Bacteria 1920
193 Ga0105240_10352537 3300009093 Bacteria 1669
194 Ga0105240_10492903 3300009093 Bacteria 1364
195 Ga0105240_10874790 3300009093 Bacteria 968
196 Ga0111539_10002094 3300009094 Bacteria 26666
197 Ga0111539_10107858 3300009094 Bacteria 3268
198 Ga0105247_10168835 3300009101 Bacteria 1453
199 Ga0105247_10281234 3300009101 Bacteria 1148
200 Ga0114129_10001077 3300009147 Bacteria 35894
201 Ga0114129_10216271 3300009147 Bacteria 2588
202 Ga0105243_10505515 3300009148 Bacteria 1146
203 Ga0105243_10587666 3300009148 Bacteria 1070
204 Ga0105241_10000339 3300009174 Bacteria 35461
205 Ga0105241_10068257 3300009174 Bacteria 2754
206 Ga0105241_10172352 3300009174 Bacteria 1788
207 Ga0105241_10202966 3300009174 Bacteria 1657
208 Ga0105242_10406871 3300009176 Bacteria 1271
209 Ga0105248_10050024 3300009177 Bacteria 4687
210 Ga0105248_10087893 3300009177 Bacteria 3498
211 Ga0105248_10229572 3300009177 Bacteria 2089
212 Ga0105248_10559668 3300009177 Bacteria 1290
213 Ga0105237_10006725 3300009545 Bacteria 12702
214 Ga0105237_10018482 3300009545 Bacteria 7214
215 Ga0105238_10005126 3300009551 Bacteria 12952
216 Ga0105238_10006388 3300009551 Bacteria 11726
217 Ga0105238_10009753 3300009551 Bacteria 9616
218 Ga0105238_10025641 3300009551 Bacteria 6010
219 Ga0105238_10133623 3300009551 Bacteria 2459
220 Ga0105238_10180200 3300009551 Bacteria 2090
221 Ga0105238_10195413 3300009551 Bacteria 1999
222 Ga0105249_10008804 3300009553 Bacteria 8810
223 Ga0105030_107549 3300009987 Bacteria 924
224 Ga0105239_10008802 3300010375 Bacteria 11423
225 Ga0105239_10025558 3300010375 Bacteria 6500
226 Ga0105239_10166198 3300010375 Bacteria 2467
227 Ga0105239_10184028 3300010375 Bacteria 2338
228 Ga0105239_10204393 3300010375 Bacteria 2213
229 Ga0105239_10304977 3300010375 Bacteria 1794
230 Ga0105239_10545953 3300010375 Bacteria 1320
231 Ga0105239_10790882 3300010375 Bacteria 1087
232 Ga0105239_10809552 3300010375 Bacteria 1073
233 Ga0157373_10047529 3300013100 Bacteria 3061
234 Ga0157371_10000111 3300013102 Bacteria 123977
235 Ga0157370_10030067 3300013104 Bacteria 5324
236 Ga0157369_10000198 3300013105 Bacteria 84274
237 Ga0157369_10000547 3300013105 Bacteria 49435
238 Ga0157369_10016581 3300013105 Bacteria 8281
239 Ga0157369_10036200 3300013105 Bacteria 5409
240 Ga0157369_10242129 3300013105 Bacteria 1884
241 Ga0157369_10418597 3300013105 Bacteria 1389
242 Ga0157369_10429614 3300013105 Bacteria 1369
243 Ga0157369_10845726 3300013105 Bacteria 939
244 Ga0163162_10029661 3300013306 Bacteria 5416
245 Ga0163162_10070034 3300013306 Bacteria 3559
246 Ga0163162_10514409 3300013306 Bacteria 1327
247 Ga0163162_10877805 3300013306 Bacteria 1011
248 Ga0157372_10831096 3300013307 Bacteria 1073
249 Ga0163163_10009652 3300014325 Bacteria 8632
250 Ga0163163_10051764 3300014325 Bacteria 4048
251 Ga0163163_10073929 3300014325 Bacteria 3399
252 Ga0163163_10353821 3300014325 Bacteria 1525
253 Ga0157380_10000486 3300014326 Bacteria 24146
254 Ga0157380_10494064 3300014326 Bacteria 1187
255 Ga0182008_10004538 3300014497 Bacteria 8102
256 Ga0157379_10000433 3300014968 Bacteria 33887
257 Ga0157379_10013089 3300014968 Bacteria 7265
258 Ga0157379_10405517 3300014968 Bacteria 1254
259 Ga0163161_10199378 3300017792 Bacteria 1542
260 Ga0197907_10093668 3300020069 Bacteria 1879
261 Ga0206354_10117369 3300020081 Bacteria 1625
262 Ga0206353_10353987 3300020082 Bacteria 6015
263 Ga0206353_11308596 3300020082 Bacteria 1120
264 Ga0213876_10001894 3300021384 Bacteria 12588
265 Ga0213875_10000174 3300021388 Bacteria 67979
266 Ga0213875_10000232 3300021388 Bacteria 56352
267 Ga0213875_10015157 3300021388 Bacteria 3753
268 Ga0213871_10000400 3300021441 Bacteria 5764
269 Ga0213871_10035768 3300021441 Bacteria 1315
270 Ga0224712_10000029 3300022467 Bacteria 21520
271 Ga0209026_1001238 3300025250 Bacteria 11686
272 Ga0209759_1000200 3300025256 Bacteria 94590
273 Ga0209676_1006255 3300025292 Bacteria 5927
274 Ga0209564_1007173 3300025295 Bacteria 5809
275 Ga0209758_1000015 3300025297 Bacteria 851943
276 Ga0209758_1005611 3300025297 Bacteria 9533
277 Ga0209050_1000034 3300025298 Bacteria 433906
278 Ga0209050_1006150 3300025298 Bacteria 7224
279 Ga0207426_1000007 3300025302 Bacteria 971011
280 Ga0209051_1008353 3300025303 Bacteria 5491
281 Ga0209257_1000052 3300025304 Bacteria 430947
282 Ga0209257_1000100 3300025304 Bacteria 253399
283 Ga0207697_10106647 3300025315 Bacteria 1197
284 Ga0207656_10001030 3300025321 Bacteria 9097
285 Ga0207713_1000089 3300025735 Bacteria 152927
286 Ga0207713_1000106 3300025735 Bacteria 137911
287 Ga0207713_1106991 3300025735 Bacteria 956
288 Ga0207692_10355258 3300025898 Bacteria 904
289 Ga0207710_10000319 3300025900 Bacteria 36927
290 Ga0207680_10022475 3300025903 Bacteria 3430
291 Ga0207680_10047043 3300025903 Bacteria 2554
292 Ga0207680_10057382 3300025903 Bacteria 2355
293 Ga0207647_10003157 3300025904 Bacteria 12363
294 Ga0207647_10003676 3300025904 Bacteria 11480
295 Ga0207647_10011500 3300025904 Bacteria 6205
296 Ga0207647_10047293 3300025904 Bacteria 2677
297 Ga0207685_10027520 3300025905 Bacteria 1991
298 Ga0207699_10019984 3300025906 Bacteria 3581
299 Ga0207645_10100473 3300025907 Bacteria 1866
300 Ga0207705_10000007 3300025909 Bacteria 597387
301 Ga0207705_10002837 3300025909 Bacteria 13262
302 Ga0207705_10010305 3300025909 Bacteria 6798
303 Ga0207705_10135889 3300025909 Bacteria 1833
304 Ga0207684_10001662 3300025910 Bacteria 23646
305 Ga0207684_10004845 3300025910 Bacteria 12593
306 Ga0207684_10025209 3300025910 Bacteria 5069
307 Ga0207654_10001428 3300025911 Bacteria 12679
308 Ga0207654_10040325 3300025911 Bacteria 2631
309 Ga0207654_10084065 3300025911 Bacteria 1923
310 Ga0207654_10182706 3300025911 Bacteria 1369
311 Ga0207654_10211128 3300025911 Bacteria 1283
312 Ga0207707_10088306 3300025912 Bacteria 2708
313 Ga0207707_10094095 3300025912 Bacteria 2618
314 Ga0207695_10001225 3300025913 Bacteria 43972
315 Ga0207695_10009783 3300025913 Bacteria 11789
316 Ga0207695_10015634 3300025913 Bacteria 8926
317 Ga0207695_10017841 3300025913 Bacteria 8227
318 Ga0207695_10021230 3300025913 Bacteria 7415
319 Ga0207695_10332928 3300025913 Bacteria 1407
320 Ga0207671_10000676 3300025914 Bacteria 44438
321 Ga0207671_10004835 3300025914 Bacteria 12685
322 Ga0207671_10047020 3300025914 Bacteria 3193
323 Ga0207671_10256642 3300025914 Bacteria 1375
324 Ga0207693_10002285 3300025915 Bacteria 16669
325 Ga0207693_10003067 3300025915 Bacteria 14409
326 Ga0207693_10003289 3300025915 Bacteria 13837
327 Ga0207693_10043926 3300025915 Bacteria 3512
328 Ga0207693_10087320 3300025915 Bacteria 2444
329 Ga0207693_10139029 3300025915 Bacteria 1910
330 Ga0207693_10371239 3300025915 Bacteria 1119
331 Ga0207663_10025128 3300025916 Bacteria 3439
332 Ga0207663_10160007 3300025916 Bacteria 1588
333 Ga0207663_10161026 3300025916 Bacteria 1584
334 Ga0207663_10372360 3300025916 Bacteria 1086
335 Ga0207660_10031804 3300025917 Bacteria 3638
336 Ga0207660_10074211 3300025917 Bacteria 2482
337 Ga0207657_10000074 3300025919 Bacteria 93185
338 Ga0207649_10000887 3300025920 Bacteria 18902
339 Ga0207649_10232619 3300025920 Bacteria 1319
340 Ga0207649_10399980 3300025920 Bacteria 1027
341 Ga0207652_10082928 3300025921 Bacteria 2806
342 Ga0207652_10227755 3300025921 Bacteria 1680
343 Ga0207652_10406166 3300025921 Bacteria 1229
344 Ga0207646_10001152 3300025922 Bacteria 33668
345 Ga0207646_10007222 3300025922 Bacteria 11334
346 Ga0207646_10011833 3300025922 Bacteria 8422
347 Ga0207681_10084247 3300025923 Bacteria 2253
348 Ga0207681_10184892 3300025923 Bacteria 1590
349 Ga0207694_10005711 3300025924 Bacteria 9536
350 Ga0207694_10023461 3300025924 Bacteria 4683
351 Ga0207694_10032894 3300025924 Bacteria 3972
352 Ga0207694_10051497 3300025924 Bacteria 3191
353 Ga0207694_10342879 3300025924 Bacteria 1236
354 Ga0207650_10200910 3300025925 Bacteria 1597
355 Ga0207650_10363604 3300025925 Bacteria 1192
356 Ga0207650_10371411 3300025925 Bacteria 1180
357 Ga0207687_10006212 3300025927 Bacteria 7912
358 Ga0207700_10031095 3300025928 Bacteria 3789
359 Ga0207700_10115729 3300025928 Bacteria 2166
360 Ga0207700_10140905 3300025928 Bacteria 1981
361 Ga0207700_10298719 3300025928 Bacteria 1390
362 Ga0207664_10103574 3300025929 Bacteria 2355
363 Ga0207664_10385054 3300025929 Bacteria 1245
364 Ga0207644_10005965 3300025931 Bacteria 7942
365 Ga0207644_10060702 3300025931 Bacteria 2736
366 Ga0207644_10272837 3300025931 Bacteria 1356
367 Ga0207690_10000840 3300025932 Bacteria 19665
368 Ga0207706_10097255 3300025933 Bacteria 2589
369 Ga0207706_10201795 3300025933 Bacteria 1744
370 Ga0207709_10351115 3300025935 Bacteria 1113
371 Ga0207665_10315194 3300025939 Bacteria 1172
372 Ga0207711_10086634 3300025941 Bacteria 2747
373 Ga0207711_10149795 3300025941 Bacteria 2105
374 Ga0207711_10151905 3300025941 Bacteria 2090
375 Ga0207711_10186561 3300025941 Bacteria 1888
376 Ga0207689_10548658 3300025942 Bacteria 971
377 Ga0207661_10045130 3300025944 Bacteria 3486
378 Ga0207667_10000004 3300025949 Bacteria 737718
379 Ga0207667_10016679 3300025949 Bacteria 8290
380 Ga0207667_10039999 3300025949 Bacteria 4992
381 Ga0207667_10044253 3300025949 Bacteria 4719
382 Ga0207651_10303898 3300025960 Bacteria 1328
383 Ga0207712_10015813 3300025961 Bacteria 4874
384 Ga0207712_10165948 3300025961 Bacteria 1721
385 Ga0207712_10565026 3300025961 Bacteria 980
386 Ga0207668_10353311 3300025972 Bacteria 1230
387 Ga0207668_10518562 3300025972 Bacteria 1028
388 Ga0207640_10000501 3300025981 Bacteria 23670
389 Ga0207640_10002751 3300025981 Bacteria 9410
390 Ga0207640_10170383 3300025981 Bacteria 1622
391 Ga0207658_10002723 3300025986 Bacteria 12767
392 Ga0207658_10003671 3300025986 Bacteria 10821
393 Ga0207658_10019163 3300025986 Bacteria 4731
394 Ga0207658_10098964 3300025986 Bacteria 2280
395 Ga0207658_10131844 3300025986 Bacteria 2009
396 Ga0207658_10439171 3300025986 Bacteria 1154
397 Ga0207677_10195743 3300026023 Bacteria 1602
398 Ga0207703_10009191 3300026035 Bacteria 7775
399 Ga0207703_10025731 3300026035 Bacteria 4630
400 Ga0207703_10030722 3300026035 Bacteria 4245
401 Ga0207703_10050958 3300026035 Bacteria 3353
402 Ga0207703_10628927 3300026035 Bacteria 1017
403 Ga0207639_10012292 3300026041 Bacteria 5961
404 Ga0207639_10261753 3300026041 Bacteria 1513
405 Ga0207678_10000056 3300026067 Bacteria 86903
406 Ga0207708_10010222 3300026075 Bacteria 6967
407 Ga0207708_10211392 3300026075 Bacteria 1551
408 Ga0207702_10000087 3300026078 Bacteria 105856
409 Ga0207702_10040449 3300026078 Bacteria 3908
410 Ga0207702_10569186 3300026078 Bacteria 1110
411 Ga0207641_10000126 3300026088 Bacteria 112607
412 Ga0207641_10017244 3300026088 Bacteria 5911
413 Ga0207641_10018234 3300026088 Bacteria 5753
414 Ga0207641_10038781 3300026088 Bacteria 3984
415 Ga0207641_10061761 3300026088 Bacteria 3196
416 Ga0207641_10558868 3300026088 Bacteria 1117
417 Ga0207648_10395532 3300026089 Bacteria 1251
418 Ga0207648_10437349 3300026089 Bacteria 1189
419 Ga0207676_10025201 3300026095 Bacteria 4412
420 Ga0207676_10243871 3300026095 Bacteria 1614
421 Ga0207674_10000121 3300026116 Bacteria 90479
422 Ga0207674_10039575 3300026116 Bacteria 4886
423 Ga0207674_10091441 3300026116 Bacteria 3033
424 Ga0207674_10104804 3300026116 Bacteria 2806
425 Ga0207675_100071634 3300026118 Bacteria 3241
426 Ga0207675_100308679 3300026118 Bacteria 1542
427 Ga0207683_10157769 3300026121 Bacteria 2050
428 Ga0207698_10000305 3300026142 Bacteria 29478
429 Ga0207698_10003375 3300026142 Bacteria 9621
430 Ga0207698_10009101 3300026142 Bacteria 6310
431 Ga0207698_10041936 3300026142 Bacteria 3415
432 Ga0209371_1004269 3300027312 Bacteria 6343
433 Ga0209813_10069741 3300027866 Bacteria 1140
434 Ga0207428_10004927 3300027907 Bacteria 12576
435 Ga0268266_10011284 3300028379 Bacteria 7776
436 Ga0268266_10090088 3300028379 Bacteria 2688
437 Ga0268266_10138059 3300028379 Bacteria 2185
438 Ga0268266_10150346 3300028379 Bacteria 2098
439 Ga0268266_10239784 3300028379 Bacteria 1673
440 Ga0268266_10629968 3300028379 Bacteria 1031
441 Ga0268265_10008961 3300028380 Bacteria 6767
442 Ga0268265_10068124 3300028380 Bacteria 2758
443 Ga0268265_10344328 3300028380 Bacteria 1359
444 Ga0268264_10000077 3300028381 Bacteria 252597
445 Ga0268264_10015126 3300028381 Bacteria 6329
446 Ga0268264_10033435 3300028381 Bacteria 4224
447 Ga0265337_1042720 3300028556 Bacteria 1299
448 Ga0265334_10033254 3300028573 Bacteria 2053
449 Ga0307515_10000572 3300028794 Bacteria 86935
450 Ga0307515_10112782 3300028794 Bacteria 3159
451 Ga0307515_10176873 3300028794 Bacteria 2101
452 Ga0265338_10000335 3300028800 Bacteria 85548
453 Ga0265338_10000344 3300028800 Bacteria 84742
454 Ga0265338_10025382 3300028800 Bacteria 6015
455 Ga0265338_10097071 3300028800 Bacteria 2415
456 Ga0265324_10065890 3300029957 Bacteria 1236
457 Ga0268256_1002337 3300030500 Bacteria 9777
458 Ga0265332_10009960 3300031238 Bacteria 4235
459 Ga0265325_10000379 3300031241 Bacteria 31331
460 Ga0265325_10002671 3300031241 Bacteria 11936
461 Ga0265340_10105954 3300031247 Bacteria 1303
462 Ga0265339_10003924 3300031249 Bacteria 10292
463 Ga0265327_10001877 3300031251 Bacteria 24307
464 Ga0265316_10057905 3300031344 Bacteria 3020
465 Ga0265316_10093549 3300031344 Bacteria 2291
466 Ga0307513_10008709 3300031456 Bacteria 12925
467 Ga0307513_10077630 3300031456 Bacteria 3438
468 Ga0307513_10102556 3300031456 Bacteria 2880
469 Ga0307513_10259565 3300031456 Bacteria 1528
470 Ga0307408_100000381 3300031548 Bacteria 40487
471 Ga0307408_100251625 3300031548 Bacteria 1457
472 Ga0265313_10000678 3300031595 Bacteria 35090
473 Ga0265313_10011566 3300031595 Bacteria 5473
474 Ga0265342_10086380 3300031712 Bacteria 1804
475 Ga0307516_10000363 3300031730 Bacteria 59029
476 Ga0307516_10007858 3300031730 Bacteria 12157
477 Ga0307405_10085526 3300031731 Bacteria 2073
478 Ga0307406_10003961 3300031901 Bacteria 8049
479 Ga0307412_10002104 3300031911 Bacteria 11059
480 Ga0307412_10003319 3300031911 Bacteria 8939
481 Ga0307412_10011660 3300031911 Bacteria 5098
482 Ga0307412_10013244 3300031911 Bacteria 4828
483 Ga0307409_100474572 3300031995 Bacteria 1212
484 Ga0307416_100037381 3300032002 Bacteria 3735
485 Ga0307414_10000185 3300032004 Bacteria 42230
486 Ga0307411_10030158 3300032005 Bacteria 3322
487 Ga0307411_10080833 3300032005 Bacteria 2236
488 Ga0307411_10256427 3300032005 Bacteria 1378
489 Ga0307415_100121409 3300032126 Bacteria 1960
490 Ga0373928_0027165 3300035084 Bacteria 1244
491 Ga0373934_0090841 3300035086 Bacteria 1231
492 Ga0373940_0002375 3300035088 Bacteria 3648
493 Ga0373944_0000063 3300035089 Bacteria 17796
494 Ga0373923_0060121 3300035111 Bacteria 1612
495 Ga0373932_0005235 3300035112 Bacteria 3049
496 Ga0373936_0000095 3300035113 Bacteria 32094
497 Ga0373939_0003794 3300035114 Bacteria 3565
498 Ga0373945_0000118 3300035116 Bacteria 19368
499 Ga0373957_0099795 3300035120 Bacteria 1161
500 Ga0373960_0015609 3300035121 Bacteria 1941
501 Ga0373943_0000007 3300035170 Bacteria 72018
502 Ga0373946_0000003 3300035171 Bacteria 72620
503 Ga0373955_0018262 3300035172 Bacteria 3485
504 Ga0373955_0050854 3300035172 Bacteria 2255
505 Ga0373955_0221080 3300035172 Bacteria 1131
506 Ga0373961_0004204 3300035241 Bacteria 3495
507 Ga0316574_0114321 3300035398 Bacteria 1731
508 Ga0373924_0134631 3300035410 Bacteria 1076
509 Ga0373931_0016291 3300035691 Bacteria 3657
510 Ga0373935_0000016 3300035692 Bacteria 71558
511 Ga0373927_0000211 3300035695 Bacteria 46349
512 Ga0373927_0073526 3300035695 Bacteria 2213
513 Ga0373933_0114817 3300035724 Bacteria 1682
514 Ga0373933_0125223 3300035724 Bacteria 1612
515 Ga0373933_0209356 3300035724 Bacteria 1249
516 Ga0373933_0265132 3300035724 Bacteria 1108
517 Ga0373947_0000043 3300035725 Bacteria 62167
518 Ga0373937_0001887 3300036401 Bacteria 17603
519 Ga0373937_0181016 3300036401 Bacteria 1979
520 Ga0373937_0385446 3300036401 Bacteria 1329
521 Ga0373925_0001599 3300037068 Bacteria 19132
522 Ga0373925_0022030 3300037068 Bacteria 4644
523 Ga0373925_0208373 3300037068 Bacteria 1557
524 Ga0373925_0420146 3300037068 Bacteria 1092
525 Ga0395899_0001978 3300037312 Bacteria 16855
526 Ga0395899_0039445 3300037312 Bacteria 3534
527 Ga0395899_0099922 3300037312 Bacteria 2095
528 Ga0395899_0140119 3300037312 Bacteria 1721
529 Ga0395900_0000057 3300037418 Bacteria 212535
530 Ga0395900_0044617 3300037418 Bacteria 4567
531 Ga0395900_0063627 3300037418 Bacteria 3792
532 Ga0395900_0064451 3300037418 Bacteria 3765
533 Ga0395900_0131844 3300037418 Bacteria 2561
534 Ga0395900_0400164 3300037418 Bacteria 1337
535 Ga0395898_0006875 3300037466 Bacteria 12100
536 Ga0395898_0014912 3300037466 Bacteria 7979
537 Ga0395898_0022982 3300037466 Bacteria 6305
538 Ga0395898_0153086 3300037466 Bacteria 2206
539 Ga0395898_0154961 3300037466 Bacteria 2191
540 Ga0395898_0434618 3300037466 Bacteria 1251
541 Ga0395905_0000014 3300037471 Bacteria 394209
542 Ga0395905_0015473 3300037471 Bacteria 7252
543 Ga0395905_0070355 3300037471 Bacteria 3278
544 Ga0395905_0121573 3300037471 Bacteria 2454
545 Ga0395905_0270759 3300037471 Bacteria 1584
546 Ga0395905_0598262 3300037471 Bacteria 1005
547 Ga0436364_0025729 3300037853 Bacteria 1159
548 Ga0436364_0676163 3300037853 Bacteria 64006
549 Ga0436364_0990344 3300037853 Bacteria 56392
550 Ga0436364_1004440 3300037853 Bacteria 13846
551 Ga0436364_1213864 3300037853 Bacteria 5463
552 Ga0436364_1238375 3300037853 Bacteria 10591
553 Ga0395901_0000002 3300038443 Bacteria 761045
554 Ga0395901_0000113 3300038443 Bacteria 110398
555 Ga0395901_0000177 3300038443 Bacteria 82539
556 Ga0395901_0001952 3300038443 Bacteria 21231
557 Ga0395901_0010068 3300038443 Bacteria 9581
558 Ga0395901_0010514 3300038443 Bacteria 9372
559 Ga0395901_0019615 3300038443 Bacteria 6911
560 Ga0395901_0021996 3300038443 Bacteria 6536
561 Ga0395901_0064667 3300038443 Bacteria 3807
562 Ga0395901_0475085 3300038443 Bacteria 1276
563 Ga0436365_0145774 3300039437 Bacteria 9949
564 Ga0436365_0473069 3300039437 Bacteria 25772
565 Ga0436365_0785175 3300039437 Bacteria 2765
566 Ga0436365_0885104 3300039437 Bacteria 3802
567 Ga0436365_1254597 3300039437 Bacteria 1638
568 Ga0436360_0148685 3300039438 Bacteria 1862
569 Ga0436360_0315794 3300039438 Bacteria 2765
570 Ga0436360_0415711 3300039438 Bacteria 1119
571 Ga0436360_0777953 3300039438 Bacteria 5974
572 Ga0436360_1255737 3300039438 Bacteria 4195
573 Ga0436360_1340002 3300039438 Bacteria 2063
574 Ga0436360_1356287 3300039438 Bacteria 2491
575 Ga0436361_0221853 3300039447 Bacteria 1255
576 Ga0436361_0460638 3300039447 Bacteria 1781
577 Ga0436361_0662945 3300039447 Bacteria 966
578 Ga0436361_0740576 3300039447 Bacteria 4062
579 Ga0436361_0912408 3300039447 Bacteria 896
580 Ga0436361_1010833 3300039447 Bacteria 2438
581 Ga0436363_0150078 3300039450 Bacteria 3393
582 Ga0436363_0274442 3300039450 Bacteria 2346
583 Ga0436363_0692852 3300039450 Bacteria 2097
584 Ga0436363_0877931 3300039450 Bacteria 3589
585 Ga0436363_1479055 3300039450 Bacteria 1669
586 Ga0436363_1498526 3300039450 Bacteria 2959
587 Ga0436362_0557887 3300039453 Bacteria 2601
588 Ga0436362_0783295 3300039453 Bacteria 4917
589 Ga0436362_0992540 3300039453 Bacteria 1395
590 Ga0436362_1084147 3300039453 Bacteria 1364
591 Ga0439436_0000964 3300041404 Bacteria 7952
592 Ga0439436_0006549 3300041404 Bacteria 3577
593 Ga0439438_016077 3300041405 Bacteria 2183
594 Ga0439439_0004111 3300041406 Bacteria 3254
595 Ga0439447_000125 3300041407 Bacteria 26154
596 Ga0439453_0035731 3300041408 Bacteria 958
597 Ga0439466_0010789 3300041411 Bacteria 3392
598 Ga0451833_1041486 3300041491 Bacteria 2699
599 Ga0451839_0251557 3300041496 Bacteria 1773
600 Ga0451841_0086406 3300041498 Bacteria 3211
601 Ga0451843_1359299 3300041509 Bacteria 1338
602 Ga0451853_0230220 3300041512 Bacteria 1603
603 Ga0439431_0017259 3300041997 Bacteria 1695
604 Ga0439433_0004061 3300041999 Bacteria 3145
605 Ga0439448_0136916 3300042005 Bacteria 846
606 Ga0439449_0000112 3300042007 Bacteria 26557
607 Ga0439449_0002521 3300042007 Bacteria 7153
608 Ga0439452_006772 3300042010 Bacteria 3562
609 Ga0439454_009380 3300042011 Bacteria 1269
610 Ga0439456_001624 3300042013 Bacteria 4537
611 Ga0439462_0025976 3300042015 Bacteria 1542
612 Ga0450923_011270 3300042125 Bacteria 1605
613 Ga0450897_005192 3300042128 Bacteria 1120
614 Ga0450894_001878 3300042131 Bacteria 2910
615 Ga0450896_006912 3300042133 Bacteria 1561
616 Ga0450903_002830 3300042138 Bacteria 3041
617 Ga0450904_004984 3300042139 Bacteria 1360
618 Ga0450906_006297 3300042145 Bacteria 2402
619 Ga0439446_0008817 3300042156 Bacteria 2689
620 Ga0439446_0013665 3300042156 Bacteria 2231
621 Ga0439446_0032048 3300042156 Bacteria 1523
622 Ga0439458_0063612 3300042157 Bacteria 924
623 Ga0450909_005880 3300042185 Bacteria 1769
624 Ga0439434_0005729 3300042435 Bacteria 3627
625 Ga0439434_0026127 3300042435 Bacteria 1763
626 Ga0439434_0050534 3300042435 Bacteria 1288
627 Ga0439464_0001842 3300042439 Bacteria 5120
628 Ga0450893_0005053 3300042532 Bacteria 2108
629 Ga0451577_0640608 3300042876 Bacteria 964
630 Ga0466969_0012592 3300044656 Bacteria 4458
631 Ga0466969_0051183 3300044656 Bacteria 2033
632 Ga0466972_0021071 3300044658 Bacteria 3254
633 Ga0466965_0030838 3300044683 Bacteria 2613
634 Ga0466966_0000006 3300044684 Bacteria 179770
635 Ga0466966_0001397 3300044684 Bacteria 15522
636 Ga0466966_0005729 3300044684 Bacteria 8177
637 Ga0466966_0026838 3300044684 Bacteria 3758
638 Ga0466966_0064567 3300044684 Bacteria 2304
639 Ga0466966_0147501 3300044684 Bacteria 1436
640 Ga0466961_0000799 3300044693 Bacteria 19647
641 Ga0466961_0046823 3300044693 Bacteria 2765
642 Ga0466963_0000688 3300044694 Bacteria 16430
643 Ga0466963_0031591 3300044694 Bacteria 3424
644 Ga0466963_0035811 3300044694 Bacteria 3234
645 Ga0466964_0000862 3300044706 Bacteria 9932
646 Ga0466971_0003183 3300044719 Bacteria 7007
647 Ga0466971_0093519 3300044719 Bacteria 1378
648 Ga0466957_0042055 3300044842 Bacteria 2764
649 Ga0466957_0049190 3300044842 Bacteria 2563
650 Ga0466957_0052427 3300044842 Bacteria 2484
651 Ga0466957_0162002 3300044842 Bacteria 1453
652 Ga0466959_0056076 3300045049 Bacteria 2875
653 Ga0466959_0085002 3300045049 Bacteria 2277
654 Ga0466959_0192552 3300045049 Bacteria 1422
655 Ga0466958_0008929 3300045836 Bacteria 5569
656 Ga0466967_0032091 3300045976 Bacteria 4431
657 Ga0466967_0040743 3300045976 Bacteria 4000
658 Ga0466967_0050170 3300045976 Bacteria 3653
659 Ga0466967_0631021 3300045976 Bacteria 1059
660 Ga0495592_0020483 3300046454 Bacteria 5030
661 Ga0495592_0115372 3300046454 Bacteria 1896
662 Ga0495603_0044634 3300046455 Bacteria 2644
663 Ga0495603_0172096 3300046455 Bacteria 1254
664 Ga0495590_0050981 3300046457 Bacteria 1445
665 Ga0495591_000634 3300046458 Bacteria 26050
666 Ga0495629_0000041 3300046459 Bacteria 115135
667 Ga0495629_0002085 3300046459 Bacteria 15511
668 Ga0495629_0006466 3300046459 Bacteria 8679
669 Ga0495629_0020326 3300046459 Bacteria 4742
670 Ga0495629_0023121 3300046459 Bacteria 4429
671 Ga0495638_0001336 3300046460 Bacteria 22627
672 Ga0495638_0009586 3300046460 Bacteria 6778
673 Ga0495641_0003952 3300046461 Bacteria 10770
674 Ga0495641_0013087 3300046461 Bacteria 4587
675 Ga0495651_0059416 3300046462 Bacteria 2932
676 Ga0495651_0069388 3300046462 Bacteria 2685
677 Ga0495651_0112435 3300046462 Bacteria 2012
678 Ga0495651_0159935 3300046462 Bacteria 1615
679 Ga0495653_0000217 3300046463 Bacteria 46686
680 Ga0495653_0001593 3300046463 Bacteria 17817
681 Ga0495653_0002973 3300046463 Bacteria 13572
682 Ga0495653_0009568 3300046463 Bacteria 7927
683 Ga0495653_0083664 3300046463 Bacteria 2352
684 Ga0495650_0010210 3300046471 Bacteria 5255
685 Ga0495650_0017107 3300046471 Bacteria 3647
686 Ga0495580_0000292 3300046472 Bacteria 40782
687 Ga0495580_0001078 3300046472 Bacteria 23945
688 Ga0495580_0002641 3300046472 Bacteria 15569
689 Ga0495580_0003482 3300046472 Bacteria 13402
690 Ga0495580_0030630 3300046472 Bacteria 3894
691 Ga0495580_0057182 3300046472 Bacteria 2745
692 Ga0495580_0167103 3300046472 Bacteria 1521
693 Ga0495582_0002227 3300046473 Bacteria 10858
694 Ga0495582_0211155 3300046473 Bacteria 1109
695 Ga0495605_0017241 3300046474 Bacteria 3892
696 Ga0495605_0044902 3300046474 Bacteria 2181
697 Ga0495605_0103109 3300046474 Bacteria 1309
698 Ga0495639_0004269 3300046475 Bacteria 6130
699 Ga0495639_0078147 3300046475 Bacteria 1537
700 Ga0495662_0008395 3300046476 Bacteria 5080
701 Ga0495662_0020078 3300046476 Bacteria 3233
702 Ga0495662_0095520 3300046476 Bacteria 1452
703 Ga0495664_0000109 3300046477 Bacteria 40957
704 Ga0495664_0049115 3300046477 Bacteria 2505
705 Ga0495664_0053210 3300046477 Bacteria 2407
706 Ga0495664_0061462 3300046477 Bacteria 2236
707 Ga0495584_0023741 3300046491 Bacteria 3109
708 Ga0495584_0139920 3300046491 Bacteria 1229
709 Ga0495594_0068921 3300046499 Bacteria 1965
710 Ga0495596_0001846 3300046500 Bacteria 11754
711 Ga0495596_0053225 3300046500 Bacteria 1584
712 Ga0495596_0070611 3300046500 Bacteria 1357
713 Ga0495583_0000481 3300046506 Bacteria 58360
714 Ga0495583_0003634 3300046506 Bacteria 11523
715 Ga0495606_0004722 3300046507 Bacteria 13426
716 Ga0495608_0005018 3300046511 Bacteria 9470
717 Ga0495608_0018548 3300046511 Bacteria 4797
718 Ga0495616_0069622 3300046513 Bacteria 1705
719 Ga0495618_0002705 3300046514 Bacteria 11297
720 Ga0495618_0025581 3300046514 Bacteria 3663
721 Ga0495618_0267306 3300046514 Bacteria 1070
722 Ga0495628_0010428 3300046516 Bacteria 7894
723 Ga0495628_0086625 3300046516 Bacteria 2428
724 Ga0495628_0094397 3300046516 Bacteria 2312
725 Ga0495630_0004630 3300046517 Bacteria 9648
726 Ga0495630_0006315 3300046517 Bacteria 8418
727 Ga0495630_0039120 3300046517 Bacteria 3547
728 Ga0495630_0041362 3300046517 Bacteria 3441
729 Ga0495630_0048964 3300046517 Bacteria 3163
730 Ga0495630_0467579 3300046517 Bacteria 966
731 Ga0495630_0589678 3300046517 Bacteria 852
732 Ga0495644_0029101 3300046523 Bacteria 2088
733 Ga0495648_0008757 3300046524 Bacteria 7922
734 Ga0495648_0013472 3300046524 Bacteria 6040
735 Ga0495648_0068281 3300046524 Bacteria 2074
736 Ga0495666_0002166 3300046526 Bacteria 9767
737 Ga0495666_0003060 3300046526 Bacteria 8407
738 Ga0495666_0011032 3300046526 Bacteria 4508
739 Ga0495652_0001202 3300046529 Bacteria 28975
740 Ga0495652_0004403 3300046529 Bacteria 13464
741 Ga0495652_0048754 3300046529 Bacteria 3627
742 Ga0495652_0353452 3300046529 Bacteria 1052
743 Ga0495665_0000102 3300046531 Bacteria 39799
744 Ga0495665_0014425 3300046531 Bacteria 4262
745 Ga0495665_0018926 3300046531 Bacteria 3701
746 Ga0495665_0025941 3300046531 Bacteria 3147
747 Ga0495665_0081594 3300046531 Bacteria 1700
748 Ga0495665_0099712 3300046531 Bacteria 1524
749 Ga0495640_0001811 3300046533 Bacteria 16954
750 Ga0495640_0014737 3300046533 Bacteria 5905
751 Ga0495640_0259715 3300046533 Bacteria 1086
752 Ga0495586_0019191 3300046535 Bacteria 3637
753 Ga0495586_0084649 3300046535 Bacteria 1746
754 Ga0495587_0003529 3300046536 Bacteria 10412
755 Ga0495609_0045483 3300046538 Bacteria 1967
756 Ga0495609_0151274 3300046538 Bacteria 987
757 Ga0495645_0001558 3300046543 Bacteria 15523
758 Ga0495645_0062903 3300046543 Bacteria 2687
759 Ga0495645_0078600 3300046543 Bacteria 2371
760 Ga0495645_0145426 3300046543 Bacteria 1651
761 Ga0495622_0000222 3300046557 Bacteria 44989
762 Ga0495667_0002040 3300046559 Bacteria 13389
763 Ga0495667_0026878 3300046559 Bacteria 3878
764 Ga0495634_0004254 3300046642 Bacteria 11290
765 Ga0495634_0008269 3300046642 Bacteria 7757
766 Ga0495634_0051889 3300046642 Bacteria 2751
767 Ga0495634_0216778 3300046642 Bacteria 1183
768 Ga0495611_0028429 3300046648 Bacteria 2448
769 Ga0495625_0019320 3300046660 Bacteria 5290
770 Ga0495625_0067078 3300046660 Bacteria 2526
771 Ga0495625_0106321 3300046660 Bacteria 1922
772 Ga0495635_0000852 3300046663 Bacteria 19966
773 Ga0495635_0001046 3300046663 Bacteria 18351
774 Ga0495635_0003763 3300046663 Bacteria 10531
775 Ga0495635_0009347 3300046663 Bacteria 6851
776 Ga0495635_0009844 3300046663 Bacteria 6683
777 Ga0495661_0001184 3300046665 Bacteria 22639
778 Ga0495661_0003822 3300046665 Bacteria 11017
779 Ga0495661_0094341 3300046665 Bacteria 1696
780 Ga0495588_0008163 3300046674 Bacteria 4793
781 Ga0495588_0079984 3300046674 Bacteria 1706
782 Ga0495588_0181920 3300046674 Bacteria 1111
783 Ga0495657_0086894 3300046675 Bacteria 2013
784 Ga0495657_0096914 3300046675 Bacteria 1884
785 Ga0495599_0007923 3300046678 Bacteria 6444
786 Ga0495599_0032059 3300046678 Bacteria 3298
787 Ga0495599_0067451 3300046678 Bacteria 2234
788 Ga0495599_0101840 3300046678 Bacteria 1790
789 Ga0495623_0029735 3300046679 Bacteria 3515
790 Ga0495623_0049423 3300046679 Bacteria 2665
791 Ga0495623_0097012 3300046679 Bacteria 1800
792 Ga0495646_0000546 3300046680 Bacteria 20295
793 Ga0495646_0003447 3300046680 Bacteria 9840
794 Ga0495646_0011537 3300046680 Bacteria 5610
795 Ga0495646_0046302 3300046680 Bacteria 2652
796 Ga0495646_0155539 3300046680 Bacteria 1269
797 Ga0495647_0107770 3300046681 Bacteria 1160
798 Ga0495613_0007648 3300046689 Bacteria 8041
799 Ga0495613_0019016 3300046689 Bacteria 5118
800 Ga0495613_0124455 3300046689 Bacteria 1850
801 Ga0495613_0126889 3300046689 Bacteria 1829
802 Ga0495624_0000067 3300046690 Bacteria 66836
803 Ga0495624_0002416 3300046690 Bacteria 14187
804 Ga0495624_0008750 3300046690 Bacteria 7044
805 Ga0495624_0019355 3300046690 Bacteria 4546
806 Ga0495671_0021569 3300046692 Bacteria 3381
807 Ga0495671_0080716 3300046692 Bacteria 1594
808 Ga0495671_0102524 3300046692 Bacteria 1398
809 Ga0495649_0030084 3300046694 Bacteria 2999
810 Ga0495649_0068173 3300046694 Bacteria 1909
811 Ga0495589_0006991 3300046794 Bacteria 5919
812 Ga0495589_0026849 3300046794 Bacteria 2916
813 Ga0495600_0003130 3300046809 Bacteria 9689
814 Ga0495600_0017324 3300046809 Bacteria 4581
815 Ga0495581_0000839 3300047315 Bacteria 16361
816 Ga0495581_0006036 3300047315 Bacteria 7021
817 Ga0495604_0003897 3300047317 Bacteria 11882
818 Ga0495604_0004803 3300047317 Bacteria 10713
819 Ga0495604_0006820 3300047317 Bacteria 9050
820 Ga0495604_0007926 3300047317 Bacteria 8413
821 Ga0495604_0046122 3300047317 Bacteria 3398
822 Ga0495604_0179777 3300047317 Bacteria 1480
823 Ga0495674_0000035 3300047319 Bacteria 104643
824 Ga0495674_0000088 3300047319 Bacteria 64974
825 Ga0495674_0002312 3300047319 Bacteria 18701
826 Ga0495674_0009692 3300047319 Bacteria 9143
827 Ga0495674_0012457 3300047319 Bacteria 8012
828 Ga0495674_0015386 3300047319 Bacteria 7153
829 Ga0495674_0021311 3300047319 Bacteria 5995
830 Ga0495674_0087871 3300047319 Bacteria 2660
831 Ga0495674_0257142 3300047319 Bacteria 1435
832 Ga0495674_0378264 3300047319 Bacteria 1146
833 Ga0495672_0004625 3300047320 Bacteria 11170
834 Ga0495672_0030969 3300047320 Bacteria 3345
835 Ga0495672_0031420 3300047320 Bacteria 3314
836 Ga0495672_0033056 3300047320 Bacteria 3209
837 Ga0495676_0000511 3300047321 Bacteria 31710
838 Ga0495676_0005872 3300047321 Bacteria 11266
839 Ga0495676_0035586 3300047321 Bacteria 4163
840 Ga0495676_0132102 3300047321 Bacteria 1800
841 Ga0495676_0199669 3300047321 Bacteria 1390
842 Ga0495680_0001707 3300047322 Bacteria 23335
843 Ga0495680_0006288 3300047322 Bacteria 11061
844 Ga0495680_0007830 3300047322 Bacteria 9755
845 Ga0495680_0020726 3300047322 Bacteria 5520
846 Ga0495680_0042069 3300047322 Bacteria 3628
847 Ga0495680_0063050 3300047322 Bacteria 2847
848 Ga0495680_0064818 3300047322 Bacteria 2800
849 Ga0495683_0002967 3300047323 Bacteria 10017
850 Ga0495687_000094 3300047443 Bacteria 136181
851 Ga0495687_008249 3300047443 Bacteria 5994
852 Ga0495687_079565 3300047443 Bacteria 1288
853 Ga0495675_0009422 3300047444 Bacteria 6076
854 Ga0495675_0054447 3300047444 Bacteria 2538
855 Ga0495675_0136490 3300047444 Bacteria 1522
856 Ga0495679_000007 3300047446 Bacteria 401482
857 Ga0495679_002567 3300047446 Bacteria 9156
858 Ga0495679_004234 3300047446 Bacteria 6674
859 Ga0495673_0028533 3300047469 Bacteria 2642
860 Ga0495673_0053773 3300047469 Bacteria 1754
861 Ga0495673_0066611 3300047469 Bacteria 1526
862 Ga0495684_0001171 3300047471 Bacteria 21114
863 Ga0495684_0004657 3300047471 Bacteria 10702
864 Ga0495686_0000014 3300047472 Bacteria 474014
865 Ga0495686_0032897 3300047472 Bacteria 3352
866 Ga0495593_0001588 3300047673 Bacteria 13409
867 Ga0495593_0002189 3300047673 Bacteria 11689
868 Ga0495593_0004823 3300047673 Bacteria 8001
869 Ga0495593_0010395 3300047673 Bacteria 5380
870 Ga0495602_0000761 3300048088 Bacteria 30659
871 Ga0495602_0033575 3300048088 Bacteria 4811
872 Ga0495602_0066166 3300048088 Bacteria 3115
873 Ga0495602_0087263 3300048088 Bacteria 2601
874 Ga0495602_0110321 3300048088 Bacteria 2236
875 Ga0495602_0110779 3300048088 Bacteria 2230
876 Ga0495614_0002155 3300048089 Bacteria 8714
877 Ga0495614_0002482 3300048089 Bacteria 8207
878 Ga0495614_0006922 3300048089 Bacteria 5071
879 Ga0495614_0009506 3300048089 Bacteria 4298
880 Ga0495626_0008973 3300048091 Bacteria 5427
881 Ga0496100_0003525 3300048903 Bacteria 8171
882 Ga0496100_0015657 3300048903 Bacteria 4432
883 Ga0496100_0101051 3300048903 Bacteria 1987
884 Ga0496100_0410692 3300048903 Bacteria 1033
885 Ga0496101_0004588 3300048904 Bacteria 8727
886 Ga0496102_0001490 3300048905 Bacteria 20686
887 Ga0496102_0014399 3300048905 Bacteria 6872
888 Ga0496102_0210892 3300048905 Unclassified 1831
889 Ga0496102_0273317 3300048905 Bacteria 1593
890 Ga0496103_0001870 3300048906 Bacteria 13679
891 Ga0496103_0009502 3300048906 Bacteria 5757
892 Ga0496103_0109443 3300048906 Bacteria 1754
893 Ga0496104_0004872 3300048907 Bacteria 11701
894 Ga0496104_0022590 3300048907 Bacteria 5777
895 Ga0496104_0046279 3300048907 Bacteria 4096
896 Ga0496104_0046592 3300048907 Bacteria 4083
897 Ga0496104_0129292 3300048907 Bacteria 2426
898 Ga0496104_0158075 3300048907 Bacteria 2175
899 Ga0496104_0574544 3300048907 Bacteria 1038
900 Ga0496105_0004419 3300048908 Bacteria 10585
901 Ga0496105_0021301 3300048908 Bacteria 5245
902 Ga0496105_0325955 3300048908 Bacteria 1230
903 Ga0496106_0000392 3300048909 Bacteria 31231
904 Ga0496107_0003945 3300048910 Bacteria 9979
905 Ga0496108_0090903 3300048911 Bacteria 2595
906 Ga0496109_0003262 3300048912 Bacteria 13533
907 Ga0496109_0082126 3300048912 Bacteria 2970
908 Ga0496109_0165496 3300048912 Bacteria 2073
909 Ga0496110_0088630 3300048913 Bacteria 2764
910 Ga0496110_0182288 3300048913 Bacteria 1907
911 Ga0496111_0124109 3300048914 Bacteria 1908
912 Ga0496112_0000224 3300048915 Bacteria 36869
913 Ga0496112_0035759 3300048915 Bacteria 4840
914 Ga0496112_0057636 3300048915 Bacteria 3825
915 Ga0496113_0000540 3300048916 Bacteria 18687
916 Ga0496113_0027595 3300048916 Bacteria 4072
917 Ga0496114_0041487 3300048917 Bacteria 3814
918 Ga0496115_0131344 3300048918 Bacteria 2064
919 Ga0496116_0009863 3300048919 Bacteria 8081
920 Ga0496116_0158874 3300048919 Bacteria 1243
921 Ga0496117_0007461 3300048920 Bacteria 10672
922 Ga0496117_0010428 3300048920 Bacteria 8475
923 Ga0496117_0018653 3300048920 Bacteria 5735
924 Ga0496117_0025338 3300048920 Bacteria 4666
925 Ga0496117_0035649 3300048920 Bacteria 3732
926 Ga0496117_0036399 3300048920 Bacteria 3683
927 Ga0496118_0000603 3300048921 Bacteria 59380
928 Ga0496118_0001810 3300048921 Bacteria 30800
929 Ga0496118_0005819 3300048921 Bacteria 13819
930 Ga0496118_0016638 3300048921 Bacteria 6738
931 Ga0496118_0024742 3300048921 Bacteria 5172
932 Ga0496118_0038955 3300048921 Bacteria 3801
933 Ga0496118_0083663 3300048921 Bacteria 2230
934 Ga0496119_0037641 3300048922 Bacteria 3139
935 Ga0496119_0060402 3300048922 Bacteria 2269
936 Ga0496119_0063362 3300048922 Bacteria 2199
937 Ga0496119_0087762 3300048922 Bacteria 1775
938 Ga0496120_0000122 3300048923 Bacteria 130209
939 Ga0496120_0000197 3300048923 Bacteria 103378
940 Ga0496120_0082644 3300048923 Bacteria 1735
941 Ga0496121_0000747 3300048924 Bacteria 59731
942 Ga0496121_0003287 3300048924 Bacteria 23207
943 Ga0496121_0013905 3300048924 Bacteria 8603
944 Ga0496121_0020006 3300048924 Bacteria 6657
945 Ga0496121_0041765 3300048924 Bacteria 4003
946 Ga0496121_0050582 3300048924 Bacteria 3509
947 Ga0496121_0066000 3300048924 Bacteria 2941
948 Ga0496121_0084256 3300048924 Bacteria 2507
949 Ga0496121_0262294 3300048924 Bacteria 1192
950 Ga0496122_0000497 3300048925 Bacteria 81763
951 Ga0496122_0047438 3300048925 Bacteria 3316
952 Ga0496122_0271464 3300048925 Bacteria 934
953 Ga0496123_0001884 3300048926 Bacteria 27381
954 Ga0496124_0000007 3300048927 Bacteria 883534
955 Ga0496125_0000166 3300048928 Bacteria 147432
956 Ga0496125_0004601 3300048928 Bacteria 15768
957 Ga0496125_0022365 3300048928 Bacteria 5873
958 Ga0496125_0029114 3300048928 Bacteria 4971
959 Ga0496125_0034773 3300048928 Bacteria 4435
960 Ga0496125_0103357 3300048928 Bacteria 2091
961 Ga0496126_0001259 3300048929 Bacteria 40861
962 Ga0496126_0006922 3300048929 Bacteria 12560
963 Ga0496126_0018649 3300048929 Bacteria 6868
964 Ga0496126_0064839 3300048929 Bacteria 3271
965 Ga0496126_0080480 3300048929 Bacteria 2883
966 Ga0496126_0128990 3300048929 Bacteria 2187
967 Ga0496126_0233949 3300048929 Bacteria 1538
968 Ga0495682_0014349 3300049460 Bacteria 3006
969 Ga0495682_0017668 3300049460 Bacteria 2688
970 Ga0495682_0038574 3300049460 Bacteria 1755
971 Ga0495682_0040460 3300049460 Bacteria 1709
972 Ga0501031_0315137 3300049568 Bacteria 1013
973 Ga0501032_0043691 3300049569 Bacteria 3033
974 Ga0501033_0034822 3300049570 Bacteria 3775
975 Ga0501033_0110486 3300049570 Bacteria 2001
976 Ga0501034_0001140 3300049571 Bacteria 37002
977 Ga0501034_0001685 3300049571 Bacteria 28484
978 Ga0501034_0037950 3300049571 Bacteria 4879
979 Ga0501034_0045339 3300049571 Bacteria 4443
980 Ga0501034_0054151 3300049571 Bacteria 4039
981 Ga0501034_0088095 3300049571 Bacteria 3103
982 Ga0501034_0149937 3300049571 Bacteria 2308
983 Ga0501034_0175420 3300049571 Bacteria 2109
984 Ga0501036_0010427 3300049572 Bacteria 7673
985 Ga0501036_0566040 3300049572 Bacteria 944
986 Ga0501036_0588219 3300049572 Bacteria 924
987 Ga0501037_0023645 3300049573 Bacteria 4543
988 Ga0501037_0320784 3300049573 Bacteria 1073
989 Ga0501038_0006734 3300049574 Bacteria 10616
990 Ga0501038_0058696 3300049574 Bacteria 3298
991 Ga0501039_0007774 3300049575 Bacteria 8178
992 Ga0501040_0025342 3300049576 Bacteria 3987
993 Ga0501041_0051080 3300049577 Bacteria 2519
994 Ga0501042_0088991 3300049578 Bacteria 2215
995 Ga0501043_0014175 3300049579 Bacteria 6237
996 Ga0501043_0017944 3300049579 Bacteria 5549
997 Ga0501046_0011523 3300049580 Bacteria 7560
998 Ga0501046_0127658 3300049580 Bacteria 1931
999 Ga0501047_0085650 3300049581 Bacteria 3028
1000 Ga0501047_0119893 3300049581 Bacteria 2513
1001 Ga0501047_0167594 3300049581 Bacteria 2067
1002 Ga0501047_0201794 3300049581 Bacteria 1850
1003 Ga0501048_0056505 3300049582 Bacteria 2784
1004 Ga0501048_0059441 3300049582 Bacteria 2709
1005 Ga0501067_0012016 3300049583 Bacteria 4799
1006 Ga0501068_0005551 3300049584 Bacteria 6910
1007 Ga0501070_0099916 3300049586 Bacteria 2400
1008 Ga0501070_0146296 3300049586 Bacteria 1950
1009 Ga0501070_0362206 3300049586 Bacteria 1176
1010 Ga0501071_0009643 3300049587 Bacteria 6445
1011 Ga0501072_0009667 3300049588 Bacteria 7335
1012 Ga0501074_0245567 3300049590 Bacteria 1273
1013 Ga0501076_0046193 3300049592 Bacteria 3440
1014 Ga0501077_0004702 3300049593 Bacteria 8300
1015 Ga0501077_0033984 3300049593 Bacteria 3245
1016 Ga0501079_0285049 3300049741 Bacteria 1291
1017 Ga0501081_0048092 3300049743 Bacteria 2935
1018 Ga0501081_0072230 3300049743 Bacteria 2406
1019 Ga0501035_0008018 3300049822 Bacteria 9844
1020 Ga0501035_0125934 3300049822 Bacteria 2236
1021 Ga0501044_0055019 3300049823 Bacteria 4088
1022 Ga0501044_0095456 3300049823 Bacteria 2996
1023 Ga0501044_0287403 3300049823 Bacteria 1577
1024 Ga0501045_0012436 3300049824 Bacteria 5993
1025 nmdc:mga03683_16511_c1 3300050489 Bacteria 2775
1026 nmdc:mga03n38_92293_c1 3300050490 Bacteria 1444
1027 nmdc:mga00v17_4840_c1 3300050491 Bacteria 7052
1028 nmdc:mga0yw44_130987_c1 3300050492 Bacteria 1624
1029 nmdc:mga0yw44_817_c1 3300050492 Bacteria 11605
1030 nmdc:mga0k408_16518_c1 3300050493 Bacteria 4097
1031 nmdc:mga0k408_353_c1 3300050493 Bacteria 25220
1032 nmdc:mga0k408_85365_c1 3300050493 Bacteria 1853
1033 nmdc:mga06z11_173654_c1 3300050494 Bacteria 1239
1034 nmdc:mga06z11_283900_c1 3300050494 Bacteria 981
1035 nmdc:mga06z11_791_c1 3300050494 Bacteria 11560
1036 nmdc:mga04h51_5107_c1 3300050495 Bacteria 3325
1037 nmdc:mga07m45_23686_c1 3300050496 Bacteria 3357
1038 nmdc:mga07m45_2716_c1 3300050496 Bacteria 8340
1039 nmdc:mga07m45_28324_c1 3300050496 Bacteria 3092
1040 nmdc:mga07m45_43155_c1 3300050496 Bacteria 2528
1041 nmdc:mga07m45_60928_c1 3300050496 Bacteria 2137
1042 nmdc:mga07m45_88_c1 3300050496 Bacteria 34971
1043 nmdc:mga05p37_463939_c1 3300050507 Bacteria 1463
1044 nmdc:mga05p37_85493_c1 3300050507 Bacteria 3887
1045 nmdc:mga09592_38642_c1 3300050508 Bacteria 4007
1046 nmdc:mga06r32_26484_c1 3300050510 Bacteria 5407
1047 nmdc:mga08y16_24351_c1 3300050511 Bacteria 6389
1048 nmdc:mga08y16_6662_c1 3300050511 Bacteria 12112
1049 nmdc:mga0a205_592920_c1 3300050515 Bacteria 961
1050 nmdc:mga0sz30_922_c1 3300050516 Bacteria 10588
1051 Ga0495601_0234603 3300053077 Bacteria 1198
1052 Ga0500643_032523 3300053087 Bacteria 1583
1053 Ga0500644_0110418 3300053088 Bacteria 1058
1054 Ga0500651_0036271 3300053093 Bacteria 3107
1055 Ga0500641_0004206 3300053096 Bacteria 5079
1056 Ga0500562_000203 3300053108 Bacteria 16106
1057 Ga0500562_010790 3300053108 Bacteria 2317
1058 Ga0500562_018737 3300053108 Bacteria 1788
1059 Ga0500595_024835 3300053119 Bacteria 2086
1060 Ga0500658_0133854 3300053134 Bacteria 1108
1061 Ga0500568_0008733 3300053139 Bacteria 4860
1062 Ga0500577_0005383 3300053142 Bacteria 3444
1063 Ga0500616_0001986 3300053153 Bacteria 18171
1064 Ga0500634_0070488 3300053161 Bacteria 1830
1065 Ga0500637_0047407 3300053178 Bacteria 2440
1066 Ga0501084_0158021 3300054114 Bacteria 1912
1067 Ga0501082_0212370 3300060353 Bacteria 1683
1068 Ga0466962_0000903 3300061719 Bacteria 13476
1069 Ga0466962_0011578 3300061719 Bacteria 4249
1070 Ga0530510_0080158 3300061734 Bacteria 2375

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025925 Ga0207650_10200910 Ga0207650_102009102 249
2 3300037471 Ga0395905_0121573 Ga0395905_0121573_658_1476 256
3 3300041408 Ga0439453_0035731 Ga0439453_0035731_12_830 256
4 3300042138 Ga0450903_002830 Ga0450903_002830_410_1228 256
5 3300042139 Ga0450904_004984 Ga0450904_004984_26_844 256
6 3300042157 Ga0439458_0063612 Ga0439458_0063612_65_883 256
7 3300042439 Ga0439464_0001842 Ga0439464_0001842_2203_3021 256
8 3300046538 Ga0495609_0151274 Ga0495609_0151274_134_964 256
9 3300005445 Ga0070708_100340258 Ga0070708_1003402581 257
10 3300025292 Ga0209676_1006255 Ga0209676_10062554 257
11 3300025298 Ga0209050_1006150 Ga0209050_10061505 257
12 3300025303 Ga0209051_1008353 Ga0209051_10083535 257
13 3300031911 Ga0307412_10002104 Ga0307412_100021046 257
14 3300042156 Ga0439446_0032048 Ga0439446_0032048_39_857 257
15 3300048919 Ga0496116_0009863 Ga0496116_0009863_1507_2340 257
16 3300048919 Ga0496116_0158874 Ga0496116_0158874_110_943 257
17 3300048920 Ga0496117_0018653 Ga0496117_0018653_3262_4095 257
18 3300048920 Ga0496117_0035649 Ga0496117_0035649_28_861 257
19 3300048921 Ga0496118_0005819 Ga0496118_0005819_3108_3941 257
20 3300048921 Ga0496118_0038955 Ga0496118_0038955_1685_2518 257
21 3300048922 Ga0496119_0037641 Ga0496119_0037641_750_1583 257
22 3300048922 Ga0496119_0060402 Ga0496119_0060402_260_1093 257
23 3300048923 Ga0496120_0082644 Ga0496120_0082644_809_1642 257
24 3300048924 Ga0496121_0003287 Ga0496121_0003287_8314_9147 257
25 3300048924 Ga0496121_0084256 Ga0496121_0084256_1435_2268 257
26 3300048925 Ga0496122_0000497 Ga0496122_0000497_26439_27272 257
27 3300048925 Ga0496122_0047438 Ga0496122_0047438_755_1588 257
28 3300048926 Ga0496123_0001884 Ga0496123_0001884_12914_13747 257
29 3300048928 Ga0496125_0000166 Ga0496125_0000166_60855_61688 257
30 3300048928 Ga0496125_0029114 Ga0496125_0029114_2566_3399 257
31 3300048928 Ga0496125_0034773 Ga0496125_0034773_562_1395 257
32 3300048929 Ga0496126_0064839 Ga0496126_0064839_733_1566 257
33 3300039450 Ga0436363_0692852 Ga0436363_0692852_161_946 259
34 3300039453 Ga0436362_0992540 Ga0436362_0992540_317_1111 259
35 3300044842 Ga0466957_0052427 Ga0466957_0052427_927_1709 259
36 3300046642 Ga0495634_0216778 Ga0495634_0216778_237_1022 259
37 3300005434 Ga0070709_10120664 Ga0070709_101206642 260
38 3300005437 Ga0070710_10052399 Ga0070710_100523992 260
39 3300005440 Ga0070705_100167200 Ga0070705_1001672001 260
40 3300005445 Ga0070708_100005199 Ga0070708_1000051996 260
41 3300005467 Ga0070706_100068870 Ga0070706_1000688704 260
42 3300005468 Ga0070707_100002122 Ga0070707_10000212211 260
43 3300005471 Ga0070698_100054589 Ga0070698_1000545894 260
44 3300005518 Ga0070699_100000865 Ga0070699_10000086527 260
45 3300005536 Ga0070697_100000222 Ga0070697_10000022211 260
46 3300006028 Ga0070717_10047005 Ga0070717_100470053 260
47 3300006175 Ga0070712_100093484 Ga0070712_1000934842 260
48 3300025906 Ga0207699_10019984 Ga0207699_100199843 260
49 3300025910 Ga0207684_10004845 Ga0207684_100048454 260
50 3300025915 Ga0207693_10003289 Ga0207693_100032899 260
51 3300025916 Ga0207663_10025128 Ga0207663_100251283 260
52 3300025917 Ga0207660_10074211 Ga0207660_100742112 260
53 3300025921 Ga0207652_10082928 Ga0207652_100829283 260
54 3300025922 Ga0207646_10001152 Ga0207646_1000115217 260
55 3300025929 Ga0207664_10103574 Ga0207664_101035743 260
56 3300025942 Ga0207689_10548658 Ga0207689_105486581 260
57 3300032126 Ga0307415_100121409 Ga0307415_1001214092 260
58 3300037853 Ga0436364_0025729 Ga0436364_0025729_73_864 260
59 3300039447 Ga0436361_0460638 Ga0436361_0460638_85_876 260
60 3300039450 Ga0436363_0150078 Ga0436363_0150078_1686_2477 260
61 3300042005 Ga0439448_0136916 Ga0439448_0136916_24_809 260
62 3300044684 Ga0466966_0026838 Ga0466966_0026838_1846_2631 260
63 3300044693 Ga0466961_0046823 Ga0466961_0046823_727_1512 260
64 3300044719 Ga0466971_0093519 Ga0466971_0093519_334_1119 260
65 3300045976 Ga0466967_0040743 Ga0466967_0040743_771_1556 260
66 3300048907 Ga0496104_0158075 Ga0496104_0158075_356_1147 260
67 3300048908 Ga0496105_0325955 Ga0496105_0325955_28_819 260
68 3300048912 Ga0496109_0003262 Ga0496109_0003262_3545_4336 260
69 3300048914 Ga0496111_0124109 Ga0496111_0124109_421_1212 260
70 3300048915 Ga0496112_0035759 Ga0496112_0035759_833_1624 260
71 3300048929 Ga0496126_0080480 Ga0496126_0080480_303_1094 260
72 3300003791 Ga0055530_10000014 Ga0055530_1000001459 261
73 3300003794 Ga0055531_10001911 Ga0055531_100019112 261
74 3300005262 Ga0065165_1041657 Ga0065165_10416572 261
75 3300009174 Ga0105241_10172352 Ga0105241_101723522 261
76 3300009551 Ga0105238_10025641 Ga0105238_100256414 261
77 3300025250 Ga0209026_1001238 Ga0209026_10012386 261
78 3300025297 Ga0209758_1005611 Ga0209758_10056114 261
79 3300025298 Ga0209050_1000034 Ga0209050_100003487 261
80 3300025304 Ga0209257_1000052 Ga0209257_1000052323 261
81 3300025304 Ga0209257_1000100 Ga0209257_1000100188 261
82 3300025911 Ga0207654_10040325 Ga0207654_100403253 261
83 3300025924 Ga0207694_10051497 Ga0207694_100514972 261
84 3300049581 Ga0501047_0167594 Ga0501047_0167594_1094_1888 261
85 3300049582 Ga0501048_0059441 Ga0501048_0059441_146_940 261
86 3300005563 Ga0068855_100037073 Ga0068855_1000370737 262
87 3300005616 Ga0068852_100013111 Ga0068852_1000131114 262
88 3300005617 Ga0068859_100330267 Ga0068859_1003302672 262
89 3300005844 Ga0068862_100299001 Ga0068862_1002990012 262
90 3300006931 Ga0097620_100330302 Ga0097620_1003303022 262
91 3300009093 Ga0105240_10874790 Ga0105240_108747901 262
92 3300009987 Ga0105030_107549 Ga0105030_1075491 262
93 3300025928 Ga0207700_10298719 Ga0207700_102987191 262
94 3300025949 Ga0207667_10044253 Ga0207667_100442531 262
95 3300026142 Ga0207698_10009101 Ga0207698_100091014 262
96 3300037068 Ga0373925_0208373 Ga0373925_0208373_286_1080 262
97 3300039453 Ga0436362_0557887 Ga0436362_0557887_1030_1827 262
98 iso_pu_bacteria 2721755763 2723876163 262
99 iso_pu_bacteria 2808606404 2809079954 262
100 iso_pu_bacteria 2808606405 2809084319 262
101 iso_pu_bacteria 2862507626 2862516581 262
102 iso_pu_bacteria 2880518877 2880522873 262
103 3300005329 Ga0070683_100423591 Ga0070683_1004235911 263
104 3300047319 Ga0495674_0378264 Ga0495674_0378264_322_1131 263
105 3300053087 Ga0500643_032523 Ga0500643_032523_288_1091 263
106 3300053108 Ga0500562_000203 Ga0500562_000203_11692_12495 263
107 iso_pu_bacteria 2508501039 2508673181 263
108 iso_pu_bacteria 2687453737 2689963099 263
109 3300001989 JGI24739J22299_10033113 JGI24739J22299_100331133 264
110 3300005327 Ga0070658_10001208 Ga0070658_100012085 264
111 3300005331 Ga0070670_100413473 Ga0070670_1004134731 264
112 3300005336 Ga0070680_100001985 Ga0070680_1000019854 264
113 3300005355 Ga0070671_100527875 Ga0070671_1005278751 264
114 3300005365 Ga0070688_100012466 Ga0070688_1000124665 264
115 3300005456 Ga0070678_100169474 Ga0070678_1001694742 264
116 3300005458 Ga0070681_10003664 Ga0070681_100036642 264
117 3300005467 Ga0070706_100277452 Ga0070706_1002774522 264
118 3300005468 Ga0070707_100101597 Ga0070707_1001015972 264
119 3300005471 Ga0070698_100000587 Ga0070698_10000058731 264
120 3300005471 Ga0070698_100068270 Ga0070698_1000682702 264
121 3300005530 Ga0070679_100048869 Ga0070679_1000488695 264
122 3300005535 Ga0070684_100321873 Ga0070684_1003218731 264
123 3300005548 Ga0070665_100004342 Ga0070665_1000043428 264
124 3300005563 Ga0068855_100075781 Ga0068855_1000757812 264
125 3300005563 Ga0068855_100187895 Ga0068855_1001878952 264
126 3300005577 Ga0068857_100073716 Ga0068857_1000737162 264
127 3300005577 Ga0068857_100578711 Ga0068857_1005787112 264
128 3300005614 Ga0068856_100260922 Ga0068856_1002609222 264
129 3300005843 Ga0068860_100117391 Ga0068860_1001173911 264
130 3300005937 Ga0081455_10002011 Ga0081455_1000201116 264
131 3300005981 Ga0081538_10073583 Ga0081538_100735832 264
132 3300005983 Ga0081540_1058979 Ga0081540_10589792 264
133 3300005985 Ga0081539_10009839 Ga0081539_100098394 264
134 3300006038 Ga0075365_10001147 Ga0075365_100011478 264
135 3300006042 Ga0075368_10019969 Ga0075368_100199692 264
136 3300006177 Ga0075362_10029001 Ga0075362_100290012 264
137 3300006177 Ga0075362_10037872 Ga0075362_100378722 264
138 3300006178 Ga0075367_10001011 Ga0075367_100010118 264
139 3300006178 Ga0075367_10036329 Ga0075367_100363292 264
140 3300006186 Ga0075369_10002056 Ga0075369_100020566 264
141 3300006195 Ga0075366_10001326 Ga0075366_1000132610 264
142 3300006195 Ga0075366_10080222 Ga0075366_100802222 264
143 3300006353 Ga0075370_10000739 Ga0075370_100007399 264
144 3300006353 Ga0075370_10145161 Ga0075370_101451612 264
145 3300006353 Ga0075370_10147046 Ga0075370_101470462 264
146 3300007265 Ga0099794_10170411 Ga0099794_101704112 264
147 3300007788 Ga0099795_10091523 Ga0099795_100915232 264
148 3300009093 Ga0105240_10027768 Ga0105240_100277683 264
149 3300010375 Ga0105239_10184028 Ga0105239_101840282 264
150 3300010375 Ga0105239_10545953 Ga0105239_105459531 264
151 3300013104 Ga0157370_10030067 Ga0157370_100300672 264
152 3300013105 Ga0157369_10429614 Ga0157369_104296142 264
153 3300014326 Ga0157380_10494064 Ga0157380_104940641 264
154 3300014968 Ga0157379_10405517 Ga0157379_104055172 264
155 3300021384 Ga0213876_10001894 Ga0213876_1000189411 264
156 3300025315 Ga0207697_10106647 Ga0207697_101066472 264
157 3300025909 Ga0207705_10010305 Ga0207705_100103057 264
158 3300025911 Ga0207654_10211128 Ga0207654_102111282 264
159 3300025912 Ga0207707_10088306 Ga0207707_100883064 264
160 3300025913 Ga0207695_10015634 Ga0207695_100156348 264
161 3300025915 Ga0207693_10371239 Ga0207693_103712391 264
162 3300025916 Ga0207663_10161026 Ga0207663_101610262 264
163 3300025917 Ga0207660_10031804 Ga0207660_100318043 264
164 3300025920 Ga0207649_10399980 Ga0207649_103999802 264
165 3300025921 Ga0207652_10227755 Ga0207652_102277552 264
166 3300025923 Ga0207681_10184892 Ga0207681_101848922 264
167 3300025924 Ga0207694_10023461 Ga0207694_100234615 264
168 3300025925 Ga0207650_10363604 Ga0207650_103636041 264
169 3300025928 Ga0207700_10031095 Ga0207700_100310953 264
170 3300025939 Ga0207665_10315194 Ga0207665_103151942 264
171 3300025944 Ga0207661_10045130 Ga0207661_100451305 264
172 3300025961 Ga0207712_10565026 Ga0207712_105650261 264
173 3300025972 Ga0207668_10353311 Ga0207668_103533112 264
174 3300025981 Ga0207640_10170383 Ga0207640_101703832 264
175 3300025986 Ga0207658_10439171 Ga0207658_104391711 264
176 3300026023 Ga0207677_10195743 Ga0207677_101957432 264
177 3300026041 Ga0207639_10261753 Ga0207639_102617532 264
178 3300026075 Ga0207708_10211392 Ga0207708_102113921 264
179 3300026078 Ga0207702_10040449 Ga0207702_100404492 264
180 3300026088 Ga0207641_10558868 Ga0207641_105588682 264
181 3300026089 Ga0207648_10395532 Ga0207648_103955322 264
182 3300026116 Ga0207674_10091441 Ga0207674_100914415 264
183 3300026116 Ga0207674_10104804 Ga0207674_101048042 264
184 3300026118 Ga0207675_100308679 Ga0207675_1003086792 264
185 3300026121 Ga0207683_10157769 Ga0207683_101577692 264
186 3300027866 Ga0209813_10069741 Ga0209813_100697412 264
187 3300028379 Ga0268266_10011284 Ga0268266_100112846 264
188 3300028379 Ga0268266_10150346 Ga0268266_101503462 264
189 3300028380 Ga0268265_10344328 Ga0268265_103443282 264
190 3300028573 Ga0265334_10033254 Ga0265334_100332542 264
191 3300031241 Ga0265325_10002671 Ga0265325_100026714 264
192 3300031247 Ga0265340_10105954 Ga0265340_101059541 264
193 3300031249 Ga0265339_10003924 Ga0265339_100039241 264
194 3300031344 Ga0265316_10057905 Ga0265316_100579054 264
195 3300031595 Ga0265313_10011566 Ga0265313_100115665 264
196 3300031712 Ga0265342_10086380 Ga0265342_100863802 264
197 3300035084 Ga0373928_0027165 Ga0373928_0027165_49_861 264
198 3300035724 Ga0373933_0125223 Ga0373933_0125223_89_901 264
199 3300037312 Ga0395899_0001978 Ga0395899_0001978_1110_1922 264
200 3300037312 Ga0395899_0140119 Ga0395899_0140119_849_1661 264
201 3300037418 Ga0395900_0044617 Ga0395900_0044617_1809_2621 264
202 3300037418 Ga0395900_0063627 Ga0395900_0063627_2246_3058 264
203 3300037418 Ga0395900_0131844 Ga0395900_0131844_208_1011 264
204 3300037418 Ga0395900_0400164 Ga0395900_0400164_18_830 264
205 3300037466 Ga0395898_0014912 Ga0395898_0014912_4512_5324 264
206 3300037466 Ga0395898_0022982 Ga0395898_0022982_5081_5893 264
207 3300037466 Ga0395898_0153086 Ga0395898_0153086_550_1401 264
208 3300038443 Ga0395901_0001952 Ga0395901_0001952_4889_5701 264
209 3300038443 Ga0395901_0010068 Ga0395901_0010068_5178_6029 264
210 3300038443 Ga0395901_0010514 Ga0395901_0010514_5052_5864 264
211 3300038443 Ga0395901_0021996 Ga0395901_0021996_2406_3218 264
212 3300038443 Ga0395901_0064667 Ga0395901_0064667_361_1173 264
213 3300039437 Ga0436365_0473069 Ga0436365_0473069_10782_11594 264
214 3300039437 Ga0436365_0885104 Ga0436365_0885104_2758_3570 264
215 3300039438 Ga0436360_0315794 Ga0436360_0315794_365_1177 264
216 3300039438 Ga0436360_0415711 Ga0436360_0415711_65_877 264
217 3300039453 Ga0436362_0783295 Ga0436362_0783295_352_1155 264
218 3300042435 Ga0439434_0050534 Ga0439434_0050534_179_982 264
219 3300044694 Ga0466963_0031591 Ga0466963_0031591_1737_2549 264
220 3300044842 Ga0466957_0049190 Ga0466957_0049190_177_989 264
221 3300045976 Ga0466967_0050170 Ga0466967_0050170_2387_3199 264
222 3300046674 Ga0495588_0181920 Ga0495588_0181920_108_908 264
223 3300048089 Ga0495614_0006922 Ga0495614_0006922_938_1744 264
224 3300049571 Ga0501034_0001140 Ga0501034_0001140_33546_34358 264
225 3300049571 Ga0501034_0001685 Ga0501034_0001685_19929_20741 264
226 3300049571 Ga0501034_0045339 Ga0501034_0045339_3570_4382 264
227 3300049573 Ga0501037_0320784 Ga0501037_0320784_202_1014 264
228 3300049579 Ga0501043_0017944 Ga0501043_0017944_1817_2638 264
229 3300049580 Ga0501046_0127658 Ga0501046_0127658_77_889 264
230 3300049581 Ga0501047_0119893 Ga0501047_0119893_1143_1955 264
231 3300049584 Ga0501068_0005551 Ga0501068_0005551_827_1639 264
232 3300049823 Ga0501044_0287403 Ga0501044_0287403_22_834 264
233 3300050492 nmdc:mga0yw44_130987_c1 nmdc:mga0yw44_130987_c1_654_1466 264
234 3300050492 nmdc:mga0yw44_817_c1 nmdc:mga0yw44_817_c1_6936_7739 264
235 3300050493 nmdc:mga0k408_353_c1 nmdc:mga0k408_353_c1_3680_4483 264
236 3300050494 nmdc:mga06z11_283900_c1 nmdc:mga06z11_283900_c1_72_884 264
237 3300050494 nmdc:mga06z11_791_c1 nmdc:mga06z11_791_c1_6891_7694 264
238 3300050495 nmdc:mga04h51_5107_c1 nmdc:mga04h51_5107_c1_141_944 264
239 3300050496 nmdc:mga07m45_43155_c1 nmdc:mga07m45_43155_c1_1240_2043 264
240 3300050496 nmdc:mga07m45_88_c1 nmdc:mga07m45_88_c1_15399_16202 264
241 3300050515 nmdc:mga0a205_592920_c1 nmdc:mga0a205_592920_c1_98_910 264
242 3300050516 nmdc:mga0sz30_922_c1 nmdc:mga0sz30_922_c1_5167_5979 264
243 3300053093 Ga0500651_0036271 Ga0500651_0036271_1923_2735 264
244 3300053096 Ga0500641_0004206 Ga0500641_0004206_4184_4996 264
245 3300053134 Ga0500658_0133854 Ga0500658_0133854_150_962 264
246 3300053139 Ga0500568_0008733 Ga0500568_0008733_364_1176 264
247 3300053153 Ga0500616_0001986 Ga0500616_0001986_10351_11163 264
248 iso_pu_bacteria 2739367655 2739613673 264
249 iso_pu_bacteria 2857542790 2857544433 264
250 iso_pu_bacteria 2887375801 2887377500 264
251 3300005355 Ga0070671_100002267 Ga0070671_1000022675 265
252 3300005435 Ga0070714_100781640 Ga0070714_1007816401 265
253 3300005439 Ga0070711_100078820 Ga0070711_1000788202 265
254 3300005445 Ga0070708_100000811 Ga0070708_1000008117 265
255 3300005445 Ga0070708_100006423 Ga0070708_1000064235 265
256 3300005467 Ga0070706_100001584 Ga0070706_10000158424 265
257 3300005467 Ga0070706_100003747 Ga0070706_1000037474 265
258 3300005468 Ga0070707_100001089 Ga0070707_10000108915 265
259 3300005468 Ga0070707_100022766 Ga0070707_1000227665 265
260 3300005518 Ga0070699_100000149 Ga0070699_10000014927 265
261 3300005536 Ga0070697_100000856 Ga0070697_10000085614 265
262 3300005842 Ga0068858_100063744 Ga0068858_1000637443 265
263 3300005981 Ga0081538_10041488 Ga0081538_100414882 265
264 3300005985 Ga0081539_10000086 Ga0081539_10000086135 265
265 3300006028 Ga0070717_10013624 Ga0070717_100136244 265
266 3300006028 Ga0070717_10025226 Ga0070717_100252266 265
267 3300006844 Ga0075428_100004344 Ga0075428_10000434414 265
268 3300006847 Ga0075431_100248864 Ga0075431_1002488641 265
269 3300006880 Ga0075429_100022391 Ga0075429_1000223912 265
270 3300006880 Ga0075429_100352675 Ga0075429_1003526752 265
271 3300009094 Ga0111539_10002094 Ga0111539_1000209420 265
272 3300009147 Ga0114129_10001077 Ga0114129_1000107710 265
273 3300009174 Ga0105241_10068257 Ga0105241_100682572 265
274 3300010375 Ga0105239_10790882 Ga0105239_107908822 265
275 3300014325 Ga0163163_10353821 Ga0163163_103538212 265
276 3300021388 Ga0213875_10000174 Ga0213875_1000017443 265
277 3300021388 Ga0213875_10015157 Ga0213875_100151573 265
278 3300025898 Ga0207692_10355258 Ga0207692_103552581 265
279 3300025910 Ga0207684_10001662 Ga0207684_1000166222 265
280 3300025910 Ga0207684_10025209 Ga0207684_100252095 265
281 3300025911 Ga0207654_10182706 Ga0207654_101827062 265
282 3300025915 Ga0207693_10003067 Ga0207693_100030676 265
283 3300025916 Ga0207663_10160007 Ga0207663_101600072 265
284 3300025922 Ga0207646_10007222 Ga0207646_1000722211 265
285 3300025922 Ga0207646_10011833 Ga0207646_100118332 265
286 3300025925 Ga0207650_10371411 Ga0207650_103714112 265
287 3300025927 Ga0207687_10006212 Ga0207687_100062123 265
288 3300025928 Ga0207700_10140905 Ga0207700_101409052 265
289 3300025929 Ga0207664_10385054 Ga0207664_103850542 265
290 3300025931 Ga0207644_10060702 Ga0207644_100607023 265
291 3300025972 Ga0207668_10518562 Ga0207668_105185621 265
292 3300026035 Ga0207703_10050958 Ga0207703_100509583 265
293 3300027907 Ga0207428_10004927 Ga0207428_100049279 265
294 3300028381 Ga0268264_10033435 Ga0268264_100334353 265
295 3300028794 Ga0307515_10176873 Ga0307515_101768732 265
296 3300035086 Ga0373934_0090841 Ga0373934_0090841_42_845 265
297 3300035089 Ga0373944_0000063 Ga0373944_0000063_1136_1987 265
298 3300035111 Ga0373923_0060121 Ga0373923_0060121_25_876 265
299 3300035113 Ga0373936_0000095 Ga0373936_0000095_11809_12660 265
300 3300035116 Ga0373945_0000118 Ga0373945_0000118_6514_7365 265
301 3300035120 Ga0373957_0099795 Ga0373957_0099795_211_1023 265
302 3300035170 Ga0373943_0000007 Ga0373943_0000007_20342_21193 265
303 3300035171 Ga0373946_0000003 Ga0373946_0000003_52337_53188 265
304 3300035172 Ga0373955_0018262 Ga0373955_0018262_1530_2381 265
305 3300035692 Ga0373935_0000016 Ga0373935_0000016_50452_51303 265
306 3300035695 Ga0373927_0000211 Ga0373927_0000211_15939_16790 265
307 3300035695 Ga0373927_0073526 Ga0373927_0073526_307_1110 265
308 3300035724 Ga0373933_0114817 Ga0373933_0114817_661_1512 265
309 3300035725 Ga0373947_0000043 Ga0373947_0000043_52202_53053 265
310 3300036401 Ga0373937_0181016 Ga0373937_0181016_32_883 265
311 3300036401 Ga0373937_0385446 Ga0373937_0385446_443_1246 265
312 3300037068 Ga0373925_0001599 Ga0373925_0001599_11767_12618 265
313 3300037853 Ga0436364_0676163 Ga0436364_0676163_23517_24332 265
314 3300037853 Ga0436364_1238375 Ga0436364_1238375_3771_4583 265
315 3300039438 Ga0436360_0148685 Ga0436360_0148685_145_948 265
316 3300039438 Ga0436360_1255737 Ga0436360_1255737_320_1129 265
317 3300039447 Ga0436361_0912408 Ga0436361_0912408_32_841 265
318 3300039447 Ga0436361_1010833 Ga0436361_1010833_369_1172 265
319 3300039450 Ga0436363_1479055 Ga0436363_1479055_532_1344 265
320 3300041512 Ga0451853_0230220 Ga0451853_0230220_724_1530 265
321 3300045976 Ga0466967_0032091 Ga0466967_0032091_2859_3683 265
322 3300045976 Ga0466967_0631021 Ga0466967_0631021_83_913 265
323 3300046454 Ga0495592_0115372 Ga0495592_0115372_835_1686 265
324 3300046461 Ga0495641_0003952 Ga0495641_0003952_3091_3942 265
325 3300046463 Ga0495653_0000217 Ga0495653_0000217_26413_27264 265
326 3300046472 Ga0495580_0167103 Ga0495580_0167103_141_944 265
327 3300046475 Ga0495639_0078147 Ga0495639_0078147_157_1008 265
328 3300046476 Ga0495662_0020078 Ga0495662_0020078_669_1520 265
329 3300046477 Ga0495664_0000109 Ga0495664_0000109_32903_33754 265
330 3300046511 Ga0495608_0018548 Ga0495608_0018548_714_1565 265
331 3300046529 Ga0495652_0001202 Ga0495652_0001202_19105_19956 265
332 3300046531 Ga0495665_0099712 Ga0495665_0099712_647_1498 265
333 3300046543 Ga0495645_0078600 Ga0495645_0078600_856_1677 265
334 3300046559 Ga0495667_0002040 Ga0495667_0002040_680_1531 265
335 3300046642 Ga0495634_0051889 Ga0495634_0051889_812_1663 265
336 3300046663 Ga0495635_0000852 Ga0495635_0000852_12601_13452 265
337 3300046678 Ga0495599_0007923 Ga0495599_0007923_3275_4126 265
338 3300046681 Ga0495647_0107770 Ga0495647_0107770_36_941 265
339 3300046689 Ga0495613_0126889 Ga0495613_0126889_495_1301 265
340 3300047319 Ga0495674_0000088 Ga0495674_0000088_43868_44719 265
341 3300047319 Ga0495674_0002312 Ga0495674_0002312_16095_16916 265
342 3300047321 Ga0495676_0000511 Ga0495676_0000511_19410_20261 265
343 3300047322 Ga0495680_0001707 Ga0495680_0001707_11660_12511 265
344 3300047471 Ga0495684_0001171 Ga0495684_0001171_829_1680 265
345 3300048907 Ga0496104_0129292 Ga0496104_0129292_847_1671 265
346 3300048913 Ga0496110_0088630 Ga0496110_0088630_1434_2258 265
347 3300048917 Ga0496114_0041487 Ga0496114_0041487_1697_2521 265
348 3300048918 Ga0496115_0131344 Ga0496115_0131344_653_1477 265
349 3300048928 Ga0496125_0022365 Ga0496125_0022365_488_1312 265
350 3300048929 Ga0496126_0001259 Ga0496126_0001259_19338_20162 265
351 3300049568 Ga0501031_0315137 Ga0501031_0315137_188_994 265
352 3300049570 Ga0501033_0110486 Ga0501033_0110486_1173_1979 265
353 3300049571 Ga0501034_0054151 Ga0501034_0054151_3164_3979 265
354 3300049572 Ga0501036_0010427 Ga0501036_0010427_3701_4507 265
355 3300049574 Ga0501038_0058696 Ga0501038_0058696_1485_2291 265
356 3300049575 Ga0501039_0007774 Ga0501039_0007774_92_898 265
357 3300049576 Ga0501040_0025342 Ga0501040_0025342_582_1388 265
358 3300049577 Ga0501041_0051080 Ga0501041_0051080_989_1795 265
359 3300049578 Ga0501042_0088991 Ga0501042_0088991_516_1322 265
360 3300049580 Ga0501046_0011523 Ga0501046_0011523_4387_5193 265
361 3300049582 Ga0501048_0056505 Ga0501048_0056505_1930_2736 265
362 3300049583 Ga0501067_0012016 Ga0501067_0012016_2785_3591 265
363 3300049587 Ga0501071_0009643 Ga0501071_0009643_4371_5177 265
364 3300049588 Ga0501072_0009667 Ga0501072_0009667_3363_4169 265
365 3300049590 Ga0501074_0245567 Ga0501074_0245567_175_981 265
366 3300049592 Ga0501076_0046193 Ga0501076_0046193_1762_2568 265
367 3300049593 Ga0501077_0004702 Ga0501077_0004702_7135_7941 265
368 3300049741 Ga0501079_0285049 Ga0501079_0285049_260_1066 265
369 3300049743 Ga0501081_0048092 Ga0501081_0048092_22_828 265
370 3300049824 Ga0501045_0012436 Ga0501045_0012436_2495_3301 265
371 3300050491 nmdc:mga00v17_4840_c1 nmdc:mga00v17_4840_c1_1991_2797 265
372 3300050507 nmdc:mga05p37_85493_c1 nmdc:mga05p37_85493_c1_898_1710 265
373 3300050508 nmdc:mga09592_38642_c1 nmdc:mga09592_38642_c1_2555_3367 265
374 3300050510 nmdc:mga06r32_26484_c1 nmdc:mga06r32_26484_c1_2806_3618 265
375 3300050511 nmdc:mga08y16_6662_c1 nmdc:mga08y16_6662_c1_1610_2419 265
376 3300053077 Ga0495601_0234603 Ga0495601_0234603_65_886 265
377 3300053142 Ga0500577_0005383 Ga0500577_0005383_921_1730 265
378 3300054114 Ga0501084_0158021 Ga0501084_0158021_495_1301 265
379 3300060353 Ga0501082_0212370 Ga0501082_0212370_261_1067 265
380 3300061734 Ga0530510_0080158 Ga0530510_0080158_102_908 265
381 iso_pu_bacteria 2856287931 2856293180 265
382 iso_pu_bacteria 2857357740 2857366703 265
383 iso_pu_bacteria 2881101125 2881101382 265
384 3300001976 JGI24752J21851_1001132 JGI24752J21851_10011323 266
385 3300005289 Ga0065704_10099041 Ga0065704_100990412 266
386 3300005295 Ga0065707_10084019 Ga0065707_100840196 266
387 3300005295 Ga0065707_10109259 Ga0065707_101092593 266
388 3300005330 Ga0070690_100057056 Ga0070690_1000570561 266
389 3300005331 Ga0070670_100168692 Ga0070670_1001686921 266
390 3300005334 Ga0068869_100111490 Ga0068869_1001114902 266
391 3300005353 Ga0070669_100139936 Ga0070669_1001399362 266
392 3300005355 Ga0070671_100000116 Ga0070671_10000011652 266
393 3300005355 Ga0070671_100205104 Ga0070671_1002051042 266
394 3300005435 Ga0070714_100015447 Ga0070714_1000154477 266
395 3300005436 Ga0070713_100051144 Ga0070713_1000511443 266
396 3300005436 Ga0070713_100146241 Ga0070713_1001462412 266
397 3300005437 Ga0070710_10214560 Ga0070710_102145602 266
398 3300005439 Ga0070711_100152938 Ga0070711_1001529382 266
399 3300005441 Ga0070700_100142279 Ga0070700_1001422793 266
400 3300005458 Ga0070681_10144789 Ga0070681_101447891 266
401 3300005471 Ga0070698_100140405 Ga0070698_1001404051 266
402 3300005530 Ga0070679_100126789 Ga0070679_1001267894 266
403 3300005539 Ga0068853_100194311 Ga0068853_1001943111 266
404 3300005548 Ga0070665_100192006 Ga0070665_1001920062 266
405 3300005577 Ga0068857_100104335 Ga0068857_1001043351 266
406 3300005578 Ga0068854_100000322 Ga0068854_10000032219 266
407 3300005614 Ga0068856_100004551 Ga0068856_1000045516 266
408 3300005616 Ga0068852_100002126 Ga0068852_1000021267 266
409 3300005719 Ga0068861_100400239 Ga0068861_1004002392 266
410 3300005841 Ga0068863_100055235 Ga0068863_1000552353 266
411 3300005841 Ga0068863_100148142 Ga0068863_1001481422 266
412 3300005841 Ga0068863_100271392 Ga0068863_1002713922 266
413 3300005842 Ga0068858_100036714 Ga0068858_1000367142 266
414 3300005843 Ga0068860_100031345 Ga0068860_1000313456 266
415 3300005937 Ga0081455_10233157 Ga0081455_102331571 266
416 3300006028 Ga0070717_10023926 Ga0070717_100239264 266
417 3300006028 Ga0070717_10316430 Ga0070717_103164301 266
418 3300006163 Ga0070715_10054017 Ga0070715_100540173 266
419 3300006173 Ga0070716_100170113 Ga0070716_1001701132 266
420 3300006173 Ga0070716_100177972 Ga0070716_1001779722 266
421 3300006175 Ga0070712_100287344 Ga0070712_1002873441 266
422 3300006353 Ga0075370_10004418 Ga0075370_100044182 266
423 3300006844 Ga0075428_100036276 Ga0075428_1000362766 266
424 3300007788 Ga0099795_10052977 Ga0099795_100529771 266
425 3300009011 Ga0105251_10164882 Ga0105251_101648821 266
426 3300009093 Ga0105240_10023389 Ga0105240_100233896 266
427 3300009093 Ga0105240_10352537 Ga0105240_103525371 266
428 3300009093 Ga0105240_10492903 Ga0105240_104929031 266
429 3300009094 Ga0111539_10107858 Ga0111539_101078582 266
430 3300009101 Ga0105247_10168835 Ga0105247_101688352 266
431 3300009147 Ga0114129_10216271 Ga0114129_102162712 266
432 3300009148 Ga0105243_10587666 Ga0105243_105876661 266
433 3300009176 Ga0105242_10406871 Ga0105242_104068712 266
434 3300009177 Ga0105248_10050024 Ga0105248_100500243 266
435 3300009177 Ga0105248_10559668 Ga0105248_105596682 266
436 3300009551 Ga0105238_10006388 Ga0105238_100063884 266
437 3300009551 Ga0105238_10180200 Ga0105238_101802002 266
438 3300009553 Ga0105249_10008804 Ga0105249_100088047 266
439 3300010375 Ga0105239_10204393 Ga0105239_102043933 266
440 3300010375 Ga0105239_10304977 Ga0105239_103049773 266
441 3300013105 Ga0157369_10418597 Ga0157369_104185972 266
442 3300013105 Ga0157369_10845726 Ga0157369_108457261 266
443 3300013306 Ga0163162_10029661 Ga0163162_100296612 266
444 3300013306 Ga0163162_10877805 Ga0163162_108778052 266
445 3300014325 Ga0163163_10073929 Ga0163163_100739292 266
446 3300014326 Ga0157380_10000486 Ga0157380_1000048610 266
447 3300014497 Ga0182008_10004538 Ga0182008_100045389 266
448 3300014968 Ga0157379_10000433 Ga0157379_1000043317 266
449 3300017792 Ga0163161_10199378 Ga0163161_101993781 266
450 3300021388 Ga0213875_10000232 Ga0213875_1000023213 266
451 3300021441 Ga0213871_10000400 Ga0213871_100004005 266
452 3300021441 Ga0213871_10035768 Ga0213871_100357682 266
453 3300025735 Ga0207713_1106991 Ga0207713_11069911 266
454 3300025903 Ga0207680_10022475 Ga0207680_100224751 266
455 3300025904 Ga0207647_10003676 Ga0207647_100036766 266
456 3300025905 Ga0207685_10027520 Ga0207685_100275202 266
457 3300025909 Ga0207705_10000007 Ga0207705_10000007459 266
458 3300025912 Ga0207707_10094095 Ga0207707_100940952 266
459 3300025913 Ga0207695_10009783 Ga0207695_100097838 266
460 3300025913 Ga0207695_10332928 Ga0207695_103329282 266
461 3300025915 Ga0207693_10002285 Ga0207693_1000228516 266
462 3300025915 Ga0207693_10043926 Ga0207693_100439264 266
463 3300025915 Ga0207693_10087320 Ga0207693_100873202 266
464 3300025915 Ga0207693_10139029 Ga0207693_101390293 266
465 3300025916 Ga0207663_10372360 Ga0207663_103723601 266
466 3300025920 Ga0207649_10232619 Ga0207649_102326192 266
467 3300025921 Ga0207652_10406166 Ga0207652_104061661 266
468 3300025923 Ga0207681_10084247 Ga0207681_100842472 266
469 3300025924 Ga0207694_10032894 Ga0207694_100328943 266
470 3300025924 Ga0207694_10342879 Ga0207694_103428792 266
471 3300025928 Ga0207700_10115729 Ga0207700_101157292 266
472 3300025931 Ga0207644_10005965 Ga0207644_100059654 266
473 3300025931 Ga0207644_10272837 Ga0207644_102728372 266
474 3300025933 Ga0207706_10201795 Ga0207706_102017952 266
475 3300025941 Ga0207711_10186561 Ga0207711_101865613 266
476 3300025949 Ga0207667_10039999 Ga0207667_100399992 266
477 3300025960 Ga0207651_10303898 Ga0207651_103038982 266
478 3300025961 Ga0207712_10015813 Ga0207712_100158134 266
479 3300025981 Ga0207640_10000501 Ga0207640_1000050120 266
480 3300025986 Ga0207658_10098964 Ga0207658_100989642 266
481 3300026075 Ga0207708_10010222 Ga0207708_100102226 266
482 3300026078 Ga0207702_10569186 Ga0207702_105691862 266
483 3300026088 Ga0207641_10017244 Ga0207641_100172445 266
484 3300026088 Ga0207641_10038781 Ga0207641_100387812 266
485 3300026095 Ga0207676_10243871 Ga0207676_102438712 266
486 3300026118 Ga0207675_100071634 Ga0207675_1000716342 266
487 3300026142 Ga0207698_10000305 Ga0207698_1000030514 266
488 3300028379 Ga0268266_10090088 Ga0268266_100900882 266
489 3300028379 Ga0268266_10629968 Ga0268266_106299681 266
490 3300028556 Ga0265337_1042720 Ga0265337_10427201 266
491 3300028800 Ga0265338_10097071 Ga0265338_100970711 266
492 3300031456 Ga0307513_10008709 Ga0307513_1000870911 266
493 3300031548 Ga0307408_100251625 Ga0307408_1002516252 266
494 3300031731 Ga0307405_10085526 Ga0307405_100855263 266
495 3300031911 Ga0307412_10011660 Ga0307412_100116606 266
496 3300035088 Ga0373940_0002375 Ga0373940_0002375_58_867 266
497 3300035112 Ga0373932_0005235 Ga0373932_0005235_1405_2214 266
498 3300035114 Ga0373939_0003794 Ga0373939_0003794_711_1520 266
499 3300035121 Ga0373960_0015609 Ga0373960_0015609_522_1331 266
500 3300035172 Ga0373955_0050854 Ga0373955_0050854_860_1666 266
501 3300035241 Ga0373961_0004204 Ga0373961_0004204_1835_2644 266
502 3300035410 Ga0373924_0134631 Ga0373924_0134631_134_940 266
503 3300035691 Ga0373931_0016291 Ga0373931_0016291_319_1128 266
504 3300035724 Ga0373933_0209356 Ga0373933_0209356_301_1107 266
505 3300037068 Ga0373925_0420146 Ga0373925_0420146_60_872 266
506 3300037471 Ga0395905_0015473 Ga0395905_0015473_1877_2686 266
507 3300037853 Ga0436364_0990344 Ga0436364_0990344_46681_47490 266
508 3300037853 Ga0436364_1213864 Ga0436364_1213864_2414_3226 266
509 3300038443 Ga0395901_0475085 Ga0395901_0475085_144_953 266
510 3300039437 Ga0436365_0145774 Ga0436365_0145774_4470_5279 266
511 3300039437 Ga0436365_1254597 Ga0436365_1254597_656_1465 266
512 3300039438 Ga0436360_0777953 Ga0436360_0777953_3865_4671 266
513 3300039438 Ga0436360_1356287 Ga0436360_1356287_744_1550 266
514 3300039447 Ga0436361_0221853 Ga0436361_0221853_196_1002 266
515 3300039447 Ga0436361_0662945 Ga0436361_0662945_32_841 266
516 3300039447 Ga0436361_0740576 Ga0436361_0740576_1102_1908 266
517 3300039450 Ga0436363_0274442 Ga0436363_0274442_401_1267 266
518 3300039453 Ga0436362_1084147 Ga0436362_1084147_406_1215 266
519 3300041404 Ga0439436_0000964 Ga0439436_0000964_94_909 266
520 3300041406 Ga0439439_0004111 Ga0439439_0004111_108_923 266
521 3300041491 Ga0451833_1041486 Ga0451833_1041486_1436_2245 266
522 3300041496 Ga0451839_0251557 Ga0451839_0251557_788_1597 266
523 3300041498 Ga0451841_0086406 Ga0451841_0086406_800_1609 266
524 3300041509 Ga0451843_1359299 Ga0451843_1359299_229_1038 266
525 3300041997 Ga0439431_0017259 Ga0439431_0017259_411_1226 266
526 3300042007 Ga0439449_0000112 Ga0439449_0000112_8657_9472 266
527 3300042010 Ga0439452_006772 Ga0439452_006772_1196_2011 266
528 3300042011 Ga0439454_009380 Ga0439454_009380_300_1115 266
529 3300042015 Ga0439462_0025976 Ga0439462_0025976_249_1064 266
530 3300042125 Ga0450923_011270 Ga0450923_011270_561_1376 266
531 3300042128 Ga0450897_005192 Ga0450897_005192_174_989 266
532 3300042133 Ga0450896_006912 Ga0450896_006912_546_1361 266
533 3300042145 Ga0450906_006297 Ga0450906_006297_680_1495 266
534 3300042156 Ga0439446_0008817 Ga0439446_0008817_412_1227 266
535 3300042185 Ga0450909_005880 Ga0450909_005880_226_1041 266
536 3300042435 Ga0439434_0005729 Ga0439434_0005729_1691_2506 266
537 3300042876 Ga0451577_0640608 Ga0451577_0640608_48_854 266
538 3300046533 Ga0495640_0259715 Ga0495640_0259715_258_1070 266
539 3300048903 Ga0496100_0015657 Ga0496100_0015657_2446_3255 266
540 3300048903 Ga0496100_0410692 Ga0496100_0410692_165_968 266
541 3300048905 Ga0496102_0014399 Ga0496102_0014399_3609_4418 266
542 3300048907 Ga0496104_0022590 Ga0496104_0022590_2659_3468 266
543 3300048908 Ga0496105_0021301 Ga0496105_0021301_3753_4562 266
544 3300048909 Ga0496106_0000392 Ga0496106_0000392_2846_3655 266
545 3300048910 Ga0496107_0003945 Ga0496107_0003945_6935_7744 266
546 3300048911 Ga0496108_0090903 Ga0496108_0090903_1056_1865 266
547 3300048912 Ga0496109_0082126 Ga0496109_0082126_1487_2293 266
548 3300048912 Ga0496109_0165496 Ga0496109_0165496_1124_1933 266
549 3300048913 Ga0496110_0182288 Ga0496110_0182288_73_882 266
550 3300048915 Ga0496112_0000224 Ga0496112_0000224_23761_24570 266
551 3300048916 Ga0496113_0000540 Ga0496113_0000540_13545_14354 266
552 3300048921 Ga0496118_0083663 Ga0496118_0083663_862_1671 266
553 3300048923 Ga0496120_0000122 Ga0496120_0000122_4722_5531 266
554 3300048924 Ga0496121_0041765 Ga0496121_0041765_362_1171 266
555 3300048925 Ga0496122_0271464 Ga0496122_0271464_84_905 266
556 3300048927 Ga0496124_0000007 Ga0496124_0000007_749528_750349 266
557 3300048929 Ga0496126_0018649 Ga0496126_0018649_2162_2968 266
558 3300049572 Ga0501036_0588219 Ga0501036_0588219_94_903 266
559 3300049581 Ga0501047_0085650 Ga0501047_0085650_1959_2768 266
560 3300049586 Ga0501070_0146296 Ga0501070_0146296_571_1380 266
561 3300049586 Ga0501070_0362206 Ga0501070_0362206_301_1107 266
562 3300049593 Ga0501077_0033984 Ga0501077_0033984_502_1311 266
563 3300049743 Ga0501081_0072230 Ga0501081_0072230_1461_2270 266
564 3300049822 Ga0501035_0008018 Ga0501035_0008018_6244_7053 266
565 3300049822 Ga0501035_0125934 Ga0501035_0125934_568_1377 266
566 3300049823 Ga0501044_0055019 Ga0501044_0055019_128_937 266
567 3300050489 nmdc:mga03683_16511_c1 nmdc:mga03683_16511_c1_1886_2701 266
568 3300050490 nmdc:mga03n38_92293_c1 nmdc:mga03n38_92293_c1_35_850 266
569 3300050493 nmdc:mga0k408_85365_c1 nmdc:mga0k408_85365_c1_857_1672 266
570 3300050496 nmdc:mga07m45_60928_c1 nmdc:mga07m45_60928_c1_845_1660 266
571 3300050507 nmdc:mga05p37_463939_c1 nmdc:mga05p37_463939_c1_485_1294 266
572 3300050511 nmdc:mga08y16_24351_c1 nmdc:mga08y16_24351_c1_2469_3278 266
573 iso_pu_bacteria 2599185292 2599904139 266
574 iso_pu_bacteria 2643221569 2643861336 266
575 iso_pu_bacteria 2643221594 2643983123 266
576 iso_pu_bacteria 2643221621 2644120534 266
577 iso_pu_bacteria 2808606395 2809032894 266
578 iso_pu_bacteria 2857537821 2857537828 266
579 iso_pu_bacteria 2941479691 2941482884 266
580 3300002459 JGI24751J29686_10002622 JGI24751J29686_100026221 267
581 3300005335 Ga0070666_10135206 Ga0070666_101352061 267
582 3300005347 Ga0070668_100309442 Ga0070668_1003094422 267
583 3300005355 Ga0070671_100000108 Ga0070671_1000001085 267
584 3300005367 Ga0070667_100002350 Ga0070667_1000023506 267
585 3300005548 Ga0070665_100005505 Ga0070665_1000055056 267
586 3300005563 Ga0068855_100000794 Ga0068855_1000007949 267
587 3300005577 Ga0068857_100296440 Ga0068857_1002964402 267
588 3300005614 Ga0068856_100034764 Ga0068856_1000347643 267
589 3300005617 Ga0068859_100000143 Ga0068859_10000014337 267
590 3300005617 Ga0068859_100364670 Ga0068859_1003646702 267
591 3300005617 Ga0068859_100492521 Ga0068859_1004925212 267
592 3300005618 Ga0068864_100007552 Ga0068864_1000075525 267
593 3300005618 Ga0068864_100055380 Ga0068864_1000553804 267
594 3300005841 Ga0068863_100000014 Ga0068863_10000001457 267
595 3300005842 Ga0068858_100000451 Ga0068858_1000004515 267
596 3300005842 Ga0068858_100016746 Ga0068858_1000167463 267
597 3300005842 Ga0068858_100047848 Ga0068858_1000478482 267
598 3300005842 Ga0068858_100686047 Ga0068858_1006860471 267
599 3300005843 Ga0068860_100000007 Ga0068860_100000007178 267
600 3300005844 Ga0068862_100012958 Ga0068862_1000129587 267
601 3300006177 Ga0075362_10007481 Ga0075362_100074815 267
602 3300006353 Ga0075370_10050113 Ga0075370_100501131 267
603 3300006931 Ga0097620_100000143 Ga0097620_10000014337 267
604 3300006931 Ga0097620_100364653 Ga0097620_1003646531 267
605 3300006931 Ga0097620_100492472 Ga0097620_1004924722 267
606 3300009177 Ga0105248_10229572 Ga0105248_102295722 267
607 3300009551 Ga0105238_10009753 Ga0105238_100097534 267
608 3300013306 Ga0163162_10070034 Ga0163162_100700345 267
609 3300014325 Ga0163163_10009652 Ga0163163_100096523 267
610 3300014325 Ga0163163_10051764 Ga0163163_100517643 267
611 3300014968 Ga0157379_10013089 Ga0157379_100130895 267
612 3300025900 Ga0207710_10000319 Ga0207710_1000031926 267
613 3300025903 Ga0207680_10047043 Ga0207680_100470433 267
614 3300025903 Ga0207680_10057382 Ga0207680_100573822 267
615 3300025941 Ga0207711_10149795 Ga0207711_101497951 267
616 3300025941 Ga0207711_10151905 Ga0207711_101519052 267
617 3300025949 Ga0207667_10016679 Ga0207667_100166797 267
618 3300025961 Ga0207712_10165948 Ga0207712_101659482 267
619 3300025986 Ga0207658_10003671 Ga0207658_100036719 267
620 3300025986 Ga0207658_10019163 Ga0207658_100191634 267
621 3300026035 Ga0207703_10009191 Ga0207703_100091915 267
622 3300026035 Ga0207703_10025731 Ga0207703_100257314 267
623 3300026035 Ga0207703_10030722 Ga0207703_100307222 267
624 3300026035 Ga0207703_10628927 Ga0207703_106289271 267
625 3300026088 Ga0207641_10000126 Ga0207641_1000012646 267
626 3300026088 Ga0207641_10018234 Ga0207641_100182345 267
627 3300026088 Ga0207641_10061761 Ga0207641_100617613 267
628 3300026095 Ga0207676_10025201 Ga0207676_100252014 267
629 3300028379 Ga0268266_10138059 Ga0268266_101380592 267
630 3300028380 Ga0268265_10008961 Ga0268265_100089612 267
631 3300028380 Ga0268265_10068124 Ga0268265_100681243 267
632 3300028381 Ga0268264_10000077 Ga0268264_1000007761 267
633 3300028381 Ga0268264_10015126 Ga0268264_100151262 267
634 3300028794 Ga0307515_10000572 Ga0307515_1000057277 267
635 3300028794 Ga0307515_10112782 Ga0307515_101127822 267
636 3300028800 Ga0265338_10000335 Ga0265338_1000033522 267
637 3300028800 Ga0265338_10000344 Ga0265338_1000034456 267
638 3300031238 Ga0265332_10009960 Ga0265332_100099603 267
639 3300031251 Ga0265327_10001877 Ga0265327_1000187714 267
640 3300031456 Ga0307513_10077630 Ga0307513_100776303 267
641 3300031456 Ga0307513_10102556 Ga0307513_101025562 267
642 3300031730 Ga0307516_10000363 Ga0307516_1000036312 267
643 3300031911 Ga0307412_10013244 Ga0307412_100132442 267
644 3300032005 Ga0307411_10256427 Ga0307411_102564272 267
645 3300035398 Ga0316574_0114321 Ga0316574_0114321_70_879 267
646 3300037471 Ga0395905_0070355 Ga0395905_0070355_48_857 267
647 3300037853 Ga0436364_1004440 Ga0436364_1004440_3694_4497 267
648 3300038443 Ga0395901_0000002 Ga0395901_0000002_11741_12586 267
649 3300041404 Ga0439436_0006549 Ga0439436_0006549_2628_3455 267
650 3300041405 Ga0439438_016077 Ga0439438_016077_137_964 267
651 3300041411 Ga0439466_0010789 Ga0439466_0010789_349_1176 267
652 3300041999 Ga0439433_0004061 Ga0439433_0004061_1330_2157 267
653 3300042007 Ga0439449_0002521 Ga0439449_0002521_1287_2114 267
654 3300042131 Ga0450894_001878 Ga0450894_001878_570_1397 267
655 3300042156 Ga0439446_0013665 Ga0439446_0013665_70_897 267
656 3300042435 Ga0439434_0026127 Ga0439434_0026127_206_1033 267
657 3300044656 Ga0466969_0051183 Ga0466969_0051183_484_1293 267
658 3300044684 Ga0466966_0001397 Ga0466966_0001397_2061_2870 267
659 3300044684 Ga0466966_0147501 Ga0466966_0147501_342_1169 267
660 3300045049 Ga0466959_0192552 Ga0466959_0192552_554_1363 267
661 3300046460 Ga0495638_0001336 Ga0495638_0001336_15844_16653 267
662 3300046474 Ga0495605_0103109 Ga0495605_0103109_157_984 267
663 3300046477 Ga0495664_0049115 Ga0495664_0049115_1350_2177 267
664 3300046491 Ga0495584_0023741 Ga0495584_0023741_106_921 267
665 3300046506 Ga0495583_0000481 Ga0495583_0000481_27871_28686 267
666 3300046516 Ga0495628_0094397 Ga0495628_0094397_559_1386 267
667 3300046535 Ga0495586_0084649 Ga0495586_0084649_221_1048 267
668 3300046543 Ga0495645_0062903 Ga0495645_0062903_582_1409 267
669 3300046660 Ga0495625_0019320 Ga0495625_0019320_3169_3978 267
670 3300046678 Ga0495599_0101840 Ga0495599_0101840_851_1678 267
671 3300046692 Ga0495671_0102524 Ga0495671_0102524_189_1016 267
672 3300047319 Ga0495674_0021311 Ga0495674_0021311_4197_5024 267
673 3300047320 Ga0495672_0004625 Ga0495672_0004625_8895_9722 267
674 3300047469 Ga0495673_0028533 Ga0495673_0028533_703_1530 267
675 3300047472 Ga0495686_0000014 Ga0495686_0000014_67528_68355 267
676 3300048905 Ga0496102_0210892 Ga0496102_0210892_571_1395 267
677 3300048905 Ga0496102_0273317 Ga0496102_0273317_123_935 267
678 3300048907 Ga0496104_0046592 Ga0496104_0046592_3214_4026 267
679 3300048908 Ga0496105_0004419 Ga0496105_0004419_5561_6373 267
680 3300048915 Ga0496112_0057636 Ga0496112_0057636_2976_3800 267
681 3300048922 Ga0496119_0087762 Ga0496119_0087762_690_1502 267
682 3300048923 Ga0496120_0000197 Ga0496120_0000197_45911_46723 267
683 3300048924 Ga0496121_0000747 Ga0496121_0000747_49309_50133 267
684 3300048924 Ga0496121_0020006 Ga0496121_0020006_1590_2399 267
685 3300048924 Ga0496121_0262294 Ga0496121_0262294_317_1129 267
686 3300048928 Ga0496125_0004601 Ga0496125_0004601_14279_15103 267
687 3300049569 Ga0501032_0043691 Ga0501032_0043691_515_1330 267
688 3300049570 Ga0501033_0034822 Ga0501033_0034822_2885_3694 267
689 3300049571 Ga0501034_0037950 Ga0501034_0037950_291_1121 267
690 3300049571 Ga0501034_0149937 Ga0501034_0149937_1382_2197 267
691 3300049572 Ga0501036_0566040 Ga0501036_0566040_43_852 267
692 3300049573 Ga0501037_0023645 Ga0501037_0023645_3693_4508 267
693 3300049574 Ga0501038_0006734 Ga0501038_0006734_2256_3071 267
694 3300049579 Ga0501043_0014175 Ga0501043_0014175_2161_2976 267
695 3300049581 Ga0501047_0201794 Ga0501047_0201794_875_1690 267
696 3300049586 Ga0501070_0099916 Ga0501070_0099916_20_835 267
697 3300049823 Ga0501044_0095456 Ga0501044_0095456_341_1156 267
698 3300050496 nmdc:mga07m45_2716_c1 nmdc:mga07m45_2716_c1_305_1132 267
699 3300053119 Ga0500595_024835 Ga0500595_024835_1169_1978 267
700 3300053178 Ga0500637_0047407 Ga0500637_0047407_1587_2396 267
701 iso_pu_bacteria 2513237151 2513959144 267
702 iso_pu_bacteria 2513237166 2514048847 267
703 iso_pu_bacteria 2562617112 2563055192 267
704 iso_pu_bacteria 2711768613 2713479167 267
705 iso_pu_bacteria 2744054900 2746086444 267
706 iso_pu_bacteria 2744054901 2746093444 267
707 iso_pu_bacteria 2791355137 2792834769 267
708 iso_pu_bacteria 2818991450 2819623854 267
709 iso_pu_bacteria 2842324504 2842331745 267
710 iso_pu_bacteria 2842348783 2842356058 267
711 iso_pu_bacteria 2842454564 2842459257 267
712 iso_pu_bacteria 2900634093 2900636490 267
713 iso_pu_bacteria 2904615490 2904619156 267
714 iso_pu_bacteria 2921643360 2921646655 267
715 iso_pu_bacteria 2928108538 2928109420 267
716 iso_pu_bacteria 2928135762 2928137126 267
717 iso_pu_bacteria 2928503688 2928506653 267
718 iso_pu_bacteria 2935694250 2935699114 267
719 iso_pu_bacteria 2935769743 2935776704 267
720 iso_pu_bacteria 2935785616 2935792606 267
721 iso_pu_bacteria 2935793552 2935800598 267
722 iso_pu_bacteria 2935810662 2935816376 267
723 iso_pu_bacteria 2936037263 2936042671 267
724 iso_pu_bacteria 642555113 642620048 267
725 iso_pu_bacteria 8019555841 8019556450 267
726 iso_pu_bacteria 8019565922 8019568858 267
727 iso_pu_bacteria 8055266321 8055268085 267
728 3300001915 JGI24741J21665_1000002 JGI24741J21665_100000248 268
729 3300001979 JGI24740J21852_10000005 JGI24740J21852_1000000568 268
730 3300001990 JGI24737J22298_10000184 JGI24737J22298_100001844 268
731 3300002705 JGI25156J39149_1001067 JGI25156J39149_100106711 268
732 3300003354 JGI25160J50197_1000186 JGI25160J50197_100018632 268
733 3300005262 Ga0065165_1000589 Ga0065165_100058933 268
734 3300005327 Ga0070658_10000738 Ga0070658_1000073813 268
735 3300005334 Ga0068869_100071159 Ga0068869_1000711593 268
736 3300005338 Ga0068868_100100841 Ga0068868_1001008413 268
737 3300005339 Ga0070660_100007378 Ga0070660_1000073784 268
738 3300005344 Ga0070661_100002371 Ga0070661_1000023719 268
739 3300005364 Ga0070673_100152392 Ga0070673_1001523922 268
740 3300005366 Ga0070659_100001817 Ga0070659_1000018174 268
741 3300005439 Ga0070711_100058759 Ga0070711_1000587592 268
742 3300005445 Ga0070708_100503186 Ga0070708_1005031861 268
743 3300005455 Ga0070663_100002745 Ga0070663_1000027456 268
744 3300005457 Ga0070662_100116823 Ga0070662_1001168231 268
745 3300005459 Ga0068867_100314202 Ga0068867_1003142021 268
746 3300005467 Ga0070706_100280170 Ga0070706_1002801702 268
747 3300005535 Ga0070684_100176235 Ga0070684_1001762352 268
748 3300005539 Ga0068853_100047725 Ga0068853_1000477252 268
749 3300005548 Ga0070665_100298724 Ga0070665_1002987241 268
750 3300005564 Ga0070664_100052359 Ga0070664_1000523594 268
751 3300005577 Ga0068857_100005815 Ga0068857_1000058154 268
752 3300005577 Ga0068857_100053144 Ga0068857_1000531442 268
753 3300005578 Ga0068854_100054275 Ga0068854_1000542752 268
754 3300005616 Ga0068852_100002464 Ga0068852_1000024646 268
755 3300005616 Ga0068852_100020571 Ga0068852_1000205713 268
756 3300005616 Ga0068852_100033295 Ga0068852_1000332951 268
757 3300005937 Ga0081455_10008960 Ga0081455_100089605 268
758 3300005983 Ga0081540_1002176 Ga0081540_100217612 268
759 3300005983 Ga0081540_1004082 Ga0081540_100408211 268
760 3300005983 Ga0081540_1011818 Ga0081540_10118184 268
761 3300005983 Ga0081540_1019729 Ga0081540_10197294 268
762 3300005983 Ga0081540_1021183 Ga0081540_10211833 268
763 3300006028 Ga0070717_10005151 Ga0070717_100051512 268
764 3300006178 Ga0075367_10065828 Ga0075367_100658284 268
765 3300006195 Ga0075366_10030068 Ga0075366_100300684 268
766 3300009093 Ga0105240_10047592 Ga0105240_100475923 268
767 3300009093 Ga0105240_10084950 Ga0105240_100849502 268
768 3300009093 Ga0105240_10094883 Ga0105240_100948832 268
769 3300009093 Ga0105240_10279136 Ga0105240_102791362 268
770 3300009101 Ga0105247_10281234 Ga0105247_102812342 268
771 3300009148 Ga0105243_10505515 Ga0105243_105055151 268
772 3300009174 Ga0105241_10000339 Ga0105241_1000033918 268
773 3300009174 Ga0105241_10202966 Ga0105241_102029662 268
774 3300009177 Ga0105248_10087893 Ga0105248_100878932 268
775 3300009545 Ga0105237_10006725 Ga0105237_100067255 268
776 3300009545 Ga0105237_10018482 Ga0105237_100184828 268
777 3300009551 Ga0105238_10005126 Ga0105238_1000512610 268
778 3300009551 Ga0105238_10133623 Ga0105238_101336231 268
779 3300009551 Ga0105238_10195413 Ga0105238_101954131 268
780 3300010375 Ga0105239_10008802 Ga0105239_100088025 268
781 3300010375 Ga0105239_10025558 Ga0105239_100255584 268
782 3300010375 Ga0105239_10166198 Ga0105239_101661984 268
783 3300010375 Ga0105239_10809552 Ga0105239_108095522 268
784 3300013100 Ga0157373_10047529 Ga0157373_100475292 268
785 3300013102 Ga0157371_10000111 Ga0157371_1000011168 268
786 3300013105 Ga0157369_10000198 Ga0157369_1000019847 268
787 3300013105 Ga0157369_10000547 Ga0157369_100005479 268
788 3300013105 Ga0157369_10016581 Ga0157369_100165817 268
789 3300013105 Ga0157369_10036200 Ga0157369_100362004 268
790 3300013105 Ga0157369_10242129 Ga0157369_102421292 268
791 3300013306 Ga0163162_10514409 Ga0163162_105144091 268
792 3300013307 Ga0157372_10831096 Ga0157372_108310961 268
793 3300020069 Ga0197907_10093668 Ga0197907_100936681 268
794 3300020081 Ga0206354_10117369 Ga0206354_101173692 268
795 3300020082 Ga0206353_10353987 Ga0206353_103539873 268
796 3300020082 Ga0206353_11308596 Ga0206353_113085961 268
797 3300022467 Ga0224712_10000029 Ga0224712_1000002913 268
798 3300025256 Ga0209759_1000200 Ga0209759_100020076 268
799 3300025295 Ga0209564_1007173 Ga0209564_10071735 268
800 3300025297 Ga0209758_1000015 Ga0209758_1000015502 268
801 3300025302 Ga0207426_1000007 Ga0207426_1000007365 268
802 3300025321 Ga0207656_10001030 Ga0207656_100010303 268
803 3300025735 Ga0207713_1000089 Ga0207713_100008930 268
804 3300025735 Ga0207713_1000106 Ga0207713_1000106123 268
805 3300025904 Ga0207647_10003157 Ga0207647_1000315712 268
806 3300025904 Ga0207647_10011500 Ga0207647_100115004 268
807 3300025904 Ga0207647_10047293 Ga0207647_100472932 268
808 3300025907 Ga0207645_10100473 Ga0207645_101004734 268
809 3300025909 Ga0207705_10002837 Ga0207705_100028379 268
810 3300025909 Ga0207705_10135889 Ga0207705_101358892 268
811 3300025911 Ga0207654_10001428 Ga0207654_100014286 268
812 3300025911 Ga0207654_10084065 Ga0207654_100840652 268
813 3300025913 Ga0207695_10001225 Ga0207695_1000122538 268
814 3300025913 Ga0207695_10017841 Ga0207695_100178415 268
815 3300025913 Ga0207695_10021230 Ga0207695_100212307 268
816 3300025914 Ga0207671_10000676 Ga0207671_1000067642 268
817 3300025914 Ga0207671_10004835 Ga0207671_100048359 268
818 3300025914 Ga0207671_10047020 Ga0207671_100470203 268
819 3300025914 Ga0207671_10256642 Ga0207671_102566422 268
820 3300025919 Ga0207657_10000074 Ga0207657_1000007418 268
821 3300025920 Ga0207649_10000887 Ga0207649_1000088710 268
822 3300025924 Ga0207694_10005711 Ga0207694_100057115 268
823 3300025932 Ga0207690_10000840 Ga0207690_1000084020 268
824 3300025933 Ga0207706_10097255 Ga0207706_100972551 268
825 3300025935 Ga0207709_10351115 Ga0207709_103511151 268
826 3300025941 Ga0207711_10086634 Ga0207711_100866342 268
827 3300025949 Ga0207667_10000004 Ga0207667_10000004570 268
828 3300025981 Ga0207640_10002751 Ga0207640_100027518 268
829 3300025986 Ga0207658_10002723 Ga0207658_100027235 268
830 3300025986 Ga0207658_10131844 Ga0207658_101318442 268
831 3300026041 Ga0207639_10012292 Ga0207639_100122926 268
832 3300026067 Ga0207678_10000056 Ga0207678_1000005667 268
833 3300026078 Ga0207702_10000087 Ga0207702_1000008739 268
834 3300026089 Ga0207648_10437349 Ga0207648_104373492 268
835 3300026116 Ga0207674_10000121 Ga0207674_1000012118 268
836 3300026116 Ga0207674_10039575 Ga0207674_100395754 268
837 3300026142 Ga0207698_10003375 Ga0207698_100033755 268
838 3300026142 Ga0207698_10041936 Ga0207698_100419365 268
839 3300027312 Ga0209371_1004269 Ga0209371_10042693 268
840 3300028379 Ga0268266_10239784 Ga0268266_102397842 268
841 3300028800 Ga0265338_10025382 Ga0265338_100253827 268
842 3300029957 Ga0265324_10065890 Ga0265324_100658901 268
843 3300030500 Ga0268256_1002337 Ga0268256_10023373 268
844 3300031241 Ga0265325_10000379 Ga0265325_100003796 268
845 3300031344 Ga0265316_10093549 Ga0265316_100935492 268
846 3300031456 Ga0307513_10259565 Ga0307513_102595652 268
847 3300031548 Ga0307408_100000381 Ga0307408_10000038135 268
848 3300031595 Ga0265313_10000678 Ga0265313_1000067817 268
849 3300031730 Ga0307516_10007858 Ga0307516_1000785810 268
850 3300031901 Ga0307406_10003961 Ga0307406_100039615 268
851 3300031911 Ga0307412_10003319 Ga0307412_100033195 268
852 3300031995 Ga0307409_100474572 Ga0307409_1004745721 268
853 3300032002 Ga0307416_100037381 Ga0307416_1000373812 268
854 3300032004 Ga0307414_10000185 Ga0307414_1000018528 268
855 3300032005 Ga0307411_10030158 Ga0307411_100301583 268
856 3300032005 Ga0307411_10080833 Ga0307411_100808333 268
857 3300035172 Ga0373955_0221080 Ga0373955_0221080_33_845 268
858 3300035724 Ga0373933_0265132 Ga0373933_0265132_92_904 268
859 3300036401 Ga0373937_0001887 Ga0373937_0001887_16599_17411 268
860 3300037068 Ga0373925_0022030 Ga0373925_0022030_145_963 268
861 3300037312 Ga0395899_0039445 Ga0395899_0039445_204_1055 268
862 3300037312 Ga0395899_0099922 Ga0395899_0099922_1020_1868 268
863 3300037418 Ga0395900_0000057 Ga0395900_0000057_124922_125770 268
864 3300037418 Ga0395900_0064451 Ga0395900_0064451_415_1266 268
865 3300037466 Ga0395898_0006875 Ga0395898_0006875_10559_11428 268
866 3300037466 Ga0395898_0154961 Ga0395898_0154961_1210_2061 268
867 3300037466 Ga0395898_0434618 Ga0395898_0434618_177_1025 268
868 3300037471 Ga0395905_0000014 Ga0395905_0000014_280401_281252 268
869 3300037471 Ga0395905_0270759 Ga0395905_0270759_206_1057 268
870 3300037471 Ga0395905_0598262 Ga0395905_0598262_163_993 268
871 3300038443 Ga0395901_0000113 Ga0395901_0000113_93625_94473 268
872 3300038443 Ga0395901_0000177 Ga0395901_0000177_73191_74042 268
873 3300038443 Ga0395901_0019615 Ga0395901_0019615_3837_4706 268
874 3300039437 Ga0436365_0785175 Ga0436365_0785175_81_926 268
875 3300039438 Ga0436360_1340002 Ga0436360_1340002_649_1461 268
876 3300039450 Ga0436363_0877931 Ga0436363_0877931_1469_2506 268
877 3300039450 Ga0436363_1498526 Ga0436363_1498526_1225_2070 268
878 3300041407 Ga0439447_000125 Ga0439447_000125_15040_15876 268
879 3300042013 Ga0439456_001624 Ga0439456_001624_3471_4307 268
880 3300042532 Ga0450893_0005053 Ga0450893_0005053_996_1814 268
881 3300044656 Ga0466969_0012592 Ga0466969_0012592_708_1556 268
882 3300044658 Ga0466972_0021071 Ga0466972_0021071_1017_1868 268
883 3300044683 Ga0466965_0030838 Ga0466965_0030838_1471_2319 268
884 3300044684 Ga0466966_0000006 Ga0466966_0000006_34472_35320 268
885 3300044684 Ga0466966_0005729 Ga0466966_0005729_1053_1904 268
886 3300044684 Ga0466966_0064567 Ga0466966_0064567_162_1010 268
887 3300044693 Ga0466961_0000799 Ga0466961_0000799_15260_16108 268
888 3300044694 Ga0466963_0000688 Ga0466963_0000688_4175_5026 268
889 3300044694 Ga0466963_0035811 Ga0466963_0035811_572_1420 268
890 3300044706 Ga0466964_0000862 Ga0466964_0000862_786_1634 268
891 3300044719 Ga0466971_0003183 Ga0466971_0003183_2236_3084 268
892 3300044842 Ga0466957_0042055 Ga0466957_0042055_1801_2649 268
893 3300044842 Ga0466957_0162002 Ga0466957_0162002_36_887 268
894 3300045049 Ga0466959_0056076 Ga0466959_0056076_130_978 268
895 3300045049 Ga0466959_0085002 Ga0466959_0085002_668_1516 268
896 3300045836 Ga0466958_0008929 Ga0466958_0008929_3287_4135 268
897 3300046454 Ga0495592_0020483 Ga0495592_0020483_2123_2974 268
898 3300046455 Ga0495603_0044634 Ga0495603_0044634_1433_2368 268
899 3300046455 Ga0495603_0172096 Ga0495603_0172096_326_1213 268
900 3300046457 Ga0495590_0050981 Ga0495590_0050981_317_1162 268
901 3300046458 Ga0495591_000634 Ga0495591_000634_15631_16575 268
902 3300046459 Ga0495629_0000041 Ga0495629_0000041_29196_30083 268
903 3300046459 Ga0495629_0002085 Ga0495629_0002085_1749_2669 268
904 3300046459 Ga0495629_0006466 Ga0495629_0006466_3834_4778 268
905 3300046459 Ga0495629_0020326 Ga0495629_0020326_1860_2705 268
906 3300046459 Ga0495629_0023121 Ga0495629_0023121_775_1626 268
907 3300046460 Ga0495638_0009586 Ga0495638_0009586_3348_4235 268
908 3300046461 Ga0495641_0013087 Ga0495641_0013087_1899_2819 268
909 3300046462 Ga0495651_0059416 Ga0495651_0059416_357_1301 268
910 3300046462 Ga0495651_0069388 Ga0495651_0069388_186_1106 268
911 3300046462 Ga0495651_0112435 Ga0495651_0112435_960_1847 268
912 3300046462 Ga0495651_0159935 Ga0495651_0159935_750_1568 268
913 3300046463 Ga0495653_0001593 Ga0495653_0001593_10035_10922 268
914 3300046463 Ga0495653_0002973 Ga0495653_0002973_5472_6317 268
915 3300046463 Ga0495653_0009568 Ga0495653_0009568_3096_4016 268
916 3300046463 Ga0495653_0083664 Ga0495653_0083664_1273_2184 268
917 3300046471 Ga0495650_0010210 Ga0495650_0010210_3213_4076 268
918 3300046471 Ga0495650_0017107 Ga0495650_0017107_1535_2470 268
919 3300046472 Ga0495580_0000292 Ga0495580_0000292_31152_32072 268
920 3300046472 Ga0495580_0001078 Ga0495580_0001078_18329_19225 268
921 3300046472 Ga0495580_0002641 Ga0495580_0002641_1557_2444 268
922 3300046472 Ga0495580_0003482 Ga0495580_0003482_1053_1988 268
923 3300046472 Ga0495580_0030630 Ga0495580_0030630_2801_3652 268
924 3300046472 Ga0495580_0057182 Ga0495580_0057182_118_1062 268
925 3300046473 Ga0495582_0002227 Ga0495582_0002227_3780_4700 268
926 3300046473 Ga0495582_0211155 Ga0495582_0211155_133_984 268
927 3300046474 Ga0495605_0017241 Ga0495605_0017241_2658_3584 268
928 3300046474 Ga0495605_0044902 Ga0495605_0044902_1041_1928 268
929 3300046475 Ga0495639_0004269 Ga0495639_0004269_4615_5433 268
930 3300046476 Ga0495662_0008395 Ga0495662_0008395_85_1005 268
931 3300046476 Ga0495662_0095520 Ga0495662_0095520_559_1410 268
932 3300046477 Ga0495664_0053210 Ga0495664_0053210_654_1598 268
933 3300046477 Ga0495664_0061462 Ga0495664_0061462_832_1683 268
934 3300046491 Ga0495584_0139920 Ga0495584_0139920_250_1095 268
935 3300046499 Ga0495594_0068921 Ga0495594_0068921_302_1222 268
936 3300046500 Ga0495596_0001846 Ga0495596_0001846_1551_2495 268
937 3300046500 Ga0495596_0053225 Ga0495596_0053225_287_1138 268
938 3300046500 Ga0495596_0070611 Ga0495596_0070611_176_1021 268
939 3300046506 Ga0495583_0003634 Ga0495583_0003634_7712_8599 268
940 3300046507 Ga0495606_0004722 Ga0495606_0004722_1629_2474 268
941 3300046511 Ga0495608_0005018 Ga0495608_0005018_4258_5109 268
942 3300046513 Ga0495616_0069622 Ga0495616_0069622_337_1272 268
943 3300046514 Ga0495618_0002705 Ga0495618_0002705_5807_6658 268
944 3300046514 Ga0495618_0025581 Ga0495618_0025581_1101_2045 268
945 3300046514 Ga0495618_0267306 Ga0495618_0267306_178_1008 268
946 3300046516 Ga0495628_0010428 Ga0495628_0010428_1049_1936 268
947 3300046516 Ga0495628_0086625 Ga0495628_0086625_512_1456 268
948 3300046517 Ga0495630_0004630 Ga0495630_0004630_8579_9499 268
949 3300046517 Ga0495630_0006315 Ga0495630_0006315_2478_3323 268
950 3300046517 Ga0495630_0039120 Ga0495630_0039120_871_1806 268
951 3300046517 Ga0495630_0041362 Ga0495630_0041362_411_1355 268
952 3300046517 Ga0495630_0048964 Ga0495630_0048964_1128_1958 268
953 3300046517 Ga0495630_0467579 Ga0495630_0467579_21_908 268
954 3300046517 Ga0495630_0589678 Ga0495630_0589678_23_841 268
955 3300046523 Ga0495644_0029101 Ga0495644_0029101_740_1594 268
956 3300046524 Ga0495648_0008757 Ga0495648_0008757_1954_2784 268
957 3300046524 Ga0495648_0013472 Ga0495648_0013472_2067_2993 268
958 3300046524 Ga0495648_0068281 Ga0495648_0068281_619_1563 268
959 3300046526 Ga0495666_0002166 Ga0495666_0002166_8184_9128 268
960 3300046526 Ga0495666_0003060 Ga0495666_0003060_1179_2099 268
961 3300046526 Ga0495666_0011032 Ga0495666_0011032_1849_2700 268
962 3300046529 Ga0495652_0004403 Ga0495652_0004403_3702_4547 268
963 3300046529 Ga0495652_0048754 Ga0495652_0048754_2032_2883 268
964 3300046529 Ga0495652_0353452 Ga0495652_0353452_72_890 268
965 3300046531 Ga0495665_0000102 Ga0495665_0000102_14760_15605 268
966 3300046531 Ga0495665_0014425 Ga0495665_0014425_2017_2868 268
967 3300046531 Ga0495665_0018926 Ga0495665_0018926_2138_2968 268
968 3300046531 Ga0495665_0025941 Ga0495665_0025941_929_1873 268
969 3300046531 Ga0495665_0081594 Ga0495665_0081594_97_1032 268
970 3300046533 Ga0495640_0001811 Ga0495640_0001811_9989_10933 268
971 3300046533 Ga0495640_0014737 Ga0495640_0014737_3206_4057 268
972 3300046535 Ga0495586_0019191 Ga0495586_0019191_2292_3143 268
973 3300046536 Ga0495587_0003529 Ga0495587_0003529_3331_4251 268
974 3300046538 Ga0495609_0045483 Ga0495609_0045483_218_1063 268
975 3300046543 Ga0495645_0001558 Ga0495645_0001558_6075_6995 268
976 3300046543 Ga0495645_0145426 Ga0495645_0145426_455_1300 268
977 3300046557 Ga0495622_0000222 Ga0495622_0000222_34657_35604 268
978 3300046559 Ga0495667_0026878 Ga0495667_0026878_2754_3605 268
979 3300046642 Ga0495634_0004254 Ga0495634_0004254_8652_9572 268
980 3300046642 Ga0495634_0008269 Ga0495634_0008269_4989_5840 268
981 3300046648 Ga0495611_0028429 Ga0495611_0028429_36_881 268
982 3300046660 Ga0495625_0067078 Ga0495625_0067078_1321_2139 268
983 3300046660 Ga0495625_0106321 Ga0495625_0106321_279_1124 268
984 3300046663 Ga0495635_0001046 Ga0495635_0001046_16088_16933 268
985 3300046663 Ga0495635_0003763 Ga0495635_0003763_3303_4223 268
986 3300046663 Ga0495635_0009347 Ga0495635_0009347_2342_3193 268
987 3300046663 Ga0495635_0009844 Ga0495635_0009844_3981_4925 268
988 3300046665 Ga0495661_0001184 Ga0495661_0001184_18804_19724 268
989 3300046665 Ga0495661_0003822 Ga0495661_0003822_8542_9486 268
990 3300046665 Ga0495661_0094341 Ga0495661_0094341_512_1399 268
991 3300046674 Ga0495588_0008163 Ga0495588_0008163_1997_2917 268
992 3300046674 Ga0495588_0079984 Ga0495588_0079984_342_1193 268
993 3300046675 Ga0495657_0086894 Ga0495657_0086894_396_1247 268
994 3300046675 Ga0495657_0096914 Ga0495657_0096914_525_1469 268
995 3300046678 Ga0495599_0032059 Ga0495599_0032059_310_1230 268
996 3300046678 Ga0495599_0067451 Ga0495599_0067451_185_1072 268
997 3300046679 Ga0495623_0029735 Ga0495623_0029735_1044_1988 268
998 3300046679 Ga0495623_0049423 Ga0495623_0049423_1702_2646 268
999 3300046679 Ga0495623_0097012 Ga0495623_0097012_412_1263 268
1000 3300046680 Ga0495646_0000546 Ga0495646_0000546_18412_19263 268
1001 3300046680 Ga0495646_0003447 Ga0495646_0003447_512_1456 268
1002 3300046680 Ga0495646_0011537 Ga0495646_0011537_1686_2606 268
1003 3300046680 Ga0495646_0046302 Ga0495646_0046302_79_966 268
1004 3300046680 Ga0495646_0155539 Ga0495646_0155539_10_876 268
1005 3300046689 Ga0495613_0007648 Ga0495613_0007648_130_1050 268
1006 3300046689 Ga0495613_0019016 Ga0495613_0019016_648_1592 268
1007 3300046689 Ga0495613_0124455 Ga0495613_0124455_994_1812 268
1008 3300046690 Ga0495624_0000067 Ga0495624_0000067_11548_12378 268
1009 3300046690 Ga0495624_0002416 Ga0495624_0002416_11743_12630 268
1010 3300046690 Ga0495624_0008750 Ga0495624_0008750_426_1244 268
1011 3300046690 Ga0495624_0019355 Ga0495624_0019355_90_941 268
1012 3300046692 Ga0495671_0021569 Ga0495671_0021569_716_1588 268
1013 3300046692 Ga0495671_0080716 Ga0495671_0080716_130_975 268
1014 3300046694 Ga0495649_0030084 Ga0495649_0030084_886_1773 268
1015 3300046694 Ga0495649_0068173 Ga0495649_0068173_454_1299 268
1016 3300046794 Ga0495589_0006991 Ga0495589_0006991_1059_2003 268
1017 3300046794 Ga0495589_0026849 Ga0495589_0026849_1380_2231 268
1018 3300046809 Ga0495600_0003130 Ga0495600_0003130_3844_4695 268
1019 3300046809 Ga0495600_0017324 Ga0495600_0017324_1048_1992 268
1020 3300047315 Ga0495581_0000839 Ga0495581_0000839_1877_2797 268
1021 3300047315 Ga0495581_0006036 Ga0495581_0006036_2480_3331 268
1022 3300047317 Ga0495604_0003897 Ga0495604_0003897_8956_9801 268
1023 3300047317 Ga0495604_0004803 Ga0495604_0004803_1251_2171 268
1024 3300047317 Ga0495604_0006820 Ga0495604_0006820_1375_2319 268
1025 3300047317 Ga0495604_0007926 Ga0495604_0007926_7389_8333 268
1026 3300047317 Ga0495604_0046122 Ga0495604_0046122_2216_3103 268
1027 3300047317 Ga0495604_0179777 Ga0495604_0179777_218_1069 268
1028 3300047319 Ga0495674_0000035 Ga0495674_0000035_11679_12509 268
1029 3300047319 Ga0495674_0009692 Ga0495674_0009692_6542_7408 268
1030 3300047319 Ga0495674_0012457 Ga0495674_0012457_4025_4969 268
1031 3300047319 Ga0495674_0015386 Ga0495674_0015386_3228_4148 268
1032 3300047319 Ga0495674_0087871 Ga0495674_0087871_1491_2378 268
1033 3300047319 Ga0495674_0257142 Ga0495674_0257142_173_1024 268
1034 3300047320 Ga0495672_0030969 Ga0495672_0030969_1148_2074 268
1035 3300047320 Ga0495672_0031420 Ga0495672_0031420_2031_2918 268
1036 3300047320 Ga0495672_0033056 Ga0495672_0033056_494_1414 268
1037 3300047321 Ga0495676_0005872 Ga0495676_0005872_6434_7354 268
1038 3300047321 Ga0495676_0035586 Ga0495676_0035586_1108_1926 268
1039 3300047321 Ga0495676_0132102 Ga0495676_0132102_538_1389 268
1040 3300047321 Ga0495676_0199669 Ga0495676_0199669_29_859 268
1041 3300047322 Ga0495680_0006288 Ga0495680_0006288_7341_8285 268
1042 3300047322 Ga0495680_0007830 Ga0495680_0007830_780_1625 268
1043 3300047322 Ga0495680_0020726 Ga0495680_0020726_3901_4752 268
1044 3300047322 Ga0495680_0042069 Ga0495680_0042069_970_1914 268
1045 3300047322 Ga0495680_0063050 Ga0495680_0063050_1749_2669 268
1046 3300047322 Ga0495680_0064818 Ga0495680_0064818_1300_2187 268
1047 3300047323 Ga0495683_0002967 Ga0495683_0002967_8242_9186 268
1048 3300047443 Ga0495687_000094 Ga0495687_000094_19891_20709 268
1049 3300047443 Ga0495687_008249 Ga0495687_008249_1406_2341 268
1050 3300047443 Ga0495687_079565 Ga0495687_079565_191_1021 268
1051 3300047444 Ga0495675_0009422 Ga0495675_0009422_1576_2427 268
1052 3300047444 Ga0495675_0054447 Ga0495675_0054447_1014_1958 268
1053 3300047444 Ga0495675_0136490 Ga0495675_0136490_498_1442 268
1054 3300047446 Ga0495679_000007 Ga0495679_000007_226800_227735 268
1055 3300047446 Ga0495679_002567 Ga0495679_002567_6488_7408 268
1056 3300047446 Ga0495679_004234 Ga0495679_004234_2696_3640 268
1057 3300047469 Ga0495673_0053773 Ga0495673_0053773_358_1206 268
1058 3300047469 Ga0495673_0066611 Ga0495673_0066611_255_1142 268
1059 3300047471 Ga0495684_0004657 Ga0495684_0004657_2717_3637 268
1060 3300047472 Ga0495686_0032897 Ga0495686_0032897_502_1389 268
1061 3300047673 Ga0495593_0001588 Ga0495593_0001588_4585_5472 268
1062 3300047673 Ga0495593_0002189 Ga0495593_0002189_1370_2200 268
1063 3300047673 Ga0495593_0004823 Ga0495593_0004823_1619_2563 268
1064 3300047673 Ga0495593_0010395 Ga0495593_0010395_2781_3626 268
1065 3300048088 Ga0495602_0000761 Ga0495602_0000761_21554_22399 268
1066 3300048088 Ga0495602_0033575 Ga0495602_0033575_412_1323 268
1067 3300048088 Ga0495602_0066166 Ga0495602_0066166_1632_2576 268
1068 3300048088 Ga0495602_0087263 Ga0495602_0087263_145_1080 268
1069 3300048088 Ga0495602_0110321 Ga0495602_0110321_218_1069 268
1070 3300048088 Ga0495602_0110779 Ga0495602_0110779_186_1130 268
1071 3300048089 Ga0495614_0002155 Ga0495614_0002155_1179_2099 268
1072 3300048089 Ga0495614_0002482 Ga0495614_0002482_986_1837 268
1073 3300048089 Ga0495614_0009506 Ga0495614_0009506_1269_2213 268
1074 3300048091 Ga0495626_0008973 Ga0495626_0008973_4341_5276 268
1075 3300048903 Ga0496100_0003525 Ga0496100_0003525_6734_7666 268
1076 3300048903 Ga0496100_0101051 Ga0496100_0101051_799_1734 268
1077 3300048904 Ga0496101_0004588 Ga0496101_0004588_6164_7096 268
1078 3300048905 Ga0496102_0001490 Ga0496102_0001490_13981_14913 268
1079 3300048906 Ga0496103_0001870 Ga0496103_0001870_6626_7558 268
1080 3300048906 Ga0496103_0009502 Ga0496103_0009502_2075_3019 268
1081 3300048906 Ga0496103_0109443 Ga0496103_0109443_576_1421 268
1082 3300048907 Ga0496104_0004872 Ga0496104_0004872_8061_8996 268
1083 3300048907 Ga0496104_0046279 Ga0496104_0046279_1569_2414 268
1084 3300048907 Ga0496104_0574544 Ga0496104_0574544_10_852 268
1085 3300048916 Ga0496113_0027595 Ga0496113_0027595_685_1620 268
1086 3300048920 Ga0496117_0007461 Ga0496117_0007461_7870_8802 268
1087 3300048920 Ga0496117_0010428 Ga0496117_0010428_5969_6865 268
1088 3300048920 Ga0496117_0025338 Ga0496117_0025338_2628_3572 268
1089 3300048920 Ga0496117_0036399 Ga0496117_0036399_1530_2417 268
1090 3300048921 Ga0496118_0000603 Ga0496118_0000603_53788_54684 268
1091 3300048921 Ga0496118_0001810 Ga0496118_0001810_1909_2841 268
1092 3300048921 Ga0496118_0016638 Ga0496118_0016638_3621_4556 268
1093 3300048921 Ga0496118_0024742 Ga0496118_0024742_2595_3539 268
1094 3300048922 Ga0496119_0063362 Ga0496119_0063362_348_1280 268
1095 3300048924 Ga0496121_0013905 Ga0496121_0013905_5803_6735 268
1096 3300048924 Ga0496121_0050582 Ga0496121_0050582_1554_2441 268
1097 3300048924 Ga0496121_0066000 Ga0496121_0066000_1910_2755 268
1098 3300048928 Ga0496125_0103357 Ga0496125_0103357_992_1837 268
1099 3300048929 Ga0496126_0006922 Ga0496126_0006922_9614_10501 268
1100 3300048929 Ga0496126_0128990 Ga0496126_0128990_158_1003 268
1101 3300048929 Ga0496126_0233949 Ga0496126_0233949_229_1074 268
1102 3300049460 Ga0495682_0014349 Ga0495682_0014349_1262_2092 268
1103 3300049460 Ga0495682_0017668 Ga0495682_0017668_1192_2079 268
1104 3300049460 Ga0495682_0038574 Ga0495682_0038574_622_1557 268
1105 3300049460 Ga0495682_0040460 Ga0495682_0040460_433_1329 268
1106 3300049571 Ga0501034_0088095 Ga0501034_0088095_108_995 268
1107 3300049571 Ga0501034_0175420 Ga0501034_0175420_827_1657 268
1108 3300050493 nmdc:mga0k408_16518_c1 nmdc:mga0k408_16518_c1_1338_2156 268
1109 3300050494 nmdc:mga06z11_173654_c1 nmdc:mga06z11_173654_c1_332_1150 268
1110 3300050496 nmdc:mga07m45_23686_c1 nmdc:mga07m45_23686_c1_1608_2438 268
1111 3300050496 nmdc:mga07m45_28324_c1 nmdc:mga07m45_28324_c1_440_1258 268
1112 3300053088 Ga0500644_0110418 Ga0500644_0110418_25_843 268
1113 3300053108 Ga0500562_010790 Ga0500562_010790_1408_2226 268
1114 3300053108 Ga0500562_018737 Ga0500562_018737_335_1180 268
1115 3300053161 Ga0500634_0070488 Ga0500634_0070488_173_1018 268
1116 3300061719 Ga0466962_0000903 Ga0466962_0000903_5319_6170 268
1117 3300061719 Ga0466962_0011578 Ga0466962_0011578_898_1746 268
1118 iso_pu_bacteria 642555112 642591960 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

72

322

0.94

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

77

253

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qk8-assembly1.cif.gz_D crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand 0.9891 5 261
3q1t-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium avium 0.9881 5 252
7m3w-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase echa15 protein from mycolicibacterium paratuberculosis 0.988 5 263
3qk8-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand 0.9875 4 262
3qk8-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand 0.98 4 262
ID Description Score Start End Superfamily
1wz8A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9671 1 206 3.90.226.10
1wz8A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9625 1 206 3.90.226.10
3rrvD00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9486 7 253 3.90.226.10
3rrvD00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9375 7 253 3.90.226.10
5wydE01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9339 9 206 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A6I1JS87-F1-model_v4 Enoyl-CoA hydratase 0.9934 1 268 GO:0005524
GO:0016887
AF-A0A7W0HPM6-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9929 12 262 GO:0004300
AF-A0A7Z9Y011-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9919 5 241 GO:0016853
AF-A0A1M6R1R1-F1-model_v4 Enoyl-CoA hydratase 0.9915 3 263 GO:0003824
AF-J5E830-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9912 20 263 GO:0004300
GO:0006631

Feature Viewer

pLDDT pTM Quality
96.23 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map