F490285

General Info

Members Datasets Scaffolds Average Seq Length
1114 452 2228 205

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0041896|Ga0466966_0041896_1489_2181
Length 230
Sequence MQPFVALTAVACPLPFANIDTDQLIPARFMRRPRAAGYGPFLLHDVRRRPDGELDPEFPLNRPLYQDARILVTRRNFGGGSSREAAVYALADFGFRVVIAPSFGDIFASNAVKNGVLPALVEESVSEDLLAALASSAARACSIDLPTQFIRVGEVATRFSIDPTWKQQLLNGWDDIDLTLNEAPAIAAFRTRDEAARPWASPRRPKKGAPQDALPHAAQSDSKVLRLPVR

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
137 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
234 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
235 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
237 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
238 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
239 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
243 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
244 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
245 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
246 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
247 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
248 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
249 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
250 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
251 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
252 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
253 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
254 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
255 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
256 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
257 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
258 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
259 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
260 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
261 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
262 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
263 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
264 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
265 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
267 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
268 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
269 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
270 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
271 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
272 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
273 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
274 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
275 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
276 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
277 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
278 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
279 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
280 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
281 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
282 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
283 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
285 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
286 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
287 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
293 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
294 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
295 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
296 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
297 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
298 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
299 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
300 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
301 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
302 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
303 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
304 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
305 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
306 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
307 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
308 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
309 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
310 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
311 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
312 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
313 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
316 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
317 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
318 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
319 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
320 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
321 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
322 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
323 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
324 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
327 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
328 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
329 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
330 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
333 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
334 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
335 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
336 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
337 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
338 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
339 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
340 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
341 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
342 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
343 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
344 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
345 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
346 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
347 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
348 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
349 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
354 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
355 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
356 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
357 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
358 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
359 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
360 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
361 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
362 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
363 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
364 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
365 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
366 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
367 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
368 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
369 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
370 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
371 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
372 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
373 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
377 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
378 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
379 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
380 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
381 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
382 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
383 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
384 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
385 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
386 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
387 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
388 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
389 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
390 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
391 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
392 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
393 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
394 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
395 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
405 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
406 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
407 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
408 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
409 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
410 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
411 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
412 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
413 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
414 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
415 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
416 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
417 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
418 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
419 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
420 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
421 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
422 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
423 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
424 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
425 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
426 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
427 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
428 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
429 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
430 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
431 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
432 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
433 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
434 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
435 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
436 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
437 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
438 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
439 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
440 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
441 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
442 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
443 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
444 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
445 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
446 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
447 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
448 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
449 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
450 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
451 641522639 Methylobacterium sp. 4-46 Isolate Nodule
452 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.18
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0.18
Rhizoplane 7.09
Rhizosphere 87.43
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0041896 3300044684 Bacteria 2941
2 2214745233 2209111006 Bacteria 3620
3 ARcpr5oldR_c000028 3300000041 Bacteria 29588
4 ARSoilYngRDRAFT_c00340 3300000042 Bacteria 6519
5 ARcpr5yngRDRAFT_c000089 3300000043 Bacteria 14792
6 ARSoilOldRDRAFT_c000023 3300000044 Bacteria 34965
7 ARCol0oldRDRAFT_c00586 3300000045 Bacteria 3236
8 ARCol0yngRDRAFT_1000137 3300000652 Bacteria 12958
9 JGI24746J21847_1005260 3300001977 Bacteria 2022
10 JGI24739J22299_10002737 3300001989 Bacteria 6785
11 JGI24737J22298_10011181 3300001990 Bacteria 2945
12 JGI24737J22298_10015146 3300001990 Bacteria 2497
13 JGI24750J21931_1001016 3300002070 Bacteria 3679
14 JGI24745J21846_1001750 3300002073 Bacteria 2139
15 JGI24738J21930_10004867 3300002075 Bacteria 3260
16 JGI24749J21850_1005886 3300002076 Bacteria 1711
17 JGI24744J21845_10023908 3300002077 Bacteria 1196
18 JGI24035J26624_1000774 3300002126 Bacteria 3008
19 JGI24742J22300_10001337 3300002244 Bacteria 3874
20 JGI25151J46595_10011150 3300003187 Bacteria 4141
21 JGI25405J52794_10014681 3300003911 Unclassified 1533
22 Ga0065717_1005402 3300005276 Bacteria 893
23 Ga0065704_10149021 3300005289 Bacteria 1446
24 Ga0065704_10244800 3300005289 Bacteria 1005
25 Ga0065712_10002437 3300005290 Bacteria 4651
26 Ga0065712_10095592 3300005290 Bacteria 2213
27 Ga0065715_10014445 3300005293 Bacteria 3675
28 Ga0065715_10113526 3300005293 Bacteria 2470
29 Ga0065707_10222935 3300005295 Bacteria 1218
30 Ga0070658_10130957 3300005327 Bacteria 2090
31 Ga0070658_10245474 3300005327 Bacteria 1518
32 Ga0070676_10094987 3300005328 Bacteria 1833
33 Ga0070683_100000144 3300005329 Bacteria 45900
34 Ga0070690_100042701 3300005330 Bacteria 2872
35 Ga0070690_100293914 3300005330 Bacteria 1163
36 Ga0070690_100642438 3300005330 Bacteria 809
37 Ga0070670_100795861 3300005331 Bacteria 854
38 Ga0070677_10001826 3300005333 Bacteria 6722
39 Ga0068869_100000620 3300005334 Bacteria 20068
40 Ga0068869_100029423 3300005334 Bacteria 3848
41 Ga0068869_100239922 3300005334 Bacteria 1444
42 Ga0070666_10011623 3300005335 Bacteria 5532
43 Ga0070666_10021834 3300005335 Bacteria 4150
44 Ga0070680_100000539 3300005336 Bacteria 25884
45 Ga0070680_100008706 3300005336 Bacteria 7779
46 Ga0070680_100022692 3300005336 Bacteria 5002
47 Ga0070680_100028225 3300005336 Bacteria 4499
48 Ga0070680_100091543 3300005336 Bacteria 2517
49 Ga0070682_100000349 3300005337 Bacteria 31600
50 Ga0070682_100015035 3300005337 Bacteria 4480
51 Ga0070682_100242828 3300005337 Bacteria 1294
52 Ga0068868_100001073 3300005338 Bacteria 18758
53 Ga0070660_100001717 3300005339 Bacteria 15017
54 Ga0070660_100056002 3300005339 Bacteria 3049
55 Ga0070660_100128590 3300005339 Bacteria 2026
56 Ga0070660_100319729 3300005339 Bacteria 1275
57 Ga0070660_100333366 3300005339 Bacteria 1248
58 Ga0070660_100525630 3300005339 Bacteria 986
59 Ga0070689_100033396 3300005340 Bacteria 3920
60 Ga0070689_100097084 3300005340 Bacteria 2329
61 Ga0070689_100243131 3300005340 Bacteria 1483
62 Ga0070691_10007726 3300005341 Bacteria 4925
63 Ga0070691_10008444 3300005341 Bacteria 4713
64 Ga0070691_10102277 3300005341 Bacteria 1424
65 Ga0070691_10151043 3300005341 Bacteria 1191
66 Ga0070687_100000558 3300005343 Bacteria 12442
67 Ga0070687_100295354 3300005343 Bacteria 1026
68 Ga0070687_100497999 3300005343 Bacteria 819
69 Ga0070661_100000017 3300005344 Bacteria 153232
70 Ga0070661_100217313 3300005344 Bacteria 1465
71 Ga0070661_100439349 3300005344 Bacteria 1037
72 Ga0070692_10000008 3300005345 Bacteria 47438
73 Ga0070692_10009654 3300005345 Bacteria 4362
74 Ga0070668_100001340 3300005347 Bacteria 17590
75 Ga0070668_100094474 3300005347 Bacteria 2361
76 Ga0070669_100000250 3300005353 Bacteria 44115
77 Ga0070669_100705968 3300005353 Bacteria 852
78 Ga0070675_100001053 3300005354 Bacteria 19902
79 Ga0070675_100133454 3300005354 Bacteria 2117
80 Ga0070675_100333954 3300005354 Bacteria 1341
81 Ga0070671_100005213 3300005355 Bacteria 10358
82 Ga0070671_100016121 3300005355 Bacteria 6041
83 Ga0070671_100157441 3300005355 Bacteria 1919
84 Ga0070674_100000443 3300005356 Bacteria 20920
85 Ga0070674_100070883 3300005356 Bacteria 2463
86 Ga0070674_100182400 3300005356 Bacteria 1609
87 Ga0070673_100002505 3300005364 Bacteria 11201
88 Ga0070673_100072626 3300005364 Bacteria 2767
89 Ga0070673_100267247 3300005364 Bacteria 1496
90 Ga0070673_100362973 3300005364 Bacteria 1288
91 Ga0070688_100002554 3300005365 Bacteria 9218
92 Ga0070688_100023001 3300005365 Bacteria 3660
93 Ga0070659_100000475 3300005366 Bacteria 29558
94 Ga0070659_100242910 3300005366 Bacteria 1491
95 Ga0070667_100006581 3300005367 Bacteria 9662
96 Ga0070667_100024191 3300005367 Bacteria 5044
97 Ga0070667_100256556 3300005367 Bacteria 1564
98 Ga0070703_10000504 3300005406 Bacteria 15126
99 Ga0070709_10004354 3300005434 Bacteria 7631
100 Ga0070709_10022516 3300005434 Bacteria 3688
101 Ga0070709_10194298 3300005434 Bacteria 1433
102 Ga0070709_10687380 3300005434 Bacteria 795
103 Ga0070714_100031450 3300005435 Bacteria 4428
104 Ga0070714_100037180 3300005435 Bacteria 4089
105 Ga0070713_100001015 3300005436 Bacteria 17955
106 Ga0070713_100047992 3300005436 Bacteria 3513
107 Ga0070710_10004820 3300005437 Bacteria 6381
108 Ga0070710_10012312 3300005437 Bacteria 4244
109 Ga0070710_10085161 3300005437 Bacteria 1853
110 Ga0070701_10000099 3300005438 Bacteria 24473
111 Ga0070711_100026078 3300005439 Bacteria 3828
112 Ga0070711_100079993 3300005439 Bacteria 2326
113 Ga0070711_100500660 3300005439 Unclassified 1001
114 Ga0070705_100000048 3300005440 Bacteria 61670
115 Ga0070705_100002964 3300005440 Bacteria 8390
116 Ga0070700_100002118 3300005441 Bacteria 10080
117 Ga0070700_100005280 3300005441 Bacteria 6834
118 Ga0070700_100080695 3300005441 Bacteria 2100
119 Ga0070700_100610346 3300005441 Unclassified 856
120 Ga0070694_100009718 3300005444 Bacteria 5907
121 Ga0070694_100017754 3300005444 Bacteria 4498
122 Ga0070694_100340297 3300005444 Bacteria 1159
123 Ga0070708_100186304 3300005445 Bacteria 1941
124 Ga0070663_100003871 3300005455 Bacteria 8719
125 Ga0070663_100006164 3300005455 Bacteria 7184
126 Ga0070663_100062499 3300005455 Bacteria 2685
127 Ga0070678_100000698 3300005456 Bacteria 16599
128 Ga0070678_100034755 3300005456 Bacteria 3512
129 Ga0070678_100507450 3300005456 Bacteria 1065
130 Ga0070678_100566714 3300005456 Bacteria 1010
131 Ga0070662_100001535 3300005457 Bacteria 14236
132 Ga0070662_100059310 3300005457 Bacteria 2788
133 Ga0070662_100460688 3300005457 Bacteria 1056
134 Ga0070681_10012731 3300005458 Bacteria 8349
135 Ga0070681_10035535 3300005458 Bacteria 5007
136 Ga0070681_10045332 3300005458 Bacteria 4400
137 Ga0070681_10163616 3300005458 Bacteria 2148
138 Ga0070681_10179218 3300005458 Bacteria 2040
139 Ga0068867_100003965 3300005459 Bacteria 10410
140 Ga0068867_100153018 3300005459 Bacteria 1813
141 Ga0068867_100604093 3300005459 Unclassified 957
142 Ga0070685_10005121 3300005466 Bacteria 6641
143 Ga0070685_10007681 3300005466 Bacteria 5520
144 Ga0070698_100163110 3300005471 Bacteria 2172
145 Ga0070699_100000895 3300005518 Bacteria 27816
146 Ga0070699_100598046 3300005518 Bacteria 1006
147 Ga0070679_100011055 3300005530 Bacteria 8586
148 Ga0070679_100035483 3300005530 Bacteria 4948
149 Ga0070679_100167484 3300005530 Bacteria 2170
150 Ga0070679_100769191 3300005530 Bacteria 906
151 Ga0070684_100094121 3300005535 Bacteria 2668
152 Ga0070684_100117766 3300005535 Bacteria 2387
153 Ga0070684_100118154 3300005535 Bacteria 2383
154 Ga0070684_100225089 3300005535 Bacteria 1712
155 Ga0070697_100005757 3300005536 Bacteria 9555
156 Ga0068853_100001011 3300005539 Bacteria 19810
157 Ga0068853_100898506 3300005539 Bacteria 851
158 Ga0070672_100002749 3300005543 Bacteria 11264
159 Ga0070672_100199808 3300005543 Bacteria 1671
160 Ga0070686_100230059 3300005544 Bacteria 1344
161 Ga0070695_100000147 3300005545 Bacteria 32891
162 Ga0070695_100007506 3300005545 Bacteria 6458
163 Ga0070695_100146675 3300005545 Bacteria 1642
164 Ga0070696_100000577 3300005546 Bacteria 23437
165 Ga0070696_100001769 3300005546 Bacteria 14170
166 Ga0070696_100079595 3300005546 Bacteria 2319
167 Ga0070696_100082310 3300005546 Bacteria 2282
168 Ga0070693_100000727 3300005547 Bacteria 14488
169 Ga0070693_100404371 3300005547 Bacteria 947
170 Ga0070693_100447430 3300005547 Bacteria 906
171 Ga0070665_100976412 3300005548 Unclassified 859
172 Ga0070665_101370529 3300005548 Unclassified 716
173 Ga0070704_100002428 3300005549 Bacteria 10451
174 Ga0070704_100073264 3300005549 Bacteria 2494
175 Ga0068855_100006405 3300005563 Bacteria 14338
176 Ga0068855_100020110 3300005563 Bacteria 8017
177 Ga0068855_100031034 3300005563 Bacteria 6386
178 Ga0068855_100070070 3300005563 Bacteria 4080
179 Ga0068855_100156101 3300005563 Bacteria 2592
180 Ga0068855_100474436 3300005563 Bacteria 1362
181 Ga0070664_100195967 3300005564 Bacteria 1801
182 Ga0070664_100259166 3300005564 Bacteria 1564
183 Ga0070664_100662191 3300005564 Bacteria 971
184 Ga0068857_100010257 3300005577 Bacteria 8144
185 Ga0068857_100010324 3300005577 Bacteria 8112
186 Ga0068854_100000139 3300005578 Bacteria 50270
187 Ga0068856_100001571 3300005614 Bacteria 23910
188 Ga0068856_100038538 3300005614 Bacteria 4692
189 Ga0068856_100040607 3300005614 Bacteria 4571
190 Ga0068856_100051791 3300005614 Bacteria 4047
191 Ga0068856_100241729 3300005614 Bacteria 1821
192 Ga0068856_101091540 3300005614 Bacteria 815
193 Ga0068856_101495598 3300005614 Unclassified 689
194 Ga0070702_100001018 3300005615 Bacteria 11112
195 Ga0070702_100009522 3300005615 Bacteria 4758
196 Ga0068852_100062036 3300005616 Bacteria 3250
197 Ga0068852_100154296 3300005616 Bacteria 2138
198 Ga0068852_100338897 3300005616 Bacteria 1465
199 Ga0068859_100004684 3300005617 Bacteria 13925
200 Ga0068859_100006339 3300005617 Bacteria 11999
201 Ga0068859_100833884 3300005617 Bacteria 1008
202 Ga0068864_100078494 3300005618 Bacteria 2889
203 Ga0068864_100086580 3300005618 Bacteria 2756
204 Ga0068864_100106062 3300005618 Bacteria 2498
205 Ga0068864_100419611 3300005618 Bacteria 1275
206 Ga0068866_10000633 3300005718 Bacteria 15989
207 Ga0068861_100000328 3300005719 Bacteria 26783
208 Ga0068861_100154805 3300005719 Bacteria 1884
209 Ga0068870_10001242 3300005840 Bacteria 10238
210 Ga0068863_100001214 3300005841 Bacteria 25744
211 Ga0068863_100070281 3300005841 Bacteria 3311
212 Ga0068863_100292293 3300005841 Bacteria 1579
213 Ga0068858_100005931 3300005842 Bacteria 11927
214 Ga0068858_100094028 3300005842 Bacteria 2791
215 Ga0068858_100108397 3300005842 Bacteria 2593
216 Ga0068858_100142594 3300005842 Bacteria 2250
217 Ga0068858_100668461 3300005842 Bacteria 1010
218 Ga0068860_100000149 3300005843 Bacteria 113068
219 Ga0068860_100007706 3300005843 Bacteria 10767
220 Ga0068860_100043019 3300005843 Bacteria 4311
221 Ga0068860_100098363 3300005843 Bacteria 2790
222 Ga0068860_100154991 3300005843 Bacteria 2207
223 Ga0068862_100001970 3300005844 Bacteria 18623
224 Ga0068862_100002292 3300005844 Bacteria 17122
225 Ga0068862_100300997 3300005844 Bacteria 1475
226 Ga0068862_100528379 3300005844 Bacteria 1124
227 Ga0081455_10000035 3300005937 Bacteria 136366
228 Ga0081455_10033652 3300005937 Bacteria 4603
229 Ga0081540_1042266 3300005983 Bacteria 2352
230 Ga0070717_10000446 3300006028 Bacteria 26199
231 Ga0070717_10239431 3300006028 Bacteria 1600
232 Ga0070717_10295344 3300006028 Bacteria 1439
233 Ga0070717_10326264 3300006028 Bacteria 1368
234 Ga0075363_100284574 3300006048 Bacteria 957
235 Ga0075432_10005367 3300006058 Bacteria 4370
236 Ga0070715_10001282 3300006163 Bacteria 7205
237 Ga0070716_100001509 3300006173 Bacteria 10411
238 Ga0070712_100029389 3300006175 Unclassified 3683
239 Ga0070712_100036964 3300006175 Bacteria 3325
240 Ga0070712_100138234 3300006175 Bacteria 1855
241 Ga0070712_100231101 3300006175 Bacteria 1469
242 Ga0075427_10005855 3300006194 Unclassified 1763
243 Ga0097621_100000049 3300006237 Bacteria 61062
244 Ga0097621_100023596 3300006237 Bacteria 4791
245 Ga0097621_100133705 3300006237 Bacteria 2113
246 Ga0097621_100456396 3300006237 Bacteria 1152
247 Ga0068871_100007039 3300006358 Bacteria 8010
248 Ga0068871_100016397 3300006358 Bacteria 5578
249 Ga0068871_100025664 3300006358 Bacteria 4588
250 Ga0075428_100000541 3300006844 Bacteria 38584
251 Ga0075428_101162513 3300006844 Unclassified 814
252 Ga0075430_100000418 3300006846 Bacteria 31614
253 Ga0075431_100000798 3300006847 Bacteria 27524
254 Ga0075433_10000721 3300006852 Bacteria 22649
255 Ga0075433_10097856 3300006852 Bacteria 2597
256 Ga0075433_10166148 3300006852 Bacteria 1964
257 Ga0075434_100000504 3300006871 Bacteria 29582
258 Ga0075434_100001435 3300006871 Bacteria 20021
259 Ga0075434_100023229 3300006871 Bacteria 6041
260 Ga0075434_100110240 3300006871 Bacteria 2763
261 Ga0075434_100157112 3300006871 Bacteria 2293
262 Ga0075434_100520671 3300006871 Bacteria 1209
263 Ga0075434_100692574 3300006871 Bacteria 1037
264 Ga0075429_100000200 3300006880 Bacteria 39608
265 Ga0068865_100000119 3300006881 Bacteria 39895
266 Ga0068865_100062460 3300006881 Bacteria 2615
267 Ga0068865_100217621 3300006881 Bacteria 1492
268 Ga0068865_100407637 3300006881 Bacteria 1115
269 Ga0075436_100152910 3300006914 Bacteria 1624
270 Ga0097620_100004684 3300006931 Bacteria 13925
271 Ga0097620_100006339 3300006931 Bacteria 11999
272 Ga0097620_100833873 3300006931 Bacteria 1008
273 Ga0075435_100001159 3300007076 Bacteria 16828
274 Ga0075435_100032910 3300007076 Bacteria 4097
275 Ga0075435_100222404 3300007076 Bacteria 1603
276 Ga0075435_100229093 3300007076 Bacteria 1579
277 Ga0075435_100486816 3300007076 Bacteria 1066
278 Ga0099794_10019572 3300007265 Bacteria 3053
279 Ga0105244_10099570 3300009036 Bacteria 1423
280 Ga0105250_10143876 3300009092 Unclassified 989
281 Ga0105240_10059413 3300009093 Bacteria 4772
282 Ga0105240_10088774 3300009093 Bacteria 3782
283 Ga0111539_10000074 3300009094 Bacteria 99231
284 Ga0111539_10000237 3300009094 Bacteria 65638
285 Ga0111539_10004552 3300009094 Bacteria 18130
286 Ga0111539_10149433 3300009094 Bacteria 2735
287 Ga0105245_10000202 3300009098 Bacteria 57012
288 Ga0105245_10015788 3300009098 Bacteria 6584
289 Ga0105245_10200377 3300009098 Bacteria 1917
290 Ga0105245_10288801 3300009098 Unclassified 1606
291 Ga0105247_10033661 3300009101 Bacteria 3118
292 Ga0105247_10042329 3300009101 Bacteria 2790
293 Ga0105247_10221259 3300009101 Bacteria 1281
294 Ga0105247_10253674 3300009101 Bacteria 1203
295 Ga0114129_10001216 3300009147 Bacteria 34224
296 Ga0114129_10009094 3300009147 Bacteria 14158
297 Ga0105243_10002106 3300009148 Bacteria 16836
298 Ga0105243_10040249 3300009148 Bacteria 3648
299 Ga0105243_10098814 3300009148 Bacteria 2418
300 Ga0105243_10410184 3300009148 Bacteria 1261
301 Ga0105243_10511952 3300009148 Bacteria 1139
302 Ga0105241_10034192 3300009174 Bacteria 3817
303 Ga0105241_10034518 3300009174 Bacteria 3801
304 Ga0105241_10161837 3300009174 Bacteria 1840
305 Ga0105241_10421994 3300009174 Bacteria 1174
306 Ga0105242_10003639 3300009176 Bacteria 12003
307 Ga0105242_10069644 3300009176 Bacteria 2914
308 Ga0105242_10302170 3300009176 Bacteria 1461
309 Ga0105248_10116834 3300009177 Bacteria 3009
310 Ga0105237_10030495 3300009545 Bacteria 5476
311 Ga0105237_10054259 3300009545 Bacteria 4016
312 Ga0105237_10602165 3300009545 Bacteria 1106
313 Ga0105238_10037015 3300009551 Bacteria 4962
314 Ga0105238_10268233 3300009551 Bacteria 1687
315 Ga0105238_10569482 3300009551 Unclassified 1138
316 Ga0105249_10000215 3300009553 Bacteria 66439
317 Ga0105249_10062926 3300009553 Bacteria 3407
318 Ga0105249_10127127 3300009553 Bacteria 2428
319 Ga0105249_10246023 3300009553 Bacteria 1770
320 Ga0105249_10293149 3300009553 Bacteria 1629
321 Ga0105239_10012900 3300010375 Bacteria 9294
322 Ga0105239_10063459 3300010375 Bacteria 4056
323 Ga0105239_10186300 3300010375 Bacteria 2323
324 Ga0105239_10338655 3300010375 Bacteria 1697
325 Ga0105239_10521698 3300010375 Bacteria 1351
326 Ga0105239_11186389 3300010375 Bacteria 880
327 Ga0105239_11186481 3300010375 Bacteria 879
328 Ga0105246_10000019 3300011119 Bacteria 62666
329 Ga0105246_10023842 3300011119 Bacteria 3966
330 Ga0105246_10170147 3300011119 Bacteria 1668
331 Ga0157322_1002534 3300012490 Bacteria 1039
332 Ga0157335_1000720 3300012492 Unclassified 1610
333 Ga0157373_10038283 3300013100 Bacteria 3438
334 Ga0157373_10110696 3300013100 Bacteria 1931
335 Ga0157373_10318009 3300013100 Bacteria 1107
336 Ga0157371_10014590 3300013102 Bacteria 5924
337 Ga0157370_10089640 3300013104 Bacteria 2889
338 Ga0157370_10098984 3300013104 Unclassified 2733
339 Ga0157370_10869801 3300013104 Bacteria 819
340 Ga0157369_10039201 3300013105 Bacteria 5178
341 Ga0157369_10077538 3300013105 Bacteria 3561
342 Ga0157369_10851533 3300013105 Bacteria 936
343 Ga0157374_10065423 3300013296 Bacteria 3414
344 Ga0157374_10096781 3300013296 Bacteria 2823
345 Ga0157374_10124352 3300013296 Bacteria 2492
346 Ga0157374_10396956 3300013296 Bacteria 1375
347 Ga0157378_10003335 3300013297 Bacteria 14284
348 Ga0157378_10079537 3300013297 Bacteria 2960
349 Ga0163162_10050618 3300013306 Bacteria 4166
350 Ga0163162_10113502 3300013306 Bacteria 2808
351 Ga0163162_10188356 3300013306 Bacteria 2190
352 Ga0163162_10254358 3300013306 Bacteria 1888
353 Ga0163162_10929896 3300013306 Unclassified 981
354 Ga0157372_10035825 3300013307 Bacteria 5464
355 Ga0157372_10232941 3300013307 Bacteria 2135
356 Ga0157372_10307163 3300013307 Bacteria 1846
357 Ga0157372_10348427 3300013307 Bacteria 1725
358 Ga0157372_10764250 3300013307 Bacteria 1123
359 Ga0157372_10896239 3300013307 Bacteria 1029
360 Ga0157375_10010984 3300013308 Bacteria 7987
361 Ga0157375_10097747 3300013308 Bacteria 3011
362 Ga0157375_10376896 3300013308 Bacteria 1585
363 Ga0163163_10011148 3300014325 Bacteria 8138
364 Ga0163163_10042113 3300014325 Bacteria 4470
365 Ga0163163_10177987 3300014325 Bacteria 2174
366 Ga0163163_10446310 3300014325 Bacteria 1354
367 Ga0157380_10003569 3300014326 Bacteria 10699
368 Ga0182008_10131264 3300014497 Bacteria 1249
369 Ga0182008_10212021 3300014497 Bacteria 988
370 Ga0157377_10004073 3300014745 Bacteria 6671
371 Ga0157377_10537066 3300014745 Unclassified 824
372 Ga0157379_10000065 3300014968 Bacteria 67475
373 Ga0157379_10051116 3300014968 Bacteria 3691
374 Ga0157379_10051254 3300014968 Bacteria 3687
375 Ga0157379_10181898 3300014968 Bacteria 1899
376 Ga0157379_10326051 3300014968 Bacteria 1402
377 Ga0157376_10006077 3300014969 Bacteria 8490
378 Ga0157376_10139825 3300014969 Bacteria 2171
379 Ga0157376_10527041 3300014969 Bacteria 1165
380 Ga0157376_10729952 3300014969 Bacteria 998
381 Ga0157376_11023693 3300014969 Unclassified 849
382 Ga0157376_11023697 3300014969 Unclassified 849
383 Ga0163161_10000372 3300017792 Bacteria 37549
384 Ga0206353_10826335 3300020082 Bacteria 1304
385 Ga0207666_1000024 3300025271 Bacteria 36609
386 Ga0209758_1001682 3300025297 Bacteria 24935
387 Ga0207697_10000287 3300025315 Bacteria 28055
388 Ga0207697_10059199 3300025315 Bacteria 1592
389 Ga0207697_10164778 3300025315 Bacteria 968
390 Ga0207653_10001230 3300025885 Bacteria 8366
391 Ga0207653_10041969 3300025885 Bacteria 1504
392 Ga0207682_10000437 3300025893 Bacteria 19265
393 Ga0207692_10000465 3300025898 Bacteria 14331
394 Ga0207692_10027285 3300025898 Bacteria 2689
395 Ga0207692_10043426 3300025898 Bacteria 2237
396 Ga0207692_10053022 3300025898 Bacteria 2064
397 Ga0207642_10001053 3300025899 Bacteria 8550
398 Ga0207710_10067840 3300025900 Bacteria 1630
399 Ga0207688_10000014 3300025901 Bacteria 59269
400 Ga0207688_10031937 3300025901 Bacteria 2908
401 Ga0207680_10048666 3300025903 Bacteria 2520
402 Ga0207680_10097172 3300025903 Bacteria 1885
403 Ga0207680_10192414 3300025903 Bacteria 1385
404 Ga0207647_10005147 3300025904 Bacteria 9623
405 Ga0207647_10051532 3300025904 Bacteria 2544
406 Ga0207699_10010773 3300025906 Bacteria 4600
407 Ga0207699_10010966 3300025906 Bacteria 4565
408 Ga0207699_10014331 3300025906 Bacteria 4083
409 Ga0207645_10000160 3300025907 Bacteria 53155
410 Ga0207645_10028320 3300025907 Bacteria 3617
411 Ga0207645_10092446 3300025907 Bacteria 1946
412 Ga0207643_10000674 3300025908 Bacteria 21291
413 Ga0207705_10052789 3300025909 Bacteria 2927
414 Ga0207684_10194242 3300025910 Bacteria 1751
415 Ga0207654_10001905 3300025911 Bacteria 10827
416 Ga0207707_10000885 3300025912 Bacteria 29271
417 Ga0207707_10065729 3300025912 Bacteria 3159
418 Ga0207707_10098808 3300025912 Bacteria 2551
419 Ga0207707_10158006 3300025912 Bacteria 1982
420 Ga0207707_10449815 3300025912 Bacteria 1102
421 Ga0207707_10538364 3300025912 Bacteria 993
422 Ga0207695_10054473 3300025913 Bacteria 4176
423 Ga0207671_10033263 3300025914 Bacteria 3836
424 Ga0207671_10331484 3300025914 Bacteria 1205
425 Ga0207693_10010542 3300025915 Bacteria 7500
426 Ga0207693_10063892 3300025915 Bacteria 2884
427 Ga0207693_10181020 3300025915 Bacteria 1658
428 Ga0207693_10317723 3300025915 Bacteria 1219
429 Ga0207663_10129297 3300025916 Bacteria 1742
430 Ga0207663_10360449 3300025916 Bacteria 1103
431 Ga0207663_10426227 3300025916 Bacteria 1019
432 Ga0207660_10000347 3300025917 Bacteria 30042
433 Ga0207660_10029561 3300025917 Bacteria 3760
434 Ga0207660_10030698 3300025917 Bacteria 3695
435 Ga0207660_10539353 3300025917 Bacteria 948
436 Ga0207660_10704937 3300025917 Bacteria 823
437 Ga0207662_10000130 3300025918 Bacteria 36097
438 Ga0207662_10060691 3300025918 Bacteria 2268
439 Ga0207662_10166872 3300025918 Bacteria 1410
440 Ga0207662_10247484 3300025918 Bacteria 1169
441 Ga0207657_10000980 3300025919 Bacteria 30300
442 Ga0207657_10009773 3300025919 Bacteria 9615
443 Ga0207657_10054880 3300025919 Bacteria 3444
444 Ga0207657_10095492 3300025919 Bacteria 2474
445 Ga0207657_10441192 3300025919 Bacteria 1022
446 Ga0207649_10000372 3300025920 Bacteria 33455
447 Ga0207649_10044297 3300025920 Bacteria 2723
448 Ga0207649_10574085 3300025920 Bacteria 865
449 Ga0207652_10000364 3300025921 Bacteria 47007
450 Ga0207652_10116277 3300025921 Bacteria 2376
451 Ga0207652_10167966 3300025921 Bacteria 1968
452 Ga0207652_10314918 3300025921 Bacteria 1412
453 Ga0207652_10761604 3300025921 Bacteria 861
454 Ga0207681_10000035 3300025923 Bacteria 161792
455 Ga0207694_10154547 3300025924 Bacteria 1850
456 Ga0207650_10020162 3300025925 Bacteria 4698
457 Ga0207650_10098514 3300025925 Bacteria 2246
458 Ga0207659_10000027 3300025926 Bacteria 135454
459 Ga0207687_10000556 3300025927 Bacteria 25111
460 Ga0207687_10192921 3300025927 Bacteria 1587
461 Ga0207700_10088212 3300025928 Bacteria 2442
462 Ga0207700_10315990 3300025928 Bacteria 1352
463 Ga0207664_10029493 3300025929 Bacteria 4179
464 Ga0207644_10019847 3300025931 Bacteria 4563
465 Ga0207644_10026227 3300025931 Bacteria 4013
466 Ga0207690_10000056 3300025932 Bacteria 101387
467 Ga0207690_10082027 3300025932 Bacteria 2255
468 Ga0207690_10167426 3300025932 Bacteria 1644
469 Ga0207706_10000307 3300025933 Bacteria 52944
470 Ga0207706_10007300 3300025933 Bacteria 10216
471 Ga0207706_10007773 3300025933 Bacteria 9900
472 Ga0207706_10113094 3300025933 Bacteria 2388
473 Ga0207706_10332455 3300025933 Bacteria 1322
474 Ga0207686_10058374 3300025934 Bacteria 2432
475 Ga0207686_10226626 3300025934 Bacteria 1352
476 Ga0207686_10418769 3300025934 Unclassified 1024
477 Ga0207709_10000087 3300025935 Bacteria 155019
478 Ga0207709_10081557 3300025935 Bacteria 2086
479 Ga0207709_10314307 3300025935 Bacteria 1170
480 Ga0207670_10016826 3300025936 Bacteria 4405
481 Ga0207669_10000052 3300025937 Bacteria 58284
482 Ga0207669_10005543 3300025937 Bacteria 5675
483 Ga0207669_10076751 3300025937 Bacteria 2122
484 Ga0207704_10000063 3300025938 Bacteria 74699
485 Ga0207704_10091771 3300025938 Bacteria 1997
486 Ga0207704_10152062 3300025938 Bacteria 1634
487 Ga0207665_10005898 3300025939 Bacteria 8151
488 Ga0207691_10000167 3300025940 Bacteria 60999
489 Ga0207691_10071096 3300025940 Bacteria 3141
490 Ga0207691_10221491 3300025940 Bacteria 1640
491 Ga0207711_10001619 3300025941 Bacteria 20775
492 Ga0207711_10110421 3300025941 Bacteria 2445
493 Ga0207689_10000155 3300025942 Bacteria 59178
494 Ga0207661_10000072 3300025944 Bacteria 69126
495 Ga0207661_10416073 3300025944 Bacteria 1220
496 Ga0207679_10000057 3300025945 Bacteria 104912
497 Ga0207679_10039116 3300025945 Bacteria 3385
498 Ga0207679_10063660 3300025945 Bacteria 2754
499 Ga0207679_10176185 3300025945 Bacteria 1765
500 Ga0207667_10010508 3300025949 Bacteria 10815
501 Ga0207667_10097219 3300025949 Bacteria 3039
502 Ga0207667_10129765 3300025949 Bacteria 2596
503 Ga0207651_10007056 3300025960 Bacteria 5958
504 Ga0207712_10000122 3300025961 Bacteria 83730
505 Ga0207712_10004173 3300025961 Bacteria 9124
506 Ga0207668_10000084 3300025972 Bacteria 70850
507 Ga0207668_10527812 3300025972 Bacteria 1019
508 Ga0207640_10001119 3300025981 Bacteria 14773
509 Ga0207658_10001051 3300025986 Bacteria 22381
510 Ga0207658_10201806 3300025986 Bacteria 1661
511 Ga0207677_10001182 3300026023 Bacteria 14192
512 Ga0207677_10219946 3300026023 Bacteria 1522
513 Ga0207703_10073375 3300026035 Bacteria 2831
514 Ga0207703_10107491 3300026035 Bacteria 2375
515 Ga0207639_10002231 3300026041 Bacteria 13024
516 Ga0207639_10632169 3300026041 Bacteria 989
517 Ga0207639_10669746 3300026041 Bacteria 961
518 Ga0207639_10796154 3300026041 Bacteria 881
519 Ga0207678_10000187 3300026067 Bacteria 53154
520 Ga0207678_10005476 3300026067 Bacteria 11355
521 Ga0207678_10009830 3300026067 Bacteria 8407
522 Ga0207678_10019376 3300026067 Bacteria 5977
523 Ga0207678_10177200 3300026067 Bacteria 1820
524 Ga0207708_10000158 3300026075 Bacteria 53154
525 Ga0207708_10002974 3300026075 Bacteria 12490
526 Ga0207708_10008881 3300026075 Bacteria 7437
527 Ga0207702_10072416 3300026078 Bacteria 2970
528 Ga0207702_10248236 3300026078 Bacteria 1670
529 Ga0207702_10396449 3300026078 Bacteria 1330
530 Ga0207641_10004012 3300026088 Bacteria 12844
531 Ga0207641_10077151 3300026088 Bacteria 2882
532 Ga0207641_10248043 3300026088 Bacteria 1662
533 Ga0207648_10003544 3300026089 Bacteria 16327
534 Ga0207648_10369868 3300026089 Bacteria 1295
535 Ga0207676_10000089 3300026095 Bacteria 82462
536 Ga0207676_10256504 3300026095 Bacteria 1576
537 Ga0207676_10706168 3300026095 Bacteria 977
538 Ga0207674_10001444 3300026116 Bacteria 30675
539 Ga0207674_10010025 3300026116 Bacteria 10781
540 Ga0207675_100000229 3300026118 Bacteria 52966
541 Ga0207675_100141856 3300026118 Bacteria 2283
542 Ga0207675_100240057 3300026118 Bacteria 1751
543 Ga0207683_10002691 3300026121 Bacteria 15530
544 Ga0207683_10015080 3300026121 Bacteria 6578
545 Ga0207683_10230508 3300026121 Bacteria 1689
546 Ga0207698_10186576 3300026142 Bacteria 1843
547 Ga0207698_10289236 3300026142 Bacteria 1520
548 Ga0209967_1017524 3300027364 Bacteria 1034
549 Ga0210002_1001963 3300027617 Bacteria 2954
550 Ga0209983_1006176 3300027665 Bacteria 2467
551 Ga0209588_1000249 3300027671 Bacteria 14347
552 Ga0209966_1004453 3300027695 Bacteria 2377
553 Ga0209998_10000675 3300027717 Bacteria 9112
554 Ga0209998_10001277 3300027717 Bacteria 6157
555 Ga0209998_10005060 3300027717 Bacteria 2770
556 Ga0209974_10001459 3300027876 Bacteria 8577
557 Ga0209974_10143458 3300027876 Bacteria 858
558 Ga0207428_10000037 3300027907 Bacteria 218857
559 Ga0207428_10000094 3300027907 Bacteria 123649
560 Ga0207428_10001060 3300027907 Bacteria 30199
561 Ga0268266_10014232 3300028379 Bacteria 6842
562 Ga0268266_10301002 3300028379 Bacteria 1496
563 Ga0268266_10714088 3300028379 Bacteria 966
564 Ga0268265_10000195 3300028380 Bacteria 70871
565 Ga0268265_10002019 3300028380 Bacteria 15920
566 Ga0268264_10000084 3300028381 Bacteria 242128
567 Ga0268264_10005196 3300028381 Bacteria 11023
568 Ga0268264_10033278 3300028381 Bacteria 4233
569 Ga0268264_10318895 3300028381 Bacteria 1469
570 Ga0268264_10467895 3300028381 Bacteria 1224
571 Ga0265338_10094824 3300028800 Bacteria 2453
572 Ga0307511_10188930 3300030521 Bacteria 1093
573 Ga0265760_10161382 3300031090 Bacteria 740
574 Ga0265325_10000190 3300031241 Bacteria 43732
575 Ga0265339_10048584 3300031249 Bacteria 2326
576 Ga0265331_10010636 3300031250 Bacteria 5080
577 Ga0307509_10037781 3300031507 Bacteria 5275
578 Ga0307509_10142531 3300031507 Bacteria 2329
579 Ga0307509_10295472 3300031507 Bacteria 1371
580 Ga0307408_100726169 3300031548 Bacteria 895
581 Ga0265313_10006294 3300031595 Bacteria 8454
582 Ga0265313_10008822 3300031595 Bacteria 6643
583 Ga0307508_10319792 3300031616 Bacteria 1143
584 Ga0316575_10207204 3300031665 Bacteria 817
585 Ga0265314_10171982 3300031711 Bacteria 1307
586 Ga0265342_10000439 3300031712 Bacteria 45473
587 Ga0307516_10013988 3300031730 Bacteria 8512
588 Ga0307516_10066559 3300031730 Bacteria 3475
589 Ga0307516_10134212 3300031730 Bacteria 2251
590 Ga0307407_10463945 3300031903 Bacteria 922
591 Ga0307415_101396126 3300032126 Bacteria 667
592 Ga0316583_10028981 3300032133 Bacteria 1974
593 Ga0307507_10004510 3300033179 Bacteria 24518
594 Ga0307510_10420913 3300033180 Bacteria 778
595 Ga0373930_0001022 3300034816 Bacteria 4024
596 Ga0373948_0000063 3300034817 Bacteria 11215
597 Ga0373958_0000151 3300034819 Bacteria 7767
598 Ga0373959_0000581 3300034820 Bacteria 6394
599 Ga0373938_0002023 3300034957 Bacteria 3247
600 Ga0373938_0002087 3300034957 Bacteria 3213
601 Ga0373938_0003203 3300034957 Bacteria 2662
602 Ga0373926_0000002 3300035083 Bacteria 53301
603 Ga0373929_0000190 3300035085 Bacteria 10950
604 Ga0373929_0033996 3300035085 Bacteria 1104
605 Ga0373934_0046661 3300035086 Bacteria 1714
606 Ga0373934_0097369 3300035086 Bacteria 1188
607 Ga0373940_0000209 3300035088 Bacteria 8206
608 Ga0373944_0000048 3300035089 Bacteria 19324
609 Ga0373949_0000483 3300035090 Bacteria 13607
610 Ga0373949_0041800 3300035090 Bacteria 1130
611 Ga0373951_0000267 3300035091 Bacteria 16834
612 Ga0373951_0001910 3300035091 Bacteria 5366
613 Ga0373951_0030306 3300035091 Bacteria 1273
614 Ga0373951_0091039 3300035091 Bacteria 800
615 Ga0373952_0000092 3300035092 Bacteria 12146
616 Ga0373952_0000344 3300035092 Bacteria 7847
617 Ga0373923_0000736 3300035111 Bacteria 8449
618 Ga0373923_0017104 3300035111 Bacteria 2767
619 Ga0373923_0075922 3300035111 Bacteria 1451
620 Ga0373932_0002056 3300035112 Bacteria 5261
621 Ga0373932_0007056 3300035112 Bacteria 2670
622 Ga0373932_0035622 3300035112 Bacteria 1408
623 Ga0373936_0000294 3300035113 Bacteria 16691
624 Ga0373941_0004398 3300035115 Bacteria 3254
625 Ga0373941_0038992 3300035115 Bacteria 1457
626 Ga0373945_0000229 3300035116 Bacteria 15364
627 Ga0373945_0036158 3300035116 Unclassified 1768
628 Ga0373953_0001420 3300035117 Bacteria 6922
629 Ga0373953_0016105 3300035117 Bacteria 2724
630 Ga0373953_0021138 3300035117 Bacteria 2438
631 Ga0373953_0023692 3300035117 Bacteria 2326
632 Ga0373953_0061767 3300035117 Bacteria 1533
633 Ga0373954_0003522 3300035118 Bacteria 6653
634 Ga0373954_0005308 3300035118 Bacteria 5567
635 Ga0373954_0030144 3300035118 Bacteria 2501
636 Ga0373954_0175423 3300035118 Bacteria 1050
637 Ga0373956_0003693 3300035119 Bacteria 6175
638 Ga0373956_0010426 3300035119 Bacteria 3810
639 Ga0373956_0012085 3300035119 Bacteria 3571
640 Ga0373956_0025698 3300035119 Bacteria 2547
641 Ga0373956_0217864 3300035119 Bacteria 906
642 Ga0373957_0005100 3300035120 Bacteria 4052
643 Ga0373957_0015798 3300035120 Bacteria 2604
644 Ga0373957_0107103 3300035120 Bacteria 1123
645 Ga0373957_0258485 3300035120 Bacteria 734
646 Ga0373960_0000278 3300035121 Bacteria 9824
647 Ga0373960_0034512 3300035121 Bacteria 1432
648 Ga0373943_0085041 3300035170 Bacteria 1628
649 Ga0373943_0138633 3300035170 Bacteria 1308
650 Ga0373943_0193449 3300035170 Bacteria 1123
651 Ga0373946_0000055 3300035171 Bacteria 30057
652 Ga0373955_0001901 3300035172 Bacteria 9010
653 Ga0373955_0003379 3300035172 Bacteria 7016
654 Ga0373955_0006761 3300035172 Bacteria 5236
655 Ga0373955_0065657 3300035172 Bacteria 2015
656 Ga0373955_0208652 3300035172 Bacteria 1164
657 Ga0373955_0461783 3300035172 Bacteria 774
658 Ga0373942_0000308 3300035207 Bacteria 13379
659 Ga0373942_0000764 3300035207 Bacteria 8849
660 Ga0373942_0032535 3300035207 Bacteria 1386
661 Ga0373961_0000880 3300035241 Bacteria 10096
662 Ga0373961_0001364 3300035241 Bacteria 7329
663 Ga0373962_0000267 3300035242 Bacteria 11173
664 Ga0373962_0000860 3300035242 Bacteria 6919
665 Ga0373962_0023248 3300035242 Bacteria 1650
666 Ga0373924_0001792 3300035410 Bacteria 7105
667 Ga0373924_0007464 3300035410 Bacteria 3948
668 Ga0373924_0018933 3300035410 Bacteria 2662
669 Ga0373924_0037326 3300035410 Bacteria 1978
670 Ga0373924_0113752 3300035410 Bacteria 1171
671 Ga0373931_0000082 3300035691 Bacteria 44600
672 Ga0373931_0061465 3300035691 Bacteria 2025
673 Ga0373931_0076198 3300035691 Bacteria 1842
674 Ga0373931_0187535 3300035691 Bacteria 1228
675 Ga0373931_0560047 3300035691 Bacteria 743
676 Ga0373935_0043139 3300035692 Bacteria 2838
677 Ga0373935_0316400 3300035692 Bacteria 1106
678 Ga0373927_0004984 3300035695 Bacteria 9202
679 Ga0373927_0023779 3300035695 Bacteria 4010
680 Ga0373927_0024938 3300035695 Bacteria 3909
681 Ga0373927_0264778 3300035695 Bacteria 1130
682 Ga0373933_0002607 3300035724 Bacteria 10099
683 Ga0373933_0003211 3300035724 Bacteria 9125
684 Ga0373933_0017454 3300035724 Bacteria 4026
685 Ga0373933_0030513 3300035724 Bacteria 3122
686 Ga0373933_0081126 3300035724 Bacteria 1989
687 Ga0373933_0154172 3300035724 Bacteria 1456
688 Ga0373933_0240831 3300035724 Bacteria 1163
689 Ga0373947_0002750 3300035725 Bacteria 10526
690 Ga0373947_0022869 3300035725 Bacteria 3629
691 Ga0373947_0106344 3300035725 Bacteria 1768
692 Ga0373937_0001536 3300036401 Bacteria 19417
693 Ga0373937_0004995 3300036401 Bacteria 11286
694 Ga0373937_0011315 3300036401 Bacteria 7827
695 Ga0373937_0029317 3300036401 Bacteria 4983
696 Ga0373937_0040504 3300036401 Bacteria 4246
697 Ga0373937_0041807 3300036401 Bacteria 4182
698 Ga0373937_0081533 3300036401 Bacteria 2993
699 Ga0373937_0088487 3300036401 Unclassified 2867
700 Ga0373937_0496685 3300036401 Bacteria 1159
701 Ga0373937_0537305 3300036401 Bacteria 1110
702 Ga0373925_0001065 3300037068 Bacteria 24770
703 Ga0373925_0010408 3300037068 Bacteria 6748
704 Ga0373925_0048907 3300037068 Bacteria 3151
705 Ga0373925_0061233 3300037068 Bacteria 2827
706 Ga0395899_0001618 3300037312 Bacteria 18822
707 Ga0395900_0007698 3300037418 Bacteria 11108
708 Ga0395900_0288328 3300037418 Bacteria 1631
709 Ga0395898_0001165 3300037466 Bacteria 40142
710 Ga0436364_0677512 3300037853 Bacteria 1156
711 Ga0395901_0218781 3300038443 Bacteria 1991
712 Ga0395901_0412884 3300038443 Bacteria 1385
713 Ga0242419_002693 3300038698 Bacteria 1168
714 Ga0400483_078291 3300039062 Bacteria 3336
715 Ga0400483_283707 3300039062 Bacteria 2984
716 Ga0436360_0117898 3300039438 Bacteria 4335
717 Ga0436360_0472256 3300039438 Bacteria 1215
718 Ga0436361_1024630 3300039447 Bacteria 774
719 Ga0439431_0101392 3300041997 Bacteria 791
720 Ga0439450_076570 3300042008 Bacteria 827
721 Ga0439463_025151 3300042016 Bacteria 1493
722 Ga0439460_0040065 3300042461 Bacteria 1371
723 Ga0453683_0123693 3300044673 Bacteria 1629
724 Ga0466965_0413126 3300044683 Bacteria 747
725 Ga0466968_0180672 3300044735 Bacteria 981
726 Ga0466957_0703800 3300044842 Unclassified 713
727 Ga0466959_0021044 3300045049 Bacteria 4809
728 Ga0451576_0024202 3300045051 Bacteria 6561
729 Ga0466967_0228270 3300045976 Bacteria 1772
730 Ga0495592_0000766 3300046454 Bacteria 22364
731 Ga0495592_0002933 3300046454 Bacteria 12140
732 Ga0495592_0027874 3300046454 Bacteria 4278
733 Ga0495592_0066144 3300046454 Bacteria 2645
734 Ga0495592_0123285 3300046454 Unclassified 1821
735 Ga0495592_0178040 3300046454 Bacteria 1450
736 Ga0495592_0179931 3300046454 Bacteria 1441
737 Ga0495592_0276219 3300046454 Bacteria 1100
738 Ga0495603_0122902 3300046455 Bacteria 1512
739 Ga0495629_0000491 3300046459 Bacteria 33064
740 Ga0495629_0019198 3300046459 Bacteria 4886
741 Ga0495629_0025714 3300046459 Bacteria 4184
742 Ga0495629_0119446 3300046459 Bacteria 1837
743 Ga0495629_0128748 3300046459 Bacteria 1763
744 Ga0495638_0020990 3300046460 Bacteria 4311
745 Ga0495641_0000380 3300046461 Bacteria 37045
746 Ga0495641_0155358 3300046461 Bacteria 1023
747 Ga0495641_0398791 3300046461 Unclassified 624
748 Ga0495651_0000929 3300046462 Bacteria 22677
749 Ga0495651_0001721 3300046462 Bacteria 16887
750 Ga0495651_0013391 3300046462 Bacteria 6342
751 Ga0495651_0017226 3300046462 Bacteria 5599
752 Ga0495651_0042477 3300046462 Bacteria 3530
753 Ga0495651_0072787 3300046462 Bacteria 2610
754 Ga0495651_0102091 3300046462 Bacteria 2133
755 Ga0495651_0395791 3300046462 Bacteria 903
756 Ga0495653_0000209 3300046463 Bacteria 47358
757 Ga0495653_0004064 3300046463 Bacteria 11825
758 Ga0495653_0028848 3300046463 Bacteria 4436
759 Ga0495653_0088754 3300046463 Bacteria 2267
760 Ga0495582_0001370 3300046473 Bacteria 13696
761 Ga0495582_0008961 3300046473 Bacteria 5521
762 Ga0495639_0257628 3300046475 Bacteria 864
763 Ga0495662_0000197 3300046476 Bacteria 24864
764 Ga0495662_0179435 3300046476 Bacteria 1044
765 Ga0495664_0001960 3300046477 Bacteria 10959
766 Ga0495664_0008074 3300046477 Bacteria 5859
767 Ga0495664_0030586 3300046477 Bacteria 3154
768 Ga0495664_0033479 3300046477 Bacteria 3020
769 Ga0495664_0048401 3300046477 Bacteria 2524
770 Ga0495664_0246428 3300046477 Bacteria 1081
771 Ga0495584_0009797 3300046491 Bacteria 4930
772 Ga0495585_0001361 3300046492 Bacteria 19352
773 Ga0495594_0056036 3300046499 Bacteria 2174
774 Ga0495594_0056852 3300046499 Bacteria 2160
775 Ga0495608_0000664 3300046511 Bacteria 23753
776 Ga0495608_0002414 3300046511 Bacteria 13447
777 Ga0495608_0029174 3300046511 Bacteria 3745
778 Ga0495616_0080636 3300046513 Bacteria 1558
779 Ga0495618_0024493 3300046514 Bacteria 3738
780 Ga0495618_0104894 3300046514 Bacteria 1810
781 Ga0495618_0133460 3300046514 Bacteria 1588
782 Ga0495628_0001791 3300046516 Bacteria 19536
783 Ga0495628_0002611 3300046516 Bacteria 16174
784 Ga0495628_0005281 3300046516 Bacteria 11325
785 Ga0495628_0016664 3300046516 Bacteria 6127
786 Ga0495628_0417226 3300046516 Bacteria 978
787 Ga0495630_0004212 3300046517 Bacteria 10074
788 Ga0495630_0028866 3300046517 Bacteria 4123
789 Ga0495630_0205011 3300046517 Bacteria 1505
790 Ga0495630_0318820 3300046517 Bacteria 1188
791 Ga0495644_0000461 3300046523 Bacteria 17621
792 Ga0495663_0007888 3300046525 Bacteria 2943
793 Ga0495666_0000462 3300046526 Bacteria 18068
794 Ga0495666_0026372 3300046526 Bacteria 2865
795 Ga0495652_0013926 3300046529 Bacteria 7230
796 Ga0495652_0020302 3300046529 Bacteria 5906
797 Ga0495652_0040307 3300046529 Bacteria 4036
798 Ga0495652_0055861 3300046529 Unclassified 3356
799 Ga0495652_0074465 3300046529 Bacteria 2823
800 Ga0495652_0118735 3300046529 Bacteria 2113
801 Ga0495652_0374912 3300046529 Bacteria 1013
802 Ga0495665_0002827 3300046531 Bacteria 9365
803 Ga0495640_0002474 3300046533 Bacteria 14855
804 Ga0495640_0017531 3300046533 Bacteria 5335
805 Ga0495640_0027678 3300046533 Bacteria 4086
806 Ga0495586_0001093 3300046535 Bacteria 15326
807 Ga0495587_0012584 3300046536 Bacteria 5321
808 Ga0495587_0015969 3300046536 Bacteria 4674
809 Ga0495587_0039613 3300046536 Bacteria 2819
810 Ga0495587_0055831 3300046536 Unclassified 2325
811 Ga0495609_0006084 3300046538 Bacteria 6212
812 Ga0495621_0081174 3300046539 Bacteria 1209
813 Ga0495645_0011632 3300046543 Bacteria 6199
814 Ga0495645_0017880 3300046543 Bacteria 5087
815 Ga0495645_0063424 3300046543 Bacteria 2675
816 Ga0495645_0065794 3300046543 Bacteria 2622
817 Ga0495622_0001441 3300046557 Bacteria 11966
818 Ga0495622_0017863 3300046557 Bacteria 3303
819 Ga0495622_0091664 3300046557 Bacteria 1396
820 Ga0495633_0000822 3300046558 Bacteria 27459
821 Ga0495667_0000857 3300046559 Bacteria 19649
822 Ga0495667_0001826 3300046559 Bacteria 14124
823 Ga0495667_0014548 3300046559 Bacteria 5316
824 Ga0495667_0020801 3300046559 Bacteria 4427
825 Ga0495667_0222020 3300046559 Bacteria 1206
826 Ga0495667_0631272 3300046559 Bacteria 666
827 Ga0495634_0005652 3300046642 Bacteria 9579
828 Ga0495634_0007063 3300046642 Bacteria 8472
829 Ga0495634_0096319 3300046642 Bacteria 1916
830 Ga0495634_0316180 3300046642 Bacteria 941
831 Ga0495611_0012306 3300046648 Bacteria 3638
832 Ga0495611_0210450 3300046648 Bacteria 906
833 Ga0495625_0450079 3300046660 Bacteria 796
834 Ga0495635_0000301 3300046663 Bacteria 31852
835 Ga0495635_0010376 3300046663 Bacteria 6514
836 Ga0495635_0034440 3300046663 Bacteria 3512
837 Ga0495635_0099327 3300046663 Bacteria 1989
838 Ga0495635_0122719 3300046663 Bacteria 1771
839 Ga0495635_0537526 3300046663 Bacteria 767
840 Ga0495635_0630650 3300046663 Bacteria 698
841 Ga0495659_0005822 3300046664 Bacteria 3890
842 Ga0495588_0000313 3300046674 Bacteria 32879
843 Ga0495657_0017046 3300046675 Bacteria 5280
844 Ga0495657_0023367 3300046675 Bacteria 4417
845 Ga0495657_0025303 3300046675 Bacteria 4218
846 Ga0495657_0052140 3300046675 Bacteria 2744
847 Ga0495599_0000261 3300046678 Bacteria 33198
848 Ga0495599_0007596 3300046678 Bacteria 6583
849 Ga0495599_0009337 3300046678 Bacteria 5991
850 Ga0495599_0046158 3300046678 Bacteria 2732
851 Ga0495623_0000700 3300046679 Bacteria 22328
852 Ga0495623_0011603 3300046679 Bacteria 5706
853 Ga0495623_0030061 3300046679 Bacteria 3495
854 Ga0495646_0000800 3300046680 Bacteria 17588
855 Ga0495646_0026148 3300046680 Bacteria 3666
856 Ga0495646_0044849 3300046680 Bacteria 2702
857 Ga0495646_0052301 3300046680 Bacteria 2468
858 Ga0495646_0135223 3300046680 Bacteria 1384
859 Ga0495646_0421966 3300046680 Unclassified 691
860 Ga0495647_0004318 3300046681 Bacteria 4606
861 Ga0495658_0002901 3300046683 Bacteria 8612
862 Ga0495658_0013849 3300046683 Bacteria 4110
863 Ga0495658_0171178 3300046683 Bacteria 1344
864 Ga0495669_0049125 3300046684 Bacteria 1888
865 Ga0495613_0009600 3300046689 Bacteria 7188
866 Ga0495613_0020946 3300046689 Bacteria 4873
867 Ga0495613_0083016 3300046689 Bacteria 2327
868 Ga0495624_0009476 3300046690 Bacteria 6744
869 Ga0495624_0160468 3300046690 Bacteria 1374
870 Ga0495600_0000309 3300046809 Bacteria 25835
871 Ga0495600_0013247 3300046809 Bacteria 5177
872 Ga0495600_0110451 3300046809 Bacteria 1790
873 Ga0495600_0150179 3300046809 Bacteria 1509
874 Ga0495581_0000491 3300047315 Bacteria 20200
875 Ga0495581_0081059 3300047315 Bacteria 1879
876 Ga0495581_0173217 3300047315 Unclassified 1262
877 Ga0495604_0001118 3300047317 Bacteria 22255
878 Ga0495604_0021322 3300047317 Bacteria 5172
879 Ga0495604_0022557 3300047317 Bacteria 5026
880 Ga0495604_0027868 3300047317 Bacteria 4493
881 Ga0495604_0041670 3300047317 Bacteria 3600
882 Ga0495604_0358574 3300047317 Bacteria 967
883 Ga0495674_0011821 3300047319 Bacteria 8230
884 Ga0495674_0024146 3300047319 Bacteria 5592
885 Ga0495674_0025966 3300047319 Bacteria 5361
886 Ga0495674_0109929 3300047319 Bacteria 2338
887 Ga0495674_0219159 3300047319 Bacteria 1573
888 Ga0495674_0522511 3300047319 Bacteria 947
889 Ga0495676_0046942 3300047321 Bacteria 3499
890 Ga0495680_0001830 3300047322 Bacteria 22458
891 Ga0495680_0002163 3300047322 Bacteria 20352
892 Ga0495680_0028751 3300047322 Bacteria 4556
893 Ga0495680_0031569 3300047322 Bacteria 4308
894 Ga0495680_0037418 3300047322 Bacteria 3887
895 Ga0495680_0121039 3300047322 Bacteria 1932
896 Ga0495675_0000885 3300047444 Bacteria 18307
897 Ga0495675_0012282 3300047444 Bacteria 5391
898 Ga0495675_0025981 3300047444 Bacteria 3732
899 Ga0495675_0067550 3300047444 Bacteria 2259
900 Ga0495675_0232786 3300047444 Bacteria 1111
901 Ga0495675_0261463 3300047444 Bacteria 1036
902 Ga0495677_0094117 3300047445 Bacteria 1131
903 Ga0495679_014902 3300047446 Bacteria 2861
904 Ga0495684_0000338 3300047471 Bacteria 37697
905 Ga0495684_0023490 3300047471 Bacteria 4740
906 Ga0495684_0052809 3300047471 Bacteria 3101
907 Ga0495684_0132659 3300047471 Unclassified 1870
908 Ga0495684_0194927 3300047471 Bacteria 1496
909 Ga0495593_0000170 3300047673 Bacteria 33637
910 Ga0495593_0454272 3300047673 Unclassified 641
911 Ga0495602_0006289 3300048088 Bacteria 12449
912 Ga0495602_0014540 3300048088 Bacteria 7986
913 Ga0495602_0085023 3300048088 Bacteria 2645
914 Ga0495602_0094499 3300048088 Bacteria 2470
915 Ga0495614_0000184 3300048089 Bacteria 23429
916 Ga0495614_0258423 3300048089 Bacteria 798
917 Ga0496100_0071429 3300048903 Bacteria 2317
918 Ga0496100_0086117 3300048903 Bacteria 2133
919 Ga0496100_0206044 3300048903 Bacteria 1436
920 Ga0496101_0000215 3300048904 Bacteria 43521
921 Ga0496101_0041567 3300048904 Bacteria 3279
922 Ga0496101_0089912 3300048904 Bacteria 2283
923 Ga0496101_0272255 3300048904 Bacteria 1322
924 Ga0496101_0372750 3300048904 Bacteria 1123
925 Ga0496101_0673519 3300048904 Unclassified 817
926 Ga0496101_0674623 3300048904 Unclassified 816
927 Ga0496102_0001555 3300048905 Bacteria 20249
928 Ga0496102_0026471 3300048905 Bacteria 5173
929 Ga0496102_0032537 3300048905 Bacteria 4685
930 Ga0496102_0058592 3300048905 Bacteria 3519
931 Ga0496102_0436218 3300048905 Bacteria 1229
932 Ga0496102_0740991 3300048905 Unclassified 905
933 Ga0496103_0000191 3300048906 Bacteria 61198
934 Ga0496103_0019378 3300048906 Bacteria 4085
935 Ga0496103_0077285 3300048906 Bacteria 2089
936 Ga0496103_0180970 3300048906 Bacteria 1355
937 Ga0496103_0214715 3300048906 Bacteria 1237
938 Ga0496104_0000720 3300048907 Bacteria 28473
939 Ga0496104_0095210 3300048907 Bacteria 2849
940 Ga0496104_0225835 3300048907 Bacteria 1784
941 Ga0496104_0253582 3300048907 Bacteria 1672
942 Ga0496104_0538797 3300048907 Bacteria 1078
943 Ga0496104_1110168 3300048907 Bacteria 694
944 Ga0496105_0029616 3300048908 Bacteria 4481
945 Ga0496105_0477997 3300048908 Bacteria 981
946 Ga0496106_0000190 3300048909 Bacteria 43243
947 Ga0496106_0001177 3300048909 Bacteria 19474
948 Ga0496106_0004138 3300048909 Bacteria 10814
949 Ga0496106_0067854 3300048909 Bacteria 2719
950 Ga0496106_0158066 3300048909 Bacteria 1791
951 Ga0496107_0000080 3300048910 Bacteria 46272
952 Ga0496107_0009942 3300048910 Bacteria 6601
953 Ga0496107_0028529 3300048910 Bacteria 3967
954 Ga0496107_0493349 3300048910 Unclassified 908
955 Ga0496108_0010355 3300048911 Bacteria 7571
956 Ga0496108_0172425 3300048911 Bacteria 1872
957 Ga0496108_0236841 3300048911 Bacteria 1588
958 Ga0496108_0551477 3300048911 Bacteria 1005
959 Ga0496109_0016503 3300048912 Bacteria 6456
960 Ga0496109_0083926 3300048912 Bacteria 2938
961 Ga0496109_0115480 3300048912 Bacteria 2498
962 Ga0496109_0198993 3300048912 Bacteria 1884
963 Ga0496109_0227472 3300048912 Bacteria 1754
964 Ga0496109_0239013 3300048912 Bacteria 1709
965 Ga0496109_0277159 3300048912 Bacteria 1580
966 Ga0496109_0348320 3300048912 Bacteria 1399
967 Ga0496110_0025701 3300048913 Bacteria 5035
968 Ga0496110_0060455 3300048913 Bacteria 3341
969 Ga0496110_0088725 3300048913 Bacteria 2763
970 Ga0496110_0105369 3300048913 Bacteria 2530
971 Ga0496110_0179091 3300048913 Bacteria 1924
972 Ga0496110_0713542 3300048913 Bacteria 905
973 Ga0496111_0125839 3300048914 Bacteria 1894
974 Ga0496111_0192192 3300048914 Bacteria 1517
975 Ga0496111_0224764 3300048914 Bacteria 1394
976 Ga0496112_0252441 3300048915 Bacteria 1714
977 Ga0496112_0326381 3300048915 Bacteria 1479
978 Ga0496112_0479463 3300048915 Bacteria 1180
979 Ga0496112_0531535 3300048915 Bacteria 1110
980 Ga0496113_0045357 3300048916 Bacteria 3260
981 Ga0496113_0071340 3300048916 Bacteria 2642
982 Ga0496113_0077318 3300048916 Bacteria 2544
983 Ga0496113_0330282 3300048916 Bacteria 1223
984 Ga0496114_0006974 3300048917 Bacteria 8903
985 Ga0496114_0011137 3300048917 Bacteria 7179
986 Ga0496114_0520073 3300048917 Bacteria 1052
987 Ga0496114_0690304 3300048917 Bacteria 896
988 Ga0496115_0008567 3300048918 Bacteria 7570
989 Ga0496115_0008655 3300048918 Bacteria 7538
990 Ga0496115_0043999 3300048918 Bacteria 3560
991 Ga0496115_0240782 3300048918 Bacteria 1491
992 Ga0496115_0396088 3300048918 Bacteria 1121
993 Ga0496115_0411385 3300048918 Unclassified 1096
994 Ga0496115_0513538 3300048918 Unclassified 961
995 Ga0496115_0906268 3300048918 Unclassified 679
996 Ga0496116_0100611 3300048919 Bacteria 1728
997 Ga0496117_0008712 3300048920 Bacteria 9586
998 Ga0496118_0002057 3300048921 Bacteria 28367
999 Ga0496118_0140490 3300048921 Bacteria 1532
1000 Ga0496119_0061277 3300048922 Bacteria 2248
1001 Ga0496119_0278128 3300048922 Bacteria 833
1002 Ga0496120_0272877 3300048923 Bacteria 785
1003 Ga0496121_0000077 3300048924 Bacteria 235293
1004 Ga0496121_0022546 3300048924 Bacteria 6103
1005 Ga0496121_0069076 3300048924 Bacteria 2854
1006 Ga0496124_0010743 3300048927 Bacteria 9231
1007 Ga0496125_0001225 3300048928 Bacteria 38426
1008 Ga0496125_0009583 3300048928 Bacteria 9912
1009 Ga0496126_0002298 3300048929 Bacteria 26300
1010 Ga0496126_0140371 3300048929 Bacteria 2080
1011 Ga0496126_0155818 3300048929 Bacteria 1955
1012 Ga0496126_0232992 3300048929 Bacteria 1542
1013 Ga0501031_0157641 3300049568 Bacteria 1484
1014 Ga0501032_0046257 3300049569 Bacteria 2941
1015 Ga0501033_0252830 3300049570 Bacteria 1248
1016 Ga0501034_0030594 3300049571 Bacteria 5472
1017 Ga0501034_0106740 3300049571 Bacteria 2793
1018 Ga0501036_0348146 3300049572 Bacteria 1237
1019 Ga0501038_0026282 3300049574 Bacteria 5185
1020 Ga0501038_0082022 3300049574 Bacteria 2716
1021 Ga0501039_0103130 3300049575 Bacteria 2227
1022 Ga0501039_0268208 3300049575 Bacteria 1342
1023 Ga0501043_0188904 3300049579 Bacteria 1603
1024 Ga0501047_0511175 3300049581 Bacteria 1027
1025 Ga0501068_0242653 3300049584 Bacteria 1147
1026 Ga0501070_0051944 3300049586 Bacteria 3402
1027 Ga0501070_0714571 3300049586 Unclassified 792
1028 Ga0501071_0267519 3300049587 Bacteria 1292
1029 Ga0501074_0497694 3300049590 Bacteria 863
1030 Ga0501077_0127889 3300049593 Bacteria 1610
1031 Ga0501079_0253707 3300049741 Bacteria 1375
1032 Ga0501083_0058902 3300049744 Bacteria 2569
1033 Ga0501044_0235344 3300049823 Bacteria 1777
1034 Ga0501044_0250477 3300049823 Bacteria 1712
1035 Ga0501044_0267012 3300049823 Bacteria 1648
1036 Ga0501044_0845159 3300049823 Bacteria 792
1037 nmdc:mga05p37_5915_c1 3300050507 Bacteria 14390
1038 nmdc:mga05p37_665_c1 3300050507 Bacteria 38005
1039 nmdc:mga09592_6633_c1 3300050508 Bacteria 9427
1040 nmdc:mga0qj67_1589_c1 3300050509 Bacteria 15982
1041 nmdc:mga06r32_139_c1 3300050510 Bacteria 54112
1042 nmdc:mga08y16_14103_c1 3300050511 Bacteria 8413
1043 nmdc:mga08y16_1835_c1 3300050511 Bacteria 21542
1044 nmdc:mga08y16_45986_c1 3300050511 Bacteria 4572
1045 nmdc:mga08y16_847_c1 3300050511 Bacteria 29383
1046 nmdc:mga0n895_1228_c1 3300050512 Bacteria 18905
1047 nmdc:mga0n895_150661_c1 3300050512 Bacteria 2356
1048 nmdc:mga0n895_170261_c1 3300050512 Bacteria 2210
1049 nmdc:mga0n895_174_c1 3300050512 Bacteria 39480
1050 nmdc:mga0n895_231037_c1 3300050512 Bacteria 1877
1051 nmdc:mga0n895_603499_c1 3300050512 Bacteria 1100
1052 nmdc:mga0rr50_71998_c1 3300050513 Bacteria 2639
1053 nmdc:mga0rr50_769620_c1 3300050513 Bacteria 822
1054 nmdc:mga0rr50_820_c1 3300050513 Bacteria 16710
1055 nmdc:mga08x19_206251_c1 3300050514 Bacteria 1348
1056 nmdc:mga0a205_16845_c2 3300050515 Bacteria 2004
1057 nmdc:mga0a205_1690_c1 3300050515 Bacteria 19057
1058 Ga0495601_0000190 3300053077 Bacteria 32567
1059 Ga0495601_0000766 3300053077 Bacteria 17298
1060 Ga0495601_0005556 3300053077 Bacteria 7352
1061 Ga0495601_0027403 3300053077 Bacteria 3522
1062 Ga0495601_0269168 3300053077 Bacteria 1111
1063 Ga0495612_0000396 3300053078 Bacteria 17444
1064 Ga0495612_0000693 3300053078 Bacteria 13603
1065 Ga0495612_0020730 3300053078 Bacteria 2635
1066 Ga0495612_0153444 3300053078 Unclassified 1003
1067 Ga0495612_0234977 3300053078 Bacteria 813
1068 Ga0500610_0281932 3300053079 Unclassified 745
1069 Ga0500635_0004110 3300053080 Bacteria 3726
1070 Ga0495595_0000177 3300053084 Bacteria 25431
1071 Ga0495595_0000475 3300053084 Bacteria 15261
1072 Ga0495595_0000863 3300053084 Bacteria 11649
1073 Ga0495595_0002591 3300053084 Bacteria 7093
1074 Ga0495595_0002921 3300053084 Bacteria 6744
1075 Ga0495595_0006260 3300053084 Bacteria 4847
1076 Ga0495595_0059360 3300053084 Bacteria 1788
1077 Ga0495595_0086900 3300053084 Bacteria 1496
1078 Ga0495595_0133950 3300053084 Bacteria 1213
1079 Ga0495619_0000148 3300053085 Bacteria 51816
1080 Ga0495619_0000265 3300053085 Bacteria 38076
1081 Ga0495619_0000635 3300053085 Bacteria 23185
1082 Ga0495619_0004768 3300053085 Bacteria 8621
1083 Ga0495619_0027843 3300053085 Bacteria 3644
1084 Ga0495619_0051166 3300053085 Bacteria 2729
1085 Ga0500578_0297371 3300053086 Bacteria 958
1086 Ga0500644_0043875 3300053088 Bacteria 1499
1087 Ga0500651_0203376 3300053093 Bacteria 1168
1088 Ga0500566_0120150 3300053094 Bacteria 1418
1089 Ga0500569_004014 3300053109 Bacteria 3060
1090 Ga0500595_016857 3300053119 Bacteria 2713
1091 Ga0500559_0026210 3300053136 Bacteria 2482
1092 Ga0500573_0060690 3300053140 Bacteria 2165
1093 Ga0500588_0019003 3300053146 Bacteria 1820
1094 Ga0500588_0027975 3300053146 Bacteria 1594
1095 Ga0500590_013358 3300053148 Bacteria 4213
1096 Ga0500590_092405 3300053148 Bacteria 1467
1097 Ga0500590_097000 3300053148 Bacteria 1421
1098 Ga0500603_067512 3300053150 Bacteria 1013
1099 Ga0500634_0009455 3300053161 Bacteria 4934
1100 Ga0500638_048135 3300053162 Bacteria 2063
1101 Ga0500636_0005008 3300053177 Bacteria 7521
1102 Ga0500636_0186266 3300053177 Bacteria 1109
1103 Ga0500596_039651 3300053735 Bacteria 748
1104 Ga0501084_0057490 3300054114 Bacteria 3255
1105 Ga0466962_0046038 3300061719 Bacteria 2085
1106 2511398496 2511231028 Bacteria 8046582
1107 2512036091 2511231221 Bacteria 6846400
1108 2545673228 2545555834 Bacteria 8130841
1109 2599106256 2597490356 Bacteria 7030811
1110 2643756998 2643221547 Bacteria 4740017
1111 2846956054 2846952575 Bacteria 6587527
1112 2848861655 2848858292 Bacteria 7391279
1113 641642174 641522639 Bacteria 7737025
1114 8054008872 8054002106 Bacteria 7987183
1115 Ga0466966_0041896
1116 2214745233
1117 ARcpr5oldR_c000028
1118 ARSoilYngRDRAFT_c00340
1119 ARcpr5yngRDRAFT_c000089
1120 ARSoilOldRDRAFT_c000023
1121 ARCol0oldRDRAFT_c00586
1122 ARCol0yngRDRAFT_1000137
1123 JGI24746J21847_1005260
1124 JGI24739J22299_10002737
1125 JGI24737J22298_10011181
1126 JGI24737J22298_10015146
1127 JGI24750J21931_1001016
1128 JGI24745J21846_1001750
1129 JGI24738J21930_10004867
1130 JGI24749J21850_1005886
1131 JGI24744J21845_10023908
1132 JGI24035J26624_1000774
1133 JGI24742J22300_10001337
1134 JGI25151J46595_10011150
1135 JGI25405J52794_10014681
1136 Ga0065717_1005402
1137 Ga0065704_10149021
1138 Ga0065704_10244800
1139 Ga0065712_10002437
1140 Ga0065712_10095592
1141 Ga0065715_10014445
1142 Ga0065715_10113526
1143 Ga0065707_10222935
1144 Ga0070658_10130957
1145 Ga0070658_10245474
1146 Ga0070676_10094987
1147 Ga0070683_100000144
1148 Ga0070690_100042701
1149 Ga0070690_100293914
1150 Ga0070690_100642438
1151 Ga0070670_100795861
1152 Ga0070677_10001826
1153 Ga0068869_100000620
1154 Ga0068869_100029423
1155 Ga0068869_100239922
1156 Ga0070666_10011623
1157 Ga0070666_10021834
1158 Ga0070680_100000539
1159 Ga0070680_100008706
1160 Ga0070680_100022692
1161 Ga0070680_100028225
1162 Ga0070680_100091543
1163 Ga0070682_100000349
1164 Ga0070682_100015035
1165 Ga0070682_100242828
1166 Ga0068868_100001073
1167 Ga0070660_100001717
1168 Ga0070660_100056002
1169 Ga0070660_100128590
1170 Ga0070660_100319729
1171 Ga0070660_100333366
1172 Ga0070660_100525630
1173 Ga0070689_100033396
1174 Ga0070689_100097084
1175 Ga0070689_100243131
1176 Ga0070691_10007726
1177 Ga0070691_10008444
1178 Ga0070691_10102277
1179 Ga0070691_10151043
1180 Ga0070687_100000558
1181 Ga0070687_100295354
1182 Ga0070687_100497999
1183 Ga0070661_100000017
1184 Ga0070661_100217313
1185 Ga0070661_100439349
1186 Ga0070692_10000008
1187 Ga0070692_10009654
1188 Ga0070668_100001340
1189 Ga0070668_100094474
1190 Ga0070669_100000250
1191 Ga0070669_100705968
1192 Ga0070675_100001053
1193 Ga0070675_100133454
1194 Ga0070675_100333954
1195 Ga0070671_100005213
1196 Ga0070671_100016121
1197 Ga0070671_100157441
1198 Ga0070674_100000443
1199 Ga0070674_100070883
1200 Ga0070674_100182400
1201 Ga0070673_100002505
1202 Ga0070673_100072626
1203 Ga0070673_100267247
1204 Ga0070673_100362973
1205 Ga0070688_100002554
1206 Ga0070688_100023001
1207 Ga0070659_100000475
1208 Ga0070659_100242910
1209 Ga0070667_100006581
1210 Ga0070667_100024191
1211 Ga0070667_100256556
1212 Ga0070703_10000504
1213 Ga0070709_10004354
1214 Ga0070709_10022516
1215 Ga0070709_10194298
1216 Ga0070709_10687380
1217 Ga0070714_100031450
1218 Ga0070714_100037180
1219 Ga0070713_100001015
1220 Ga0070713_100047992
1221 Ga0070710_10004820
1222 Ga0070710_10012312
1223 Ga0070710_10085161
1224 Ga0070701_10000099
1225 Ga0070711_100026078
1226 Ga0070711_100079993
1227 Ga0070711_100500660
1228 Ga0070705_100000048
1229 Ga0070705_100002964
1230 Ga0070700_100002118
1231 Ga0070700_100005280
1232 Ga0070700_100080695
1233 Ga0070700_100610346
1234 Ga0070694_100009718
1235 Ga0070694_100017754
1236 Ga0070694_100340297
1237 Ga0070708_100186304
1238 Ga0070663_100003871
1239 Ga0070663_100006164
1240 Ga0070663_100062499
1241 Ga0070678_100000698
1242 Ga0070678_100034755
1243 Ga0070678_100507450
1244 Ga0070678_100566714
1245 Ga0070662_100001535
1246 Ga0070662_100059310
1247 Ga0070662_100460688
1248 Ga0070681_10012731
1249 Ga0070681_10035535
1250 Ga0070681_10045332
1251 Ga0070681_10163616
1252 Ga0070681_10179218
1253 Ga0068867_100003965
1254 Ga0068867_100153018
1255 Ga0068867_100604093
1256 Ga0070685_10005121
1257 Ga0070685_10007681
1258 Ga0070698_100163110
1259 Ga0070699_100000895
1260 Ga0070699_100598046
1261 Ga0070679_100011055
1262 Ga0070679_100035483
1263 Ga0070679_100167484
1264 Ga0070679_100769191
1265 Ga0070684_100094121
1266 Ga0070684_100117766
1267 Ga0070684_100118154
1268 Ga0070684_100225089
1269 Ga0070697_100005757
1270 Ga0068853_100001011
1271 Ga0068853_100898506
1272 Ga0070672_100002749
1273 Ga0070672_100199808
1274 Ga0070686_100230059
1275 Ga0070695_100000147
1276 Ga0070695_100007506
1277 Ga0070695_100146675
1278 Ga0070696_100000577
1279 Ga0070696_100001769
1280 Ga0070696_100079595
1281 Ga0070696_100082310
1282 Ga0070693_100000727
1283 Ga0070693_100404371
1284 Ga0070693_100447430
1285 Ga0070665_100976412
1286 Ga0070665_101370529
1287 Ga0070704_100002428
1288 Ga0070704_100073264
1289 Ga0068855_100006405
1290 Ga0068855_100020110
1291 Ga0068855_100031034
1292 Ga0068855_100070070
1293 Ga0068855_100156101
1294 Ga0068855_100474436
1295 Ga0070664_100195967
1296 Ga0070664_100259166
1297 Ga0070664_100662191
1298 Ga0068857_100010257
1299 Ga0068857_100010324
1300 Ga0068854_100000139
1301 Ga0068856_100001571
1302 Ga0068856_100038538
1303 Ga0068856_100040607
1304 Ga0068856_100051791
1305 Ga0068856_100241729
1306 Ga0068856_101091540
1307 Ga0068856_101495598
1308 Ga0070702_100001018
1309 Ga0070702_100009522
1310 Ga0068852_100062036
1311 Ga0068852_100154296
1312 Ga0068852_100338897
1313 Ga0068859_100004684
1314 Ga0068859_100006339
1315 Ga0068859_100833884
1316 Ga0068864_100078494
1317 Ga0068864_100086580
1318 Ga0068864_100106062
1319 Ga0068864_100419611
1320 Ga0068866_10000633
1321 Ga0068861_100000328
1322 Ga0068861_100154805
1323 Ga0068870_10001242
1324 Ga0068863_100001214
1325 Ga0068863_100070281
1326 Ga0068863_100292293
1327 Ga0068858_100005931
1328 Ga0068858_100094028
1329 Ga0068858_100108397
1330 Ga0068858_100142594
1331 Ga0068858_100668461
1332 Ga0068860_100000149
1333 Ga0068860_100007706
1334 Ga0068860_100043019
1335 Ga0068860_100098363
1336 Ga0068860_100154991
1337 Ga0068862_100001970
1338 Ga0068862_100002292
1339 Ga0068862_100300997
1340 Ga0068862_100528379
1341 Ga0081455_10000035
1342 Ga0081455_10033652
1343 Ga0081540_1042266
1344 Ga0070717_10000446
1345 Ga0070717_10239431
1346 Ga0070717_10295344
1347 Ga0070717_10326264
1348 Ga0075363_100284574
1349 Ga0075432_10005367
1350 Ga0070715_10001282
1351 Ga0070716_100001509
1352 Ga0070712_100029389
1353 Ga0070712_100036964
1354 Ga0070712_100138234
1355 Ga0070712_100231101
1356 Ga0075427_10005855
1357 Ga0097621_100000049
1358 Ga0097621_100023596
1359 Ga0097621_100133705
1360 Ga0097621_100456396
1361 Ga0068871_100007039
1362 Ga0068871_100016397
1363 Ga0068871_100025664
1364 Ga0075428_100000541
1365 Ga0075428_101162513
1366 Ga0075430_100000418
1367 Ga0075431_100000798
1368 Ga0075433_10000721
1369 Ga0075433_10097856
1370 Ga0075433_10166148
1371 Ga0075434_100000504
1372 Ga0075434_100001435
1373 Ga0075434_100023229
1374 Ga0075434_100110240
1375 Ga0075434_100157112
1376 Ga0075434_100520671
1377 Ga0075434_100692574
1378 Ga0075429_100000200
1379 Ga0068865_100000119
1380 Ga0068865_100062460
1381 Ga0068865_100217621
1382 Ga0068865_100407637
1383 Ga0075436_100152910
1384 Ga0097620_100004684
1385 Ga0097620_100006339
1386 Ga0097620_100833873
1387 Ga0075435_100001159
1388 Ga0075435_100032910
1389 Ga0075435_100222404
1390 Ga0075435_100229093
1391 Ga0075435_100486816
1392 Ga0099794_10019572
1393 Ga0105244_10099570
1394 Ga0105250_10143876
1395 Ga0105240_10059413
1396 Ga0105240_10088774
1397 Ga0111539_10000074
1398 Ga0111539_10000237
1399 Ga0111539_10004552
1400 Ga0111539_10149433
1401 Ga0105245_10000202
1402 Ga0105245_10015788
1403 Ga0105245_10200377
1404 Ga0105245_10288801
1405 Ga0105247_10033661
1406 Ga0105247_10042329
1407 Ga0105247_10221259
1408 Ga0105247_10253674
1409 Ga0114129_10001216
1410 Ga0114129_10009094
1411 Ga0105243_10002106
1412 Ga0105243_10040249
1413 Ga0105243_10098814
1414 Ga0105243_10410184
1415 Ga0105243_10511952
1416 Ga0105241_10034192
1417 Ga0105241_10034518
1418 Ga0105241_10161837
1419 Ga0105241_10421994
1420 Ga0105242_10003639
1421 Ga0105242_10069644
1422 Ga0105242_10302170
1423 Ga0105248_10116834
1424 Ga0105237_10030495
1425 Ga0105237_10054259
1426 Ga0105237_10602165
1427 Ga0105238_10037015
1428 Ga0105238_10268233
1429 Ga0105238_10569482
1430 Ga0105249_10000215
1431 Ga0105249_10062926
1432 Ga0105249_10127127
1433 Ga0105249_10246023
1434 Ga0105249_10293149
1435 Ga0105239_10012900
1436 Ga0105239_10063459
1437 Ga0105239_10186300
1438 Ga0105239_10338655
1439 Ga0105239_10521698
1440 Ga0105239_11186389
1441 Ga0105239_11186481
1442 Ga0105246_10000019
1443 Ga0105246_10023842
1444 Ga0105246_10170147
1445 Ga0157322_1002534
1446 Ga0157335_1000720
1447 Ga0157373_10038283
1448 Ga0157373_10110696
1449 Ga0157373_10318009
1450 Ga0157371_10014590
1451 Ga0157370_10089640
1452 Ga0157370_10098984
1453 Ga0157370_10869801
1454 Ga0157369_10039201
1455 Ga0157369_10077538
1456 Ga0157369_10851533
1457 Ga0157374_10065423
1458 Ga0157374_10096781
1459 Ga0157374_10124352
1460 Ga0157374_10396956
1461 Ga0157378_10003335
1462 Ga0157378_10079537
1463 Ga0163162_10050618
1464 Ga0163162_10113502
1465 Ga0163162_10188356
1466 Ga0163162_10254358
1467 Ga0163162_10929896
1468 Ga0157372_10035825
1469 Ga0157372_10232941
1470 Ga0157372_10307163
1471 Ga0157372_10348427
1472 Ga0157372_10764250
1473 Ga0157372_10896239
1474 Ga0157375_10010984
1475 Ga0157375_10097747
1476 Ga0157375_10376896
1477 Ga0163163_10011148
1478 Ga0163163_10042113
1479 Ga0163163_10177987
1480 Ga0163163_10446310
1481 Ga0157380_10003569
1482 Ga0182008_10131264
1483 Ga0182008_10212021
1484 Ga0157377_10004073
1485 Ga0157377_10537066
1486 Ga0157379_10000065
1487 Ga0157379_10051116
1488 Ga0157379_10051254
1489 Ga0157379_10181898
1490 Ga0157379_10326051
1491 Ga0157376_10006077
1492 Ga0157376_10139825
1493 Ga0157376_10527041
1494 Ga0157376_10729952
1495 Ga0157376_11023693
1496 Ga0157376_11023697
1497 Ga0163161_10000372
1498 Ga0206353_10826335
1499 Ga0207666_1000024
1500 Ga0209758_1001682
1501 Ga0207697_10000287
1502 Ga0207697_10059199
1503 Ga0207697_10164778
1504 Ga0207653_10001230
1505 Ga0207653_10041969
1506 Ga0207682_10000437
1507 Ga0207692_10000465
1508 Ga0207692_10027285
1509 Ga0207692_10043426
1510 Ga0207692_10053022
1511 Ga0207642_10001053
1512 Ga0207710_10067840
1513 Ga0207688_10000014
1514 Ga0207688_10031937
1515 Ga0207680_10048666
1516 Ga0207680_10097172
1517 Ga0207680_10192414
1518 Ga0207647_10005147
1519 Ga0207647_10051532
1520 Ga0207699_10010773
1521 Ga0207699_10010966
1522 Ga0207699_10014331
1523 Ga0207645_10000160
1524 Ga0207645_10028320
1525 Ga0207645_10092446
1526 Ga0207643_10000674
1527 Ga0207705_10052789
1528 Ga0207684_10194242
1529 Ga0207654_10001905
1530 Ga0207707_10000885
1531 Ga0207707_10065729
1532 Ga0207707_10098808
1533 Ga0207707_10158006
1534 Ga0207707_10449815
1535 Ga0207707_10538364
1536 Ga0207695_10054473
1537 Ga0207671_10033263
1538 Ga0207671_10331484
1539 Ga0207693_10010542
1540 Ga0207693_10063892
1541 Ga0207693_10181020
1542 Ga0207693_10317723
1543 Ga0207663_10129297
1544 Ga0207663_10360449
1545 Ga0207663_10426227
1546 Ga0207660_10000347
1547 Ga0207660_10029561
1548 Ga0207660_10030698
1549 Ga0207660_10539353
1550 Ga0207660_10704937
1551 Ga0207662_10000130
1552 Ga0207662_10060691
1553 Ga0207662_10166872
1554 Ga0207662_10247484
1555 Ga0207657_10000980
1556 Ga0207657_10009773
1557 Ga0207657_10054880
1558 Ga0207657_10095492
1559 Ga0207657_10441192
1560 Ga0207649_10000372
1561 Ga0207649_10044297
1562 Ga0207649_10574085
1563 Ga0207652_10000364
1564 Ga0207652_10116277
1565 Ga0207652_10167966
1566 Ga0207652_10314918
1567 Ga0207652_10761604
1568 Ga0207681_10000035
1569 Ga0207694_10154547
1570 Ga0207650_10020162
1571 Ga0207650_10098514
1572 Ga0207659_10000027
1573 Ga0207687_10000556
1574 Ga0207687_10192921
1575 Ga0207700_10088212
1576 Ga0207700_10315990
1577 Ga0207664_10029493
1578 Ga0207644_10019847
1579 Ga0207644_10026227
1580 Ga0207690_10000056
1581 Ga0207690_10082027
1582 Ga0207690_10167426
1583 Ga0207706_10000307
1584 Ga0207706_10007300
1585 Ga0207706_10007773
1586 Ga0207706_10113094
1587 Ga0207706_10332455
1588 Ga0207686_10058374
1589 Ga0207686_10226626
1590 Ga0207686_10418769
1591 Ga0207709_10000087
1592 Ga0207709_10081557
1593 Ga0207709_10314307
1594 Ga0207670_10016826
1595 Ga0207669_10000052
1596 Ga0207669_10005543
1597 Ga0207669_10076751
1598 Ga0207704_10000063
1599 Ga0207704_10091771
1600 Ga0207704_10152062
1601 Ga0207665_10005898
1602 Ga0207691_10000167
1603 Ga0207691_10071096
1604 Ga0207691_10221491
1605 Ga0207711_10001619
1606 Ga0207711_10110421
1607 Ga0207689_10000155
1608 Ga0207661_10000072
1609 Ga0207661_10416073
1610 Ga0207679_10000057
1611 Ga0207679_10039116
1612 Ga0207679_10063660
1613 Ga0207679_10176185
1614 Ga0207667_10010508
1615 Ga0207667_10097219
1616 Ga0207667_10129765
1617 Ga0207651_10007056
1618 Ga0207712_10000122
1619 Ga0207712_10004173
1620 Ga0207668_10000084
1621 Ga0207668_10527812
1622 Ga0207640_10001119
1623 Ga0207658_10001051
1624 Ga0207658_10201806
1625 Ga0207677_10001182
1626 Ga0207677_10219946
1627 Ga0207703_10073375
1628 Ga0207703_10107491
1629 Ga0207639_10002231
1630 Ga0207639_10632169
1631 Ga0207639_10669746
1632 Ga0207639_10796154
1633 Ga0207678_10000187
1634 Ga0207678_10005476
1635 Ga0207678_10009830
1636 Ga0207678_10019376
1637 Ga0207678_10177200
1638 Ga0207708_10000158
1639 Ga0207708_10002974
1640 Ga0207708_10008881
1641 Ga0207702_10072416
1642 Ga0207702_10248236
1643 Ga0207702_10396449
1644 Ga0207641_10004012
1645 Ga0207641_10077151
1646 Ga0207641_10248043
1647 Ga0207648_10003544
1648 Ga0207648_10369868
1649 Ga0207676_10000089
1650 Ga0207676_10256504
1651 Ga0207676_10706168
1652 Ga0207674_10001444
1653 Ga0207674_10010025
1654 Ga0207675_100000229
1655 Ga0207675_100141856
1656 Ga0207675_100240057
1657 Ga0207683_10002691
1658 Ga0207683_10015080
1659 Ga0207683_10230508
1660 Ga0207698_10186576
1661 Ga0207698_10289236
1662 Ga0209967_1017524
1663 Ga0210002_1001963
1664 Ga0209983_1006176
1665 Ga0209588_1000249
1666 Ga0209966_1004453
1667 Ga0209998_10000675
1668 Ga0209998_10001277
1669 Ga0209998_10005060
1670 Ga0209974_10001459
1671 Ga0209974_10143458
1672 Ga0207428_10000037
1673 Ga0207428_10000094
1674 Ga0207428_10001060
1675 Ga0268266_10014232
1676 Ga0268266_10301002
1677 Ga0268266_10714088
1678 Ga0268265_10000195
1679 Ga0268265_10002019
1680 Ga0268264_10000084
1681 Ga0268264_10005196
1682 Ga0268264_10033278
1683 Ga0268264_10318895
1684 Ga0268264_10467895
1685 Ga0265338_10094824
1686 Ga0307511_10188930
1687 Ga0265760_10161382
1688 Ga0265325_10000190
1689 Ga0265339_10048584
1690 Ga0265331_10010636
1691 Ga0307509_10037781
1692 Ga0307509_10142531
1693 Ga0307509_10295472
1694 Ga0307408_100726169
1695 Ga0265313_10006294
1696 Ga0265313_10008822
1697 Ga0307508_10319792
1698 Ga0316575_10207204
1699 Ga0265314_10171982
1700 Ga0265342_10000439
1701 Ga0307516_10013988
1702 Ga0307516_10066559
1703 Ga0307516_10134212
1704 Ga0307407_10463945
1705 Ga0307415_101396126
1706 Ga0316583_10028981
1707 Ga0307507_10004510
1708 Ga0307510_10420913
1709 Ga0373930_0001022
1710 Ga0373948_0000063
1711 Ga0373958_0000151
1712 Ga0373959_0000581
1713 Ga0373938_0002023
1714 Ga0373938_0002087
1715 Ga0373938_0003203
1716 Ga0373926_0000002
1717 Ga0373929_0000190
1718 Ga0373929_0033996
1719 Ga0373934_0046661
1720 Ga0373934_0097369
1721 Ga0373940_0000209
1722 Ga0373944_0000048
1723 Ga0373949_0000483
1724 Ga0373949_0041800
1725 Ga0373951_0000267
1726 Ga0373951_0001910
1727 Ga0373951_0030306
1728 Ga0373951_0091039
1729 Ga0373952_0000092
1730 Ga0373952_0000344
1731 Ga0373923_0000736
1732 Ga0373923_0017104
1733 Ga0373923_0075922
1734 Ga0373932_0002056
1735 Ga0373932_0007056
1736 Ga0373932_0035622
1737 Ga0373936_0000294
1738 Ga0373941_0004398
1739 Ga0373941_0038992
1740 Ga0373945_0000229
1741 Ga0373945_0036158
1742 Ga0373953_0001420
1743 Ga0373953_0016105
1744 Ga0373953_0021138
1745 Ga0373953_0023692
1746 Ga0373953_0061767
1747 Ga0373954_0003522
1748 Ga0373954_0005308
1749 Ga0373954_0030144
1750 Ga0373954_0175423
1751 Ga0373956_0003693
1752 Ga0373956_0010426
1753 Ga0373956_0012085
1754 Ga0373956_0025698
1755 Ga0373956_0217864
1756 Ga0373957_0005100
1757 Ga0373957_0015798
1758 Ga0373957_0107103
1759 Ga0373957_0258485
1760 Ga0373960_0000278
1761 Ga0373960_0034512
1762 Ga0373943_0085041
1763 Ga0373943_0138633
1764 Ga0373943_0193449
1765 Ga0373946_0000055
1766 Ga0373955_0001901
1767 Ga0373955_0003379
1768 Ga0373955_0006761
1769 Ga0373955_0065657
1770 Ga0373955_0208652
1771 Ga0373955_0461783
1772 Ga0373942_0000308
1773 Ga0373942_0000764
1774 Ga0373942_0032535
1775 Ga0373961_0000880
1776 Ga0373961_0001364
1777 Ga0373962_0000267
1778 Ga0373962_0000860
1779 Ga0373962_0023248
1780 Ga0373924_0001792
1781 Ga0373924_0007464
1782 Ga0373924_0018933
1783 Ga0373924_0037326
1784 Ga0373924_0113752
1785 Ga0373931_0000082
1786 Ga0373931_0061465
1787 Ga0373931_0076198
1788 Ga0373931_0187535
1789 Ga0373931_0560047
1790 Ga0373935_0043139
1791 Ga0373935_0316400
1792 Ga0373927_0004984
1793 Ga0373927_0023779
1794 Ga0373927_0024938
1795 Ga0373927_0264778
1796 Ga0373933_0002607
1797 Ga0373933_0003211
1798 Ga0373933_0017454
1799 Ga0373933_0030513
1800 Ga0373933_0081126
1801 Ga0373933_0154172
1802 Ga0373933_0240831
1803 Ga0373947_0002750
1804 Ga0373947_0022869
1805 Ga0373947_0106344
1806 Ga0373937_0001536
1807 Ga0373937_0004995
1808 Ga0373937_0011315
1809 Ga0373937_0029317
1810 Ga0373937_0040504
1811 Ga0373937_0041807
1812 Ga0373937_0081533
1813 Ga0373937_0088487
1814 Ga0373937_0496685
1815 Ga0373937_0537305
1816 Ga0373925_0001065
1817 Ga0373925_0010408
1818 Ga0373925_0048907
1819 Ga0373925_0061233
1820 Ga0395899_0001618
1821 Ga0395900_0007698
1822 Ga0395900_0288328
1823 Ga0395898_0001165
1824 Ga0436364_0677512
1825 Ga0395901_0218781
1826 Ga0395901_0412884
1827 Ga0242419_002693
1828 Ga0400483_078291
1829 Ga0400483_283707
1830 Ga0436360_0117898
1831 Ga0436360_0472256
1832 Ga0436361_1024630
1833 Ga0439431_0101392
1834 Ga0439450_076570
1835 Ga0439463_025151
1836 Ga0439460_0040065
1837 Ga0453683_0123693
1838 Ga0466965_0413126
1839 Ga0466968_0180672
1840 Ga0466957_0703800
1841 Ga0466959_0021044
1842 Ga0451576_0024202
1843 Ga0466967_0228270
1844 Ga0495592_0000766
1845 Ga0495592_0002933
1846 Ga0495592_0027874
1847 Ga0495592_0066144
1848 Ga0495592_0123285
1849 Ga0495592_0178040
1850 Ga0495592_0179931
1851 Ga0495592_0276219
1852 Ga0495603_0122902
1853 Ga0495629_0000491
1854 Ga0495629_0019198
1855 Ga0495629_0025714
1856 Ga0495629_0119446
1857 Ga0495629_0128748
1858 Ga0495638_0020990
1859 Ga0495641_0000380
1860 Ga0495641_0155358
1861 Ga0495641_0398791
1862 Ga0495651_0000929
1863 Ga0495651_0001721
1864 Ga0495651_0013391
1865 Ga0495651_0017226
1866 Ga0495651_0042477
1867 Ga0495651_0072787
1868 Ga0495651_0102091
1869 Ga0495651_0395791
1870 Ga0495653_0000209
1871 Ga0495653_0004064
1872 Ga0495653_0028848
1873 Ga0495653_0088754
1874 Ga0495582_0001370
1875 Ga0495582_0008961
1876 Ga0495639_0257628
1877 Ga0495662_0000197
1878 Ga0495662_0179435
1879 Ga0495664_0001960
1880 Ga0495664_0008074
1881 Ga0495664_0030586
1882 Ga0495664_0033479
1883 Ga0495664_0048401
1884 Ga0495664_0246428
1885 Ga0495584_0009797
1886 Ga0495585_0001361
1887 Ga0495594_0056036
1888 Ga0495594_0056852
1889 Ga0495608_0000664
1890 Ga0495608_0002414
1891 Ga0495608_0029174
1892 Ga0495616_0080636
1893 Ga0495618_0024493
1894 Ga0495618_0104894
1895 Ga0495618_0133460
1896 Ga0495628_0001791
1897 Ga0495628_0002611
1898 Ga0495628_0005281
1899 Ga0495628_0016664
1900 Ga0495628_0417226
1901 Ga0495630_0004212
1902 Ga0495630_0028866
1903 Ga0495630_0205011
1904 Ga0495630_0318820
1905 Ga0495644_0000461
1906 Ga0495663_0007888
1907 Ga0495666_0000462
1908 Ga0495666_0026372
1909 Ga0495652_0013926
1910 Ga0495652_0020302
1911 Ga0495652_0040307
1912 Ga0495652_0055861
1913 Ga0495652_0074465
1914 Ga0495652_0118735
1915 Ga0495652_0374912
1916 Ga0495665_0002827
1917 Ga0495640_0002474
1918 Ga0495640_0017531
1919 Ga0495640_0027678
1920 Ga0495586_0001093
1921 Ga0495587_0012584
1922 Ga0495587_0015969
1923 Ga0495587_0039613
1924 Ga0495587_0055831
1925 Ga0495609_0006084
1926 Ga0495621_0081174
1927 Ga0495645_0011632
1928 Ga0495645_0017880
1929 Ga0495645_0063424
1930 Ga0495645_0065794
1931 Ga0495622_0001441
1932 Ga0495622_0017863
1933 Ga0495622_0091664
1934 Ga0495633_0000822
1935 Ga0495667_0000857
1936 Ga0495667_0001826
1937 Ga0495667_0014548
1938 Ga0495667_0020801
1939 Ga0495667_0222020
1940 Ga0495667_0631272
1941 Ga0495634_0005652
1942 Ga0495634_0007063
1943 Ga0495634_0096319
1944 Ga0495634_0316180
1945 Ga0495611_0012306
1946 Ga0495611_0210450
1947 Ga0495625_0450079
1948 Ga0495635_0000301
1949 Ga0495635_0010376
1950 Ga0495635_0034440
1951 Ga0495635_0099327
1952 Ga0495635_0122719
1953 Ga0495635_0537526
1954 Ga0495635_0630650
1955 Ga0495659_0005822
1956 Ga0495588_0000313
1957 Ga0495657_0017046
1958 Ga0495657_0023367
1959 Ga0495657_0025303
1960 Ga0495657_0052140
1961 Ga0495599_0000261
1962 Ga0495599_0007596
1963 Ga0495599_0009337
1964 Ga0495599_0046158
1965 Ga0495623_0000700
1966 Ga0495623_0011603
1967 Ga0495623_0030061
1968 Ga0495646_0000800
1969 Ga0495646_0026148
1970 Ga0495646_0044849
1971 Ga0495646_0052301
1972 Ga0495646_0135223
1973 Ga0495646_0421966
1974 Ga0495647_0004318
1975 Ga0495658_0002901
1976 Ga0495658_0013849
1977 Ga0495658_0171178
1978 Ga0495669_0049125
1979 Ga0495613_0009600
1980 Ga0495613_0020946
1981 Ga0495613_0083016
1982 Ga0495624_0009476
1983 Ga0495624_0160468
1984 Ga0495600_0000309
1985 Ga0495600_0013247
1986 Ga0495600_0110451
1987 Ga0495600_0150179
1988 Ga0495581_0000491
1989 Ga0495581_0081059
1990 Ga0495581_0173217
1991 Ga0495604_0001118
1992 Ga0495604_0021322
1993 Ga0495604_0022557
1994 Ga0495604_0027868
1995 Ga0495604_0041670
1996 Ga0495604_0358574
1997 Ga0495674_0011821
1998 Ga0495674_0024146
1999 Ga0495674_0025966
2000 Ga0495674_0109929
2001 Ga0495674_0219159
2002 Ga0495674_0522511
2003 Ga0495676_0046942
2004 Ga0495680_0001830
2005 Ga0495680_0002163
2006 Ga0495680_0028751
2007 Ga0495680_0031569
2008 Ga0495680_0037418
2009 Ga0495680_0121039
2010 Ga0495675_0000885
2011 Ga0495675_0012282
2012 Ga0495675_0025981
2013 Ga0495675_0067550
2014 Ga0495675_0232786
2015 Ga0495675_0261463
2016 Ga0495677_0094117
2017 Ga0495679_014902
2018 Ga0495684_0000338
2019 Ga0495684_0023490
2020 Ga0495684_0052809
2021 Ga0495684_0132659
2022 Ga0495684_0194927
2023 Ga0495593_0000170
2024 Ga0495593_0454272
2025 Ga0495602_0006289
2026 Ga0495602_0014540
2027 Ga0495602_0085023
2028 Ga0495602_0094499
2029 Ga0495614_0000184
2030 Ga0495614_0258423
2031 Ga0496100_0071429
2032 Ga0496100_0086117
2033 Ga0496100_0206044
2034 Ga0496101_0000215
2035 Ga0496101_0041567
2036 Ga0496101_0089912
2037 Ga0496101_0272255
2038 Ga0496101_0372750
2039 Ga0496101_0673519
2040 Ga0496101_0674623
2041 Ga0496102_0001555
2042 Ga0496102_0026471
2043 Ga0496102_0032537
2044 Ga0496102_0058592
2045 Ga0496102_0436218
2046 Ga0496102_0740991
2047 Ga0496103_0000191
2048 Ga0496103_0019378
2049 Ga0496103_0077285
2050 Ga0496103_0180970
2051 Ga0496103_0214715
2052 Ga0496104_0000720
2053 Ga0496104_0095210
2054 Ga0496104_0225835
2055 Ga0496104_0253582
2056 Ga0496104_0538797
2057 Ga0496104_1110168
2058 Ga0496105_0029616
2059 Ga0496105_0477997
2060 Ga0496106_0000190
2061 Ga0496106_0001177
2062 Ga0496106_0004138
2063 Ga0496106_0067854
2064 Ga0496106_0158066
2065 Ga0496107_0000080
2066 Ga0496107_0009942
2067 Ga0496107_0028529
2068 Ga0496107_0493349
2069 Ga0496108_0010355
2070 Ga0496108_0172425
2071 Ga0496108_0236841
2072 Ga0496108_0551477
2073 Ga0496109_0016503
2074 Ga0496109_0083926
2075 Ga0496109_0115480
2076 Ga0496109_0198993
2077 Ga0496109_0227472
2078 Ga0496109_0239013
2079 Ga0496109_0277159
2080 Ga0496109_0348320
2081 Ga0496110_0025701
2082 Ga0496110_0060455
2083 Ga0496110_0088725
2084 Ga0496110_0105369
2085 Ga0496110_0179091
2086 Ga0496110_0713542
2087 Ga0496111_0125839
2088 Ga0496111_0192192
2089 Ga0496111_0224764
2090 Ga0496112_0252441
2091 Ga0496112_0326381
2092 Ga0496112_0479463
2093 Ga0496112_0531535
2094 Ga0496113_0045357
2095 Ga0496113_0071340
2096 Ga0496113_0077318
2097 Ga0496113_0330282
2098 Ga0496114_0006974
2099 Ga0496114_0011137
2100 Ga0496114_0520073
2101 Ga0496114_0690304
2102 Ga0496115_0008567
2103 Ga0496115_0008655
2104 Ga0496115_0043999
2105 Ga0496115_0240782
2106 Ga0496115_0396088
2107 Ga0496115_0411385
2108 Ga0496115_0513538
2109 Ga0496115_0906268
2110 Ga0496116_0100611
2111 Ga0496117_0008712
2112 Ga0496118_0002057
2113 Ga0496118_0140490
2114 Ga0496119_0061277
2115 Ga0496119_0278128
2116 Ga0496120_0272877
2117 Ga0496121_0000077
2118 Ga0496121_0022546
2119 Ga0496121_0069076
2120 Ga0496124_0010743
2121 Ga0496125_0001225
2122 Ga0496125_0009583
2123 Ga0496126_0002298
2124 Ga0496126_0140371
2125 Ga0496126_0155818
2126 Ga0496126_0232992
2127 Ga0501031_0157641
2128 Ga0501032_0046257
2129 Ga0501033_0252830
2130 Ga0501034_0030594
2131 Ga0501034_0106740
2132 Ga0501036_0348146
2133 Ga0501038_0026282
2134 Ga0501038_0082022
2135 Ga0501039_0103130
2136 Ga0501039_0268208
2137 Ga0501043_0188904
2138 Ga0501047_0511175
2139 Ga0501068_0242653
2140 Ga0501070_0051944
2141 Ga0501070_0714571
2142 Ga0501071_0267519
2143 Ga0501074_0497694
2144 Ga0501077_0127889
2145 Ga0501079_0253707
2146 Ga0501083_0058902
2147 Ga0501044_0235344
2148 Ga0501044_0250477
2149 Ga0501044_0267012
2150 Ga0501044_0845159
2151 nmdc:mga05p37_5915_c1
2152 nmdc:mga05p37_665_c1
2153 nmdc:mga09592_6633_c1
2154 nmdc:mga0qj67_1589_c1
2155 nmdc:mga06r32_139_c1
2156 nmdc:mga08y16_14103_c1
2157 nmdc:mga08y16_1835_c1
2158 nmdc:mga08y16_45986_c1
2159 nmdc:mga08y16_847_c1
2160 nmdc:mga0n895_1228_c1
2161 nmdc:mga0n895_150661_c1
2162 nmdc:mga0n895_170261_c1
2163 nmdc:mga0n895_174_c1
2164 nmdc:mga0n895_231037_c1
2165 nmdc:mga0n895_603499_c1
2166 nmdc:mga0rr50_71998_c1
2167 nmdc:mga0rr50_769620_c1
2168 nmdc:mga0rr50_820_c1
2169 nmdc:mga08x19_206251_c1
2170 nmdc:mga0a205_16845_c2
2171 nmdc:mga0a205_1690_c1
2172 Ga0495601_0000190
2173 Ga0495601_0000766
2174 Ga0495601_0005556
2175 Ga0495601_0027403
2176 Ga0495601_0269168
2177 Ga0495612_0000396
2178 Ga0495612_0000693
2179 Ga0495612_0020730
2180 Ga0495612_0153444
2181 Ga0495612_0234977
2182 Ga0500610_0281932
2183 Ga0500635_0004110
2184 Ga0495595_0000177
2185 Ga0495595_0000475
2186 Ga0495595_0000863
2187 Ga0495595_0002591
2188 Ga0495595_0002921
2189 Ga0495595_0006260
2190 Ga0495595_0059360
2191 Ga0495595_0086900
2192 Ga0495595_0133950
2193 Ga0495619_0000148
2194 Ga0495619_0000265
2195 Ga0495619_0000635
2196 Ga0495619_0004768
2197 Ga0495619_0027843
2198 Ga0495619_0051166
2199 Ga0500578_0297371
2200 Ga0500644_0043875
2201 Ga0500651_0203376
2202 Ga0500566_0120150
2203 Ga0500569_004014
2204 Ga0500595_016857
2205 Ga0500559_0026210
2206 Ga0500573_0060690
2207 Ga0500588_0019003
2208 Ga0500588_0027975
2209 Ga0500590_013358
2210 Ga0500590_092405
2211 Ga0500590_097000
2212 Ga0500603_067512
2213 Ga0500634_0009455
2214 Ga0500638_048135
2215 Ga0500636_0005008
2216 Ga0500636_0186266
2217 Ga0500596_039651
2218 Ga0501084_0057490
2219 Ga0466962_0046038
2220 2511398496
2221 2512036091
2222 2545673228
2223 2599106256
2224 2643756998
2225 2846956054
2226 2848861655
2227 641642174
2228 8054008872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

1

124

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9532 1 174
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9477 1 174
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9447 4 161
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9388 4 161
2hcu-assembly1.cif.gz_A crystal structure of smu.1381 (or leud) from streptococcus mutans 0.9238 1 174
ID Description Score Start End Superfamily
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9532 1 174 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9477 1 174 3.20.19.10
af_O14289_535_712_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9186 1 176 3.20.19.10
af_Q2FWK0_1_171_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9146 1 174 3.20.19.10
3q3wA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9135 1 175 3.20.19.10
ID Description Score Start End GO Terms
AF-A0A2M8PKQ9-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9569 7 166 GO:0009098
GO:0016829
GO:0016853
AF-A0A7K0VSJ6-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (Isopropylmalate isomerase) 0.9567 1 151 GO:0003861
GO:0009098
GO:0009316
AF-A0A4D4LGC2-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) 0.9542 1 176 GO:0003861
GO:0009098
GO:0009316
AF-A0A2V6TEP6-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9539 9 138 GO:0009098
GO:0016829
GO:0016853
AF-A0A7G3D6B9-F1-model_v4 deleted 0.9532 1 153

Map