F490278

General Info

Members Datasets Scaffolds Average Seq Length
1114 501 1104 113

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10346593|Ga0207674_103465932
Length 137
Sequence MTKKIEAIFREEKLIAVKEALSEIGIIGMNVMEVRGHGRQGGIELAGRIGTYRVDLLPRVQLNIILSDRNVEKTIGIIQQATQTGNIGDGIIFVYAVEEVIRIRTGERGRDALTYEGDIDVRRDLEADLVNAIGISD

Samples

Sample ID Description Type Environment
1 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
2 2643221585 Pelomonas sp. Root662 Isolate Unclassified
3 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
4 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
5 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
6 2643221656 Pelomonas sp. Root405 Isolate Unclassified
7 2738541337 Pelomonas sp. BT06 Isolate Unclassified
8 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
9 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
10 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
124 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
135 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
136 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
137 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
156 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
157 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
162 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
164 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
165 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
235 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
243 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
244 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
245 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
246 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
247 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
248 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
249 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
250 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
251 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
252 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
255 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
256 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
257 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
258 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
259 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
260 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
261 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
264 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
265 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
266 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
267 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
268 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
269 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
270 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
271 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
272 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
273 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
275 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
279 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
280 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
281 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
282 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
283 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
285 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
286 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
287 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
288 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
289 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
290 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
292 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
293 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
295 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
296 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
297 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
298 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
299 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
300 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
301 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
302 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
303 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
304 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
305 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
306 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
307 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
308 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
309 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
310 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
311 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
312 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
313 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
314 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
315 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
316 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
317 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
318 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
319 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
320 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
321 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
322 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
323 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
324 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
325 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
326 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
327 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
328 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
329 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
330 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
331 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
332 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
333 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
334 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
335 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
336 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
337 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
338 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
339 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
340 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
341 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
342 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
343 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
344 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
345 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
346 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
347 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
348 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
349 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
350 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
351 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
352 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
353 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
354 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
355 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
356 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
357 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
358 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
359 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
360 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
361 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
362 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
363 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
364 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
365 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
366 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
367 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
368 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
369 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
370 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
371 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
374 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
375 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
376 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
377 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
378 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
379 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
380 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
381 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
382 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
383 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
384 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
385 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
386 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
387 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
388 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
389 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
390 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
391 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
392 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
393 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
394 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
395 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
396 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
397 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
398 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
399 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
400 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
401 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
402 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
403 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
404 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
405 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
406 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
407 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
408 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
409 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
410 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
411 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
412 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
413 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
414 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
415 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
416 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
417 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
418 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
419 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
420 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
421 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
422 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
426 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
427 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
428 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
429 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
430 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
431 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
432 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
446 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
449 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
450 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
451 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
452 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
453 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
454 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
455 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
456 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
457 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
458 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
459 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
460 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
461 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
462 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
463 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
464 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
465 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
466 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
467 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
468 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
469 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
470 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
471 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
472 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
473 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
474 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
475 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
476 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
479 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
480 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
481 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
482 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
483 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
484 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
485 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
486 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
487 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
488 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
489 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
490 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
491 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
492 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
493 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
494 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
495 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
496 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
497 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
498 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
499 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 2.6
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.66
Nodule 0.18
Rhizoplane 4.49
Rhizosphere 84.47
Stem 0
Stem Tuber 0
Unclassified 5.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10025768 3300001989 Bacteria 2068
2 JGI24737J22298_10096788 3300001990 Bacteria 875
3 JGI24735J21928_10011789 3300002067 Bacteria 2768
4 JGI24744J21845_10006067 3300002077 Bacteria 2507
5 JGI25156J39149_1001412 3300002705 Bacteria 10229
6 JGI25154J39366_1002457 3300002738 Bacteria 4779
7 JGI25157J39369_1000423 3300002741 Bacteria 27882
8 JGI25164J39214_1003965 3300002772 Bacteria 1771
9 Ga0006778J45830_1096314 3300003162 Bacteria 530
10 Ga0006777J48905_1063803 3300003308 Bacteria 790
11 rootL2_10006260 3300003322 Bacteria 9795
12 JGI25160J50197_1091470 3300003354 Bacteria 551
13 Ga0055539_1000874 3300003752 Bacteria 6913
14 Ga0055539_1001489 3300003752 Bacteria 4307
15 Ga0055533_1000006 3300003756 Bacteria 635559
16 Ga0055535_1010743 3300003761 Bacteria 1487
17 Ga0055524_1003908 3300003775 Bacteria 7061
18 Ga0055524_1011613 3300003775 Bacteria 3432
19 Ga0055530_10043228 3300003791 Bacteria 1088
20 Ga0055540_1033015 3300003792 Bacteria 1176
21 Ga0055531_10000313 3300003794 Bacteria 47791
22 Ga0055531_10004052 3300003794 Bacteria 9081
23 Ga0055531_10009008 3300003794 Bacteria 5160
24 Ga0058861_11642297 3300004800 Bacteria 509
25 Ga0065165_1000184 3300005262 Bacteria 109539
26 Ga0065704_10169711 3300005289 Bacteria 1288
27 Ga0065704_10475728 3300005289 Unclassified 685
28 Ga0065715_10304726 3300005293 Bacteria 1033
29 Ga0065715_10423716 3300005293 Bacteria 855
30 Ga0065715_10657363 3300005293 Bacteria 675
31 Ga0065707_10002367 3300005295 Bacteria 6817
32 Ga0065707_11073738 3300005295 Unclassified 521
33 Ga0070658_10045045 3300005327 Bacteria 3566
34 Ga0070658_10231457 3300005327 Bacteria 1565
35 Ga0070658_10453221 3300005327 Bacteria 1105
36 Ga0070676_10005714 3300005328 Bacteria 6629
37 Ga0070676_10107903 3300005328 Bacteria 1729
38 Ga0070676_10340037 3300005328 Bacteria 1029
39 Ga0070676_10786420 3300005328 Bacteria 701
40 Ga0070683_100239506 3300005329 Bacteria 1725
41 Ga0070683_100674772 3300005329 Bacteria 990
42 Ga0070690_100001971 3300005330 Bacteria 10933
43 Ga0070690_100018981 3300005330 Bacteria 4164
44 Ga0070670_100006292 3300005331 Bacteria 10052
45 Ga0070670_100025014 3300005331 Bacteria 5137
46 Ga0070670_100227875 3300005331 Bacteria 1621
47 Ga0070670_100517913 3300005331 Bacteria 1062
48 Ga0070670_100560409 3300005331 Bacteria 1020
49 Ga0070670_101343585 3300005331 Bacteria 655
50 Ga0070677_10087336 3300005333 Bacteria 1349
51 Ga0070677_10251214 3300005333 Bacteria 878
52 Ga0068869_100002581 3300005334 Bacteria 10938
53 Ga0068869_100040418 3300005334 Bacteria 3335
54 Ga0068869_100049953 3300005334 Bacteria 3030
55 Ga0068869_100074593 3300005334 Bacteria 2518
56 Ga0068869_100890308 3300005334 Bacteria 770
57 Ga0068869_101311655 3300005334 Bacteria 639
58 Ga0070682_100061679 3300005337 Bacteria 2374
59 Ga0068868_100004780 3300005338 Bacteria 9510
60 Ga0068868_100113852 3300005338 Bacteria 2200
61 Ga0068868_100416010 3300005338 Bacteria 1163
62 Ga0068868_100750939 3300005338 Bacteria 877
63 Ga0070660_100414090 3300005339 Bacteria 1115
64 Ga0070689_100005903 3300005340 Bacteria 8420
65 Ga0070691_10011042 3300005341 Bacteria 4126
66 Ga0070661_100110585 3300005344 Bacteria 2051
67 Ga0070692_10042501 3300005345 Bacteria 2334
68 Ga0070692_10462025 3300005345 Bacteria 815
69 Ga0070692_10576267 3300005345 Bacteria 741
70 Ga0070668_100003380 3300005347 Bacteria 11769
71 Ga0070668_100040416 3300005347 Bacteria 3568
72 Ga0070668_100100591 3300005347 Bacteria 2290
73 Ga0070668_100255410 3300005347 Bacteria 1456
74 Ga0070668_100729319 3300005347 Bacteria 876
75 Ga0070669_100013932 3300005353 Bacteria 5718
76 Ga0070669_100029809 3300005353 Bacteria 3936
77 Ga0070669_100234526 3300005353 Bacteria 1456
78 Ga0070675_100011427 3300005354 Bacteria 6949
79 Ga0070675_100059003 3300005354 Bacteria 3165
80 Ga0070675_100230942 3300005354 Bacteria 1614
81 Ga0070675_100760156 3300005354 Bacteria 885
82 Ga0070675_100973166 3300005354 Bacteria 779
83 Ga0070671_100078732 3300005355 Bacteria 2755
84 Ga0070671_100131713 3300005355 Bacteria 2106
85 Ga0070674_100064999 3300005356 Bacteria 2559
86 Ga0070673_100262558 3300005364 Bacteria 1509
87 Ga0070688_100109170 3300005365 Bacteria 1837
88 Ga0070688_100854879 3300005365 Bacteria 715
89 Ga0070659_100083453 3300005366 Bacteria 2554
90 Ga0070659_100093911 3300005366 Bacteria 2408
91 Ga0070659_100694396 3300005366 Bacteria 880
92 Ga0070667_100006231 3300005367 Bacteria 9925
93 Ga0070667_100018932 3300005367 Bacteria 5709
94 Ga0070667_101426982 3300005367 Bacteria 649
95 Ga0070713_100365386 3300005436 Bacteria 1342
96 Ga0070701_10004252 3300005438 Bacteria 5770
97 Ga0070711_100871702 3300005439 Bacteria 767
98 Ga0070711_100995868 3300005439 Bacteria 719
99 Ga0070705_100077812 3300005440 Bacteria 2027
100 Ga0070700_100001276 3300005441 Bacteria 12494
101 Ga0070700_100623604 3300005441 Bacteria 848
102 Ga0070700_101374993 3300005441 Bacteria 596
103 Ga0070700_101495590 3300005441 Bacteria 574
104 Ga0070708_100000726 3300005445 Bacteria 25018
105 Ga0070708_100114581 3300005445 Bacteria 2480
106 Ga0070708_100617810 3300005445 Bacteria 1022
107 Ga0070663_100012072 3300005455 Bacteria 5451
108 Ga0070663_100060237 3300005455 Bacteria 2729
109 Ga0070663_100822870 3300005455 Bacteria 797
110 Ga0070663_100837994 3300005455 Bacteria 791
111 Ga0070678_100011210 3300005456 Bacteria 5519
112 Ga0070678_100175503 3300005456 Bacteria 1749
113 Ga0070678_100390947 3300005456 Bacteria 1206
114 Ga0070662_100089481 3300005457 Bacteria 2309
115 Ga0070662_100662984 3300005457 Bacteria 881
116 Ga0068867_100000610 3300005459 Bacteria 23663
117 Ga0068867_100001706 3300005459 Bacteria 15301
118 Ga0068867_100008197 3300005459 Bacteria 7380
119 Ga0068867_100008463 3300005459 Bacteria 7258
120 Ga0068867_100317408 3300005459 Bacteria 1290
121 Ga0068867_100378813 3300005459 Bacteria 1188
122 Ga0068867_100386264 3300005459 Bacteria 1177
123 Ga0068867_100387353 3300005459 Bacteria 1176
124 Ga0070685_10321549 3300005466 Bacteria 1049
125 Ga0070706_100396687 3300005467 Bacteria 1284
126 Ga0070706_101015595 3300005467 Bacteria 765
127 Ga0070707_100098346 3300005468 Bacteria 2834
128 Ga0070698_100174328 3300005471 Bacteria 2091
129 Ga0070698_100249367 3300005471 Bacteria 1708
130 Ga0070698_100862335 3300005471 Bacteria 851
131 Ga0070699_100099649 3300005518 Bacteria 2546
132 Ga0070684_100937387 3300005535 Bacteria 812
133 Ga0070697_100510661 3300005536 Bacteria 1051
134 Ga0068853_100399837 3300005539 Bacteria 1286
135 Ga0068853_100731849 3300005539 Bacteria 945
136 Ga0070672_100005096 3300005543 Bacteria 8667
137 Ga0070672_100018094 3300005543 Bacteria 5087
138 Ga0070672_100026372 3300005543 Bacteria 4323
139 Ga0070672_100365888 3300005543 Bacteria 1231
140 Ga0070672_100400917 3300005543 Bacteria 1176
141 Ga0070672_100710640 3300005543 Bacteria 880
142 Ga0070686_100026545 3300005544 Bacteria 3497
143 Ga0070695_100043274 3300005545 Bacteria 2863
144 Ga0070695_100280176 3300005545 Bacteria 1225
145 Ga0070696_100417909 3300005546 Bacteria 1052
146 Ga0070693_100457333 3300005547 Bacteria 897
147 Ga0070665_100029400 3300005548 Bacteria 5531
148 Ga0070665_100085416 3300005548 Bacteria 3161
149 Ga0070665_100305599 3300005548 Bacteria 1594
150 Ga0070665_100450514 3300005548 Bacteria 1297
151 Ga0070704_100309738 3300005549 Bacteria 1319
152 Ga0070704_100384762 3300005549 Bacteria 1193
153 Ga0068855_100056261 3300005563 Bacteria 4616
154 Ga0068855_100342735 3300005563 Bacteria 1647
155 Ga0068855_100750014 3300005563 Bacteria 1041
156 Ga0070664_100010288 3300005564 Bacteria 7590
157 Ga0070664_100065829 3300005564 Bacteria 3093
158 Ga0070664_100179946 3300005564 Bacteria 1879
159 Ga0070664_100460415 3300005564 Bacteria 1168
160 Ga0070664_100593119 3300005564 Bacteria 1027
161 Ga0070664_100699584 3300005564 Bacteria 944
162 Ga0068857_100007291 3300005577 Bacteria 9524
163 Ga0068857_100019102 3300005577 Bacteria 6015
164 Ga0068857_100198181 3300005577 Bacteria 1830
165 Ga0068857_100227840 3300005577 Bacteria 1704
166 Ga0068854_100011530 3300005578 Bacteria 5761
167 Ga0068854_100024015 3300005578 Bacteria 4169
168 Ga0068854_100040406 3300005578 Bacteria 3291
169 Ga0068854_100577809 3300005578 Bacteria 957
170 Ga0068856_100002869 3300005614 Bacteria 17647
171 Ga0070702_100010963 3300005615 Bacteria 4492
172 Ga0068852_100022906 3300005616 Bacteria 5017
173 Ga0068852_100066636 3300005616 Bacteria 3145
174 Ga0068852_100410913 3300005616 Bacteria 1333
175 Ga0068852_101009828 3300005616 Bacteria 851
176 Ga0068859_100002465 3300005617 Bacteria 18831
177 Ga0068859_100118538 3300005617 Bacteria 2712
178 Ga0068859_100294143 3300005617 Bacteria 1717
179 Ga0068859_100713096 3300005617 Bacteria 1093
180 Ga0068859_100748041 3300005617 Bacteria 1067
181 Ga0068864_100003756 3300005618 Bacteria 12529
182 Ga0068864_100005694 3300005618 Bacteria 10215
183 Ga0068864_100149765 3300005618 Bacteria 2113
184 Ga0068864_100300491 3300005618 Bacteria 1503
185 Ga0068864_101072137 3300005618 Bacteria 801
186 Ga0068866_10013782 3300005718 Bacteria 3555
187 Ga0068866_10225756 3300005718 Bacteria 1133
188 Ga0068861_100003054 3300005719 Bacteria 11054
189 Ga0068861_100285963 3300005719 Bacteria 1422
190 Ga0068861_100470782 3300005719 Bacteria 1130
191 Ga0068861_100536719 3300005719 Bacteria 1063
192 Ga0068851_10185924 3300005834 Bacteria 1153
193 Ga0068851_10974760 3300005834 Bacteria 534
194 Ga0068870_10023946 3300005840 Bacteria 3017
195 Ga0068870_10127882 3300005840 Bacteria 1472
196 Ga0068870_10548644 3300005840 Bacteria 778
197 Ga0068863_100067683 3300005841 Bacteria 3378
198 Ga0068863_100127860 3300005841 Bacteria 2425
199 Ga0068863_100224774 3300005841 Bacteria 1809
200 Ga0068863_100249319 3300005841 Bacteria 1715
201 Ga0068863_100663312 3300005841 Bacteria 1035
202 Ga0068863_101049664 3300005841 Bacteria 818
203 Ga0068858_100003435 3300005842 Bacteria 15741
204 Ga0068858_100009536 3300005842 Bacteria 9260
205 Ga0068858_100009830 3300005842 Bacteria 9100
206 Ga0068858_100348196 3300005842 Bacteria 1419
207 Ga0068858_101929513 3300005842 Bacteria 584
208 Ga0068860_100003281 3300005843 Bacteria 16651
209 Ga0068860_100034146 3300005843 Bacteria 4878
210 Ga0068860_100222236 3300005843 Bacteria 1834
211 Ga0068860_100302226 3300005843 Bacteria 1568
212 Ga0068860_100886657 3300005843 Bacteria 908
213 Ga0068860_100941884 3300005843 Bacteria 881
214 Ga0068862_100023698 3300005844 Bacteria 5144
215 Ga0068862_100033125 3300005844 Bacteria 4365
216 Ga0068862_100238659 3300005844 Bacteria 1652
217 Ga0070716_100602882 3300006173 Bacteria 826
218 Ga0070716_100994372 3300006173 Bacteria 663
219 Ga0070716_101313075 3300006173 Bacteria 585
220 Ga0075362_10374219 3300006177 Bacteria 716
221 Ga0075367_10555632 3300006178 Bacteria 729
222 Ga0075427_10002958 3300006194 Bacteria 2314
223 Ga0075427_10023948 3300006194 Bacteria 979
224 Ga0075366_10013383 3300006195 Bacteria 4669
225 Ga0075366_10064639 3300006195 Bacteria 2176
226 Ga0075366_10081396 3300006195 Bacteria 1934
227 Ga0075366_10144212 3300006195 Bacteria 1440
228 Ga0075366_10383142 3300006195 Bacteria 865
229 Ga0075366_10426097 3300006195 Bacteria 817
230 Ga0075366_10842144 3300006195 Bacteria 571
231 Ga0097621_100047387 3300006237 Bacteria 3483
232 Ga0097621_100245659 3300006237 Bacteria 1566
233 Ga0097621_101331335 3300006237 Bacteria 679
234 Ga0075370_10015045 3300006353 Bacteria 4135
235 Ga0075370_10018575 3300006353 Bacteria 3774
236 Ga0075370_10036940 3300006353 Bacteria 2745
237 Ga0075370_10476620 3300006353 Bacteria 752
238 Ga0068871_100015936 3300006358 Bacteria 5645
239 Ga0068871_100018412 3300006358 Bacteria 5307
240 Ga0068871_101240659 3300006358 Bacteria 700
241 Ga0068871_101619352 3300006358 Bacteria 613
242 Ga0075428_100054190 3300006844 Bacteria 4395
243 Ga0075428_100288887 3300006844 Bacteria 1764
244 Ga0075428_100609698 3300006844 Bacteria 1165
245 Ga0075428_100893231 3300006844 Bacteria 943
246 Ga0075428_101531957 3300006844 Bacteria 698
247 Ga0075430_100320684 3300006846 Bacteria 1281
248 Ga0075430_100564827 3300006846 Unclassified 938
249 Ga0075431_100061108 3300006847 Bacteria 3888
250 Ga0075433_10079733 3300006852 Bacteria 2885
251 Ga0075433_10430172 3300006852 Bacteria 1164
252 Ga0075433_10646754 3300006852 Bacteria 927
253 Ga0075434_100035518 3300006871 Bacteria 4928
254 Ga0075434_100326253 3300006871 Bacteria 1556
255 Ga0075434_101078018 3300006871 Bacteria 817
256 Ga0075429_100001462 3300006880 Bacteria 19410
257 Ga0075429_100062270 3300006880 Bacteria 3251
258 Ga0075429_100097238 3300006880 Bacteria 2568
259 Ga0075429_100959157 3300006880 Unclassified 748
260 Ga0068865_100004028 3300006881 Bacteria 8825
261 Ga0068865_100023534 3300006881 Bacteria 4034
262 Ga0068865_100129605 3300006881 Bacteria 1888
263 Ga0068865_101192388 3300006881 Bacteria 674
264 Ga0075436_100041282 3300006914 Bacteria 3183
265 Ga0097620_100002465 3300006931 Bacteria 18831
266 Ga0097620_100118535 3300006931 Bacteria 2712
267 Ga0097620_100294133 3300006931 Bacteria 1717
268 Ga0097620_100713090 3300006931 Bacteria 1093
269 Ga0097620_100747970 3300006931 Bacteria 1067
270 Ga0099823_1000039 3300006944 Bacteria 61476
271 Ga0075435_100093531 3300007076 Bacteria 2484
272 Ga0075435_100882729 3300007076 Bacteria 779
273 Ga0105251_10002039 3300009011 Bacteria 16393
274 Ga0105251_10004772 3300009011 Bacteria 9073
275 Ga0105240_10066599 3300009093 Bacteria 4467
276 Ga0105240_10167932 3300009093 Bacteria 2601
277 Ga0105240_10650979 3300009093 Bacteria 1155
278 Ga0111539_10056418 3300009094 Bacteria 4668
279 Ga0111539_10527171 3300009094 Bacteria 1376
280 Ga0111539_10527406 3300009094 Bacteria 1376
281 Ga0105245_10026425 3300009098 Bacteria 5109
282 Ga0105245_10404071 3300009098 Bacteria 1366
283 Ga0105245_11262081 3300009098 Bacteria 787
284 Ga0105247_10007966 3300009101 Bacteria 6473
285 Ga0114129_10014043 3300009147 Bacteria 11408
286 Ga0114129_10025476 3300009147 Bacteria 8382
287 Ga0114129_10095326 3300009147 Bacteria 4121
288 Ga0114129_10141482 3300009147 Bacteria 3297
289 Ga0114129_10334723 3300009147 Unclassified 2009
290 Ga0114129_10809372 3300009147 Bacteria 1194
291 Ga0114129_12239859 3300009147 Unclassified 657
292 Ga0105243_10008116 3300009148 Bacteria 8059
293 Ga0105243_10010621 3300009148 Bacteria 6988
294 Ga0105243_10235877 3300009148 Bacteria 1625
295 Ga0105243_11397151 3300009148 Bacteria 720
296 Ga0105243_12713615 3300009148 Bacteria 536
297 Ga0105241_10213554 3300009174 Bacteria 1618
298 Ga0105241_11051791 3300009174 Bacteria 764
299 Ga0105241_11295995 3300009174 Bacteria 694
300 Ga0105241_11772186 3300009174 Bacteria 602
301 Ga0105242_10066853 3300009176 Bacteria 2970
302 Ga0105242_10990887 3300009176 Bacteria 847
303 Ga0105248_10005793 3300009177 Bacteria 13581
304 Ga0105248_10108265 3300009177 Bacteria 3133
305 Ga0105248_10180048 3300009177 Bacteria 2382
306 Ga0105248_10965075 3300009177 Bacteria 963
307 Ga0105237_10231349 3300009545 Bacteria 1849
308 Ga0105238_10108475 3300009551 Bacteria 2757
309 Ga0105238_10626530 3300009551 Bacteria 1085
310 Ga0105238_11353320 3300009551 Bacteria 739
311 Ga0105249_10063404 3300009553 Bacteria 3395
312 Ga0105249_10324206 3300009553 Bacteria 1552
313 Ga0105249_10736290 3300009553 Bacteria 1048
314 Ga0105239_10036788 3300010375 Bacteria 5370
315 Ga0105239_10243351 3300010375 Bacteria 2019
316 Ga0105239_11516147 3300010375 Bacteria 775
317 Ga0105246_10169149 3300011119 Bacteria 1672
318 Ga0157317_1000744 3300012475 Bacteria 1546
319 Ga0157329_1028350 3300012491 Bacteria 569
320 Ga0157319_1000009 3300012497 Bacteria 227971
321 Ga0157326_1072398 3300012513 Bacteria 549
322 Ga0157373_10180537 3300013100 Bacteria 1486
323 Ga0157373_10508701 3300013100 Bacteria 870
324 Ga0157371_11472322 3300013102 Bacteria 530
325 Ga0157370_10082879 3300013104 Bacteria 3016
326 Ga0157370_10496245 3300013104 Bacteria 1121
327 Ga0157369_10024322 3300013105 Bacteria 6740
328 Ga0157369_10393451 3300013105 Bacteria 1438
329 Ga0157369_10461657 3300013105 Bacteria 1315
330 Ga0157369_10569797 3300013105 Bacteria 1170
331 Ga0157374_10004327 3300013296 Bacteria 11944
332 Ga0157374_10020860 3300013296 Bacteria 5820
333 Ga0157374_10062072 3300013296 Bacteria 3501
334 Ga0157374_10192598 3300013296 Bacteria 1994
335 Ga0157374_11278967 3300013296 Bacteria 755
336 Ga0157374_11359201 3300013296 Bacteria 733
337 Ga0157378_10014439 3300013297 Bacteria 6915
338 Ga0157378_10066087 3300013297 Bacteria 3238
339 Ga0157378_10122241 3300013297 Bacteria 2401
340 Ga0157378_10482280 3300013297 Bacteria 1236
341 Ga0157378_11101428 3300013297 Bacteria 831
342 Ga0163162_10086943 3300013306 Bacteria 3204
343 Ga0163162_13259084 3300013306 Bacteria 520
344 Ga0157372_10313070 3300013307 Bacteria 1827
345 Ga0157372_11498347 3300013307 Bacteria 777
346 Ga0157375_10194638 3300013308 Bacteria 2183
347 Ga0157375_10329761 3300013308 Bacteria 1691
348 Ga0157375_10750598 3300013308 Bacteria 1127
349 Ga0157375_10980943 3300013308 Bacteria 985
350 Ga0163163_10001673 3300014325 Bacteria 18702
351 Ga0163163_12787259 3300014325 Bacteria 545
352 Ga0157380_10041059 3300014326 Bacteria 3608
353 Ga0157380_10187073 3300014326 Bacteria 1825
354 Ga0157380_10634255 3300014326 Bacteria 1063
355 Ga0182008_10037099 3300014497 Bacteria 2439
356 Ga0182008_10180800 3300014497 Bacteria 1067
357 Ga0157377_10000014 3300014745 Bacteria 213961
358 Ga0157377_10081716 3300014745 Bacteria 1891
359 Ga0157379_10000219 3300014968 Bacteria 44603
360 Ga0157379_10030507 3300014968 Bacteria 4800
361 Ga0157379_10124167 3300014968 Bacteria 2323
362 Ga0157379_10254490 3300014968 Bacteria 1595
363 Ga0157379_11705899 3300014968 Bacteria 617
364 Ga0157379_12678901 3300014968 Bacteria 500
365 Ga0157376_10054088 3300014969 Bacteria 3345
366 Ga0157376_10236378 3300014969 Bacteria 1700
367 Ga0157376_10265575 3300014969 Bacteria 1610
368 Ga0157376_10534013 3300014969 Bacteria 1158
369 Ga0157376_10810522 3300014969 Bacteria 949
370 Ga0157376_11595455 3300014969 Bacteria 687
371 Ga0163161_10072368 3300017792 Bacteria 2524
372 Ga0163161_10326148 3300017792 Bacteria 1215
373 Ga0206354_11614687 3300020081 Bacteria 618
374 Ga0213872_10000003 3300021361 Bacteria 366948
375 Ga0213872_10000004 3300021361 Bacteria 306230
376 Ga0213872_10145217 3300021361 Bacteria 1039
377 Ga0213876_10631559 3300021384 Bacteria 570
378 Ga0224712_10291944 3300022467 Bacteria 761
379 Ga0224712_10465848 3300022467 Bacteria 608
380 Ga0209566_119113 3300025225 Bacteria 566
381 Ga0209674_100003 3300025226 Bacteria 2196646
382 Ga0209563_100010 3300025230 Bacteria 1337457
383 Ga0207427_100190 3300025231 Bacteria 61601
384 Ga0209258_101187 3300025242 Bacteria 10481
385 Ga0209646_1000376 3300025246 Bacteria 28912
386 Ga0209026_1000179 3300025250 Bacteria 95680
387 Ga0209677_100026 3300025253 Bacteria 382520
388 Ga0209677_101024 3300025253 Bacteria 13321
389 Ga0209759_1000196 3300025256 Bacteria 95680
390 Ga0209759_1018777 3300025256 Bacteria 1662
391 Ga0209233_1048389 3300025261 Bacteria 878
392 Ga0209455_1016722 3300025272 Bacteria 1566
393 Ga0209673_1002939 3300025273 Bacteria 10725
394 Ga0209050_1005985 3300025298 Bacteria 7379
395 Ga0209256_1001390 3300025299 Bacteria 25244
396 Ga0209256_1003868 3300025299 Bacteria 9943
397 Ga0207426_1053188 3300025302 Bacteria 1196
398 Ga0209051_1001698 3300025303 Bacteria 17649
399 Ga0209051_1009070 3300025303 Bacteria 5175
400 Ga0209257_1000021 3300025304 Bacteria 771986
401 Ga0209257_1001619 3300025304 Bacteria 25820
402 Ga0209257_1002501 3300025304 Bacteria 18143
403 Ga0209257_1028703 3300025304 Bacteria 1827
404 Ga0207697_10015713 3300025315 Bacteria 3124
405 Ga0207697_10515293 3300025315 Bacteria 527
406 Ga0207656_10005381 3300025321 Bacteria 4521
407 Ga0207656_10076829 3300025321 Bacteria 1494
408 Ga0207656_10178703 3300025321 Bacteria 1018
409 Ga0207656_10526283 3300025321 Bacteria 601
410 Ga0207713_1004561 3300025735 Bacteria 8965
411 Ga0207682_10255469 3300025893 Bacteria 816
412 Ga0207642_10006837 3300025899 Bacteria 3816
413 Ga0207642_10074052 3300025899 Bacteria 1631
414 Ga0207642_11133081 3300025899 Bacteria 506
415 Ga0207710_10007106 3300025900 Bacteria 4750
416 Ga0207680_11068510 3300025903 Bacteria 577
417 Ga0207647_10051489 3300025904 Bacteria 2545
418 Ga0207645_10006139 3300025907 Bacteria 8631
419 Ga0207645_10033936 3300025907 Bacteria 3279
420 Ga0207645_10078391 3300025907 Bacteria 2117
421 Ga0207643_10086392 3300025908 Bacteria 1823
422 Ga0207643_10269398 3300025908 Bacteria 1053
423 Ga0207705_10020768 3300025909 Bacteria 4687
424 Ga0207705_10126668 3300025909 Bacteria 1899
425 Ga0207705_10269535 3300025909 Bacteria 1302
426 Ga0207684_10024612 3300025910 Bacteria 5133
427 Ga0207695_10074919 3300025913 Bacteria 3445
428 Ga0207695_10096986 3300025913 Bacteria 2949
429 Ga0207671_10170734 3300025914 Bacteria 1689
430 Ga0207671_10215547 3300025914 Bacteria 1503
431 Ga0207663_10759310 3300025916 Bacteria 771
432 Ga0207663_11319003 3300025916 Bacteria 581
433 Ga0207662_10284952 3300025918 Bacteria 1094
434 Ga0207657_10603296 3300025919 Bacteria 856
435 Ga0207649_10051542 3300025920 Bacteria 2549
436 Ga0207649_10167688 3300025920 Bacteria 1527
437 Ga0207649_10226266 3300025920 Bacteria 1335
438 Ga0207652_11703011 3300025921 Bacteria 535
439 Ga0207646_10327844 3300025922 Bacteria 1383
440 Ga0207646_10865572 3300025922 Bacteria 803
441 Ga0207681_10009728 3300025923 Bacteria 5884
442 Ga0207681_10266132 3300025923 Bacteria 1344
443 Ga0207681_10337164 3300025923 Bacteria 1203
444 Ga0207681_11359215 3300025923 Bacteria 596
445 Ga0207694_10010892 3300025924 Bacteria 6867
446 Ga0207694_10025050 3300025924 Bacteria 4533
447 Ga0207694_10903853 3300025924 Bacteria 747
448 Ga0207650_10036058 3300025925 Bacteria 3596
449 Ga0207650_10100444 3300025925 Bacteria 2226
450 Ga0207650_10254922 3300025925 Bacteria 1421
451 Ga0207650_10410741 3300025925 Bacteria 1122
452 Ga0207650_10423425 3300025925 Bacteria 1105
453 Ga0207659_10013120 3300025926 Bacteria 5299
454 Ga0207659_10300693 3300025926 Bacteria 1318
455 Ga0207659_10506020 3300025926 Bacteria 1023
456 Ga0207659_10519516 3300025926 Bacteria 1009
457 Ga0207659_10861505 3300025926 Bacteria 779
458 Ga0207687_10008565 3300025927 Bacteria 6688
459 Ga0207687_10355086 3300025927 Bacteria 1195
460 Ga0207687_10409440 3300025927 Bacteria 1117
461 Ga0207687_10606097 3300025927 Bacteria 923
462 Ga0207687_11720477 3300025927 Bacteria 537
463 Ga0207687_11844587 3300025927 Bacteria 517
464 Ga0207700_10368001 3300025928 Bacteria 1255
465 Ga0207664_10306616 3300025929 Bacteria 1398
466 Ga0207644_10015963 3300025931 Bacteria 5049
467 Ga0207644_10254235 3300025931 Bacteria 1403
468 Ga0207644_10860453 3300025931 Bacteria 759
469 Ga0207706_10117651 3300025933 Bacteria 2337
470 Ga0207706_10154164 3300025933 Bacteria 2021
471 Ga0207706_10676719 3300025933 Bacteria 883
472 Ga0207686_10011200 3300025934 Bacteria 4904
473 Ga0207709_10003260 3300025935 Bacteria 9730
474 Ga0207709_10015301 3300025935 Bacteria 4254
475 Ga0207709_10092039 3300025935 Bacteria 1984
476 Ga0207709_11533997 3300025935 Bacteria 553
477 Ga0207709_11677443 3300025935 Bacteria 528
478 Ga0207670_10010371 3300025936 Bacteria 5363
479 Ga0207669_10019511 3300025937 Bacteria 3533
480 Ga0207669_11789508 3300025937 Bacteria 525
481 Ga0207704_10064689 3300025938 Bacteria 2286
482 Ga0207704_10118500 3300025938 Bacteria 1806
483 Ga0207704_10702727 3300025938 Bacteria 837
484 Ga0207665_10621534 3300025939 Bacteria 845
485 Ga0207691_10004487 3300025940 Bacteria 13521
486 Ga0207691_10033350 3300025940 Bacteria 4794
487 Ga0207691_10060567 3300025940 Bacteria 3439
488 Ga0207691_10091311 3300025940 Bacteria 2729
489 Ga0207691_10193180 3300025940 Bacteria 1775
490 Ga0207691_10873224 3300025940 Bacteria 754
491 Ga0207711_10243081 3300025941 Bacteria 1651
492 Ga0207711_10253640 3300025941 Bacteria 1616
493 Ga0207711_10336820 3300025941 Bacteria 1396
494 Ga0207711_10357472 3300025941 Bacteria 1353
495 Ga0207711_11098577 3300025941 Bacteria 736
496 Ga0207711_11225471 3300025941 Bacteria 692
497 Ga0207689_10001602 3300025942 Bacteria 21425
498 Ga0207689_10002140 3300025942 Bacteria 18578
499 Ga0207689_10022610 3300025942 Bacteria 5283
500 Ga0207689_10134055 3300025942 Bacteria 2039
501 Ga0207689_10439543 3300025942 Bacteria 1090
502 Ga0207661_10068140 3300025944 Bacteria 2897
503 Ga0207661_10138200 3300025944 Bacteria 2095
504 Ga0207679_10008635 3300025945 Bacteria 6496
505 Ga0207679_10040313 3300025945 Bacteria 3342
506 Ga0207679_10515944 3300025945 Bacteria 1068
507 Ga0207679_10748737 3300025945 Bacteria 889
508 Ga0207679_10925411 3300025945 Bacteria 798
509 Ga0207679_11384647 3300025945 Bacteria 645
510 Ga0207667_10018765 3300025949 Bacteria 7745
511 Ga0207667_10047346 3300025949 Bacteria 4551
512 Ga0207667_10611192 3300025949 Bacteria 1098
513 Ga0207651_10223928 3300025960 Bacteria 1522
514 Ga0207651_10606709 3300025960 Bacteria 957
515 Ga0207651_11282564 3300025960 Bacteria 658
516 Ga0207712_10164157 3300025961 Bacteria 1729
517 Ga0207712_10269282 3300025961 Bacteria 1385
518 Ga0207712_10288885 3300025961 Bacteria 1341
519 Ga0207712_11853793 3300025961 Bacteria 540
520 Ga0207712_11854197 3300025961 Bacteria 540
521 Ga0207668_10039842 3300025972 Bacteria 3166
522 Ga0207668_10212146 3300025972 Bacteria 1549
523 Ga0207668_10571838 3300025972 Bacteria 981
524 Ga0207668_10617292 3300025972 Bacteria 946
525 Ga0207640_10010078 3300025981 Bacteria 5311
526 Ga0207640_10057871 3300025981 Bacteria 2551
527 Ga0207640_10061867 3300025981 Bacteria 2481
528 Ga0207640_10173292 3300025981 Bacteria 1610
529 Ga0207658_10013887 3300025986 Bacteria 5511
530 Ga0207658_10039087 3300025986 Bacteria 3422
531 Ga0207658_10154139 3300025986 Bacteria 1875
532 Ga0207658_10354194 3300025986 Bacteria 1279
533 Ga0207658_10389701 3300025986 Bacteria 1222
534 Ga0207658_11127817 3300025986 Bacteria 717
535 Ga0207677_10008875 3300026023 Bacteria 5635
536 Ga0207677_10059362 3300026023 Bacteria 2638
537 Ga0207677_10104206 3300026023 Bacteria 2096
538 Ga0207677_10116499 3300026023 Bacteria 2000
539 Ga0207703_10001278 3300026035 Bacteria 23343
540 Ga0207703_10029403 3300026035 Bacteria 4335
541 Ga0207703_10078750 3300026035 Bacteria 2739
542 Ga0207639_10693086 3300026041 Bacteria 945
543 Ga0207639_10697948 3300026041 Bacteria 941
544 Ga0207678_10000473 3300026067 Bacteria 36408
545 Ga0207678_10205504 3300026067 Bacteria 1685
546 Ga0207678_10208716 3300026067 Bacteria 1671
547 Ga0207678_10312398 3300026067 Bacteria 1351
548 Ga0207678_10375123 3300026067 Bacteria 1229
549 Ga0207678_10937314 3300026067 Bacteria 766
550 Ga0207708_10000303 3300026075 Bacteria 38825
551 Ga0207702_10000199 3300026078 Bacteria 70834
552 Ga0207702_10769020 3300026078 Bacteria 951
553 Ga0207702_10779771 3300026078 Bacteria 944
554 Ga0207641_10069900 3300026088 Bacteria 3016
555 Ga0207641_10152819 3300026088 Bacteria 2091
556 Ga0207641_10709242 3300026088 Bacteria 991
557 Ga0207641_10824435 3300026088 Bacteria 918
558 Ga0207641_11636214 3300026088 Bacteria 646
559 Ga0207648_10000989 3300026089 Bacteria 32078
560 Ga0207648_10001210 3300026089 Bacteria 28894
561 Ga0207648_10002261 3300026089 Bacteria 20835
562 Ga0207648_10005878 3300026089 Bacteria 12276
563 Ga0207648_10023717 3300026089 Bacteria 5490
564 Ga0207648_10177063 3300026089 Bacteria 1886
565 Ga0207648_10211059 3300026089 Bacteria 1724
566 Ga0207648_11358921 3300026089 Bacteria 668
567 Ga0207676_10001174 3300026095 Bacteria 19678
568 Ga0207676_10444026 3300026095 Bacteria 1221
569 Ga0207676_10838016 3300026095 Bacteria 899
570 Ga0207676_11955823 3300026095 Bacteria 585
571 Ga0207674_10002529 3300026116 Bacteria 23045
572 Ga0207674_10002678 3300026116 Bacteria 22220
573 Ga0207674_10223653 3300026116 Bacteria 1830
574 Ga0207674_10346593 3300026116 Bacteria 1436
575 Ga0207675_100007517 3300026118 Bacteria 10295
576 Ga0207675_100012286 3300026118 Bacteria 8000
577 Ga0207675_100053002 3300026118 Bacteria 3785
578 Ga0207675_100490497 3300026118 Bacteria 1222
579 Ga0207675_100785176 3300026118 Bacteria 965
580 Ga0207683_10003640 3300026121 Bacteria 13410
581 Ga0207683_10019235 3300026121 Bacteria 5831
582 Ga0207683_10134817 3300026121 Bacteria 2222
583 Ga0207683_10455791 3300026121 Bacteria 1179
584 Ga0207683_10722411 3300026121 Bacteria 924
585 Ga0207698_10011109 3300026142 Bacteria 5822
586 Ga0207698_10047615 3300026142 Bacteria 3250
587 Ga0207698_10054580 3300026142 Bacteria 3075
588 Ga0207698_11001758 3300026142 Bacteria 846
589 Ga0209389_1016990 3300027296 Bacteria 6583
590 Ga0209371_1041869 3300027312 Bacteria 924
591 Ga0209970_1000375 3300027614 Bacteria 7529
592 Ga0209974_10018581 3300027876 Bacteria 2307
593 Ga0209974_10026701 3300027876 Bacteria 1910
594 Ga0207428_10128569 3300027907 Bacteria 1939
595 Ga0268266_10063069 3300028379 Bacteria 3199
596 Ga0268266_10159918 3300028379 Bacteria 2037
597 Ga0268266_11460086 3300028379 Bacteria 659
598 Ga0268265_10016585 3300028380 Bacteria 5064
599 Ga0268265_10069764 3300028380 Bacteria 2731
600 Ga0268265_10907858 3300028380 Bacteria 865
601 Ga0268265_12089455 3300028380 Bacteria 573
602 Ga0268264_10002240 3300028381 Bacteria 17151
603 Ga0268264_10280643 3300028381 Bacteria 1560
604 Ga0268264_10365844 3300028381 Bacteria 1377
605 Ga0268264_10622522 3300028381 Bacteria 1066
606 Ga0268264_10815731 3300028381 Bacteria 933
607 Ga0268264_11228319 3300028381 Bacteria 759
608 Ga0268264_12426213 3300028381 Bacteria 530
609 Ga0265326_10044657 3300028558 Bacteria 1257
610 Ga0307515_10015579 3300028794 Bacteria 13992
611 Ga0307515_10034448 3300028794 Bacteria 8286
612 Ga0307515_10319825 3300028794 Bacteria 1219
613 Ga0265338_11029938 3300028800 Bacteria 556
614 Ga0268256_1035716 3300030500 Bacteria 1153
615 Ga0265330_10104424 3300031235 Bacteria 1212
616 Ga0265332_10000003 3300031238 Bacteria 482849
617 Ga0265332_10047978 3300031238 Bacteria 1837
618 Ga0265328_10056596 3300031239 Bacteria 1439
619 Ga0265331_10009862 3300031250 Bacteria 5323
620 Ga0265331_10152723 3300031250 Bacteria 1048
621 Ga0265331_10393606 3300031250 Bacteria 621
622 Ga0265327_10000639 3300031251 Bacteria 56852
623 Ga0265327_10281483 3300031251 Bacteria 735
624 Ga0265327_10291881 3300031251 Bacteria 719
625 Ga0265316_10299230 3300031344 Bacteria 1172
626 Ga0307513_10886298 3300031456 Bacteria 599
627 Ga0307408_100000008 3300031548 Bacteria 456355
628 Ga0307408_100010784 3300031548 Bacteria 6030
629 Ga0307408_100139882 3300031548 Bacteria 1899
630 Ga0307408_100166112 3300031548 Bacteria 1758
631 Ga0307408_100500722 3300031548 Bacteria 1063
632 Ga0307408_100810674 3300031548 Bacteria 850
633 Ga0307408_101869776 3300031548 Bacteria 575
634 Ga0307514_10009729 3300031649 Bacteria 8065
635 Ga0265314_10006842 3300031711 Bacteria 9991
636 Ga0265314_10173303 3300031711 Bacteria 1300
637 Ga0316578_10297624 3300031728 Unclassified 965
638 Ga0316578_10734005 3300031728 Bacteria 574
639 Ga0307516_10046181 3300031730 Bacteria 4299
640 Ga0307516_10489805 3300031730 Bacteria 884
641 Ga0307405_11081714 3300031731 Bacteria 688
642 Ga0316577_10112505 3300031733 Bacteria 1528
643 Ga0307413_10066854 3300031824 Bacteria 2245
644 Ga0307413_11824667 3300031824 Bacteria 545
645 Ga0307410_10233903 3300031852 Bacteria 1420
646 Ga0307410_10463845 3300031852 Unclassified 1036
647 Ga0307406_10283571 3300031901 Bacteria 1265
648 Ga0307406_10813340 3300031901 Bacteria 789
649 Ga0307407_10125131 3300031903 Bacteria 1636
650 Ga0307412_10071470 3300031911 Bacteria 2369
651 Ga0307412_11905926 3300031911 Bacteria 548
652 Ga0307409_100832962 3300031995 Bacteria 932
653 Ga0307416_100406253 3300032002 Bacteria 1401
654 Ga0307416_100457337 3300032002 Bacteria 1331
655 Ga0307414_10005408 3300032004 Bacteria 7032
656 Ga0307414_10077234 3300032004 Bacteria 2423
657 Ga0307411_10002403 3300032005 Bacteria 8259
658 Ga0307411_10046584 3300032005 Bacteria 2797
659 Ga0307411_10059237 3300032005 Bacteria 2538
660 Ga0307411_10098512 3300032005 Bacteria 2061
661 Ga0307411_11054269 3300032005 Bacteria 730
662 Ga0307411_11527810 3300032005 Bacteria 614
663 Ga0307415_100972357 3300032126 Bacteria 787
664 Ga0307415_101463994 3300032126 Bacteria 652
665 Ga0316583_10000505 3300032133 Bacteria 11690
666 Ga0316583_10046522 3300032133 Bacteria 1531
667 Ga0316585_10090382 3300032137 Bacteria 1000
668 Ga0316580_10006497 3300032139 Bacteria 3456
669 Ga0316593_10017449 3300032168 Bacteria 2189
670 Ga0316593_10075960 3300032168 Bacteria 1167
671 Ga0316593_10339833 3300032168 Bacteria 573
672 Ga0307510_10010932 3300033180 Bacteria 10784
673 Ga0316592_1009074 3300033524 Bacteria 1984
674 Ga0316592_1011917 3300033524 Bacteria 1776
675 Ga0316592_1066976 3300033524 Bacteria 809
676 Ga0316588_1011413 3300033528 Bacteria 1895
677 Ga0316588_1030504 3300033528 Bacteria 1264
678 Ga0316588_1082867 3300033528 Bacteria 795
679 Ga0316588_1159407 3300033528 Bacteria 581
680 Ga0316596_1008073 3300033541 Bacteria 2500
681 Ga0316596_1015318 3300033541 Bacteria 1909
682 Ga0316596_1023247 3300033541 Bacteria 1587
683 Ga0316596_1091781 3300033541 Bacteria 819
684 Ga0373948_0013571 3300034817 Bacteria 1473
685 Ga0373948_0177691 3300034817 Bacteria 545
686 Ga0373950_0004828 3300034818 Bacteria 1989
687 Ga0373959_0011480 3300034820 Bacteria 1566
688 Ga0373940_0360028 3300035088 Bacteria 512
689 Ga0373944_0056740 3300035089 Bacteria 1247
690 Ga0373936_0044210 3300035113 Bacteria 1792
691 Ga0373939_0000087 3300035114 Bacteria 29365
692 Ga0373939_0046994 3300035114 Bacteria 1324
693 Ga0373960_0001671 3300035121 Bacteria 4958
694 Ga0373943_0006120 3300035170 Bacteria 5407
695 Ga0373943_0329173 3300035170 Bacteria 872
696 Ga0373955_0317179 3300035172 Bacteria 941
697 Ga0373955_0832678 3300035172 Bacteria 567
698 Ga0316574_0123163 3300035398 Bacteria 1665
699 Ga0373931_0028446 3300035691 Bacteria 2862
700 Ga0373935_0260506 3300035692 Bacteria 1216
701 Ga0373935_0374048 3300035692 Bacteria 1019
702 Ga0373935_1164537 3300035692 Bacteria 574
703 Ga0373933_0155594 3300035724 Bacteria 1450
704 Ga0373933_0230600 3300035724 Bacteria 1189
705 Ga0373933_0895212 3300035724 Bacteria 584
706 Ga0373933_0896887 3300035724 Bacteria 584
707 Ga0373937_0264803 3300036401 Bacteria 1621
708 Ga0373937_0637354 3300036401 Bacteria 1011
709 Ga0265778_045304 3300036457 Bacteria 593
710 Ga0316582_0011992 3300036647 Bacteria 4821
711 Ga0316582_0139318 3300036647 Bacteria 1635
712 Ga0316582_0256101 3300036647 Bacteria 1200
713 Ga0316582_0802616 3300036647 Bacteria 645
714 Ga0316582_0836391 3300036647 Bacteria 630
715 Ga0316584_0191418 3300036712 Bacteria 1512
716 Ga0316584_0313368 3300036712 Bacteria 1134
717 Ga0373925_0003208 3300037068 Bacteria 12787
718 Ga0373925_0018461 3300037068 Bacteria 5069
719 Ga0373925_0158168 3300037068 Bacteria 1783
720 Ga0373925_0158692 3300037068 Bacteria 1780
721 Ga0395899_0001756 3300037312 Bacteria 17997
722 Ga0395899_0222706 3300037312 Bacteria 1306
723 Ga0395899_0983985 3300037312 Bacteria 510
724 Ga0395900_0004771 3300037418 Bacteria 14288
725 Ga0395900_0026850 3300037418 Bacteria 5892
726 Ga0395900_0124112 3300037418 Bacteria 2648
727 Ga0395900_0403427 3300037418 Bacteria 1331
728 Ga0395900_1845541 3300037418 Bacteria 515
729 Ga0395898_0009054 3300037466 Bacteria 10483
730 Ga0395898_0010085 3300037466 Bacteria 9887
731 Ga0395898_0517414 3300037466 Bacteria 1134
732 Ga0395905_0000766 3300037471 Bacteria 42342
733 Ga0395905_0001291 3300037471 Bacteria 30780
734 Ga0395905_0004548 3300037471 Bacteria 14362
735 Ga0395905_0052309 3300037471 Bacteria 3823
736 Ga0395905_0059255 3300037471 Bacteria 3579
737 Ga0395905_1032633 3300037471 Bacteria 725
738 Ga0395905_1759121 3300037471 Bacteria 525
739 Ga0395905_1783186 3300037471 Bacteria 521
740 Ga0395901_0007642 3300038443 Bacteria 10911
741 Ga0395901_0019770 3300038443 Bacteria 6886
742 Ga0395901_0117284 3300038443 Bacteria 2797
743 Ga0395901_0356645 3300038443 Bacteria 1509
744 Ga0395901_0360516 3300038443 Bacteria 1499
745 Ga0400489_45479 3300039093 Bacteria 11750
746 Ga0436360_0744003 3300039438 Bacteria 1670
747 Ga0436360_1242945 3300039438 Bacteria 594
748 Ga0436361_0279516 3300039447 Bacteria 4326
749 Ga0436361_0287447 3300039447 Bacteria 113524
750 Ga0436361_0678114 3300039447 Bacteria 29523
751 Ga0436361_0705591 3300039447 Bacteria 695
752 Ga0436363_0441867 3300039450 Bacteria 976
753 Ga0436363_0596578 3300039450 Bacteria 796
754 Ga0436363_0815012 3300039450 Bacteria 632
755 Ga0436363_1031840 3300039450 Bacteria 570
756 Ga0436363_1464495 3300039450 Bacteria 1052
757 Ga0436362_1021080 3300039453 Bacteria 588
758 Ga0439466_0082200 3300041411 Bacteria 1015
759 Ga0451787_030105 3300041441 Bacteria 544
760 Ga0451787_668171 3300041441 Bacteria 1255
761 Ga0451791_1086428 3300041451 Bacteria 603
762 Ga0451802_0131515 3300041460 Bacteria 1008
763 Ga0451807_2119567 3300041486 Bacteria 2241
764 Ga0451837_0043705 3300041494 Bacteria 524
765 Ga0451837_0666052 3300041494 Bacteria 583
766 Ga0451837_1120325 3300041494 Bacteria 646
767 Ga0451841_0206002 3300041498 Bacteria 566
768 Ga0451845_0380090 3300041501 Bacteria 600
769 Ga0451845_0830242 3300041501 Bacteria 599
770 Ga0451855_0132408 3300041511 Bacteria 571
771 Ga0451853_1463132 3300041512 Bacteria 868
772 Ga0450911_000894 3300042115 Bacteria 8015
773 Ga0450917_001378 3300042120 Bacteria 1739
774 Ga0450888_005029 3300042126 Bacteria 1398
775 Ga0450890_001901 3300042127 Bacteria 2959
776 Ga0450890_004383 3300042127 Bacteria 1845
777 Ga0450891_001710 3300042129 Bacteria 2256
778 Ga0450892_001476 3300042130 Bacteria 2269
779 Ga0450898_024633 3300042134 Bacteria 1076
780 Ga0450902_006744 3300042137 Bacteria 1764
781 Ga0450903_007325 3300042138 Bacteria 1817
782 Ga0439459_0003448 3300042438 Bacteria 2511
783 Ga0439459_0103217 3300042438 Bacteria 700
784 Ga0439460_0264163 3300042461 Bacteria 597
785 Ga0450893_0006035 3300042532 Bacteria 1952
786 Ga0451577_0000114 3300042876 Bacteria 175957
787 Ga0451577_0000794 3300042876 Bacteria 47578
788 Ga0451577_0159878 3300042876 Bacteria 2028
789 Ga0451577_0631408 3300042876 Bacteria 972
790 Ga0451577_0687709 3300042876 Bacteria 927
791 Ga0451577_0962168 3300042876 Bacteria 768
792 Ga0466972_0084766 3300044658 Bacteria 1506
793 Ga0453683_0180180 3300044673 Bacteria 1340
794 Ga0453683_0629555 3300044673 Bacteria 701
795 Ga0466965_0117317 3300044683 Bacteria 1372
796 Ga0466965_0505387 3300044683 Bacteria 678
797 Ga0466966_0103684 3300044684 Bacteria 1758
798 Ga0466966_0198910 3300044684 Bacteria 1213
799 Ga0466963_0145702 3300044694 Bacteria 1643
800 Ga0466963_0371434 3300044694 Bacteria 1008
801 Ga0453684_0001710 3300044712 Bacteria 59044
802 Ga0453684_0068382 3300044712 Bacteria 4511
803 Ga0453684_0326156 3300044712 Bacteria 1737
804 Ga0453684_1349225 3300044712 Bacteria 742
805 Ga0453684_2004800 3300044712 Unclassified 583
806 Ga0453684_2054193 3300044712 Bacteria 574
807 Ga0466968_0147808 3300044735 Bacteria 1078
808 Ga0466968_0306713 3300044735 Bacteria 764
809 Ga0466957_0216089 3300044842 Bacteria 1264
810 Ga0466960_0089877 3300044901 Bacteria 1563
811 Ga0466960_0746211 3300044901 Bacteria 590
812 Ga0451576_0000099 3300045051 Bacteria 220245
813 Ga0451576_0000335 3300045051 Bacteria 113806
814 Ga0451576_0006435 3300045051 Bacteria 14400
815 Ga0451576_0012757 3300045051 Bacteria 9431
816 Ga0451576_0104147 3300045051 Bacteria 2951
817 Ga0451576_0239277 3300045051 Bacteria 1896
818 Ga0451576_0504691 3300045051 Bacteria 1271
819 Ga0451576_1363199 3300045051 Unclassified 739
820 Ga0466967_1369738 3300045976 Bacteria 705
821 Ga0495603_0321590 3300046455 Bacteria 888
822 Ga0495590_0001778 3300046457 Bacteria 9154
823 Ga0495590_0059944 3300046457 Bacteria 1332
824 Ga0495590_0096535 3300046457 Bacteria 1048
825 Ga0495629_0256849 3300046459 Bacteria 1201
826 Ga0495629_0483610 3300046459 Bacteria 836
827 Ga0495653_0111372 3300046463 Bacteria 1966
828 Ga0495650_0044940 3300046471 Bacteria 1863
829 Ga0495662_0048356 3300046476 Bacteria 2053
830 Ga0495664_0007416 3300046477 Bacteria 6089
831 Ga0495664_0060716 3300046477 Bacteria 2251
832 Ga0495594_0586819 3300046499 Bacteria 632
833 Ga0495596_0056108 3300046500 Bacteria 1539
834 Ga0495607_0000128 3300046501 Bacteria 80585
835 Ga0495606_0005133 3300046507 Bacteria 12701
836 Ga0495606_0007947 3300046507 Bacteria 9343
837 Ga0495608_0283582 3300046511 Bacteria 1028
838 Ga0495608_0737903 3300046511 Bacteria 584
839 Ga0495618_0144220 3300046514 Bacteria 1523
840 Ga0495620_0060161 3300046515 Bacteria 1584
841 Ga0495628_0056722 3300046516 Bacteria 3082
842 Ga0495628_0367036 3300046516 Bacteria 1056
843 Ga0495632_0177607 3300046519 Bacteria 976
844 Ga0495643_0000363 3300046522 Bacteria 61710
845 Ga0495644_0341347 3300046523 Bacteria 589
846 Ga0495652_0117812 3300046529 Bacteria 2123
847 Ga0495654_0020792 3300046530 Bacteria 3418
848 Ga0495654_0033445 3300046530 Bacteria 2602
849 Ga0495654_0265227 3300046530 Bacteria 711
850 Ga0495665_0078186 3300046531 Bacteria 1740
851 Ga0495586_0261995 3300046535 Bacteria 987
852 Ga0495587_0148275 3300046536 Bacteria 1337
853 Ga0495597_0006061 3300046542 Bacteria 6294
854 Ga0495645_0019385 3300046543 Bacteria 4897
855 Ga0495645_0079259 3300046543 Bacteria 2359
856 Ga0495645_0114708 3300046543 Bacteria 1903
857 Ga0495645_0424570 3300046543 Bacteria 843
858 Ga0495622_0157320 3300046557 Bacteria 1026
859 Ga0495667_0635068 3300046559 Bacteria 664
860 Ga0495611_0472353 3300046648 Bacteria 571
861 Ga0495625_0008095 3300046660 Bacteria 9014
862 Ga0495625_0181815 3300046660 Bacteria 1397
863 Ga0495635_0322791 3300046663 Bacteria 1033
864 Ga0495635_0345849 3300046663 Bacteria 992
865 Ga0495588_0320519 3300046674 Bacteria 815
866 Ga0495588_0339750 3300046674 Bacteria 789
867 Ga0495657_0038484 3300046675 Bacteria 3291
868 Ga0495599_0217271 3300046678 Bacteria 1171
869 Ga0495599_0707098 3300046678 Bacteria 580
870 Ga0495623_0057100 3300046679 Bacteria 2456
871 Ga0495646_0076728 3300046680 Bacteria 1956
872 Ga0495646_0169371 3300046680 Bacteria 1204
873 Ga0495658_0158634 3300046683 Bacteria 1394
874 Ga0495658_0594809 3300046683 Bacteria 709
875 Ga0495624_0065050 3300046690 Bacteria 2278
876 Ga0495624_0235589 3300046690 Bacteria 1108
877 Ga0495671_0080454 3300046692 Bacteria 1596
878 Ga0495649_0005791 3300046694 Bacteria 7787
879 Ga0495649_0040011 3300046694 Bacteria 2569
880 Ga0495649_0040733 3300046694 Bacteria 2542
881 Ga0495649_0249808 3300046694 Bacteria 911
882 Ga0495600_0156726 3300046809 Bacteria 1473
883 Ga0495660_0183393 3300046810 Bacteria 1011
884 Ga0495604_0118990 3300047317 Bacteria 1914
885 Ga0495674_0034424 3300047319 Bacteria 4581
886 Ga0495674_0794830 3300047319 Bacteria 736
887 Ga0495672_0000330 3300047320 Bacteria 62176
888 Ga0495680_0202234 3300047322 Bacteria 1424
889 Ga0495680_0628364 3300047322 Bacteria 716
890 Ga0495680_0927895 3300047322 Bacteria 561
891 Ga0495683_0001439 3300047323 Bacteria 15648
892 Ga0495683_0040580 3300047323 Bacteria 2351
893 Ga0495683_0175268 3300047323 Bacteria 983
894 Ga0495687_000011 3300047443 Bacteria 397225
895 Ga0495687_039572 3300047443 Bacteria 2085
896 Ga0495687_130333 3300047443 Bacteria 891
897 Ga0495675_0191475 3300047444 Bacteria 1248
898 Ga0495675_0792198 3300047444 Bacteria 525
899 Ga0495673_0189758 3300047469 Bacteria 774
900 Ga0495684_0135088 3300047471 Bacteria 1851
901 Ga0495684_0472858 3300047471 Bacteria 867
902 Ga0495686_0011473 3300047472 Bacteria 6239
903 Ga0495686_0157648 3300047472 Bacteria 1328
904 Ga0495593_0056524 3300047673 Bacteria 2062
905 Ga0495593_0135404 3300047673 Bacteria 1249
906 Ga0495593_0141152 3300047673 Bacteria 1220
907 Ga0495602_0084270 3300048088 Bacteria 2660
908 Ga0495602_0178179 3300048088 Bacteria 1642
909 Ga0495626_0221612 3300048091 Bacteria 768
910 Ga0496100_0028622 3300048903 Bacteria 3438
911 Ga0496100_0321480 3300048903 Bacteria 1162
912 Ga0496100_1124069 3300048903 Bacteria 619
913 Ga0496100_1366102 3300048903 Bacteria 559
914 Ga0496101_0014863 3300048904 Bacteria 5239
915 Ga0496101_0179631 3300048904 Bacteria 1629
916 Ga0496101_0402812 3300048904 Bacteria 1077
917 Ga0496102_0010175 3300048905 Bacteria 8088
918 Ga0496102_0095352 3300048905 Bacteria 2757
919 Ga0496102_0254979 3300048905 Bacteria 1654
920 Ga0496103_0009526 3300048906 Bacteria 5750
921 Ga0496103_0097531 3300048906 Bacteria 1858
922 Ga0496104_0228353 3300048907 Bacteria 1773
923 Ga0496104_0501831 3300048907 Bacteria 1124
924 Ga0496104_0766574 3300048907 Bacteria 871
925 Ga0496105_0090234 3300048908 Bacteria 2531
926 Ga0496105_0249069 3300048908 Bacteria 1440
927 Ga0496105_0261635 3300048908 Bacteria 1399
928 Ga0496105_0626065 3300048908 Bacteria 833
929 Ga0496106_0002491 3300048909 Bacteria 13709
930 Ga0496106_0250470 3300048909 Bacteria 1416
931 Ga0496106_1480719 3300048909 Bacteria 523
932 Ga0496107_0015993 3300048910 Bacteria 5264
933 Ga0496107_0917383 3300048910 Bacteria 638
934 Ga0496108_0192950 3300048911 Bacteria 1766
935 Ga0496108_0472425 3300048911 Bacteria 1096
936 Ga0496108_0876541 3300048911 Bacteria 771
937 Ga0496109_0082395 3300048912 Bacteria 2965
938 Ga0496109_0110266 3300048912 Bacteria 2559
939 Ga0496109_0171369 3300048912 Bacteria 2036
940 Ga0496109_1033871 3300048912 Bacteria 759
941 Ga0496109_1809612 3300048912 Bacteria 544
942 Ga0496110_0003972 3300048913 Bacteria 11386
943 Ga0496111_0132611 3300048914 Bacteria 1844
944 Ga0496111_0152600 3300048914 Bacteria 1714
945 Ga0496112_0019328 3300048915 Bacteria 6428
946 Ga0496112_0982063 3300048915 Bacteria 765
947 Ga0496112_1632226 3300048915 Bacteria 558
948 Ga0496113_0132535 3300048916 Bacteria 1956
949 Ga0496113_0453903 3300048916 Bacteria 1030
950 Ga0496114_0038689 3300048917 Bacteria 3947
951 Ga0496114_0738500 3300048917 Bacteria 861
952 Ga0496114_0739676 3300048917 Bacteria 860
953 Ga0496115_0604957 3300048918 Bacteria 871
954 Ga0496115_1193498 3300048918 Bacteria 572
955 Ga0496116_0009193 3300048919 Bacteria 8459
956 Ga0496117_0026874 3300048920 Bacteria 4494
957 Ga0496117_0507096 3300048920 Bacteria 583
958 Ga0496118_0041832 3300048921 Bacteria 3622
959 Ga0496119_0026780 3300048922 Bacteria 3986
960 Ga0496120_0224537 3300048923 Bacteria 895
961 Ga0496121_0019078 3300048924 Bacteria 6879
962 Ga0496121_0039345 3300048924 Bacteria 4170
963 Ga0496122_0004945 3300048925 Bacteria 16161
964 Ga0496122_0184625 3300048925 Bacteria 1239
965 Ga0496123_0039281 3300048926 Bacteria 3312
966 Ga0496124_0092106 3300048927 Bacteria 2469
967 Ga0496125_0018804 3300048928 Bacteria 6545
968 Ga0496125_0022128 3300048928 Bacteria 5909
969 Ga0496125_0076660 3300048928 Bacteria 2580
970 Ga0496125_0180485 3300048928 Bacteria 1407
971 Ga0496126_0117688 3300048929 Bacteria 2308
972 Ga0496126_0217715 3300048929 Bacteria 1606
973 Ga0496126_0241750 3300048929 Bacteria 1508
974 Ga0501309_041843 3300049129 Bacteria 702
975 Ga0501304_034299 3300049160 Bacteria 550
976 Ga0501305_018980 3300049161 Bacteria 1000
977 Ga0501293_019775 3300049516 Bacteria 652
978 Ga0501294_019481 3300049517 Bacteria 726
979 Ga0501295_068977 3300049518 Bacteria 787
980 Ga0501296_058137 3300049519 Bacteria 580
981 Ga0501298_015382 3300049521 Bacteria 1377
982 Ga0501298_085417 3300049521 Bacteria 700
983 Ga0501300_001083 3300049523 Bacteria 4132
984 Ga0501300_057153 3300049523 Unclassified 612
985 Ga0501301_004146 3300049524 Bacteria 1019
986 Ga0501311_052383 3300049527 Bacteria 642
987 Ga0501314_004795 3300049530 Bacteria 1134
988 Ga0501315_024162 3300049531 Bacteria 839
989 Ga0501032_0125834 3300049569 Bacteria 1693
990 Ga0501034_0001279 3300049571 Bacteria 34010
991 Ga0501034_0048885 3300049571 Bacteria 4268
992 Ga0501034_0057761 3300049571 Bacteria 3900
993 Ga0501034_0354738 3300049571 Bacteria 1394
994 Ga0501036_0227629 3300049572 Bacteria 1565
995 Ga0501036_1719121 3300049572 Bacteria 505
996 Ga0501038_0201101 3300049574 Bacteria 1599
997 Ga0501039_0111979 3300049575 Bacteria 2134
998 Ga0501039_0407647 3300049575 Bacteria 1068
999 Ga0501041_0247270 3300049577 Bacteria 1121
1000 Ga0501043_0174669 3300049579 Bacteria 1675
1001 Ga0501046_0174512 3300049580 Bacteria 1611
1002 Ga0501046_0646528 3300049580 Bacteria 748
1003 Ga0501046_1061848 3300049580 Bacteria 560
1004 Ga0501047_0062974 3300049581 Bacteria 3578
1005 Ga0501048_0645028 3300049582 Bacteria 760
1006 Ga0501067_0300921 3300049583 Bacteria 893
1007 Ga0501068_0008164 3300049584 Bacteria 5816
1008 Ga0501070_0014948 3300049586 Bacteria 6530
1009 Ga0501070_0036866 3300049586 Bacteria 4083
1010 Ga0501072_0016016 3300049588 Bacteria 5749
1011 Ga0501072_0026626 3300049588 Bacteria 4509
1012 Ga0501073_0005603 3300049589 Bacteria 9397
1013 Ga0501073_0042689 3300049589 Bacteria 3199
1014 Ga0501074_0054209 3300049590 Bacteria 2892
1015 Ga0501074_0130885 3300049590 Bacteria 1795
1016 Ga0501201_000859 3300049651 Bacteria 2848
1017 Ga0501201_036779 3300049651 Bacteria 576
1018 Ga0501202_038852 3300049652 Bacteria 1021
1019 Ga0501206_052465 3300049653 Bacteria 652
1020 Ga0501207_081301 3300049654 Bacteria 624
1021 Ga0501211_000781 3300049658 Bacteria 3272
1022 Ga0501222_007027 3300049662 Bacteria 1507
1023 Ga0501227_016101 3300049665 Bacteria 1677
1024 Ga0501227_120054 3300049665 Bacteria 709
1025 Ga0501233_095703 3300049668 Bacteria 780
1026 Ga0501235_005194 3300049669 Bacteria 2831
1027 Ga0501257_241715 3300049686 Bacteria 532
1028 Ga0501258_031822 3300049687 Bacteria 670
1029 Ga0501261_026506 3300049690 Bacteria 858
1030 Ga0501221_002565 3300049704 Bacteria 2994
1031 Ga0501225_0007329 3300049705 Bacteria 3197
1032 Ga0501225_0151083 3300049705 Bacteria 708
1033 Ga0501229_003048 3300049706 Bacteria 1993
1034 Ga0501079_1403461 3300049741 Bacteria 549
1035 Ga0501080_0005258 3300049742 Bacteria 11527
1036 Ga0501080_0069393 3300049742 Bacteria 3278
1037 Ga0501080_0516962 3300049742 Bacteria 1065
1038 Ga0501080_1837926 3300049742 Bacteria 508
1039 Ga0501083_0178203 3300049744 Bacteria 1388
1040 Ga0501262_015777 3300049759 Bacteria 994
1041 Ga0501262_075898 3300049759 Bacteria 556
1042 Ga0501263_015469 3300049760 Bacteria 986
1043 Ga0501265_001438 3300049762 Bacteria 2696
1044 Ga0501265_061022 3300049762 Bacteria 616
1045 Ga0501267_005593 3300049764 Bacteria 1192
1046 Ga0501269_002880 3300049766 Bacteria 2097
1047 Ga0501270_054354 3300049767 Bacteria 734
1048 Ga0501272_011539 3300049769 Bacteria 996
1049 Ga0501035_0040039 3300049822 Bacteria 4237
1050 Ga0501044_0085617 3300049823 Bacteria 3185
1051 Ga0501044_0466820 3300049823 Bacteria 1167
1052 Ga0501045_0132772 3300049824 Bacteria 1851
1053 Ga0501045_1314721 3300049824 Bacteria 526
1054 nmdc:mga0k408_135732_c1 3300050493 Bacteria 1462
1055 nmdc:mga0k408_4965_c1 3300050493 Bacteria 7050
1056 nmdc:mga0k408_53793_c1 3300050493 Bacteria 2333
1057 nmdc:mga0k408_560699_c1 3300050493 Bacteria 675
1058 nmdc:mga0k408_75037_c1 3300050493 Bacteria 1976
1059 nmdc:mga06z11_567089_c1 3300050494 Bacteria 690
1060 nmdc:mga07m45_11043_c1 3300050496 Bacteria 4735
1061 nmdc:mga07m45_13378_c2 3300050496 Bacteria 3567
1062 nmdc:mga07m45_5516_c1 3300050496 Bacteria 6304
1063 nmdc:mga07m45_68942_c1 3300050496 Bacteria 1248
1064 nmdc:mga05p37_1031235_c1 3300050507 Bacteria 870
1065 nmdc:mga05p37_17657_c1 3300050507 Bacteria 8610
1066 nmdc:mga05p37_2063341_c1 3300050507 Unclassified 536
1067 nmdc:mga05p37_316962_c1 3300050507 Bacteria 1847
1068 nmdc:mga05p37_38293_c1 3300050507 Bacteria 5882
1069 nmdc:mga05p37_3859_c1 3300050507 Bacteria 17541
1070 nmdc:mga05p37_809731_c1 3300050507 Bacteria 1023
1071 nmdc:mga05p37_90325_c1 3300050507 Bacteria 3775
1072 nmdc:mga09592_227045_c1 3300050508 Bacteria 1618
1073 nmdc:mga09592_448440_c1 3300050508 Unclassified 1113
1074 nmdc:mga09592_547183_c1 3300050508 Bacteria 994
1075 nmdc:mga09592_9225_c1 3300050508 Bacteria 8023
1076 nmdc:mga0qj67_1374977_c1 3300050509 Bacteria 545
1077 nmdc:mga0qj67_519531_c1 3300050509 Unclassified 956
1078 nmdc:mga06r32_33320_c1 3300050510 Bacteria 4852
1079 nmdc:mga08y16_1724283_c1 3300050511 Bacteria 581
1080 nmdc:mga08y16_44605_c1 3300050511 Bacteria 4645
1081 nmdc:mga0n895_24727_c1 3300050512 Bacteria 5663
1082 nmdc:mga0n895_880590_c1 3300050512 Bacteria 882
1083 nmdc:mga0n895_912803_c1 3300050512 Bacteria 863
1084 nmdc:mga0rr50_1085303_c1 3300050513 Bacteria 681
1085 nmdc:mga0rr50_152126_c1 3300050513 Bacteria 1871
1086 nmdc:mga08x19_46492_c1 3300050514 Bacteria 2776
1087 nmdc:mga0a205_31268_c1 3300050515 Bacteria 5100
1088 nmdc:mga0a205_566832_c1 3300050515 Bacteria 990
1089 nmdc:mga0sz30_57096_c2 3300050516 Bacteria 937
1090 Ga0495612_0026745 3300053078 Bacteria 2318
1091 Ga0500578_0043481 3300053086 Bacteria 2884
1092 Ga0500607_084959 3300053121 Bacteria 1606
1093 Ga0500636_0536665 3300053177 Bacteria 509
1094 Ga0500645_003647 3300053730 Bacteria 6157
1095 Ga0500587_010883 3300053739 Bacteria 1152
1096 Ga0501084_0081891 3300054114 Bacteria 2708
1097 Ga0501084_0421750 3300054114 Bacteria 1128
1098 Ga0587125_016601 3300059607 Bacteria 828
1099 Ga0587111_0280390 3300060346 Bacteria 503
1100 Ga0501082_0112905 3300060353 Bacteria 2353
1101 Ga0501082_0375736 3300060353 Bacteria 1240
1102 Ga0501082_0381022 3300060353 Bacteria 1231
1103 Ga0501082_0735769 3300060353 Bacteria 863
1104 Ga0501082_1557610 3300060353 Bacteria 577

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0962168 Ga0451577_0962168_448_750 100
2 3300037418 Ga0395900_1845541 Ga0395900_1845541_111_449 105
3 3300038443 Ga0395901_0356645 Ga0395901_0356645_520_858 105
4 3300042134 Ga0450898_024633 Ga0450898_024633_243_566 107
5 iso_pu_bacteria 2643221544 2643742746 108
6 iso_pu_bacteria 2643221585 2643936267 108
7 iso_pu_bacteria 2643221639 2644217638 108
8 iso_pu_bacteria 2643221646 2644258627 108
9 iso_pu_bacteria 2643221654 2644304956 108
10 iso_pu_bacteria 2643221656 2644316912 108
11 iso_pu_bacteria 2738541337 2739056673 108
12 iso_pu_bacteria 2881927736 2881931439 108
13 iso_pu_bacteria 2886848708 2886853515 108
14 iso_pu_bacteria 2919704043 2919705496 108
15 3300060353 Ga0501082_1557610 Ga0501082_1557610_66_398 110
16 3300001989 JGI24739J22299_10025768 JGI24739J22299_100257683 112
17 3300001990 JGI24737J22298_10096788 JGI24737J22298_100967881 112
18 3300002067 JGI24735J21928_10011789 JGI24735J21928_100117892 112
19 3300002077 JGI24744J21845_10006067 JGI24744J21845_100060672 112
20 3300002705 JGI25156J39149_1001412 JGI25156J39149_100141210 112
21 3300002738 JGI25154J39366_1002457 JGI25154J39366_10024576 112
22 3300002741 JGI25157J39369_1000423 JGI25157J39369_100042330 112
23 3300002772 JGI25164J39214_1003965 JGI25164J39214_10039652 112
24 3300003162 Ga0006778J45830_1096314 Ga0006778J45830_10963141 112
25 3300003308 Ga0006777J48905_1063803 Ga0006777J48905_10638031 112
26 3300003322 rootL2_10006260 rootL2_100062609 112
27 3300003354 JGI25160J50197_1091470 JGI25160J50197_10914701 112
28 3300003752 Ga0055539_1000874 Ga0055539_10008747 112
29 3300003752 Ga0055539_1001489 Ga0055539_10014892 112
30 3300003756 Ga0055533_1000006 Ga0055533_1000006138 112
31 3300003761 Ga0055535_1010743 Ga0055535_10107432 112
32 3300003775 Ga0055524_1003908 Ga0055524_10039085 112
33 3300003775 Ga0055524_1011613 Ga0055524_10116133 112
34 3300003791 Ga0055530_10043228 Ga0055530_100432283 112
35 3300003792 Ga0055540_1033015 Ga0055540_10330151 112
36 3300003794 Ga0055531_10000313 Ga0055531_1000031332 112
37 3300003794 Ga0055531_10004052 Ga0055531_100040526 112
38 3300003794 Ga0055531_10009008 Ga0055531_100090085 112
39 3300004800 Ga0058861_11642297 Ga0058861_116422971 112
40 3300005262 Ga0065165_1000184 Ga0065165_100018464 112
41 3300005289 Ga0065704_10169711 Ga0065704_101697112 112
42 3300005289 Ga0065704_10475728 Ga0065704_104757281 112
43 3300005293 Ga0065715_10304726 Ga0065715_103047262 112
44 3300005293 Ga0065715_10423716 Ga0065715_104237162 112
45 3300005293 Ga0065715_10657363 Ga0065715_106573632 112
46 3300005295 Ga0065707_10002367 Ga0065707_100023674 112
47 3300005295 Ga0065707_11073738 Ga0065707_110737381 112
48 3300005327 Ga0070658_10045045 Ga0070658_100450454 112
49 3300005327 Ga0070658_10231457 Ga0070658_102314572 112
50 3300005327 Ga0070658_10453221 Ga0070658_104532212 112
51 3300005328 Ga0070676_10005714 Ga0070676_100057143 112
52 3300005328 Ga0070676_10107903 Ga0070676_101079033 112
53 3300005328 Ga0070676_10340037 Ga0070676_103400372 112
54 3300005328 Ga0070676_10786420 Ga0070676_107864201 112
55 3300005329 Ga0070683_100239506 Ga0070683_1002395062 112
56 3300005329 Ga0070683_100674772 Ga0070683_1006747722 112
57 3300005330 Ga0070690_100001971 Ga0070690_1000019716 112
58 3300005330 Ga0070690_100018981 Ga0070690_1000189813 112
59 3300005331 Ga0070670_100006292 Ga0070670_1000062929 112
60 3300005331 Ga0070670_100025014 Ga0070670_1000250145 112
61 3300005331 Ga0070670_100227875 Ga0070670_1002278753 112
62 3300005331 Ga0070670_100517913 Ga0070670_1005179131 112
63 3300005331 Ga0070670_100560409 Ga0070670_1005604092 112
64 3300005331 Ga0070670_101343585 Ga0070670_1013435852 112
65 3300005333 Ga0070677_10087336 Ga0070677_100873361 112
66 3300005333 Ga0070677_10251214 Ga0070677_102512141 112
67 3300005334 Ga0068869_100002581 Ga0068869_1000025814 112
68 3300005334 Ga0068869_100040418 Ga0068869_1000404183 112
69 3300005334 Ga0068869_100049953 Ga0068869_1000499532 112
70 3300005334 Ga0068869_100074593 Ga0068869_1000745932 112
71 3300005334 Ga0068869_100890308 Ga0068869_1008903082 112
72 3300005334 Ga0068869_101311655 Ga0068869_1013116551 112
73 3300005337 Ga0070682_100061679 Ga0070682_1000616792 112
74 3300005338 Ga0068868_100004780 Ga0068868_1000047808 112
75 3300005338 Ga0068868_100113852 Ga0068868_1001138523 112
76 3300005338 Ga0068868_100416010 Ga0068868_1004160102 112
77 3300005338 Ga0068868_100750939 Ga0068868_1007509391 112
78 3300005339 Ga0070660_100414090 Ga0070660_1004140902 112
79 3300005340 Ga0070689_100005903 Ga0070689_10000590311 112
80 3300005341 Ga0070691_10011042 Ga0070691_100110421 112
81 3300005344 Ga0070661_100110585 Ga0070661_1001105852 112
82 3300005345 Ga0070692_10042501 Ga0070692_100425012 112
83 3300005345 Ga0070692_10462025 Ga0070692_104620252 112
84 3300005345 Ga0070692_10576267 Ga0070692_105762672 112
85 3300005347 Ga0070668_100003380 Ga0070668_1000033806 112
86 3300005347 Ga0070668_100040416 Ga0070668_1000404163 112
87 3300005347 Ga0070668_100100591 Ga0070668_1001005912 112
88 3300005347 Ga0070668_100255410 Ga0070668_1002554102 112
89 3300005347 Ga0070668_100729319 Ga0070668_1007293192 112
90 3300005353 Ga0070669_100013932 Ga0070669_1000139324 112
91 3300005353 Ga0070669_100029809 Ga0070669_1000298093 112
92 3300005353 Ga0070669_100234526 Ga0070669_1002345261 112
93 3300005354 Ga0070675_100011427 Ga0070675_1000114275 112
94 3300005354 Ga0070675_100059003 Ga0070675_1000590032 112
95 3300005354 Ga0070675_100230942 Ga0070675_1002309422 112
96 3300005354 Ga0070675_100760156 Ga0070675_1007601562 112
97 3300005354 Ga0070675_100973166 Ga0070675_1009731661 112
98 3300005355 Ga0070671_100078732 Ga0070671_1000787323 112
99 3300005355 Ga0070671_100131713 Ga0070671_1001317133 112
100 3300005356 Ga0070674_100064999 Ga0070674_1000649992 112
101 3300005364 Ga0070673_100262558 Ga0070673_1002625582 112
102 3300005365 Ga0070688_100109170 Ga0070688_1001091703 112
103 3300005365 Ga0070688_100854879 Ga0070688_1008548791 112
104 3300005366 Ga0070659_100083453 Ga0070659_1000834532 112
105 3300005366 Ga0070659_100093911 Ga0070659_1000939112 112
106 3300005366 Ga0070659_100694396 Ga0070659_1006943962 112
107 3300005367 Ga0070667_100006231 Ga0070667_1000062314 112
108 3300005367 Ga0070667_100018932 Ga0070667_1000189322 112
109 3300005367 Ga0070667_101426982 Ga0070667_1014269821 112
110 3300005436 Ga0070713_100365386 Ga0070713_1003653862 112
111 3300005438 Ga0070701_10004252 Ga0070701_100042522 112
112 3300005439 Ga0070711_100871702 Ga0070711_1008717022 112
113 3300005439 Ga0070711_100995868 Ga0070711_1009958682 112
114 3300005440 Ga0070705_100077812 Ga0070705_1000778123 112
115 3300005441 Ga0070700_100001276 Ga0070700_10000127610 112
116 3300005441 Ga0070700_100623604 Ga0070700_1006236041 112
117 3300005441 Ga0070700_101374993 Ga0070700_1013749931 112
118 3300005441 Ga0070700_101495590 Ga0070700_1014955901 112
119 3300005445 Ga0070708_100000726 Ga0070708_1000007265 112
120 3300005445 Ga0070708_100114581 Ga0070708_1001145811 112
121 3300005445 Ga0070708_100617810 Ga0070708_1006178101 112
122 3300005455 Ga0070663_100012072 Ga0070663_1000120722 112
123 3300005455 Ga0070663_100060237 Ga0070663_1000602373 112
124 3300005455 Ga0070663_100822870 Ga0070663_1008228701 112
125 3300005455 Ga0070663_100837994 Ga0070663_1008379942 112
126 3300005456 Ga0070678_100011210 Ga0070678_1000112104 112
127 3300005456 Ga0070678_100175503 Ga0070678_1001755032 112
128 3300005456 Ga0070678_100390947 Ga0070678_1003909472 112
129 3300005457 Ga0070662_100089481 Ga0070662_1000894812 112
130 3300005457 Ga0070662_100662984 Ga0070662_1006629842 112
131 3300005459 Ga0068867_100000610 Ga0068867_10000061021 112
132 3300005459 Ga0068867_100001706 Ga0068867_1000017064 112
133 3300005459 Ga0068867_100008197 Ga0068867_1000081974 112
134 3300005459 Ga0068867_100008463 Ga0068867_1000084635 112
135 3300005459 Ga0068867_100317408 Ga0068867_1003174082 112
136 3300005459 Ga0068867_100378813 Ga0068867_1003788132 112
137 3300005459 Ga0068867_100386264 Ga0068867_1003862642 112
138 3300005459 Ga0068867_100387353 Ga0068867_1003873532 112
139 3300005466 Ga0070685_10321549 Ga0070685_103215492 112
140 3300005467 Ga0070706_100396687 Ga0070706_1003966872 112
141 3300005467 Ga0070706_101015595 Ga0070706_1010155951 112
142 3300005468 Ga0070707_100098346 Ga0070707_1000983462 112
143 3300005471 Ga0070698_100174328 Ga0070698_1001743282 112
144 3300005471 Ga0070698_100249367 Ga0070698_1002493673 112
145 3300005471 Ga0070698_100862335 Ga0070698_1008623351 112
146 3300005518 Ga0070699_100099649 Ga0070699_1000996492 112
147 3300005535 Ga0070684_100937387 Ga0070684_1009373872 112
148 3300005536 Ga0070697_100510661 Ga0070697_1005106612 112
149 3300005539 Ga0068853_100399837 Ga0068853_1003998372 112
150 3300005539 Ga0068853_100731849 Ga0068853_1007318491 112
151 3300005543 Ga0070672_100005096 Ga0070672_1000050966 112
152 3300005543 Ga0070672_100018094 Ga0070672_1000180943 112
153 3300005543 Ga0070672_100026372 Ga0070672_1000263724 112
154 3300005543 Ga0070672_100365888 Ga0070672_1003658882 112
155 3300005543 Ga0070672_100400917 Ga0070672_1004009173 112
156 3300005543 Ga0070672_100710640 Ga0070672_1007106401 112
157 3300005544 Ga0070686_100026545 Ga0070686_1000265453 112
158 3300005545 Ga0070695_100043274 Ga0070695_1000432741 112
159 3300005545 Ga0070695_100280176 Ga0070695_1002801762 112
160 3300005546 Ga0070696_100417909 Ga0070696_1004179092 112
161 3300005547 Ga0070693_100457333 Ga0070693_1004573331 112
162 3300005548 Ga0070665_100029400 Ga0070665_1000294002 112
163 3300005548 Ga0070665_100085416 Ga0070665_1000854163 112
164 3300005548 Ga0070665_100305599 Ga0070665_1003055992 112
165 3300005548 Ga0070665_100450514 Ga0070665_1004505142 112
166 3300005549 Ga0070704_100309738 Ga0070704_1003097382 112
167 3300005549 Ga0070704_100384762 Ga0070704_1003847622 112
168 3300005563 Ga0068855_100056261 Ga0068855_1000562612 112
169 3300005563 Ga0068855_100342735 Ga0068855_1003427352 112
170 3300005563 Ga0068855_100750014 Ga0068855_1007500141 112
171 3300005564 Ga0070664_100010288 Ga0070664_1000102882 112
172 3300005564 Ga0070664_100065829 Ga0070664_1000658291 112
173 3300005564 Ga0070664_100179946 Ga0070664_1001799462 112
174 3300005564 Ga0070664_100460415 Ga0070664_1004604152 112
175 3300005564 Ga0070664_100593119 Ga0070664_1005931192 112
176 3300005564 Ga0070664_100699584 Ga0070664_1006995842 112
177 3300005577 Ga0068857_100007291 Ga0068857_1000072913 112
178 3300005577 Ga0068857_100019102 Ga0068857_1000191021 112
179 3300005577 Ga0068857_100198181 Ga0068857_1001981813 112
180 3300005577 Ga0068857_100227840 Ga0068857_1002278402 112
181 3300005578 Ga0068854_100011530 Ga0068854_1000115303 112
182 3300005578 Ga0068854_100024015 Ga0068854_1000240154 112
183 3300005578 Ga0068854_100040406 Ga0068854_1000404063 112
184 3300005578 Ga0068854_100577809 Ga0068854_1005778092 112
185 3300005614 Ga0068856_100002869 Ga0068856_10000286911 112
186 3300005615 Ga0070702_100010963 Ga0070702_1000109633 112
187 3300005616 Ga0068852_100022906 Ga0068852_1000229065 112
188 3300005616 Ga0068852_100066636 Ga0068852_1000666363 112
189 3300005616 Ga0068852_100410913 Ga0068852_1004109131 112
190 3300005616 Ga0068852_101009828 Ga0068852_1010098281 112
191 3300005617 Ga0068859_100002465 Ga0068859_1000024656 112
192 3300005617 Ga0068859_100118538 Ga0068859_1001185383 112
193 3300005617 Ga0068859_100294143 Ga0068859_1002941432 112
194 3300005617 Ga0068859_100713096 Ga0068859_1007130961 112
195 3300005617 Ga0068859_100748041 Ga0068859_1007480412 112
196 3300005618 Ga0068864_100003756 Ga0068864_1000037568 112
197 3300005618 Ga0068864_100005694 Ga0068864_1000056946 112
198 3300005618 Ga0068864_100149765 Ga0068864_1001497652 112
199 3300005618 Ga0068864_100300491 Ga0068864_1003004913 112
200 3300005618 Ga0068864_101072137 Ga0068864_1010721371 112
201 3300005718 Ga0068866_10013782 Ga0068866_100137823 112
202 3300005718 Ga0068866_10225756 Ga0068866_102257562 112
203 3300005719 Ga0068861_100003054 Ga0068861_1000030545 112
204 3300005719 Ga0068861_100285963 Ga0068861_1002859633 112
205 3300005719 Ga0068861_100470782 Ga0068861_1004707822 112
206 3300005719 Ga0068861_100536719 Ga0068861_1005367192 112
207 3300005834 Ga0068851_10185924 Ga0068851_101859242 112
208 3300005834 Ga0068851_10974760 Ga0068851_109747602 112
209 3300005840 Ga0068870_10023946 Ga0068870_100239463 112
210 3300005840 Ga0068870_10127882 Ga0068870_101278823 112
211 3300005840 Ga0068870_10548644 Ga0068870_105486442 112
212 3300005841 Ga0068863_100067683 Ga0068863_1000676832 112
213 3300005841 Ga0068863_100127860 Ga0068863_1001278604 112
214 3300005841 Ga0068863_100224774 Ga0068863_1002247742 112
215 3300005841 Ga0068863_100249319 Ga0068863_1002493192 112
216 3300005841 Ga0068863_100663312 Ga0068863_1006633121 112
217 3300005841 Ga0068863_101049664 Ga0068863_1010496642 112
218 3300005842 Ga0068858_100003435 Ga0068858_10000343511 112
219 3300005842 Ga0068858_100009536 Ga0068858_1000095363 112
220 3300005842 Ga0068858_100009830 Ga0068858_1000098308 112
221 3300005842 Ga0068858_100348196 Ga0068858_1003481962 112
222 3300005842 Ga0068858_101929513 Ga0068858_1019295131 112
223 3300005843 Ga0068860_100003281 Ga0068860_10000328112 112
224 3300005843 Ga0068860_100034146 Ga0068860_1000341464 112
225 3300005843 Ga0068860_100222236 Ga0068860_1002222362 112
226 3300005843 Ga0068860_100302226 Ga0068860_1003022262 112
227 3300005843 Ga0068860_100886657 Ga0068860_1008866572 112
228 3300005843 Ga0068860_100941884 Ga0068860_1009418842 112
229 3300005844 Ga0068862_100023698 Ga0068862_1000236983 112
230 3300005844 Ga0068862_100033125 Ga0068862_1000331255 112
231 3300005844 Ga0068862_100238659 Ga0068862_1002386592 112
232 3300006173 Ga0070716_100602882 Ga0070716_1006028821 112
233 3300006173 Ga0070716_100994372 Ga0070716_1009943721 112
234 3300006173 Ga0070716_101313075 Ga0070716_1013130752 112
235 3300006177 Ga0075362_10374219 Ga0075362_103742192 112
236 3300006178 Ga0075367_10555632 Ga0075367_105556322 112
237 3300006194 Ga0075427_10002958 Ga0075427_100029581 112
238 3300006194 Ga0075427_10023948 Ga0075427_100239481 112
239 3300006195 Ga0075366_10013383 Ga0075366_100133832 112
240 3300006195 Ga0075366_10064639 Ga0075366_100646392 112
241 3300006195 Ga0075366_10081396 Ga0075366_100813962 112
242 3300006195 Ga0075366_10144212 Ga0075366_101442122 112
243 3300006195 Ga0075366_10383142 Ga0075366_103831422 112
244 3300006195 Ga0075366_10426097 Ga0075366_104260971 112
245 3300006195 Ga0075366_10842144 Ga0075366_108421441 112
246 3300006237 Ga0097621_100047387 Ga0097621_1000473873 112
247 3300006237 Ga0097621_100245659 Ga0097621_1002456592 112
248 3300006237 Ga0097621_101331335 Ga0097621_1013313352 112
249 3300006353 Ga0075370_10015045 Ga0075370_100150452 112
250 3300006353 Ga0075370_10018575 Ga0075370_100185753 112
251 3300006353 Ga0075370_10036940 Ga0075370_100369402 112
252 3300006353 Ga0075370_10476620 Ga0075370_104766202 112
253 3300006358 Ga0068871_100015936 Ga0068871_1000159361 112
254 3300006358 Ga0068871_100018412 Ga0068871_1000184122 112
255 3300006358 Ga0068871_101240659 Ga0068871_1012406592 112
256 3300006358 Ga0068871_101619352 Ga0068871_1016193521 112
257 3300006844 Ga0075428_100054190 Ga0075428_1000541902 112
258 3300006844 Ga0075428_100288887 Ga0075428_1002888872 112
259 3300006844 Ga0075428_100609698 Ga0075428_1006096982 112
260 3300006844 Ga0075428_100893231 Ga0075428_1008932311 112
261 3300006844 Ga0075428_101531957 Ga0075428_1015319572 112
262 3300006846 Ga0075430_100320684 Ga0075430_1003206842 112
263 3300006846 Ga0075430_100564827 Ga0075430_1005648272 112
264 3300006847 Ga0075431_100061108 Ga0075431_1000611082 112
265 3300006852 Ga0075433_10079733 Ga0075433_100797334 112
266 3300006852 Ga0075433_10430172 Ga0075433_104301723 112
267 3300006852 Ga0075433_10646754 Ga0075433_106467541 112
268 3300006871 Ga0075434_100035518 Ga0075434_1000355185 112
269 3300006871 Ga0075434_100326253 Ga0075434_1003262533 112
270 3300006871 Ga0075434_101078018 Ga0075434_1010780182 112
271 3300006880 Ga0075429_100001462 Ga0075429_1000014626 112
272 3300006880 Ga0075429_100062270 Ga0075429_1000622702 112
273 3300006880 Ga0075429_100097238 Ga0075429_1000972381 112
274 3300006880 Ga0075429_100959157 Ga0075429_1009591571 112
275 3300006881 Ga0068865_100004028 Ga0068865_1000040284 112
276 3300006881 Ga0068865_100023534 Ga0068865_1000235343 112
277 3300006881 Ga0068865_100129605 Ga0068865_1001296051 112
278 3300006881 Ga0068865_101192388 Ga0068865_1011923881 112
279 3300006914 Ga0075436_100041282 Ga0075436_1000412822 112
280 3300006931 Ga0097620_100002465 Ga0097620_1000024656 112
281 3300006931 Ga0097620_100118535 Ga0097620_1001185353 112
282 3300006931 Ga0097620_100294133 Ga0097620_1002941332 112
283 3300006931 Ga0097620_100713090 Ga0097620_1007130901 112
284 3300006931 Ga0097620_100747970 Ga0097620_1007479702 112
285 3300006944 Ga0099823_1000039 Ga0099823_100003930 112
286 3300007076 Ga0075435_100093531 Ga0075435_1000935312 112
287 3300007076 Ga0075435_100882729 Ga0075435_1008827292 112
288 3300009011 Ga0105251_10002039 Ga0105251_1000203912 112
289 3300009011 Ga0105251_10004772 Ga0105251_100047727 112
290 3300009093 Ga0105240_10066599 Ga0105240_100665992 112
291 3300009093 Ga0105240_10167932 Ga0105240_101679324 112
292 3300009093 Ga0105240_10650979 Ga0105240_106509792 112
293 3300009094 Ga0111539_10056418 Ga0111539_100564182 112
294 3300009094 Ga0111539_10527171 Ga0111539_105271712 112
295 3300009094 Ga0111539_10527406 Ga0111539_105274061 112
296 3300009098 Ga0105245_10026425 Ga0105245_100264252 112
297 3300009098 Ga0105245_10404071 Ga0105245_104040712 112
298 3300009098 Ga0105245_11262081 Ga0105245_112620812 112
299 3300009101 Ga0105247_10007966 Ga0105247_100079666 112
300 3300009147 Ga0114129_10014043 Ga0114129_100140435 112
301 3300009147 Ga0114129_10025476 Ga0114129_100254766 112
302 3300009147 Ga0114129_10095326 Ga0114129_100953261 112
303 3300009147 Ga0114129_10141482 Ga0114129_101414823 112
304 3300009147 Ga0114129_10334723 Ga0114129_103347232 112
305 3300009147 Ga0114129_10809372 Ga0114129_108093722 112
306 3300009147 Ga0114129_12239859 Ga0114129_122398591 112
307 3300009148 Ga0105243_10008116 Ga0105243_100081165 112
308 3300009148 Ga0105243_10010621 Ga0105243_100106219 112
309 3300009148 Ga0105243_10235877 Ga0105243_102358773 112
310 3300009148 Ga0105243_11397151 Ga0105243_113971512 112
311 3300009148 Ga0105243_12713615 Ga0105243_127136152 112
312 3300009174 Ga0105241_10213554 Ga0105241_102135542 112
313 3300009174 Ga0105241_11051791 Ga0105241_110517912 112
314 3300009174 Ga0105241_11295995 Ga0105241_112959952 112
315 3300009174 Ga0105241_11772186 Ga0105241_117721861 112
316 3300009176 Ga0105242_10066853 Ga0105242_100668533 112
317 3300009176 Ga0105242_10990887 Ga0105242_109908872 112
318 3300009177 Ga0105248_10005793 Ga0105248_1000579313 112
319 3300009177 Ga0105248_10108265 Ga0105248_101082652 112
320 3300009177 Ga0105248_10180048 Ga0105248_101800483 112
321 3300009177 Ga0105248_10965075 Ga0105248_109650751 112
322 3300009545 Ga0105237_10231349 Ga0105237_102313492 112
323 3300009551 Ga0105238_10108475 Ga0105238_101084753 112
324 3300009551 Ga0105238_10626530 Ga0105238_106265302 112
325 3300009551 Ga0105238_11353320 Ga0105238_113533201 112
326 3300009553 Ga0105249_10063404 Ga0105249_100634042 112
327 3300009553 Ga0105249_10324206 Ga0105249_103242062 112
328 3300009553 Ga0105249_10736290 Ga0105249_107362902 112
329 3300010375 Ga0105239_10036788 Ga0105239_100367887 112
330 3300010375 Ga0105239_10243351 Ga0105239_102433512 112
331 3300010375 Ga0105239_11516147 Ga0105239_115161471 112
332 3300011119 Ga0105246_10169149 Ga0105246_101691492 112
333 3300012475 Ga0157317_1000744 Ga0157317_10007442 112
334 3300012491 Ga0157329_1028350 Ga0157329_10283502 112
335 3300012497 Ga0157319_1000009 Ga0157319_100000974 112
336 3300012513 Ga0157326_1072398 Ga0157326_10723982 112
337 3300013100 Ga0157373_10180537 Ga0157373_101805372 112
338 3300013100 Ga0157373_10508701 Ga0157373_105087012 112
339 3300013102 Ga0157371_11472322 Ga0157371_114723221 112
340 3300013104 Ga0157370_10082879 Ga0157370_100828793 112
341 3300013104 Ga0157370_10496245 Ga0157370_104962452 112
342 3300013105 Ga0157369_10024322 Ga0157369_100243223 112
343 3300013105 Ga0157369_10393451 Ga0157369_103934512 112
344 3300013105 Ga0157369_10461657 Ga0157369_104616572 112
345 3300013105 Ga0157369_10569797 Ga0157369_105697971 112
346 3300013296 Ga0157374_10004327 Ga0157374_100043273 112
347 3300013296 Ga0157374_10020860 Ga0157374_100208605 112
348 3300013296 Ga0157374_10062072 Ga0157374_100620722 112
349 3300013296 Ga0157374_10192598 Ga0157374_101925983 112
350 3300013296 Ga0157374_11278967 Ga0157374_112789672 112
351 3300013296 Ga0157374_11359201 Ga0157374_113592012 112
352 3300013297 Ga0157378_10014439 Ga0157378_100144395 112
353 3300013297 Ga0157378_10066087 Ga0157378_100660873 112
354 3300013297 Ga0157378_10122241 Ga0157378_101222413 112
355 3300013297 Ga0157378_10482280 Ga0157378_104822802 112
356 3300013297 Ga0157378_11101428 Ga0157378_111014282 112
357 3300013306 Ga0163162_10086943 Ga0163162_100869433 112
358 3300013306 Ga0163162_13259084 Ga0163162_132590841 112
359 3300013307 Ga0157372_10313070 Ga0157372_103130704 112
360 3300013307 Ga0157372_11498347 Ga0157372_114983472 112
361 3300013308 Ga0157375_10194638 Ga0157375_101946382 112
362 3300013308 Ga0157375_10329761 Ga0157375_103297611 112
363 3300013308 Ga0157375_10750598 Ga0157375_107505982 112
364 3300013308 Ga0157375_10980943 Ga0157375_109809432 112
365 3300014325 Ga0163163_10001673 Ga0163163_1000167313 112
366 3300014325 Ga0163163_12787259 Ga0163163_127872592 112
367 3300014326 Ga0157380_10041059 Ga0157380_100410594 112
368 3300014326 Ga0157380_10187073 Ga0157380_101870732 112
369 3300014326 Ga0157380_10634255 Ga0157380_106342552 112
370 3300014497 Ga0182008_10037099 Ga0182008_100370992 112
371 3300014497 Ga0182008_10180800 Ga0182008_101808002 112
372 3300014745 Ga0157377_10000014 Ga0157377_10000014113 112
373 3300014745 Ga0157377_10081716 Ga0157377_100817163 112
374 3300014968 Ga0157379_10000219 Ga0157379_1000021927 112
375 3300014968 Ga0157379_10030507 Ga0157379_100305073 112
376 3300014968 Ga0157379_10124167 Ga0157379_101241673 112
377 3300014968 Ga0157379_10254490 Ga0157379_102544903 112
378 3300014968 Ga0157379_11705899 Ga0157379_117058991 112
379 3300014968 Ga0157379_12678901 Ga0157379_126789011 112
380 3300014969 Ga0157376_10054088 Ga0157376_100540882 112
381 3300014969 Ga0157376_10236378 Ga0157376_102363782 112
382 3300014969 Ga0157376_10265575 Ga0157376_102655752 112
383 3300014969 Ga0157376_10534013 Ga0157376_105340132 112
384 3300014969 Ga0157376_10810522 Ga0157376_108105222 112
385 3300014969 Ga0157376_11595455 Ga0157376_115954552 112
386 3300017792 Ga0163161_10072368 Ga0163161_100723683 112
387 3300017792 Ga0163161_10326148 Ga0163161_103261481 112
388 3300020081 Ga0206354_11614687 Ga0206354_116146872 112
389 3300021361 Ga0213872_10000003 Ga0213872_1000000312 112
390 3300021361 Ga0213872_10000004 Ga0213872_10000004144 112
391 3300021361 Ga0213872_10145217 Ga0213872_101452172 112
392 3300021384 Ga0213876_10631559 Ga0213876_106315591 112
393 3300022467 Ga0224712_10291944 Ga0224712_102919441 112
394 3300022467 Ga0224712_10465848 Ga0224712_104658481 112
395 3300025225 Ga0209566_119113 Ga0209566_1191132 112
396 3300025226 Ga0209674_100003 Ga0209674_1000031198 112
397 3300025230 Ga0209563_100010 Ga0209563_100010926 112
398 3300025231 Ga0207427_100190 Ga0207427_1001904 112
399 3300025242 Ga0209258_101187 Ga0209258_10118711 112
400 3300025246 Ga0209646_1000376 Ga0209646_100037631 112
401 3300025250 Ga0209026_1000179 Ga0209026_100017960 112
402 3300025253 Ga0209677_100026 Ga0209677_1000269 112
403 3300025253 Ga0209677_101024 Ga0209677_1010248 112
404 3300025256 Ga0209759_1000196 Ga0209759_100019660 112
405 3300025256 Ga0209759_1018777 Ga0209759_10187772 112
406 3300025261 Ga0209233_1048389 Ga0209233_10483892 112
407 3300025272 Ga0209455_1016722 Ga0209455_10167221 112
408 3300025273 Ga0209673_1002939 Ga0209673_10029398 112
409 3300025298 Ga0209050_1005985 Ga0209050_10059856 112
410 3300025299 Ga0209256_1001390 Ga0209256_10013907 112
411 3300025299 Ga0209256_1003868 Ga0209256_10038686 112
412 3300025302 Ga0207426_1053188 Ga0207426_10531882 112
413 3300025303 Ga0209051_1001698 Ga0209051_100169810 112
414 3300025303 Ga0209051_1009070 Ga0209051_10090703 112
415 3300025304 Ga0209257_1000021 Ga0209257_1000021438 112
416 3300025304 Ga0209257_1001619 Ga0209257_100161917 112
417 3300025304 Ga0209257_1002501 Ga0209257_10025017 112
418 3300025304 Ga0209257_1028703 Ga0209257_10287033 112
419 3300025315 Ga0207697_10015713 Ga0207697_100157133 112
420 3300025315 Ga0207697_10515293 Ga0207697_105152931 112
421 3300025321 Ga0207656_10005381 Ga0207656_100053816 112
422 3300025321 Ga0207656_10076829 Ga0207656_100768293 112
423 3300025321 Ga0207656_10178703 Ga0207656_101787032 112
424 3300025321 Ga0207656_10526283 Ga0207656_105262831 112
425 3300025735 Ga0207713_1004561 Ga0207713_10045616 112
426 3300025893 Ga0207682_10255469 Ga0207682_102554692 112
427 3300025899 Ga0207642_10006837 Ga0207642_100068373 112
428 3300025899 Ga0207642_10074052 Ga0207642_100740522 112
429 3300025899 Ga0207642_11133081 Ga0207642_111330811 112
430 3300025900 Ga0207710_10007106 Ga0207710_100071064 112
431 3300025903 Ga0207680_11068510 Ga0207680_110685102 112
432 3300025904 Ga0207647_10051489 Ga0207647_100514893 112
433 3300025907 Ga0207645_10006139 Ga0207645_100061394 112
434 3300025907 Ga0207645_10033936 Ga0207645_100339362 112
435 3300025907 Ga0207645_10078391 Ga0207645_100783913 112
436 3300025908 Ga0207643_10086392 Ga0207643_100863924 112
437 3300025908 Ga0207643_10269398 Ga0207643_102693983 112
438 3300025909 Ga0207705_10020768 Ga0207705_100207685 112
439 3300025909 Ga0207705_10126668 Ga0207705_101266682 112
440 3300025909 Ga0207705_10269535 Ga0207705_102695351 112
441 3300025910 Ga0207684_10024612 Ga0207684_100246122 112
442 3300025913 Ga0207695_10074919 Ga0207695_100749192 112
443 3300025913 Ga0207695_10096986 Ga0207695_100969861 112
444 3300025914 Ga0207671_10170734 Ga0207671_101707344 112
445 3300025914 Ga0207671_10215547 Ga0207671_102155473 112
446 3300025916 Ga0207663_10759310 Ga0207663_107593102 112
447 3300025916 Ga0207663_11319003 Ga0207663_113190032 112
448 3300025918 Ga0207662_10284952 Ga0207662_102849521 112
449 3300025919 Ga0207657_10603296 Ga0207657_106032962 112
450 3300025920 Ga0207649_10051542 Ga0207649_100515424 112
451 3300025920 Ga0207649_10167688 Ga0207649_101676882 112
452 3300025920 Ga0207649_10226266 Ga0207649_102262663 112
453 3300025921 Ga0207652_11703011 Ga0207652_117030112 112
454 3300025922 Ga0207646_10327844 Ga0207646_103278441 112
455 3300025922 Ga0207646_10865572 Ga0207646_108655722 112
456 3300025923 Ga0207681_10009728 Ga0207681_100097282 112
457 3300025923 Ga0207681_10266132 Ga0207681_102661323 112
458 3300025923 Ga0207681_10337164 Ga0207681_103371641 112
459 3300025923 Ga0207681_11359215 Ga0207681_113592151 112
460 3300025924 Ga0207694_10010892 Ga0207694_100108922 112
461 3300025924 Ga0207694_10025050 Ga0207694_100250503 112
462 3300025924 Ga0207694_10903853 Ga0207694_109038532 112
463 3300025925 Ga0207650_10036058 Ga0207650_100360582 112
464 3300025925 Ga0207650_10100444 Ga0207650_101004442 112
465 3300025925 Ga0207650_10254922 Ga0207650_102549222 112
466 3300025925 Ga0207650_10410741 Ga0207650_104107412 112
467 3300025925 Ga0207650_10423425 Ga0207650_104234252 112
468 3300025926 Ga0207659_10013120 Ga0207659_100131204 112
469 3300025926 Ga0207659_10300693 Ga0207659_103006932 112
470 3300025926 Ga0207659_10506020 Ga0207659_105060202 112
471 3300025926 Ga0207659_10519516 Ga0207659_105195162 112
472 3300025926 Ga0207659_10861505 Ga0207659_108615052 112
473 3300025927 Ga0207687_10008565 Ga0207687_100085654 112
474 3300025927 Ga0207687_10355086 Ga0207687_103550862 112
475 3300025927 Ga0207687_10409440 Ga0207687_104094402 112
476 3300025927 Ga0207687_10606097 Ga0207687_106060972 112
477 3300025927 Ga0207687_11720477 Ga0207687_117204771 112
478 3300025927 Ga0207687_11844587 Ga0207687_118445871 112
479 3300025928 Ga0207700_10368001 Ga0207700_103680012 112
480 3300025929 Ga0207664_10306616 Ga0207664_103066162 112
481 3300025931 Ga0207644_10015963 Ga0207644_100159634 112
482 3300025931 Ga0207644_10254235 Ga0207644_102542352 112
483 3300025931 Ga0207644_10860453 Ga0207644_108604532 112
484 3300025933 Ga0207706_10117651 Ga0207706_101176512 112
485 3300025933 Ga0207706_10154164 Ga0207706_101541642 112
486 3300025933 Ga0207706_10676719 Ga0207706_106767192 112
487 3300025934 Ga0207686_10011200 Ga0207686_100112002 112
488 3300025935 Ga0207709_10003260 Ga0207709_100032602 112
489 3300025935 Ga0207709_10015301 Ga0207709_100153015 112
490 3300025935 Ga0207709_10092039 Ga0207709_100920392 112
491 3300025935 Ga0207709_11533997 Ga0207709_115339972 112
492 3300025935 Ga0207709_11677443 Ga0207709_116774432 112
493 3300025936 Ga0207670_10010371 Ga0207670_100103716 112
494 3300025937 Ga0207669_10019511 Ga0207669_100195111 112
495 3300025937 Ga0207669_11789508 Ga0207669_117895081 112
496 3300025938 Ga0207704_10064689 Ga0207704_100646892 112
497 3300025938 Ga0207704_10118500 Ga0207704_101185001 112
498 3300025938 Ga0207704_10702727 Ga0207704_107027271 112
499 3300025939 Ga0207665_10621534 Ga0207665_106215341 112
500 3300025940 Ga0207691_10004487 Ga0207691_1000448711 112
501 3300025940 Ga0207691_10033350 Ga0207691_100333503 112
502 3300025940 Ga0207691_10060567 Ga0207691_100605674 112
503 3300025940 Ga0207691_10091311 Ga0207691_100913112 112
504 3300025940 Ga0207691_10193180 Ga0207691_101931802 112
505 3300025940 Ga0207691_10873224 Ga0207691_108732242 112
506 3300025941 Ga0207711_10243081 Ga0207711_102430812 112
507 3300025941 Ga0207711_10253640 Ga0207711_102536402 112
508 3300025941 Ga0207711_10336820 Ga0207711_103368201 112
509 3300025941 Ga0207711_10357472 Ga0207711_103574723 112
510 3300025941 Ga0207711_11098577 Ga0207711_110985772 112
511 3300025941 Ga0207711_11225471 Ga0207711_112254712 112
512 3300025942 Ga0207689_10001602 Ga0207689_1000160214 112
513 3300025942 Ga0207689_10002140 Ga0207689_1000214021 112
514 3300025942 Ga0207689_10022610 Ga0207689_100226105 112
515 3300025942 Ga0207689_10134055 Ga0207689_101340553 112
516 3300025942 Ga0207689_10439543 Ga0207689_104395432 112
517 3300025944 Ga0207661_10068140 Ga0207661_100681404 112
518 3300025944 Ga0207661_10138200 Ga0207661_101382002 112
519 3300025945 Ga0207679_10008635 Ga0207679_100086352 112
520 3300025945 Ga0207679_10040313 Ga0207679_100403132 112
521 3300025945 Ga0207679_10515944 Ga0207679_105159442 112
522 3300025945 Ga0207679_10748737 Ga0207679_107487372 112
523 3300025945 Ga0207679_10925411 Ga0207679_109254111 112
524 3300025945 Ga0207679_11384647 Ga0207679_113846472 112
525 3300025949 Ga0207667_10018765 Ga0207667_100187657 112
526 3300025949 Ga0207667_10047346 Ga0207667_100473462 112
527 3300025949 Ga0207667_10611192 Ga0207667_106111922 112
528 3300025960 Ga0207651_10223928 Ga0207651_102239282 112
529 3300025960 Ga0207651_10606709 Ga0207651_106067092 112
530 3300025960 Ga0207651_11282564 Ga0207651_112825642 112
531 3300025961 Ga0207712_10164157 Ga0207712_101641572 112
532 3300025961 Ga0207712_10269282 Ga0207712_102692822 112
533 3300025961 Ga0207712_10288885 Ga0207712_102888852 112
534 3300025961 Ga0207712_11853793 Ga0207712_118537931 112
535 3300025961 Ga0207712_11854197 Ga0207712_118541971 112
536 3300025972 Ga0207668_10039842 Ga0207668_100398422 112
537 3300025972 Ga0207668_10212146 Ga0207668_102121462 112
538 3300025972 Ga0207668_10571838 Ga0207668_105718381 112
539 3300025972 Ga0207668_10617292 Ga0207668_106172922 112
540 3300025981 Ga0207640_10010078 Ga0207640_100100784 112
541 3300025981 Ga0207640_10057871 Ga0207640_100578713 112
542 3300025981 Ga0207640_10061867 Ga0207640_100618672 112
543 3300025981 Ga0207640_10173292 Ga0207640_101732922 112
544 3300025986 Ga0207658_10013887 Ga0207658_100138878 112
545 3300025986 Ga0207658_10039087 Ga0207658_100390871 112
546 3300025986 Ga0207658_10154139 Ga0207658_101541392 112
547 3300025986 Ga0207658_10354194 Ga0207658_103541943 112
548 3300025986 Ga0207658_10389701 Ga0207658_103897012 112
549 3300025986 Ga0207658_11127817 Ga0207658_111278171 112
550 3300026023 Ga0207677_10008875 Ga0207677_100088758 112
551 3300026023 Ga0207677_10059362 Ga0207677_100593622 112
552 3300026023 Ga0207677_10104206 Ga0207677_101042062 112
553 3300026023 Ga0207677_10116499 Ga0207677_101164993 112
554 3300026035 Ga0207703_10001278 Ga0207703_1000127817 112
555 3300026035 Ga0207703_10029403 Ga0207703_100294031 112
556 3300026035 Ga0207703_10078750 Ga0207703_100787502 112
557 3300026041 Ga0207639_10693086 Ga0207639_106930862 112
558 3300026041 Ga0207639_10697948 Ga0207639_106979482 112
559 3300026067 Ga0207678_10000473 Ga0207678_1000047310 112
560 3300026067 Ga0207678_10205504 Ga0207678_102055042 112
561 3300026067 Ga0207678_10208716 Ga0207678_102087162 112
562 3300026067 Ga0207678_10312398 Ga0207678_103123982 112
563 3300026067 Ga0207678_10375123 Ga0207678_103751232 112
564 3300026067 Ga0207678_10937314 Ga0207678_109373141 112
565 3300026075 Ga0207708_10000303 Ga0207708_100003032 112
566 3300026078 Ga0207702_10000199 Ga0207702_1000019940 112
567 3300026078 Ga0207702_10769020 Ga0207702_107690202 112
568 3300026078 Ga0207702_10779771 Ga0207702_107797712 112
569 3300026088 Ga0207641_10069900 Ga0207641_100699003 112
570 3300026088 Ga0207641_10152819 Ga0207641_101528193 112
571 3300026088 Ga0207641_10709242 Ga0207641_107092422 112
572 3300026088 Ga0207641_10824435 Ga0207641_108244351 112
573 3300026088 Ga0207641_11636214 Ga0207641_116362141 112
574 3300026089 Ga0207648_10000989 Ga0207648_100009899 112
575 3300026089 Ga0207648_10001210 Ga0207648_1000121025 112
576 3300026089 Ga0207648_10002261 Ga0207648_100022614 112
577 3300026089 Ga0207648_10005878 Ga0207648_1000587812 112
578 3300026089 Ga0207648_10023717 Ga0207648_100237173 112
579 3300026089 Ga0207648_10177063 Ga0207648_101770633 112
580 3300026089 Ga0207648_10211059 Ga0207648_102110592 112
581 3300026089 Ga0207648_11358921 Ga0207648_113589212 112
582 3300026095 Ga0207676_10001174 Ga0207676_1000117417 112
583 3300026095 Ga0207676_10444026 Ga0207676_104440262 112
584 3300026095 Ga0207676_10838016 Ga0207676_108380161 112
585 3300026095 Ga0207676_11955823 Ga0207676_119558231 112
586 3300026116 Ga0207674_10002529 Ga0207674_1000252910 112
587 3300026116 Ga0207674_10002678 Ga0207674_1000267819 112
588 3300026116 Ga0207674_10223653 Ga0207674_102236533 112
589 3300026116 Ga0207674_10346593 Ga0207674_103465932 112
590 3300026118 Ga0207675_100007517 Ga0207675_1000075175 112
591 3300026118 Ga0207675_100012286 Ga0207675_10001228611 112
592 3300026118 Ga0207675_100053002 Ga0207675_1000530022 112
593 3300026118 Ga0207675_100490497 Ga0207675_1004904973 112
594 3300026118 Ga0207675_100785176 Ga0207675_1007851761 112
595 3300026121 Ga0207683_10003640 Ga0207683_1000364011 112
596 3300026121 Ga0207683_10019235 Ga0207683_100192357 112
597 3300026121 Ga0207683_10134817 Ga0207683_101348172 112
598 3300026121 Ga0207683_10455791 Ga0207683_104557912 112
599 3300026121 Ga0207683_10722411 Ga0207683_107224112 112
600 3300026142 Ga0207698_10011109 Ga0207698_100111096 112
601 3300026142 Ga0207698_10047615 Ga0207698_100476152 112
602 3300026142 Ga0207698_10054580 Ga0207698_100545804 112
603 3300026142 Ga0207698_11001758 Ga0207698_110017582 112
604 3300027296 Ga0209389_1016990 Ga0209389_10169904 112
605 3300027312 Ga0209371_1041869 Ga0209371_10418691 112
606 3300027614 Ga0209970_1000375 Ga0209970_10003756 112
607 3300027876 Ga0209974_10018581 Ga0209974_100185812 112
608 3300027876 Ga0209974_10026701 Ga0209974_100267012 112
609 3300027907 Ga0207428_10128569 Ga0207428_101285692 112
610 3300028379 Ga0268266_10063069 Ga0268266_100630692 112
611 3300028379 Ga0268266_10159918 Ga0268266_101599183 112
612 3300028379 Ga0268266_11460086 Ga0268266_114600861 112
613 3300028380 Ga0268265_10016585 Ga0268265_100165853 112
614 3300028380 Ga0268265_10069764 Ga0268265_100697643 112
615 3300028380 Ga0268265_10907858 Ga0268265_109078582 112
616 3300028380 Ga0268265_12089455 Ga0268265_120894551 112
617 3300028381 Ga0268264_10002240 Ga0268264_100022405 112
618 3300028381 Ga0268264_10280643 Ga0268264_102806432 112
619 3300028381 Ga0268264_10365844 Ga0268264_103658441 112
620 3300028381 Ga0268264_10622522 Ga0268264_106225221 112
621 3300028381 Ga0268264_10815731 Ga0268264_108157312 112
622 3300028381 Ga0268264_11228319 Ga0268264_112283192 112
623 3300028381 Ga0268264_12426213 Ga0268264_124262131 112
624 3300028558 Ga0265326_10044657 Ga0265326_100446572 112
625 3300028794 Ga0307515_10015579 Ga0307515_1001557910 112
626 3300028794 Ga0307515_10034448 Ga0307515_100344484 112
627 3300028794 Ga0307515_10319825 Ga0307515_103198252 112
628 3300028800 Ga0265338_11029938 Ga0265338_110299381 112
629 3300030500 Ga0268256_1035716 Ga0268256_10357162 112
630 3300031235 Ga0265330_10104424 Ga0265330_101044242 112
631 3300031238 Ga0265332_10000003 Ga0265332_10000003215 112
632 3300031238 Ga0265332_10047978 Ga0265332_100479781 112
633 3300031239 Ga0265328_10056596 Ga0265328_100565962 112
634 3300031250 Ga0265331_10009862 Ga0265331_100098624 112
635 3300031250 Ga0265331_10152723 Ga0265331_101527232 112
636 3300031250 Ga0265331_10393606 Ga0265331_103936062 112
637 3300031251 Ga0265327_10000639 Ga0265327_1000063948 112
638 3300031251 Ga0265327_10281483 Ga0265327_102814831 112
639 3300031251 Ga0265327_10291881 Ga0265327_102918812 112
640 3300031344 Ga0265316_10299230 Ga0265316_102992302 112
641 3300031456 Ga0307513_10886298 Ga0307513_108862981 112
642 3300031548 Ga0307408_100000008 Ga0307408_100000008157 112
643 3300031548 Ga0307408_100010784 Ga0307408_1000107842 112
644 3300031548 Ga0307408_100139882 Ga0307408_1001398823 112
645 3300031548 Ga0307408_100166112 Ga0307408_1001661122 112
646 3300031548 Ga0307408_100500722 Ga0307408_1005007221 112
647 3300031548 Ga0307408_100810674 Ga0307408_1008106741 112
648 3300031548 Ga0307408_101869776 Ga0307408_1018697761 112
649 3300031649 Ga0307514_10009729 Ga0307514_100097297 112
650 3300031711 Ga0265314_10006842 Ga0265314_100068426 112
651 3300031711 Ga0265314_10173303 Ga0265314_101733032 112
652 3300031728 Ga0316578_10297624 Ga0316578_102976242 112
653 3300031728 Ga0316578_10734005 Ga0316578_107340051 112
654 3300031730 Ga0307516_10046181 Ga0307516_100461813 112
655 3300031730 Ga0307516_10489805 Ga0307516_104898051 112
656 3300031731 Ga0307405_11081714 Ga0307405_110817142 112
657 3300031733 Ga0316577_10112505 Ga0316577_101125052 112
658 3300031824 Ga0307413_10066854 Ga0307413_100668543 112
659 3300031824 Ga0307413_11824667 Ga0307413_118246671 112
660 3300031852 Ga0307410_10233903 Ga0307410_102339032 112
661 3300031852 Ga0307410_10463845 Ga0307410_104638452 112
662 3300031901 Ga0307406_10283571 Ga0307406_102835711 112
663 3300031901 Ga0307406_10813340 Ga0307406_108133401 112
664 3300031903 Ga0307407_10125131 Ga0307407_101251313 112
665 3300031911 Ga0307412_10071470 Ga0307412_100714703 112
666 3300031911 Ga0307412_11905926 Ga0307412_119059261 112
667 3300031995 Ga0307409_100832962 Ga0307409_1008329622 112
668 3300032002 Ga0307416_100406253 Ga0307416_1004062532 112
669 3300032002 Ga0307416_100457337 Ga0307416_1004573372 112
670 3300032004 Ga0307414_10005408 Ga0307414_100054085 112
671 3300032004 Ga0307414_10077234 Ga0307414_100772341 112
672 3300032005 Ga0307411_10002403 Ga0307411_100024033 112
673 3300032005 Ga0307411_10046584 Ga0307411_100465842 112
674 3300032005 Ga0307411_10059237 Ga0307411_100592373 112
675 3300032005 Ga0307411_10098512 Ga0307411_100985122 112
676 3300032005 Ga0307411_11054269 Ga0307411_110542691 112
677 3300032005 Ga0307411_11527810 Ga0307411_115278101 112
678 3300032126 Ga0307415_100972357 Ga0307415_1009723572 112
679 3300032126 Ga0307415_101463994 Ga0307415_1014639942 112
680 3300032133 Ga0316583_10000505 Ga0316583_100005056 112
681 3300032133 Ga0316583_10046522 Ga0316583_100465222 112
682 3300032137 Ga0316585_10090382 Ga0316585_100903822 112
683 3300032139 Ga0316580_10006497 Ga0316580_100064972 112
684 3300032168 Ga0316593_10017449 Ga0316593_100174492 112
685 3300032168 Ga0316593_10075960 Ga0316593_100759602 112
686 3300032168 Ga0316593_10339833 Ga0316593_103398331 112
687 3300033180 Ga0307510_10010932 Ga0307510_100109327 112
688 3300033524 Ga0316592_1009074 Ga0316592_10090742 112
689 3300033524 Ga0316592_1011917 Ga0316592_10119171 112
690 3300033524 Ga0316592_1066976 Ga0316592_10669762 112
691 3300033528 Ga0316588_1011413 Ga0316588_10114132 112
692 3300033528 Ga0316588_1030504 Ga0316588_10305041 112
693 3300033528 Ga0316588_1082867 Ga0316588_10828672 112
694 3300033528 Ga0316588_1159407 Ga0316588_11594071 112
695 3300033541 Ga0316596_1008073 Ga0316596_10080732 112
696 3300033541 Ga0316596_1015318 Ga0316596_10153182 112
697 3300033541 Ga0316596_1023247 Ga0316596_10232472 112
698 3300033541 Ga0316596_1091781 Ga0316596_10917812 112
699 3300034817 Ga0373948_0013571 Ga0373948_0013571_187_525 112
700 3300034817 Ga0373948_0177691 Ga0373948_0177691_81_434 112
701 3300034818 Ga0373950_0004828 Ga0373950_0004828_1386_1724 112
702 3300034820 Ga0373959_0011480 Ga0373959_0011480_1000_1338 112
703 3300035088 Ga0373940_0360028 Ga0373940_0360028_53_391 112
704 3300035089 Ga0373944_0056740 Ga0373944_0056740_654_992 112
705 3300035113 Ga0373936_0044210 Ga0373936_0044210_183_521 112
706 3300035114 Ga0373939_0000087 Ga0373939_0000087_28412_28750 112
707 3300035114 Ga0373939_0046994 Ga0373939_0046994_371_709 112
708 3300035121 Ga0373960_0001671 Ga0373960_0001671_2140_2478 112
709 3300035170 Ga0373943_0006120 Ga0373943_0006120_4987_5325 112
710 3300035170 Ga0373943_0329173 Ga0373943_0329173_191_529 112
711 3300035172 Ga0373955_0317179 Ga0373955_0317179_476_868 112
712 3300035172 Ga0373955_0832678 Ga0373955_0832678_132_470 112
713 3300035398 Ga0316574_0123163 Ga0316574_0123163_872_1210 112
714 3300035691 Ga0373931_0028446 Ga0373931_0028446_2054_2392 112
715 3300035692 Ga0373935_0260506 Ga0373935_0260506_411_749 112
716 3300035692 Ga0373935_0374048 Ga0373935_0374048_309_647 112
717 3300035692 Ga0373935_1164537 Ga0373935_1164537_108_446 112
718 3300035724 Ga0373933_0155594 Ga0373933_0155594_900_1244 112
719 3300035724 Ga0373933_0230600 Ga0373933_0230600_228_566 112
720 3300035724 Ga0373933_0895212 Ga0373933_0895212_20_412 112
721 3300035724 Ga0373933_0896887 Ga0373933_0896887_192_530 112
722 3300036401 Ga0373937_0264803 Ga0373937_0264803_1024_1416 112
723 3300036401 Ga0373937_0637354 Ga0373937_0637354_185_523 112
724 3300036457 Ga0265778_045304 Ga0265778_045304_67_405 112
725 3300036647 Ga0316582_0011992 Ga0316582_0011992_2175_2513 112
726 3300036647 Ga0316582_0139318 Ga0316582_0139318_1184_1522 112
727 3300036647 Ga0316582_0256101 Ga0316582_0256101_97_465 112
728 3300036647 Ga0316582_0802616 Ga0316582_0802616_257_625 112
729 3300036647 Ga0316582_0836391 Ga0316582_0836391_39_377 112
730 3300036712 Ga0316584_0191418 Ga0316584_0191418_29_367 112
731 3300036712 Ga0316584_0313368 Ga0316584_0313368_343_681 112
732 3300037068 Ga0373925_0003208 Ga0373925_0003208_1108_1446 112
733 3300037068 Ga0373925_0018461 Ga0373925_0018461_1185_1523 112
734 3300037068 Ga0373925_0158168 Ga0373925_0158168_1384_1722 112
735 3300037068 Ga0373925_0158692 Ga0373925_0158692_1149_1487 112
736 3300037312 Ga0395899_0001756 Ga0395899_0001756_2293_2631 112
737 3300037312 Ga0395899_0222706 Ga0395899_0222706_460_798 112
738 3300037312 Ga0395899_0983985 Ga0395899_0983985_136_474 112
739 3300037418 Ga0395900_0004771 Ga0395900_0004771_6322_6660 112
740 3300037418 Ga0395900_0026850 Ga0395900_0026850_5424_5762 112
741 3300037418 Ga0395900_0124112 Ga0395900_0124112_1713_2051 112
742 3300037418 Ga0395900_0403427 Ga0395900_0403427_867_1205 112
743 3300037466 Ga0395898_0009054 Ga0395898_0009054_3492_3830 112
744 3300037466 Ga0395898_0010085 Ga0395898_0010085_8359_8697 112
745 3300037466 Ga0395898_0517414 Ga0395898_0517414_102_440 112
746 3300037471 Ga0395905_0000766 Ga0395905_0000766_38438_38776 112
747 3300037471 Ga0395905_0001291 Ga0395905_0001291_5644_5982 112
748 3300037471 Ga0395905_0004548 Ga0395905_0004548_7614_7952 112
749 3300037471 Ga0395905_0052309 Ga0395905_0052309_2910_3248 112
750 3300037471 Ga0395905_0059255 Ga0395905_0059255_1474_1812 112
751 3300037471 Ga0395905_1032633 Ga0395905_1032633_53_391 112
752 3300037471 Ga0395905_1759121 Ga0395905_1759121_13_351 112
753 3300037471 Ga0395905_1783186 Ga0395905_1783186_25_363 112
754 3300038443 Ga0395901_0007642 Ga0395901_0007642_7295_7633 112
755 3300038443 Ga0395901_0019770 Ga0395901_0019770_3728_4066 112
756 3300038443 Ga0395901_0117284 Ga0395901_0117284_114_452 112
757 3300038443 Ga0395901_0360516 Ga0395901_0360516_746_1084 112
758 3300039093 Ga0400489_45479 Ga0400489_45479_8735_9106 112
759 3300039438 Ga0436360_0744003 Ga0436360_0744003_96_434 112
760 3300039438 Ga0436360_1242945 Ga0436360_1242945_47_385 112
761 3300039447 Ga0436361_0279516 Ga0436361_0279516_1726_2064 112
762 3300039447 Ga0436361_0287447 Ga0436361_0287447_95946_96284 112
763 3300039447 Ga0436361_0678114 Ga0436361_0678114_5960_6298 112
764 3300039447 Ga0436361_0705591 Ga0436361_0705591_288_626 112
765 3300039450 Ga0436363_0441867 Ga0436363_0441867_472_810 112
766 3300039450 Ga0436363_0596578 Ga0436363_0596578_99_437 112
767 3300039450 Ga0436363_0815012 Ga0436363_0815012_83_421 112
768 3300039450 Ga0436363_1031840 Ga0436363_1031840_135_473 112
769 3300039450 Ga0436363_1464495 Ga0436363_1464495_367_705 112
770 3300039453 Ga0436362_1021080 Ga0436362_1021080_160_498 112
771 3300041411 Ga0439466_0082200 Ga0439466_0082200_136_474 112
772 3300041441 Ga0451787_030105 Ga0451787_030105_196_534 112
773 3300041441 Ga0451787_668171 Ga0451787_668171_32_370 112
774 3300041451 Ga0451791_1086428 Ga0451791_1086428_32_370 112
775 3300041460 Ga0451802_0131515 Ga0451802_0131515_367_705 112
776 3300041486 Ga0451807_2119567 Ga0451807_2119567_555_893 112
777 3300041494 Ga0451837_0043705 Ga0451837_0043705_152_490 112
778 3300041494 Ga0451837_0666052 Ga0451837_0666052_120_458 112
779 3300041494 Ga0451837_1120325 Ga0451837_1120325_176_514 112
780 3300041498 Ga0451841_0206002 Ga0451841_0206002_207_545 112
781 3300041501 Ga0451845_0380090 Ga0451845_0380090_44_382 112
782 3300041501 Ga0451845_0830242 Ga0451845_0830242_41_379 112
783 3300041511 Ga0451855_0132408 Ga0451855_0132408_132_470 112
784 3300041512 Ga0451853_1463132 Ga0451853_1463132_512_850 112
785 3300042115 Ga0450911_000894 Ga0450911_000894_3724_4062 112
786 3300042120 Ga0450917_001378 Ga0450917_001378_1254_1592 112
787 3300042126 Ga0450888_005029 Ga0450888_005029_642_980 112
788 3300042127 Ga0450890_001901 Ga0450890_001901_1340_1678 112
789 3300042127 Ga0450890_004383 Ga0450890_004383_207_545 112
790 3300042129 Ga0450891_001710 Ga0450891_001710_1239_1577 112
791 3300042130 Ga0450892_001476 Ga0450892_001476_1562_1900 112
792 3300042137 Ga0450902_006744 Ga0450902_006744_555_893 112
793 3300042138 Ga0450903_007325 Ga0450903_007325_136_474 112
794 3300042438 Ga0439459_0003448 Ga0439459_0003448_1112_1450 112
795 3300042438 Ga0439459_0103217 Ga0439459_0103217_26_364 112
796 3300042461 Ga0439460_0264163 Ga0439460_0264163_139_534 112
797 3300042532 Ga0450893_0006035 Ga0450893_0006035_985_1323 112
798 3300042876 Ga0451577_0000114 Ga0451577_0000114_15119_15457 112
799 3300042876 Ga0451577_0000794 Ga0451577_0000794_4189_4527 112
800 3300042876 Ga0451577_0159878 Ga0451577_0159878_1197_1535 112
801 3300042876 Ga0451577_0631408 Ga0451577_0631408_407_745 112
802 3300042876 Ga0451577_0687709 Ga0451577_0687709_552_890 112
803 3300044658 Ga0466972_0084766 Ga0466972_0084766_614_952 112
804 3300044673 Ga0453683_0180180 Ga0453683_0180180_20_358 112
805 3300044673 Ga0453683_0629555 Ga0453683_0629555_334_672 112
806 3300044683 Ga0466965_0117317 Ga0466965_0117317_346_684 112
807 3300044683 Ga0466965_0505387 Ga0466965_0505387_321_659 112
808 3300044684 Ga0466966_0103684 Ga0466966_0103684_682_1020 112
809 3300044684 Ga0466966_0198910 Ga0466966_0198910_201_539 112
810 3300044694 Ga0466963_0145702 Ga0466963_0145702_206_544 112
811 3300044694 Ga0466963_0371434 Ga0466963_0371434_447_785 112
812 3300044712 Ga0453684_0001710 Ga0453684_0001710_15184_15522 112
813 3300044712 Ga0453684_0068382 Ga0453684_0068382_3635_3973 112
814 3300044712 Ga0453684_0326156 Ga0453684_0326156_1029_1367 112
815 3300044712 Ga0453684_1349225 Ga0453684_1349225_133_471 112
816 3300044712 Ga0453684_2004800 Ga0453684_2004800_94_489 112
817 3300044712 Ga0453684_2054193 Ga0453684_2054193_96_434 112
818 3300044735 Ga0466968_0147808 Ga0466968_0147808_645_983 112
819 3300044735 Ga0466968_0306713 Ga0466968_0306713_96_434 112
820 3300044842 Ga0466957_0216089 Ga0466957_0216089_162_500 112
821 3300044901 Ga0466960_0089877 Ga0466960_0089877_744_1082 112
822 3300044901 Ga0466960_0746211 Ga0466960_0746211_21_359 112
823 3300045051 Ga0451576_0000099 Ga0451576_0000099_198636_198974 112
824 3300045051 Ga0451576_0000335 Ga0451576_0000335_12341_12679 112
825 3300045051 Ga0451576_0006435 Ga0451576_0006435_3353_3691 112
826 3300045051 Ga0451576_0012757 Ga0451576_0012757_3190_3528 112
827 3300045051 Ga0451576_0104147 Ga0451576_0104147_54_392 112
828 3300045051 Ga0451576_0239277 Ga0451576_0239277_1520_1858 112
829 3300045051 Ga0451576_0504691 Ga0451576_0504691_321_659 112
830 3300045051 Ga0451576_1363199 Ga0451576_1363199_211_606 112
831 3300045976 Ga0466967_1369738 Ga0466967_1369738_324_662 112
832 3300046455 Ga0495603_0321590 Ga0495603_0321590_183_521 112
833 3300046457 Ga0495590_0001778 Ga0495590_0001778_4307_4645 112
834 3300046457 Ga0495590_0059944 Ga0495590_0059944_731_1069 112
835 3300046457 Ga0495590_0096535 Ga0495590_0096535_345_683 112
836 3300046459 Ga0495629_0256849 Ga0495629_0256849_460_798 112
837 3300046459 Ga0495629_0483610 Ga0495629_0483610_480_818 112
838 3300046463 Ga0495653_0111372 Ga0495653_0111372_843_1181 112
839 3300046471 Ga0495650_0044940 Ga0495650_0044940_151_489 112
840 3300046476 Ga0495662_0048356 Ga0495662_0048356_1216_1554 112
841 3300046477 Ga0495664_0007416 Ga0495664_0007416_3574_3912 112
842 3300046477 Ga0495664_0060716 Ga0495664_0060716_1176_1514 112
843 3300046499 Ga0495594_0586819 Ga0495594_0586819_74_412 112
844 3300046500 Ga0495596_0056108 Ga0495596_0056108_897_1235 112
845 3300046501 Ga0495607_0000128 Ga0495607_0000128_79969_80307 112
846 3300046507 Ga0495606_0005133 Ga0495606_0005133_4908_5246 112
847 3300046507 Ga0495606_0007947 Ga0495606_0007947_6702_7040 112
848 3300046511 Ga0495608_0283582 Ga0495608_0283582_597_941 112
849 3300046511 Ga0495608_0737903 Ga0495608_0737903_181_519 112
850 3300046514 Ga0495618_0144220 Ga0495618_0144220_198_536 112
851 3300046515 Ga0495620_0060161 Ga0495620_0060161_109_447 112
852 3300046516 Ga0495628_0056722 Ga0495628_0056722_837_1175 112
853 3300046516 Ga0495628_0367036 Ga0495628_0367036_346_690 112
854 3300046519 Ga0495632_0177607 Ga0495632_0177607_538_876 112
855 3300046522 Ga0495643_0000363 Ga0495643_0000363_503_847 112
856 3300046523 Ga0495644_0341347 Ga0495644_0341347_78_461 112
857 3300046529 Ga0495652_0117812 Ga0495652_0117812_600_938 112
858 3300046530 Ga0495654_0020792 Ga0495654_0020792_1317_1655 112
859 3300046530 Ga0495654_0033445 Ga0495654_0033445_63_401 112
860 3300046530 Ga0495654_0265227 Ga0495654_0265227_302_640 112
861 3300046531 Ga0495665_0078186 Ga0495665_0078186_666_1004 112
862 3300046535 Ga0495586_0261995 Ga0495586_0261995_52_390 112
863 3300046536 Ga0495587_0148275 Ga0495587_0148275_35_373 112
864 3300046542 Ga0495597_0006061 Ga0495597_0006061_913_1251 112
865 3300046543 Ga0495645_0019385 Ga0495645_0019385_2855_3193 112
866 3300046543 Ga0495645_0079259 Ga0495645_0079259_1243_1581 112
867 3300046543 Ga0495645_0114708 Ga0495645_0114708_1510_1848 112
868 3300046543 Ga0495645_0424570 Ga0495645_0424570_479_817 112
869 3300046557 Ga0495622_0157320 Ga0495622_0157320_184_522 112
870 3300046559 Ga0495667_0635068 Ga0495667_0635068_113_457 112
871 3300046648 Ga0495611_0472353 Ga0495611_0472353_128_502 112
872 3300046660 Ga0495625_0008095 Ga0495625_0008095_340_684 112
873 3300046660 Ga0495625_0181815 Ga0495625_0181815_480_824 112
874 3300046663 Ga0495635_0322791 Ga0495635_0322791_524_862 112
875 3300046663 Ga0495635_0345849 Ga0495635_0345849_592_930 112
876 3300046674 Ga0495588_0320519 Ga0495588_0320519_439_777 112
877 3300046674 Ga0495588_0339750 Ga0495588_0339750_432_770 112
878 3300046675 Ga0495657_0038484 Ga0495657_0038484_2271_2663 112
879 3300046678 Ga0495599_0217271 Ga0495599_0217271_742_1080 112
880 3300046678 Ga0495599_0707098 Ga0495599_0707098_120_458 112
881 3300046679 Ga0495623_0057100 Ga0495623_0057100_491_829 112
882 3300046680 Ga0495646_0076728 Ga0495646_0076728_1272_1610 112
883 3300046680 Ga0495646_0169371 Ga0495646_0169371_654_992 112
884 3300046683 Ga0495658_0158634 Ga0495658_0158634_777_1115 112
885 3300046683 Ga0495658_0594809 Ga0495658_0594809_227_565 112
886 3300046690 Ga0495624_0065050 Ga0495624_0065050_1108_1446 112
887 3300046690 Ga0495624_0235589 Ga0495624_0235589_317_655 112
888 3300046692 Ga0495671_0080454 Ga0495671_0080454_1198_1536 112
889 3300046694 Ga0495649_0005791 Ga0495649_0005791_950_1288 112
890 3300046694 Ga0495649_0040011 Ga0495649_0040011_1118_1456 112
891 3300046694 Ga0495649_0040733 Ga0495649_0040733_705_1043 112
892 3300046694 Ga0495649_0249808 Ga0495649_0249808_55_393 112
893 3300046809 Ga0495600_0156726 Ga0495600_0156726_1057_1395 112
894 3300046810 Ga0495660_0183393 Ga0495660_0183393_53_391 112
895 3300047317 Ga0495604_0118990 Ga0495604_0118990_266_604 112
896 3300047319 Ga0495674_0034424 Ga0495674_0034424_4202_4540 112
897 3300047319 Ga0495674_0794830 Ga0495674_0794830_38_376 112
898 3300047320 Ga0495672_0000330 Ga0495672_0000330_745_1089 112
899 3300047322 Ga0495680_0202234 Ga0495680_0202234_347_685 112
900 3300047322 Ga0495680_0628364 Ga0495680_0628364_335_673 112
901 3300047322 Ga0495680_0927895 Ga0495680_0927895_168_506 112
902 3300047323 Ga0495683_0001439 Ga0495683_0001439_11905_12243 112
903 3300047323 Ga0495683_0040580 Ga0495683_0040580_1228_1566 112
904 3300047323 Ga0495683_0175268 Ga0495683_0175268_446_784 112
905 3300047443 Ga0495687_000011 Ga0495687_000011_78081_78419 112
906 3300047443 Ga0495687_039572 Ga0495687_039572_1032_1370 112
907 3300047443 Ga0495687_130333 Ga0495687_130333_418_756 112
908 3300047444 Ga0495675_0191475 Ga0495675_0191475_679_1017 112
909 3300047444 Ga0495675_0792198 Ga0495675_0792198_137_481 112
910 3300047469 Ga0495673_0189758 Ga0495673_0189758_329_667 112
911 3300047471 Ga0495684_0135088 Ga0495684_0135088_92_430 112
912 3300047471 Ga0495684_0472858 Ga0495684_0472858_188_526 112
913 3300047472 Ga0495686_0011473 Ga0495686_0011473_1468_1806 112
914 3300047472 Ga0495686_0157648 Ga0495686_0157648_489_833 112
915 3300047673 Ga0495593_0056524 Ga0495593_0056524_479_817 112
916 3300047673 Ga0495593_0135404 Ga0495593_0135404_49_387 112
917 3300047673 Ga0495593_0141152 Ga0495593_0141152_773_1111 112
918 3300048088 Ga0495602_0084270 Ga0495602_0084270_449_793 112
919 3300048088 Ga0495602_0178179 Ga0495602_0178179_1043_1381 112
920 3300048091 Ga0495626_0221612 Ga0495626_0221612_301_639 112
921 3300048903 Ga0496100_0028622 Ga0496100_0028622_631_969 112
922 3300048903 Ga0496100_0321480 Ga0496100_0321480_477_815 112
923 3300048903 Ga0496100_1124069 Ga0496100_1124069_255_593 112
924 3300048903 Ga0496100_1366102 Ga0496100_1366102_208_546 112
925 3300048904 Ga0496101_0014863 Ga0496101_0014863_183_521 112
926 3300048904 Ga0496101_0179631 Ga0496101_0179631_23_361 112
927 3300048904 Ga0496101_0402812 Ga0496101_0402812_42_380 112
928 3300048905 Ga0496102_0010175 Ga0496102_0010175_3579_3917 112
929 3300048905 Ga0496102_0095352 Ga0496102_0095352_2209_2547 112
930 3300048905 Ga0496102_0254979 Ga0496102_0254979_756_1094 112
931 3300048906 Ga0496103_0009526 Ga0496103_0009526_4790_5128 112
932 3300048906 Ga0496103_0097531 Ga0496103_0097531_1328_1666 112
933 3300048907 Ga0496104_0228353 Ga0496104_0228353_1007_1345 112
934 3300048907 Ga0496104_0501831 Ga0496104_0501831_23_361 112
935 3300048907 Ga0496104_0766574 Ga0496104_0766574_45_383 112
936 3300048908 Ga0496105_0090234 Ga0496105_0090234_837_1175 112
937 3300048908 Ga0496105_0249069 Ga0496105_0249069_590_928 112
938 3300048908 Ga0496105_0261635 Ga0496105_0261635_83_421 112
939 3300048908 Ga0496105_0626065 Ga0496105_0626065_202_540 112
940 3300048909 Ga0496106_0002491 Ga0496106_0002491_3808_4146 112
941 3300048909 Ga0496106_0250470 Ga0496106_0250470_919_1257 112
942 3300048909 Ga0496106_1480719 Ga0496106_1480719_151_489 112
943 3300048910 Ga0496107_0015993 Ga0496107_0015993_1479_1817 112
944 3300048910 Ga0496107_0917383 Ga0496107_0917383_115_453 112
945 3300048911 Ga0496108_0192950 Ga0496108_0192950_30_368 112
946 3300048911 Ga0496108_0472425 Ga0496108_0472425_540_878 112
947 3300048911 Ga0496108_0876541 Ga0496108_0876541_36_374 112
948 3300048912 Ga0496109_0082395 Ga0496109_0082395_313_651 112
949 3300048912 Ga0496109_0110266 Ga0496109_0110266_2187_2525 112
950 3300048912 Ga0496109_0171369 Ga0496109_0171369_526_864 112
951 3300048912 Ga0496109_1033871 Ga0496109_1033871_243_581 112
952 3300048912 Ga0496109_1809612 Ga0496109_1809612_19_357 112
953 3300048913 Ga0496110_0003972 Ga0496110_0003972_5473_5811 112
954 3300048914 Ga0496111_0132611 Ga0496111_0132611_496_834 112
955 3300048914 Ga0496111_0152600 Ga0496111_0152600_640_978 112
956 3300048915 Ga0496112_0019328 Ga0496112_0019328_3503_3841 112
957 3300048915 Ga0496112_0982063 Ga0496112_0982063_413_751 112
958 3300048915 Ga0496112_1632226 Ga0496112_1632226_171_509 112
959 3300048916 Ga0496113_0132535 Ga0496113_0132535_1481_1819 112
960 3300048916 Ga0496113_0453903 Ga0496113_0453903_202_540 112
961 3300048917 Ga0496114_0038689 Ga0496114_0038689_699_1037 112
962 3300048917 Ga0496114_0738500 Ga0496114_0738500_238_576 112
963 3300048917 Ga0496114_0739676 Ga0496114_0739676_416_754 112
964 3300048918 Ga0496115_0604957 Ga0496115_0604957_338_676 112
965 3300048918 Ga0496115_1193498 Ga0496115_1193498_175_513 112
966 3300048919 Ga0496116_0009193 Ga0496116_0009193_2813_3151 112
967 3300048920 Ga0496117_0026874 Ga0496117_0026874_3420_3758 112
968 3300048920 Ga0496117_0507096 Ga0496117_0507096_77_415 112
969 3300048921 Ga0496118_0041832 Ga0496118_0041832_2416_2754 112
970 3300048922 Ga0496119_0026780 Ga0496119_0026780_173_511 112
971 3300048923 Ga0496120_0224537 Ga0496120_0224537_365_703 112
972 3300048924 Ga0496121_0019078 Ga0496121_0019078_4200_4538 112
973 3300048924 Ga0496121_0039345 Ga0496121_0039345_3631_3969 112
974 3300048925 Ga0496122_0004945 Ga0496122_0004945_12421_12759 112
975 3300048925 Ga0496122_0184625 Ga0496122_0184625_567_905 112
976 3300048926 Ga0496123_0039281 Ga0496123_0039281_2413_2751 112
977 3300048927 Ga0496124_0092106 Ga0496124_0092106_847_1185 112
978 3300048928 Ga0496125_0018804 Ga0496125_0018804_2702_3040 112
979 3300048928 Ga0496125_0022128 Ga0496125_0022128_603_941 112
980 3300048928 Ga0496125_0076660 Ga0496125_0076660_1356_1694 112
981 3300048928 Ga0496125_0180485 Ga0496125_0180485_552_890 112
982 3300048929 Ga0496126_0117688 Ga0496126_0117688_227_565 112
983 3300048929 Ga0496126_0217715 Ga0496126_0217715_459_797 112
984 3300048929 Ga0496126_0241750 Ga0496126_0241750_503_841 112
985 3300049129 Ga0501309_041843 Ga0501309_041843_258_596 112
986 3300049160 Ga0501304_034299 Ga0501304_034299_14_352 112
987 3300049161 Ga0501305_018980 Ga0501305_018980_309_647 112
988 3300049516 Ga0501293_019775 Ga0501293_019775_147_485 112
989 3300049517 Ga0501294_019481 Ga0501294_019481_346_684 112
990 3300049518 Ga0501295_068977 Ga0501295_068977_144_482 112
991 3300049519 Ga0501296_058137 Ga0501296_058137_134_472 112
992 3300049521 Ga0501298_015382 Ga0501298_015382_383_721 112
993 3300049521 Ga0501298_085417 Ga0501298_085417_40_378 112
994 3300049523 Ga0501300_001083 Ga0501300_001083_2455_2793 112
995 3300049523 Ga0501300_057153 Ga0501300_057153_94_489 112
996 3300049524 Ga0501301_004146 Ga0501301_004146_351_689 112
997 3300049527 Ga0501311_052383 Ga0501311_052383_276_614 112
998 3300049530 Ga0501314_004795 Ga0501314_004795_539_877 112
999 3300049531 Ga0501315_024162 Ga0501315_024162_176_514 112
1000 3300049569 Ga0501032_0125834 Ga0501032_0125834_1163_1501 112
1001 3300049571 Ga0501034_0001279 Ga0501034_0001279_15272_15610 112
1002 3300049571 Ga0501034_0048885 Ga0501034_0048885_187_525 112
1003 3300049571 Ga0501034_0057761 Ga0501034_0057761_550_888 112
1004 3300049571 Ga0501034_0354738 Ga0501034_0354738_195_533 112
1005 3300049572 Ga0501036_0227629 Ga0501036_0227629_1183_1521 112
1006 3300049572 Ga0501036_1719121 Ga0501036_1719121_108_446 112
1007 3300049574 Ga0501038_0201101 Ga0501038_0201101_99_437 112
1008 3300049575 Ga0501039_0111979 Ga0501039_0111979_245_583 112
1009 3300049575 Ga0501039_0407647 Ga0501039_0407647_254_592 112
1010 3300049577 Ga0501041_0247270 Ga0501041_0247270_437_775 112
1011 3300049579 Ga0501043_0174669 Ga0501043_0174669_1193_1531 112
1012 3300049580 Ga0501046_0174512 Ga0501046_0174512_274_612 112
1013 3300049580 Ga0501046_0646528 Ga0501046_0646528_11_349 112
1014 3300049580 Ga0501046_1061848 Ga0501046_1061848_55_393 112
1015 3300049581 Ga0501047_0062974 Ga0501047_0062974_1103_1441 112
1016 3300049582 Ga0501048_0645028 Ga0501048_0645028_35_430 112
1017 3300049583 Ga0501067_0300921 Ga0501067_0300921_73_411 112
1018 3300049584 Ga0501068_0008164 Ga0501068_0008164_373_711 112
1019 3300049586 Ga0501070_0014948 Ga0501070_0014948_1256_1594 112
1020 3300049586 Ga0501070_0036866 Ga0501070_0036866_895_1233 112
1021 3300049588 Ga0501072_0016016 Ga0501072_0016016_3088_3426 112
1022 3300049588 Ga0501072_0026626 Ga0501072_0026626_2160_2498 112
1023 3300049589 Ga0501073_0005603 Ga0501073_0005603_6092_6430 112
1024 3300049589 Ga0501073_0042689 Ga0501073_0042689_411_749 112
1025 3300049590 Ga0501074_0054209 Ga0501074_0054209_1708_2046 112
1026 3300049590 Ga0501074_0130885 Ga0501074_0130885_498_836 112
1027 3300049651 Ga0501201_000859 Ga0501201_000859_1838_2176 112
1028 3300049651 Ga0501201_036779 Ga0501201_036779_111_449 112
1029 3300049652 Ga0501202_038852 Ga0501202_038852_106_444 112
1030 3300049653 Ga0501206_052465 Ga0501206_052465_168_506 112
1031 3300049654 Ga0501207_081301 Ga0501207_081301_133_471 112
1032 3300049658 Ga0501211_000781 Ga0501211_000781_262_600 112
1033 3300049662 Ga0501222_007027 Ga0501222_007027_1049_1387 112
1034 3300049665 Ga0501227_016101 Ga0501227_016101_1264_1602 112
1035 3300049665 Ga0501227_120054 Ga0501227_120054_266_661 112
1036 3300049668 Ga0501233_095703 Ga0501233_095703_316_654 112
1037 3300049669 Ga0501235_005194 Ga0501235_005194_1460_1798 112
1038 3300049686 Ga0501257_241715 Ga0501257_241715_128_466 112
1039 3300049687 Ga0501258_031822 Ga0501258_031822_49_387 112
1040 3300049690 Ga0501261_026506 Ga0501261_026506_350_688 112
1041 3300049704 Ga0501221_002565 Ga0501221_002565_1610_1948 112
1042 3300049705 Ga0501225_0007329 Ga0501225_0007329_1906_2244 112
1043 3300049705 Ga0501225_0151083 Ga0501225_0151083_200_538 112
1044 3300049706 Ga0501229_003048 Ga0501229_003048_597_935 112
1045 3300049741 Ga0501079_1403461 Ga0501079_1403461_86_424 112
1046 3300049742 Ga0501080_0005258 Ga0501080_0005258_2680_3018 112
1047 3300049742 Ga0501080_0069393 Ga0501080_0069393_1150_1488 112
1048 3300049742 Ga0501080_0516962 Ga0501080_0516962_290_628 112
1049 3300049742 Ga0501080_1837926 Ga0501080_1837926_20_358 112
1050 3300049744 Ga0501083_0178203 Ga0501083_0178203_799_1137 112
1051 3300049759 Ga0501262_015777 Ga0501262_015777_122_460 112
1052 3300049759 Ga0501262_075898 Ga0501262_075898_96_434 112
1053 3300049760 Ga0501263_015469 Ga0501263_015469_493_831 112
1054 3300049762 Ga0501265_001438 Ga0501265_001438_131_469 112
1055 3300049762 Ga0501265_061022 Ga0501265_061022_222_560 112
1056 3300049764 Ga0501267_005593 Ga0501267_005593_601_939 112
1057 3300049766 Ga0501269_002880 Ga0501269_002880_619_957 112
1058 3300049767 Ga0501270_054354 Ga0501270_054354_284_622 112
1059 3300049769 Ga0501272_011539 Ga0501272_011539_403_741 112
1060 3300049822 Ga0501035_0040039 Ga0501035_0040039_3857_4195 112
1061 3300049823 Ga0501044_0085617 Ga0501044_0085617_2545_2883 112
1062 3300049823 Ga0501044_0466820 Ga0501044_0466820_581_919 112
1063 3300049824 Ga0501045_0132772 Ga0501045_0132772_850_1188 112
1064 3300049824 Ga0501045_1314721 Ga0501045_1314721_67_462 112
1065 3300050493 nmdc:mga0k408_135732_c1 nmdc:mga0k408_135732_c1_456_794 112
1066 3300050493 nmdc:mga0k408_4965_c1 nmdc:mga0k408_4965_c1_3258_3596 112
1067 3300050493 nmdc:mga0k408_53793_c1 nmdc:mga0k408_53793_c1_1040_1378 112
1068 3300050493 nmdc:mga0k408_560699_c1 nmdc:mga0k408_560699_c1_273_611 112
1069 3300050493 nmdc:mga0k408_75037_c1 nmdc:mga0k408_75037_c1_1016_1354 112
1070 3300050494 nmdc:mga06z11_567089_c1 nmdc:mga06z11_567089_c1_195_533 112
1071 3300050496 nmdc:mga07m45_11043_c1 nmdc:mga07m45_11043_c1_3463_3801 112
1072 3300050496 nmdc:mga07m45_13378_c2 nmdc:mga07m45_13378_c2_1205_1543 112
1073 3300050496 nmdc:mga07m45_5516_c1 nmdc:mga07m45_5516_c1_3306_3644 112
1074 3300050496 nmdc:mga07m45_68942_c1 nmdc:mga07m45_68942_c1_751_1089 112
1075 3300050507 nmdc:mga05p37_1031235_c1 nmdc:mga05p37_1031235_c1_244_582 112
1076 3300050507 nmdc:mga05p37_17657_c1 nmdc:mga05p37_17657_c1_547_942 112
1077 3300050507 nmdc:mga05p37_2063341_c1 nmdc:mga05p37_2063341_c1_64_459 112
1078 3300050507 nmdc:mga05p37_316962_c1 nmdc:mga05p37_316962_c1_351_746 112
1079 3300050507 nmdc:mga05p37_38293_c1 nmdc:mga05p37_38293_c1_5379_5774 112
1080 3300050507 nmdc:mga05p37_3859_c1 nmdc:mga05p37_3859_c1_1196_1591 112
1081 3300050507 nmdc:mga05p37_809731_c1 nmdc:mga05p37_809731_c1_420_758 112
1082 3300050507 nmdc:mga05p37_90325_c1 nmdc:mga05p37_90325_c1_3110_3505 112
1083 3300050508 nmdc:mga09592_227045_c1 nmdc:mga09592_227045_c1_207_602 112
1084 3300050508 nmdc:mga09592_448440_c1 nmdc:mga09592_448440_c1_690_1085 112
1085 3300050508 nmdc:mga09592_547183_c1 nmdc:mga09592_547183_c1_451_789 112
1086 3300050508 nmdc:mga09592_9225_c1 nmdc:mga09592_9225_c1_1565_1960 112
1087 3300050509 nmdc:mga0qj67_1374977_c1 nmdc:mga0qj67_1374977_c1_46_459 112
1088 3300050509 nmdc:mga0qj67_519531_c1 nmdc:mga0qj67_519531_c1_548_943 112
1089 3300050510 nmdc:mga06r32_33320_c1 nmdc:mga06r32_33320_c1_2682_3077 112
1090 3300050511 nmdc:mga08y16_1724283_c1 nmdc:mga08y16_1724283_c1_83_421 112
1091 3300050511 nmdc:mga08y16_44605_c1 nmdc:mga08y16_44605_c1_372_710 112
1092 3300050512 nmdc:mga0n895_24727_c1 nmdc:mga0n895_24727_c1_3849_4187 112
1093 3300050512 nmdc:mga0n895_880590_c1 nmdc:mga0n895_880590_c1_297_635 112
1094 3300050512 nmdc:mga0n895_912803_c1 nmdc:mga0n895_912803_c1_436_774 112
1095 3300050513 nmdc:mga0rr50_1085303_c1 nmdc:mga0rr50_1085303_c1_196_534 112
1096 3300050513 nmdc:mga0rr50_152126_c1 nmdc:mga0rr50_152126_c1_224_562 112
1097 3300050514 nmdc:mga08x19_46492_c1 nmdc:mga08x19_46492_c1_1366_1704 112
1098 3300050515 nmdc:mga0a205_31268_c1 nmdc:mga0a205_31268_c1_2623_2961 112
1099 3300050515 nmdc:mga0a205_566832_c1 nmdc:mga0a205_566832_c1_79_417 112
1100 3300050516 nmdc:mga0sz30_57096_c2 nmdc:mga0sz30_57096_c2_31_369 112
1101 3300053078 Ga0495612_0026745 Ga0495612_0026745_583_921 112
1102 3300053086 Ga0500578_0043481 Ga0500578_0043481_414_752 112
1103 3300053121 Ga0500607_084959 Ga0500607_084959_249_587 112
1104 3300053177 Ga0500636_0536665 Ga0500636_0536665_74_412 112
1105 3300053730 Ga0500645_003647 Ga0500645_003647_4001_4339 112
1106 3300053739 Ga0500587_010883 Ga0500587_010883_240_578 112
1107 3300054114 Ga0501084_0081891 Ga0501084_0081891_602_940 112
1108 3300054114 Ga0501084_0421750 Ga0501084_0421750_62_400 112
1109 3300059607 Ga0587125_016601 Ga0587125_016601_15_353 112
1110 3300060346 Ga0587111_0280390 Ga0587111_0280390_135_473 112
1111 3300060353 Ga0501082_0112905 Ga0501082_0112905_1123_1518 112
1112 3300060353 Ga0501082_0375736 Ga0501082_0375736_60_398 112
1113 3300060353 Ga0501082_0381022 Ga0501082_0381022_882_1220 112
1114 3300060353 Ga0501082_0735769 Ga0501082_0735769_181_519 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

2

107

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hwu-assembly3.cif.gz_C structure of pii protein from herbaspirillum seropedicae 0.9757 1 112
5l9n-assembly1.cif.gz_A structure of uridylylated glnb from escherichia coli bound to atp 0.974 1 108
4co4-assembly1.cif.gz_A structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate 0.9726 1 108
3t9z-assembly1.cif.gz_B a. fulgidus glnk3, ligand-free 0.9697 1 108
1ul3-assembly3.cif.gz_A-5 crystal structure of pii from synechocystis sp. pcc 6803 0.9692 1 108
ID Description Score Start End Superfamily
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.941 1 111 3.30.70.120
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9366 2 111 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9361 2 112 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9317 1 111 3.30.70.120
2xulB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8989 1 111 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A1Q4DS82-F1-model_v4 Transcriptional regulator 0.9661 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A1Q4DS82-F1-model_v4 Transcriptional regulator 0.9561 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A836T1U7-F1-model_v4 P-II family nitrogen regulator 0.9165 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0RYL7-F1-model_v4 Nitrogen regulatory protein PII 0.9147 2 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A1F7F2C5-F1-model_v4 Transcriptional regulator 0.9091 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234

Feature Viewer

pLDDT pTM Quality
86.86 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map