F490278
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1114 | 501 | 1104 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300026116|Ga0207674_10346593|Ga0207674_103465932 |
| Length | 137 |
| Sequence | MTKKIEAIFREEKLIAVKEALSEIGIIGMNVMEVRGHGRQGGIELAGRIGTYRVDLLPRVQLNIILSDRNVEKTIGIIQQATQTGNIGDGIIFVYAVEEVIRIRTGERGRDALTYEGDIDVRRDLEADLVNAIGISD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 2 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 3 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 4 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 5 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 6 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 7 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 8 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 9 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 10 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 16 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 23 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 95 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 135 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 136 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 137 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 138 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 156 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 157 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 243 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 244 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 246 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 249 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 250 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 251 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 252 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 253 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 254 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 255 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 256 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 257 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 258 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 260 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 261 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 262 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 263 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 264 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 265 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 266 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 267 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 268 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 269 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 270 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 271 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 272 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 273 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 275 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 279 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 280 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 281 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 282 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 283 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 284 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 285 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 286 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 287 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 289 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 290 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 291 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 295 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 296 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 298 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 299 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 300 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 301 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 302 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 303 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 304 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 305 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 306 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 307 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 308 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 313 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 314 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 315 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 316 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 317 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 318 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 319 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 320 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 321 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 322 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 323 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 324 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 325 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 326 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 327 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 328 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 329 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 330 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 331 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 332 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 333 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 334 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 335 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 336 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 337 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 338 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 339 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 340 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 341 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 398 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 399 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 400 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 401 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 402 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 403 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 406 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 407 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 408 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 409 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 410 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 411 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 412 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 413 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 414 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 415 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 416 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 417 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 418 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 419 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 420 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 421 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 422 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 426 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 427 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 428 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 429 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 430 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 431 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 432 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 452 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 453 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 454 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 455 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 456 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 457 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 458 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 459 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 460 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 461 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 462 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 463 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 464 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 465 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 466 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 470 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 471 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 472 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 473 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 474 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 475 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 476 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 480 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 481 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 482 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 492 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 494 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 495 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 496 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 497 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 498 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.5 |
| Metatranscriptomes | 2.6 |
| Isolates | 0.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.66 |
| Nodule | 0.18 |
| Rhizoplane | 4.49 |
| Rhizosphere | 84.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10025768 | 3300001989 | Bacteria | 2068 |
| 2 | JGI24737J22298_10096788 | 3300001990 | Bacteria | 875 |
| 3 | JGI24735J21928_10011789 | 3300002067 | Bacteria | 2768 |
| 4 | JGI24744J21845_10006067 | 3300002077 | Bacteria | 2507 |
| 5 | JGI25156J39149_1001412 | 3300002705 | Bacteria | 10229 |
| 6 | JGI25154J39366_1002457 | 3300002738 | Bacteria | 4779 |
| 7 | JGI25157J39369_1000423 | 3300002741 | Bacteria | 27882 |
| 8 | JGI25164J39214_1003965 | 3300002772 | Bacteria | 1771 |
| 9 | Ga0006778J45830_1096314 | 3300003162 | Bacteria | 530 |
| 10 | Ga0006777J48905_1063803 | 3300003308 | Bacteria | 790 |
| 11 | rootL2_10006260 | 3300003322 | Bacteria | 9795 |
| 12 | JGI25160J50197_1091470 | 3300003354 | Bacteria | 551 |
| 13 | Ga0055539_1000874 | 3300003752 | Bacteria | 6913 |
| 14 | Ga0055539_1001489 | 3300003752 | Bacteria | 4307 |
| 15 | Ga0055533_1000006 | 3300003756 | Bacteria | 635559 |
| 16 | Ga0055535_1010743 | 3300003761 | Bacteria | 1487 |
| 17 | Ga0055524_1003908 | 3300003775 | Bacteria | 7061 |
| 18 | Ga0055524_1011613 | 3300003775 | Bacteria | 3432 |
| 19 | Ga0055530_10043228 | 3300003791 | Bacteria | 1088 |
| 20 | Ga0055540_1033015 | 3300003792 | Bacteria | 1176 |
| 21 | Ga0055531_10000313 | 3300003794 | Bacteria | 47791 |
| 22 | Ga0055531_10004052 | 3300003794 | Bacteria | 9081 |
| 23 | Ga0055531_10009008 | 3300003794 | Bacteria | 5160 |
| 24 | Ga0058861_11642297 | 3300004800 | Bacteria | 509 |
| 25 | Ga0065165_1000184 | 3300005262 | Bacteria | 109539 |
| 26 | Ga0065704_10169711 | 3300005289 | Bacteria | 1288 |
| 27 | Ga0065704_10475728 | 3300005289 | Unclassified | 685 |
| 28 | Ga0065715_10304726 | 3300005293 | Bacteria | 1033 |
| 29 | Ga0065715_10423716 | 3300005293 | Bacteria | 855 |
| 30 | Ga0065715_10657363 | 3300005293 | Bacteria | 675 |
| 31 | Ga0065707_10002367 | 3300005295 | Bacteria | 6817 |
| 32 | Ga0065707_11073738 | 3300005295 | Unclassified | 521 |
| 33 | Ga0070658_10045045 | 3300005327 | Bacteria | 3566 |
| 34 | Ga0070658_10231457 | 3300005327 | Bacteria | 1565 |
| 35 | Ga0070658_10453221 | 3300005327 | Bacteria | 1105 |
| 36 | Ga0070676_10005714 | 3300005328 | Bacteria | 6629 |
| 37 | Ga0070676_10107903 | 3300005328 | Bacteria | 1729 |
| 38 | Ga0070676_10340037 | 3300005328 | Bacteria | 1029 |
| 39 | Ga0070676_10786420 | 3300005328 | Bacteria | 701 |
| 40 | Ga0070683_100239506 | 3300005329 | Bacteria | 1725 |
| 41 | Ga0070683_100674772 | 3300005329 | Bacteria | 990 |
| 42 | Ga0070690_100001971 | 3300005330 | Bacteria | 10933 |
| 43 | Ga0070690_100018981 | 3300005330 | Bacteria | 4164 |
| 44 | Ga0070670_100006292 | 3300005331 | Bacteria | 10052 |
| 45 | Ga0070670_100025014 | 3300005331 | Bacteria | 5137 |
| 46 | Ga0070670_100227875 | 3300005331 | Bacteria | 1621 |
| 47 | Ga0070670_100517913 | 3300005331 | Bacteria | 1062 |
| 48 | Ga0070670_100560409 | 3300005331 | Bacteria | 1020 |
| 49 | Ga0070670_101343585 | 3300005331 | Bacteria | 655 |
| 50 | Ga0070677_10087336 | 3300005333 | Bacteria | 1349 |
| 51 | Ga0070677_10251214 | 3300005333 | Bacteria | 878 |
| 52 | Ga0068869_100002581 | 3300005334 | Bacteria | 10938 |
| 53 | Ga0068869_100040418 | 3300005334 | Bacteria | 3335 |
| 54 | Ga0068869_100049953 | 3300005334 | Bacteria | 3030 |
| 55 | Ga0068869_100074593 | 3300005334 | Bacteria | 2518 |
| 56 | Ga0068869_100890308 | 3300005334 | Bacteria | 770 |
| 57 | Ga0068869_101311655 | 3300005334 | Bacteria | 639 |
| 58 | Ga0070682_100061679 | 3300005337 | Bacteria | 2374 |
| 59 | Ga0068868_100004780 | 3300005338 | Bacteria | 9510 |
| 60 | Ga0068868_100113852 | 3300005338 | Bacteria | 2200 |
| 61 | Ga0068868_100416010 | 3300005338 | Bacteria | 1163 |
| 62 | Ga0068868_100750939 | 3300005338 | Bacteria | 877 |
| 63 | Ga0070660_100414090 | 3300005339 | Bacteria | 1115 |
| 64 | Ga0070689_100005903 | 3300005340 | Bacteria | 8420 |
| 65 | Ga0070691_10011042 | 3300005341 | Bacteria | 4126 |
| 66 | Ga0070661_100110585 | 3300005344 | Bacteria | 2051 |
| 67 | Ga0070692_10042501 | 3300005345 | Bacteria | 2334 |
| 68 | Ga0070692_10462025 | 3300005345 | Bacteria | 815 |
| 69 | Ga0070692_10576267 | 3300005345 | Bacteria | 741 |
| 70 | Ga0070668_100003380 | 3300005347 | Bacteria | 11769 |
| 71 | Ga0070668_100040416 | 3300005347 | Bacteria | 3568 |
| 72 | Ga0070668_100100591 | 3300005347 | Bacteria | 2290 |
| 73 | Ga0070668_100255410 | 3300005347 | Bacteria | 1456 |
| 74 | Ga0070668_100729319 | 3300005347 | Bacteria | 876 |
| 75 | Ga0070669_100013932 | 3300005353 | Bacteria | 5718 |
| 76 | Ga0070669_100029809 | 3300005353 | Bacteria | 3936 |
| 77 | Ga0070669_100234526 | 3300005353 | Bacteria | 1456 |
| 78 | Ga0070675_100011427 | 3300005354 | Bacteria | 6949 |
| 79 | Ga0070675_100059003 | 3300005354 | Bacteria | 3165 |
| 80 | Ga0070675_100230942 | 3300005354 | Bacteria | 1614 |
| 81 | Ga0070675_100760156 | 3300005354 | Bacteria | 885 |
| 82 | Ga0070675_100973166 | 3300005354 | Bacteria | 779 |
| 83 | Ga0070671_100078732 | 3300005355 | Bacteria | 2755 |
| 84 | Ga0070671_100131713 | 3300005355 | Bacteria | 2106 |
| 85 | Ga0070674_100064999 | 3300005356 | Bacteria | 2559 |
| 86 | Ga0070673_100262558 | 3300005364 | Bacteria | 1509 |
| 87 | Ga0070688_100109170 | 3300005365 | Bacteria | 1837 |
| 88 | Ga0070688_100854879 | 3300005365 | Bacteria | 715 |
| 89 | Ga0070659_100083453 | 3300005366 | Bacteria | 2554 |
| 90 | Ga0070659_100093911 | 3300005366 | Bacteria | 2408 |
| 91 | Ga0070659_100694396 | 3300005366 | Bacteria | 880 |
| 92 | Ga0070667_100006231 | 3300005367 | Bacteria | 9925 |
| 93 | Ga0070667_100018932 | 3300005367 | Bacteria | 5709 |
| 94 | Ga0070667_101426982 | 3300005367 | Bacteria | 649 |
| 95 | Ga0070713_100365386 | 3300005436 | Bacteria | 1342 |
| 96 | Ga0070701_10004252 | 3300005438 | Bacteria | 5770 |
| 97 | Ga0070711_100871702 | 3300005439 | Bacteria | 767 |
| 98 | Ga0070711_100995868 | 3300005439 | Bacteria | 719 |
| 99 | Ga0070705_100077812 | 3300005440 | Bacteria | 2027 |
| 100 | Ga0070700_100001276 | 3300005441 | Bacteria | 12494 |
| 101 | Ga0070700_100623604 | 3300005441 | Bacteria | 848 |
| 102 | Ga0070700_101374993 | 3300005441 | Bacteria | 596 |
| 103 | Ga0070700_101495590 | 3300005441 | Bacteria | 574 |
| 104 | Ga0070708_100000726 | 3300005445 | Bacteria | 25018 |
| 105 | Ga0070708_100114581 | 3300005445 | Bacteria | 2480 |
| 106 | Ga0070708_100617810 | 3300005445 | Bacteria | 1022 |
| 107 | Ga0070663_100012072 | 3300005455 | Bacteria | 5451 |
| 108 | Ga0070663_100060237 | 3300005455 | Bacteria | 2729 |
| 109 | Ga0070663_100822870 | 3300005455 | Bacteria | 797 |
| 110 | Ga0070663_100837994 | 3300005455 | Bacteria | 791 |
| 111 | Ga0070678_100011210 | 3300005456 | Bacteria | 5519 |
| 112 | Ga0070678_100175503 | 3300005456 | Bacteria | 1749 |
| 113 | Ga0070678_100390947 | 3300005456 | Bacteria | 1206 |
| 114 | Ga0070662_100089481 | 3300005457 | Bacteria | 2309 |
| 115 | Ga0070662_100662984 | 3300005457 | Bacteria | 881 |
| 116 | Ga0068867_100000610 | 3300005459 | Bacteria | 23663 |
| 117 | Ga0068867_100001706 | 3300005459 | Bacteria | 15301 |
| 118 | Ga0068867_100008197 | 3300005459 | Bacteria | 7380 |
| 119 | Ga0068867_100008463 | 3300005459 | Bacteria | 7258 |
| 120 | Ga0068867_100317408 | 3300005459 | Bacteria | 1290 |
| 121 | Ga0068867_100378813 | 3300005459 | Bacteria | 1188 |
| 122 | Ga0068867_100386264 | 3300005459 | Bacteria | 1177 |
| 123 | Ga0068867_100387353 | 3300005459 | Bacteria | 1176 |
| 124 | Ga0070685_10321549 | 3300005466 | Bacteria | 1049 |
| 125 | Ga0070706_100396687 | 3300005467 | Bacteria | 1284 |
| 126 | Ga0070706_101015595 | 3300005467 | Bacteria | 765 |
| 127 | Ga0070707_100098346 | 3300005468 | Bacteria | 2834 |
| 128 | Ga0070698_100174328 | 3300005471 | Bacteria | 2091 |
| 129 | Ga0070698_100249367 | 3300005471 | Bacteria | 1708 |
| 130 | Ga0070698_100862335 | 3300005471 | Bacteria | 851 |
| 131 | Ga0070699_100099649 | 3300005518 | Bacteria | 2546 |
| 132 | Ga0070684_100937387 | 3300005535 | Bacteria | 812 |
| 133 | Ga0070697_100510661 | 3300005536 | Bacteria | 1051 |
| 134 | Ga0068853_100399837 | 3300005539 | Bacteria | 1286 |
| 135 | Ga0068853_100731849 | 3300005539 | Bacteria | 945 |
| 136 | Ga0070672_100005096 | 3300005543 | Bacteria | 8667 |
| 137 | Ga0070672_100018094 | 3300005543 | Bacteria | 5087 |
| 138 | Ga0070672_100026372 | 3300005543 | Bacteria | 4323 |
| 139 | Ga0070672_100365888 | 3300005543 | Bacteria | 1231 |
| 140 | Ga0070672_100400917 | 3300005543 | Bacteria | 1176 |
| 141 | Ga0070672_100710640 | 3300005543 | Bacteria | 880 |
| 142 | Ga0070686_100026545 | 3300005544 | Bacteria | 3497 |
| 143 | Ga0070695_100043274 | 3300005545 | Bacteria | 2863 |
| 144 | Ga0070695_100280176 | 3300005545 | Bacteria | 1225 |
| 145 | Ga0070696_100417909 | 3300005546 | Bacteria | 1052 |
| 146 | Ga0070693_100457333 | 3300005547 | Bacteria | 897 |
| 147 | Ga0070665_100029400 | 3300005548 | Bacteria | 5531 |
| 148 | Ga0070665_100085416 | 3300005548 | Bacteria | 3161 |
| 149 | Ga0070665_100305599 | 3300005548 | Bacteria | 1594 |
| 150 | Ga0070665_100450514 | 3300005548 | Bacteria | 1297 |
| 151 | Ga0070704_100309738 | 3300005549 | Bacteria | 1319 |
| 152 | Ga0070704_100384762 | 3300005549 | Bacteria | 1193 |
| 153 | Ga0068855_100056261 | 3300005563 | Bacteria | 4616 |
| 154 | Ga0068855_100342735 | 3300005563 | Bacteria | 1647 |
| 155 | Ga0068855_100750014 | 3300005563 | Bacteria | 1041 |
| 156 | Ga0070664_100010288 | 3300005564 | Bacteria | 7590 |
| 157 | Ga0070664_100065829 | 3300005564 | Bacteria | 3093 |
| 158 | Ga0070664_100179946 | 3300005564 | Bacteria | 1879 |
| 159 | Ga0070664_100460415 | 3300005564 | Bacteria | 1168 |
| 160 | Ga0070664_100593119 | 3300005564 | Bacteria | 1027 |
| 161 | Ga0070664_100699584 | 3300005564 | Bacteria | 944 |
| 162 | Ga0068857_100007291 | 3300005577 | Bacteria | 9524 |
| 163 | Ga0068857_100019102 | 3300005577 | Bacteria | 6015 |
| 164 | Ga0068857_100198181 | 3300005577 | Bacteria | 1830 |
| 165 | Ga0068857_100227840 | 3300005577 | Bacteria | 1704 |
| 166 | Ga0068854_100011530 | 3300005578 | Bacteria | 5761 |
| 167 | Ga0068854_100024015 | 3300005578 | Bacteria | 4169 |
| 168 | Ga0068854_100040406 | 3300005578 | Bacteria | 3291 |
| 169 | Ga0068854_100577809 | 3300005578 | Bacteria | 957 |
| 170 | Ga0068856_100002869 | 3300005614 | Bacteria | 17647 |
| 171 | Ga0070702_100010963 | 3300005615 | Bacteria | 4492 |
| 172 | Ga0068852_100022906 | 3300005616 | Bacteria | 5017 |
| 173 | Ga0068852_100066636 | 3300005616 | Bacteria | 3145 |
| 174 | Ga0068852_100410913 | 3300005616 | Bacteria | 1333 |
| 175 | Ga0068852_101009828 | 3300005616 | Bacteria | 851 |
| 176 | Ga0068859_100002465 | 3300005617 | Bacteria | 18831 |
| 177 | Ga0068859_100118538 | 3300005617 | Bacteria | 2712 |
| 178 | Ga0068859_100294143 | 3300005617 | Bacteria | 1717 |
| 179 | Ga0068859_100713096 | 3300005617 | Bacteria | 1093 |
| 180 | Ga0068859_100748041 | 3300005617 | Bacteria | 1067 |
| 181 | Ga0068864_100003756 | 3300005618 | Bacteria | 12529 |
| 182 | Ga0068864_100005694 | 3300005618 | Bacteria | 10215 |
| 183 | Ga0068864_100149765 | 3300005618 | Bacteria | 2113 |
| 184 | Ga0068864_100300491 | 3300005618 | Bacteria | 1503 |
| 185 | Ga0068864_101072137 | 3300005618 | Bacteria | 801 |
| 186 | Ga0068866_10013782 | 3300005718 | Bacteria | 3555 |
| 187 | Ga0068866_10225756 | 3300005718 | Bacteria | 1133 |
| 188 | Ga0068861_100003054 | 3300005719 | Bacteria | 11054 |
| 189 | Ga0068861_100285963 | 3300005719 | Bacteria | 1422 |
| 190 | Ga0068861_100470782 | 3300005719 | Bacteria | 1130 |
| 191 | Ga0068861_100536719 | 3300005719 | Bacteria | 1063 |
| 192 | Ga0068851_10185924 | 3300005834 | Bacteria | 1153 |
| 193 | Ga0068851_10974760 | 3300005834 | Bacteria | 534 |
| 194 | Ga0068870_10023946 | 3300005840 | Bacteria | 3017 |
| 195 | Ga0068870_10127882 | 3300005840 | Bacteria | 1472 |
| 196 | Ga0068870_10548644 | 3300005840 | Bacteria | 778 |
| 197 | Ga0068863_100067683 | 3300005841 | Bacteria | 3378 |
| 198 | Ga0068863_100127860 | 3300005841 | Bacteria | 2425 |
| 199 | Ga0068863_100224774 | 3300005841 | Bacteria | 1809 |
| 200 | Ga0068863_100249319 | 3300005841 | Bacteria | 1715 |
| 201 | Ga0068863_100663312 | 3300005841 | Bacteria | 1035 |
| 202 | Ga0068863_101049664 | 3300005841 | Bacteria | 818 |
| 203 | Ga0068858_100003435 | 3300005842 | Bacteria | 15741 |
| 204 | Ga0068858_100009536 | 3300005842 | Bacteria | 9260 |
| 205 | Ga0068858_100009830 | 3300005842 | Bacteria | 9100 |
| 206 | Ga0068858_100348196 | 3300005842 | Bacteria | 1419 |
| 207 | Ga0068858_101929513 | 3300005842 | Bacteria | 584 |
| 208 | Ga0068860_100003281 | 3300005843 | Bacteria | 16651 |
| 209 | Ga0068860_100034146 | 3300005843 | Bacteria | 4878 |
| 210 | Ga0068860_100222236 | 3300005843 | Bacteria | 1834 |
| 211 | Ga0068860_100302226 | 3300005843 | Bacteria | 1568 |
| 212 | Ga0068860_100886657 | 3300005843 | Bacteria | 908 |
| 213 | Ga0068860_100941884 | 3300005843 | Bacteria | 881 |
| 214 | Ga0068862_100023698 | 3300005844 | Bacteria | 5144 |
| 215 | Ga0068862_100033125 | 3300005844 | Bacteria | 4365 |
| 216 | Ga0068862_100238659 | 3300005844 | Bacteria | 1652 |
| 217 | Ga0070716_100602882 | 3300006173 | Bacteria | 826 |
| 218 | Ga0070716_100994372 | 3300006173 | Bacteria | 663 |
| 219 | Ga0070716_101313075 | 3300006173 | Bacteria | 585 |
| 220 | Ga0075362_10374219 | 3300006177 | Bacteria | 716 |
| 221 | Ga0075367_10555632 | 3300006178 | Bacteria | 729 |
| 222 | Ga0075427_10002958 | 3300006194 | Bacteria | 2314 |
| 223 | Ga0075427_10023948 | 3300006194 | Bacteria | 979 |
| 224 | Ga0075366_10013383 | 3300006195 | Bacteria | 4669 |
| 225 | Ga0075366_10064639 | 3300006195 | Bacteria | 2176 |
| 226 | Ga0075366_10081396 | 3300006195 | Bacteria | 1934 |
| 227 | Ga0075366_10144212 | 3300006195 | Bacteria | 1440 |
| 228 | Ga0075366_10383142 | 3300006195 | Bacteria | 865 |
| 229 | Ga0075366_10426097 | 3300006195 | Bacteria | 817 |
| 230 | Ga0075366_10842144 | 3300006195 | Bacteria | 571 |
| 231 | Ga0097621_100047387 | 3300006237 | Bacteria | 3483 |
| 232 | Ga0097621_100245659 | 3300006237 | Bacteria | 1566 |
| 233 | Ga0097621_101331335 | 3300006237 | Bacteria | 679 |
| 234 | Ga0075370_10015045 | 3300006353 | Bacteria | 4135 |
| 235 | Ga0075370_10018575 | 3300006353 | Bacteria | 3774 |
| 236 | Ga0075370_10036940 | 3300006353 | Bacteria | 2745 |
| 237 | Ga0075370_10476620 | 3300006353 | Bacteria | 752 |
| 238 | Ga0068871_100015936 | 3300006358 | Bacteria | 5645 |
| 239 | Ga0068871_100018412 | 3300006358 | Bacteria | 5307 |
| 240 | Ga0068871_101240659 | 3300006358 | Bacteria | 700 |
| 241 | Ga0068871_101619352 | 3300006358 | Bacteria | 613 |
| 242 | Ga0075428_100054190 | 3300006844 | Bacteria | 4395 |
| 243 | Ga0075428_100288887 | 3300006844 | Bacteria | 1764 |
| 244 | Ga0075428_100609698 | 3300006844 | Bacteria | 1165 |
| 245 | Ga0075428_100893231 | 3300006844 | Bacteria | 943 |
| 246 | Ga0075428_101531957 | 3300006844 | Bacteria | 698 |
| 247 | Ga0075430_100320684 | 3300006846 | Bacteria | 1281 |
| 248 | Ga0075430_100564827 | 3300006846 | Unclassified | 938 |
| 249 | Ga0075431_100061108 | 3300006847 | Bacteria | 3888 |
| 250 | Ga0075433_10079733 | 3300006852 | Bacteria | 2885 |
| 251 | Ga0075433_10430172 | 3300006852 | Bacteria | 1164 |
| 252 | Ga0075433_10646754 | 3300006852 | Bacteria | 927 |
| 253 | Ga0075434_100035518 | 3300006871 | Bacteria | 4928 |
| 254 | Ga0075434_100326253 | 3300006871 | Bacteria | 1556 |
| 255 | Ga0075434_101078018 | 3300006871 | Bacteria | 817 |
| 256 | Ga0075429_100001462 | 3300006880 | Bacteria | 19410 |
| 257 | Ga0075429_100062270 | 3300006880 | Bacteria | 3251 |
| 258 | Ga0075429_100097238 | 3300006880 | Bacteria | 2568 |
| 259 | Ga0075429_100959157 | 3300006880 | Unclassified | 748 |
| 260 | Ga0068865_100004028 | 3300006881 | Bacteria | 8825 |
| 261 | Ga0068865_100023534 | 3300006881 | Bacteria | 4034 |
| 262 | Ga0068865_100129605 | 3300006881 | Bacteria | 1888 |
| 263 | Ga0068865_101192388 | 3300006881 | Bacteria | 674 |
| 264 | Ga0075436_100041282 | 3300006914 | Bacteria | 3183 |
| 265 | Ga0097620_100002465 | 3300006931 | Bacteria | 18831 |
| 266 | Ga0097620_100118535 | 3300006931 | Bacteria | 2712 |
| 267 | Ga0097620_100294133 | 3300006931 | Bacteria | 1717 |
| 268 | Ga0097620_100713090 | 3300006931 | Bacteria | 1093 |
| 269 | Ga0097620_100747970 | 3300006931 | Bacteria | 1067 |
| 270 | Ga0099823_1000039 | 3300006944 | Bacteria | 61476 |
| 271 | Ga0075435_100093531 | 3300007076 | Bacteria | 2484 |
| 272 | Ga0075435_100882729 | 3300007076 | Bacteria | 779 |
| 273 | Ga0105251_10002039 | 3300009011 | Bacteria | 16393 |
| 274 | Ga0105251_10004772 | 3300009011 | Bacteria | 9073 |
| 275 | Ga0105240_10066599 | 3300009093 | Bacteria | 4467 |
| 276 | Ga0105240_10167932 | 3300009093 | Bacteria | 2601 |
| 277 | Ga0105240_10650979 | 3300009093 | Bacteria | 1155 |
| 278 | Ga0111539_10056418 | 3300009094 | Bacteria | 4668 |
| 279 | Ga0111539_10527171 | 3300009094 | Bacteria | 1376 |
| 280 | Ga0111539_10527406 | 3300009094 | Bacteria | 1376 |
| 281 | Ga0105245_10026425 | 3300009098 | Bacteria | 5109 |
| 282 | Ga0105245_10404071 | 3300009098 | Bacteria | 1366 |
| 283 | Ga0105245_11262081 | 3300009098 | Bacteria | 787 |
| 284 | Ga0105247_10007966 | 3300009101 | Bacteria | 6473 |
| 285 | Ga0114129_10014043 | 3300009147 | Bacteria | 11408 |
| 286 | Ga0114129_10025476 | 3300009147 | Bacteria | 8382 |
| 287 | Ga0114129_10095326 | 3300009147 | Bacteria | 4121 |
| 288 | Ga0114129_10141482 | 3300009147 | Bacteria | 3297 |
| 289 | Ga0114129_10334723 | 3300009147 | Unclassified | 2009 |
| 290 | Ga0114129_10809372 | 3300009147 | Bacteria | 1194 |
| 291 | Ga0114129_12239859 | 3300009147 | Unclassified | 657 |
| 292 | Ga0105243_10008116 | 3300009148 | Bacteria | 8059 |
| 293 | Ga0105243_10010621 | 3300009148 | Bacteria | 6988 |
| 294 | Ga0105243_10235877 | 3300009148 | Bacteria | 1625 |
| 295 | Ga0105243_11397151 | 3300009148 | Bacteria | 720 |
| 296 | Ga0105243_12713615 | 3300009148 | Bacteria | 536 |
| 297 | Ga0105241_10213554 | 3300009174 | Bacteria | 1618 |
| 298 | Ga0105241_11051791 | 3300009174 | Bacteria | 764 |
| 299 | Ga0105241_11295995 | 3300009174 | Bacteria | 694 |
| 300 | Ga0105241_11772186 | 3300009174 | Bacteria | 602 |
| 301 | Ga0105242_10066853 | 3300009176 | Bacteria | 2970 |
| 302 | Ga0105242_10990887 | 3300009176 | Bacteria | 847 |
| 303 | Ga0105248_10005793 | 3300009177 | Bacteria | 13581 |
| 304 | Ga0105248_10108265 | 3300009177 | Bacteria | 3133 |
| 305 | Ga0105248_10180048 | 3300009177 | Bacteria | 2382 |
| 306 | Ga0105248_10965075 | 3300009177 | Bacteria | 963 |
| 307 | Ga0105237_10231349 | 3300009545 | Bacteria | 1849 |
| 308 | Ga0105238_10108475 | 3300009551 | Bacteria | 2757 |
| 309 | Ga0105238_10626530 | 3300009551 | Bacteria | 1085 |
| 310 | Ga0105238_11353320 | 3300009551 | Bacteria | 739 |
| 311 | Ga0105249_10063404 | 3300009553 | Bacteria | 3395 |
| 312 | Ga0105249_10324206 | 3300009553 | Bacteria | 1552 |
| 313 | Ga0105249_10736290 | 3300009553 | Bacteria | 1048 |
| 314 | Ga0105239_10036788 | 3300010375 | Bacteria | 5370 |
| 315 | Ga0105239_10243351 | 3300010375 | Bacteria | 2019 |
| 316 | Ga0105239_11516147 | 3300010375 | Bacteria | 775 |
| 317 | Ga0105246_10169149 | 3300011119 | Bacteria | 1672 |
| 318 | Ga0157317_1000744 | 3300012475 | Bacteria | 1546 |
| 319 | Ga0157329_1028350 | 3300012491 | Bacteria | 569 |
| 320 | Ga0157319_1000009 | 3300012497 | Bacteria | 227971 |
| 321 | Ga0157326_1072398 | 3300012513 | Bacteria | 549 |
| 322 | Ga0157373_10180537 | 3300013100 | Bacteria | 1486 |
| 323 | Ga0157373_10508701 | 3300013100 | Bacteria | 870 |
| 324 | Ga0157371_11472322 | 3300013102 | Bacteria | 530 |
| 325 | Ga0157370_10082879 | 3300013104 | Bacteria | 3016 |
| 326 | Ga0157370_10496245 | 3300013104 | Bacteria | 1121 |
| 327 | Ga0157369_10024322 | 3300013105 | Bacteria | 6740 |
| 328 | Ga0157369_10393451 | 3300013105 | Bacteria | 1438 |
| 329 | Ga0157369_10461657 | 3300013105 | Bacteria | 1315 |
| 330 | Ga0157369_10569797 | 3300013105 | Bacteria | 1170 |
| 331 | Ga0157374_10004327 | 3300013296 | Bacteria | 11944 |
| 332 | Ga0157374_10020860 | 3300013296 | Bacteria | 5820 |
| 333 | Ga0157374_10062072 | 3300013296 | Bacteria | 3501 |
| 334 | Ga0157374_10192598 | 3300013296 | Bacteria | 1994 |
| 335 | Ga0157374_11278967 | 3300013296 | Bacteria | 755 |
| 336 | Ga0157374_11359201 | 3300013296 | Bacteria | 733 |
| 337 | Ga0157378_10014439 | 3300013297 | Bacteria | 6915 |
| 338 | Ga0157378_10066087 | 3300013297 | Bacteria | 3238 |
| 339 | Ga0157378_10122241 | 3300013297 | Bacteria | 2401 |
| 340 | Ga0157378_10482280 | 3300013297 | Bacteria | 1236 |
| 341 | Ga0157378_11101428 | 3300013297 | Bacteria | 831 |
| 342 | Ga0163162_10086943 | 3300013306 | Bacteria | 3204 |
| 343 | Ga0163162_13259084 | 3300013306 | Bacteria | 520 |
| 344 | Ga0157372_10313070 | 3300013307 | Bacteria | 1827 |
| 345 | Ga0157372_11498347 | 3300013307 | Bacteria | 777 |
| 346 | Ga0157375_10194638 | 3300013308 | Bacteria | 2183 |
| 347 | Ga0157375_10329761 | 3300013308 | Bacteria | 1691 |
| 348 | Ga0157375_10750598 | 3300013308 | Bacteria | 1127 |
| 349 | Ga0157375_10980943 | 3300013308 | Bacteria | 985 |
| 350 | Ga0163163_10001673 | 3300014325 | Bacteria | 18702 |
| 351 | Ga0163163_12787259 | 3300014325 | Bacteria | 545 |
| 352 | Ga0157380_10041059 | 3300014326 | Bacteria | 3608 |
| 353 | Ga0157380_10187073 | 3300014326 | Bacteria | 1825 |
| 354 | Ga0157380_10634255 | 3300014326 | Bacteria | 1063 |
| 355 | Ga0182008_10037099 | 3300014497 | Bacteria | 2439 |
| 356 | Ga0182008_10180800 | 3300014497 | Bacteria | 1067 |
| 357 | Ga0157377_10000014 | 3300014745 | Bacteria | 213961 |
| 358 | Ga0157377_10081716 | 3300014745 | Bacteria | 1891 |
| 359 | Ga0157379_10000219 | 3300014968 | Bacteria | 44603 |
| 360 | Ga0157379_10030507 | 3300014968 | Bacteria | 4800 |
| 361 | Ga0157379_10124167 | 3300014968 | Bacteria | 2323 |
| 362 | Ga0157379_10254490 | 3300014968 | Bacteria | 1595 |
| 363 | Ga0157379_11705899 | 3300014968 | Bacteria | 617 |
| 364 | Ga0157379_12678901 | 3300014968 | Bacteria | 500 |
| 365 | Ga0157376_10054088 | 3300014969 | Bacteria | 3345 |
| 366 | Ga0157376_10236378 | 3300014969 | Bacteria | 1700 |
| 367 | Ga0157376_10265575 | 3300014969 | Bacteria | 1610 |
| 368 | Ga0157376_10534013 | 3300014969 | Bacteria | 1158 |
| 369 | Ga0157376_10810522 | 3300014969 | Bacteria | 949 |
| 370 | Ga0157376_11595455 | 3300014969 | Bacteria | 687 |
| 371 | Ga0163161_10072368 | 3300017792 | Bacteria | 2524 |
| 372 | Ga0163161_10326148 | 3300017792 | Bacteria | 1215 |
| 373 | Ga0206354_11614687 | 3300020081 | Bacteria | 618 |
| 374 | Ga0213872_10000003 | 3300021361 | Bacteria | 366948 |
| 375 | Ga0213872_10000004 | 3300021361 | Bacteria | 306230 |
| 376 | Ga0213872_10145217 | 3300021361 | Bacteria | 1039 |
| 377 | Ga0213876_10631559 | 3300021384 | Bacteria | 570 |
| 378 | Ga0224712_10291944 | 3300022467 | Bacteria | 761 |
| 379 | Ga0224712_10465848 | 3300022467 | Bacteria | 608 |
| 380 | Ga0209566_119113 | 3300025225 | Bacteria | 566 |
| 381 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 382 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 383 | Ga0207427_100190 | 3300025231 | Bacteria | 61601 |
| 384 | Ga0209258_101187 | 3300025242 | Bacteria | 10481 |
| 385 | Ga0209646_1000376 | 3300025246 | Bacteria | 28912 |
| 386 | Ga0209026_1000179 | 3300025250 | Bacteria | 95680 |
| 387 | Ga0209677_100026 | 3300025253 | Bacteria | 382520 |
| 388 | Ga0209677_101024 | 3300025253 | Bacteria | 13321 |
| 389 | Ga0209759_1000196 | 3300025256 | Bacteria | 95680 |
| 390 | Ga0209759_1018777 | 3300025256 | Bacteria | 1662 |
| 391 | Ga0209233_1048389 | 3300025261 | Bacteria | 878 |
| 392 | Ga0209455_1016722 | 3300025272 | Bacteria | 1566 |
| 393 | Ga0209673_1002939 | 3300025273 | Bacteria | 10725 |
| 394 | Ga0209050_1005985 | 3300025298 | Bacteria | 7379 |
| 395 | Ga0209256_1001390 | 3300025299 | Bacteria | 25244 |
| 396 | Ga0209256_1003868 | 3300025299 | Bacteria | 9943 |
| 397 | Ga0207426_1053188 | 3300025302 | Bacteria | 1196 |
| 398 | Ga0209051_1001698 | 3300025303 | Bacteria | 17649 |
| 399 | Ga0209051_1009070 | 3300025303 | Bacteria | 5175 |
| 400 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 401 | Ga0209257_1001619 | 3300025304 | Bacteria | 25820 |
| 402 | Ga0209257_1002501 | 3300025304 | Bacteria | 18143 |
| 403 | Ga0209257_1028703 | 3300025304 | Bacteria | 1827 |
| 404 | Ga0207697_10015713 | 3300025315 | Bacteria | 3124 |
| 405 | Ga0207697_10515293 | 3300025315 | Bacteria | 527 |
| 406 | Ga0207656_10005381 | 3300025321 | Bacteria | 4521 |
| 407 | Ga0207656_10076829 | 3300025321 | Bacteria | 1494 |
| 408 | Ga0207656_10178703 | 3300025321 | Bacteria | 1018 |
| 409 | Ga0207656_10526283 | 3300025321 | Bacteria | 601 |
| 410 | Ga0207713_1004561 | 3300025735 | Bacteria | 8965 |
| 411 | Ga0207682_10255469 | 3300025893 | Bacteria | 816 |
| 412 | Ga0207642_10006837 | 3300025899 | Bacteria | 3816 |
| 413 | Ga0207642_10074052 | 3300025899 | Bacteria | 1631 |
| 414 | Ga0207642_11133081 | 3300025899 | Bacteria | 506 |
| 415 | Ga0207710_10007106 | 3300025900 | Bacteria | 4750 |
| 416 | Ga0207680_11068510 | 3300025903 | Bacteria | 577 |
| 417 | Ga0207647_10051489 | 3300025904 | Bacteria | 2545 |
| 418 | Ga0207645_10006139 | 3300025907 | Bacteria | 8631 |
| 419 | Ga0207645_10033936 | 3300025907 | Bacteria | 3279 |
| 420 | Ga0207645_10078391 | 3300025907 | Bacteria | 2117 |
| 421 | Ga0207643_10086392 | 3300025908 | Bacteria | 1823 |
| 422 | Ga0207643_10269398 | 3300025908 | Bacteria | 1053 |
| 423 | Ga0207705_10020768 | 3300025909 | Bacteria | 4687 |
| 424 | Ga0207705_10126668 | 3300025909 | Bacteria | 1899 |
| 425 | Ga0207705_10269535 | 3300025909 | Bacteria | 1302 |
| 426 | Ga0207684_10024612 | 3300025910 | Bacteria | 5133 |
| 427 | Ga0207695_10074919 | 3300025913 | Bacteria | 3445 |
| 428 | Ga0207695_10096986 | 3300025913 | Bacteria | 2949 |
| 429 | Ga0207671_10170734 | 3300025914 | Bacteria | 1689 |
| 430 | Ga0207671_10215547 | 3300025914 | Bacteria | 1503 |
| 431 | Ga0207663_10759310 | 3300025916 | Bacteria | 771 |
| 432 | Ga0207663_11319003 | 3300025916 | Bacteria | 581 |
| 433 | Ga0207662_10284952 | 3300025918 | Bacteria | 1094 |
| 434 | Ga0207657_10603296 | 3300025919 | Bacteria | 856 |
| 435 | Ga0207649_10051542 | 3300025920 | Bacteria | 2549 |
| 436 | Ga0207649_10167688 | 3300025920 | Bacteria | 1527 |
| 437 | Ga0207649_10226266 | 3300025920 | Bacteria | 1335 |
| 438 | Ga0207652_11703011 | 3300025921 | Bacteria | 535 |
| 439 | Ga0207646_10327844 | 3300025922 | Bacteria | 1383 |
| 440 | Ga0207646_10865572 | 3300025922 | Bacteria | 803 |
| 441 | Ga0207681_10009728 | 3300025923 | Bacteria | 5884 |
| 442 | Ga0207681_10266132 | 3300025923 | Bacteria | 1344 |
| 443 | Ga0207681_10337164 | 3300025923 | Bacteria | 1203 |
| 444 | Ga0207681_11359215 | 3300025923 | Bacteria | 596 |
| 445 | Ga0207694_10010892 | 3300025924 | Bacteria | 6867 |
| 446 | Ga0207694_10025050 | 3300025924 | Bacteria | 4533 |
| 447 | Ga0207694_10903853 | 3300025924 | Bacteria | 747 |
| 448 | Ga0207650_10036058 | 3300025925 | Bacteria | 3596 |
| 449 | Ga0207650_10100444 | 3300025925 | Bacteria | 2226 |
| 450 | Ga0207650_10254922 | 3300025925 | Bacteria | 1421 |
| 451 | Ga0207650_10410741 | 3300025925 | Bacteria | 1122 |
| 452 | Ga0207650_10423425 | 3300025925 | Bacteria | 1105 |
| 453 | Ga0207659_10013120 | 3300025926 | Bacteria | 5299 |
| 454 | Ga0207659_10300693 | 3300025926 | Bacteria | 1318 |
| 455 | Ga0207659_10506020 | 3300025926 | Bacteria | 1023 |
| 456 | Ga0207659_10519516 | 3300025926 | Bacteria | 1009 |
| 457 | Ga0207659_10861505 | 3300025926 | Bacteria | 779 |
| 458 | Ga0207687_10008565 | 3300025927 | Bacteria | 6688 |
| 459 | Ga0207687_10355086 | 3300025927 | Bacteria | 1195 |
| 460 | Ga0207687_10409440 | 3300025927 | Bacteria | 1117 |
| 461 | Ga0207687_10606097 | 3300025927 | Bacteria | 923 |
| 462 | Ga0207687_11720477 | 3300025927 | Bacteria | 537 |
| 463 | Ga0207687_11844587 | 3300025927 | Bacteria | 517 |
| 464 | Ga0207700_10368001 | 3300025928 | Bacteria | 1255 |
| 465 | Ga0207664_10306616 | 3300025929 | Bacteria | 1398 |
| 466 | Ga0207644_10015963 | 3300025931 | Bacteria | 5049 |
| 467 | Ga0207644_10254235 | 3300025931 | Bacteria | 1403 |
| 468 | Ga0207644_10860453 | 3300025931 | Bacteria | 759 |
| 469 | Ga0207706_10117651 | 3300025933 | Bacteria | 2337 |
| 470 | Ga0207706_10154164 | 3300025933 | Bacteria | 2021 |
| 471 | Ga0207706_10676719 | 3300025933 | Bacteria | 883 |
| 472 | Ga0207686_10011200 | 3300025934 | Bacteria | 4904 |
| 473 | Ga0207709_10003260 | 3300025935 | Bacteria | 9730 |
| 474 | Ga0207709_10015301 | 3300025935 | Bacteria | 4254 |
| 475 | Ga0207709_10092039 | 3300025935 | Bacteria | 1984 |
| 476 | Ga0207709_11533997 | 3300025935 | Bacteria | 553 |
| 477 | Ga0207709_11677443 | 3300025935 | Bacteria | 528 |
| 478 | Ga0207670_10010371 | 3300025936 | Bacteria | 5363 |
| 479 | Ga0207669_10019511 | 3300025937 | Bacteria | 3533 |
| 480 | Ga0207669_11789508 | 3300025937 | Bacteria | 525 |
| 481 | Ga0207704_10064689 | 3300025938 | Bacteria | 2286 |
| 482 | Ga0207704_10118500 | 3300025938 | Bacteria | 1806 |
| 483 | Ga0207704_10702727 | 3300025938 | Bacteria | 837 |
| 484 | Ga0207665_10621534 | 3300025939 | Bacteria | 845 |
| 485 | Ga0207691_10004487 | 3300025940 | Bacteria | 13521 |
| 486 | Ga0207691_10033350 | 3300025940 | Bacteria | 4794 |
| 487 | Ga0207691_10060567 | 3300025940 | Bacteria | 3439 |
| 488 | Ga0207691_10091311 | 3300025940 | Bacteria | 2729 |
| 489 | Ga0207691_10193180 | 3300025940 | Bacteria | 1775 |
| 490 | Ga0207691_10873224 | 3300025940 | Bacteria | 754 |
| 491 | Ga0207711_10243081 | 3300025941 | Bacteria | 1651 |
| 492 | Ga0207711_10253640 | 3300025941 | Bacteria | 1616 |
| 493 | Ga0207711_10336820 | 3300025941 | Bacteria | 1396 |
| 494 | Ga0207711_10357472 | 3300025941 | Bacteria | 1353 |
| 495 | Ga0207711_11098577 | 3300025941 | Bacteria | 736 |
| 496 | Ga0207711_11225471 | 3300025941 | Bacteria | 692 |
| 497 | Ga0207689_10001602 | 3300025942 | Bacteria | 21425 |
| 498 | Ga0207689_10002140 | 3300025942 | Bacteria | 18578 |
| 499 | Ga0207689_10022610 | 3300025942 | Bacteria | 5283 |
| 500 | Ga0207689_10134055 | 3300025942 | Bacteria | 2039 |
| 501 | Ga0207689_10439543 | 3300025942 | Bacteria | 1090 |
| 502 | Ga0207661_10068140 | 3300025944 | Bacteria | 2897 |
| 503 | Ga0207661_10138200 | 3300025944 | Bacteria | 2095 |
| 504 | Ga0207679_10008635 | 3300025945 | Bacteria | 6496 |
| 505 | Ga0207679_10040313 | 3300025945 | Bacteria | 3342 |
| 506 | Ga0207679_10515944 | 3300025945 | Bacteria | 1068 |
| 507 | Ga0207679_10748737 | 3300025945 | Bacteria | 889 |
| 508 | Ga0207679_10925411 | 3300025945 | Bacteria | 798 |
| 509 | Ga0207679_11384647 | 3300025945 | Bacteria | 645 |
| 510 | Ga0207667_10018765 | 3300025949 | Bacteria | 7745 |
| 511 | Ga0207667_10047346 | 3300025949 | Bacteria | 4551 |
| 512 | Ga0207667_10611192 | 3300025949 | Bacteria | 1098 |
| 513 | Ga0207651_10223928 | 3300025960 | Bacteria | 1522 |
| 514 | Ga0207651_10606709 | 3300025960 | Bacteria | 957 |
| 515 | Ga0207651_11282564 | 3300025960 | Bacteria | 658 |
| 516 | Ga0207712_10164157 | 3300025961 | Bacteria | 1729 |
| 517 | Ga0207712_10269282 | 3300025961 | Bacteria | 1385 |
| 518 | Ga0207712_10288885 | 3300025961 | Bacteria | 1341 |
| 519 | Ga0207712_11853793 | 3300025961 | Bacteria | 540 |
| 520 | Ga0207712_11854197 | 3300025961 | Bacteria | 540 |
| 521 | Ga0207668_10039842 | 3300025972 | Bacteria | 3166 |
| 522 | Ga0207668_10212146 | 3300025972 | Bacteria | 1549 |
| 523 | Ga0207668_10571838 | 3300025972 | Bacteria | 981 |
| 524 | Ga0207668_10617292 | 3300025972 | Bacteria | 946 |
| 525 | Ga0207640_10010078 | 3300025981 | Bacteria | 5311 |
| 526 | Ga0207640_10057871 | 3300025981 | Bacteria | 2551 |
| 527 | Ga0207640_10061867 | 3300025981 | Bacteria | 2481 |
| 528 | Ga0207640_10173292 | 3300025981 | Bacteria | 1610 |
| 529 | Ga0207658_10013887 | 3300025986 | Bacteria | 5511 |
| 530 | Ga0207658_10039087 | 3300025986 | Bacteria | 3422 |
| 531 | Ga0207658_10154139 | 3300025986 | Bacteria | 1875 |
| 532 | Ga0207658_10354194 | 3300025986 | Bacteria | 1279 |
| 533 | Ga0207658_10389701 | 3300025986 | Bacteria | 1222 |
| 534 | Ga0207658_11127817 | 3300025986 | Bacteria | 717 |
| 535 | Ga0207677_10008875 | 3300026023 | Bacteria | 5635 |
| 536 | Ga0207677_10059362 | 3300026023 | Bacteria | 2638 |
| 537 | Ga0207677_10104206 | 3300026023 | Bacteria | 2096 |
| 538 | Ga0207677_10116499 | 3300026023 | Bacteria | 2000 |
| 539 | Ga0207703_10001278 | 3300026035 | Bacteria | 23343 |
| 540 | Ga0207703_10029403 | 3300026035 | Bacteria | 4335 |
| 541 | Ga0207703_10078750 | 3300026035 | Bacteria | 2739 |
| 542 | Ga0207639_10693086 | 3300026041 | Bacteria | 945 |
| 543 | Ga0207639_10697948 | 3300026041 | Bacteria | 941 |
| 544 | Ga0207678_10000473 | 3300026067 | Bacteria | 36408 |
| 545 | Ga0207678_10205504 | 3300026067 | Bacteria | 1685 |
| 546 | Ga0207678_10208716 | 3300026067 | Bacteria | 1671 |
| 547 | Ga0207678_10312398 | 3300026067 | Bacteria | 1351 |
| 548 | Ga0207678_10375123 | 3300026067 | Bacteria | 1229 |
| 549 | Ga0207678_10937314 | 3300026067 | Bacteria | 766 |
| 550 | Ga0207708_10000303 | 3300026075 | Bacteria | 38825 |
| 551 | Ga0207702_10000199 | 3300026078 | Bacteria | 70834 |
| 552 | Ga0207702_10769020 | 3300026078 | Bacteria | 951 |
| 553 | Ga0207702_10779771 | 3300026078 | Bacteria | 944 |
| 554 | Ga0207641_10069900 | 3300026088 | Bacteria | 3016 |
| 555 | Ga0207641_10152819 | 3300026088 | Bacteria | 2091 |
| 556 | Ga0207641_10709242 | 3300026088 | Bacteria | 991 |
| 557 | Ga0207641_10824435 | 3300026088 | Bacteria | 918 |
| 558 | Ga0207641_11636214 | 3300026088 | Bacteria | 646 |
| 559 | Ga0207648_10000989 | 3300026089 | Bacteria | 32078 |
| 560 | Ga0207648_10001210 | 3300026089 | Bacteria | 28894 |
| 561 | Ga0207648_10002261 | 3300026089 | Bacteria | 20835 |
| 562 | Ga0207648_10005878 | 3300026089 | Bacteria | 12276 |
| 563 | Ga0207648_10023717 | 3300026089 | Bacteria | 5490 |
| 564 | Ga0207648_10177063 | 3300026089 | Bacteria | 1886 |
| 565 | Ga0207648_10211059 | 3300026089 | Bacteria | 1724 |
| 566 | Ga0207648_11358921 | 3300026089 | Bacteria | 668 |
| 567 | Ga0207676_10001174 | 3300026095 | Bacteria | 19678 |
| 568 | Ga0207676_10444026 | 3300026095 | Bacteria | 1221 |
| 569 | Ga0207676_10838016 | 3300026095 | Bacteria | 899 |
| 570 | Ga0207676_11955823 | 3300026095 | Bacteria | 585 |
| 571 | Ga0207674_10002529 | 3300026116 | Bacteria | 23045 |
| 572 | Ga0207674_10002678 | 3300026116 | Bacteria | 22220 |
| 573 | Ga0207674_10223653 | 3300026116 | Bacteria | 1830 |
| 574 | Ga0207674_10346593 | 3300026116 | Bacteria | 1436 |
| 575 | Ga0207675_100007517 | 3300026118 | Bacteria | 10295 |
| 576 | Ga0207675_100012286 | 3300026118 | Bacteria | 8000 |
| 577 | Ga0207675_100053002 | 3300026118 | Bacteria | 3785 |
| 578 | Ga0207675_100490497 | 3300026118 | Bacteria | 1222 |
| 579 | Ga0207675_100785176 | 3300026118 | Bacteria | 965 |
| 580 | Ga0207683_10003640 | 3300026121 | Bacteria | 13410 |
| 581 | Ga0207683_10019235 | 3300026121 | Bacteria | 5831 |
| 582 | Ga0207683_10134817 | 3300026121 | Bacteria | 2222 |
| 583 | Ga0207683_10455791 | 3300026121 | Bacteria | 1179 |
| 584 | Ga0207683_10722411 | 3300026121 | Bacteria | 924 |
| 585 | Ga0207698_10011109 | 3300026142 | Bacteria | 5822 |
| 586 | Ga0207698_10047615 | 3300026142 | Bacteria | 3250 |
| 587 | Ga0207698_10054580 | 3300026142 | Bacteria | 3075 |
| 588 | Ga0207698_11001758 | 3300026142 | Bacteria | 846 |
| 589 | Ga0209389_1016990 | 3300027296 | Bacteria | 6583 |
| 590 | Ga0209371_1041869 | 3300027312 | Bacteria | 924 |
| 591 | Ga0209970_1000375 | 3300027614 | Bacteria | 7529 |
| 592 | Ga0209974_10018581 | 3300027876 | Bacteria | 2307 |
| 593 | Ga0209974_10026701 | 3300027876 | Bacteria | 1910 |
| 594 | Ga0207428_10128569 | 3300027907 | Bacteria | 1939 |
| 595 | Ga0268266_10063069 | 3300028379 | Bacteria | 3199 |
| 596 | Ga0268266_10159918 | 3300028379 | Bacteria | 2037 |
| 597 | Ga0268266_11460086 | 3300028379 | Bacteria | 659 |
| 598 | Ga0268265_10016585 | 3300028380 | Bacteria | 5064 |
| 599 | Ga0268265_10069764 | 3300028380 | Bacteria | 2731 |
| 600 | Ga0268265_10907858 | 3300028380 | Bacteria | 865 |
| 601 | Ga0268265_12089455 | 3300028380 | Bacteria | 573 |
| 602 | Ga0268264_10002240 | 3300028381 | Bacteria | 17151 |
| 603 | Ga0268264_10280643 | 3300028381 | Bacteria | 1560 |
| 604 | Ga0268264_10365844 | 3300028381 | Bacteria | 1377 |
| 605 | Ga0268264_10622522 | 3300028381 | Bacteria | 1066 |
| 606 | Ga0268264_10815731 | 3300028381 | Bacteria | 933 |
| 607 | Ga0268264_11228319 | 3300028381 | Bacteria | 759 |
| 608 | Ga0268264_12426213 | 3300028381 | Bacteria | 530 |
| 609 | Ga0265326_10044657 | 3300028558 | Bacteria | 1257 |
| 610 | Ga0307515_10015579 | 3300028794 | Bacteria | 13992 |
| 611 | Ga0307515_10034448 | 3300028794 | Bacteria | 8286 |
| 612 | Ga0307515_10319825 | 3300028794 | Bacteria | 1219 |
| 613 | Ga0265338_11029938 | 3300028800 | Bacteria | 556 |
| 614 | Ga0268256_1035716 | 3300030500 | Bacteria | 1153 |
| 615 | Ga0265330_10104424 | 3300031235 | Bacteria | 1212 |
| 616 | Ga0265332_10000003 | 3300031238 | Bacteria | 482849 |
| 617 | Ga0265332_10047978 | 3300031238 | Bacteria | 1837 |
| 618 | Ga0265328_10056596 | 3300031239 | Bacteria | 1439 |
| 619 | Ga0265331_10009862 | 3300031250 | Bacteria | 5323 |
| 620 | Ga0265331_10152723 | 3300031250 | Bacteria | 1048 |
| 621 | Ga0265331_10393606 | 3300031250 | Bacteria | 621 |
| 622 | Ga0265327_10000639 | 3300031251 | Bacteria | 56852 |
| 623 | Ga0265327_10281483 | 3300031251 | Bacteria | 735 |
| 624 | Ga0265327_10291881 | 3300031251 | Bacteria | 719 |
| 625 | Ga0265316_10299230 | 3300031344 | Bacteria | 1172 |
| 626 | Ga0307513_10886298 | 3300031456 | Bacteria | 599 |
| 627 | Ga0307408_100000008 | 3300031548 | Bacteria | 456355 |
| 628 | Ga0307408_100010784 | 3300031548 | Bacteria | 6030 |
| 629 | Ga0307408_100139882 | 3300031548 | Bacteria | 1899 |
| 630 | Ga0307408_100166112 | 3300031548 | Bacteria | 1758 |
| 631 | Ga0307408_100500722 | 3300031548 | Bacteria | 1063 |
| 632 | Ga0307408_100810674 | 3300031548 | Bacteria | 850 |
| 633 | Ga0307408_101869776 | 3300031548 | Bacteria | 575 |
| 634 | Ga0307514_10009729 | 3300031649 | Bacteria | 8065 |
| 635 | Ga0265314_10006842 | 3300031711 | Bacteria | 9991 |
| 636 | Ga0265314_10173303 | 3300031711 | Bacteria | 1300 |
| 637 | Ga0316578_10297624 | 3300031728 | Unclassified | 965 |
| 638 | Ga0316578_10734005 | 3300031728 | Bacteria | 574 |
| 639 | Ga0307516_10046181 | 3300031730 | Bacteria | 4299 |
| 640 | Ga0307516_10489805 | 3300031730 | Bacteria | 884 |
| 641 | Ga0307405_11081714 | 3300031731 | Bacteria | 688 |
| 642 | Ga0316577_10112505 | 3300031733 | Bacteria | 1528 |
| 643 | Ga0307413_10066854 | 3300031824 | Bacteria | 2245 |
| 644 | Ga0307413_11824667 | 3300031824 | Bacteria | 545 |
| 645 | Ga0307410_10233903 | 3300031852 | Bacteria | 1420 |
| 646 | Ga0307410_10463845 | 3300031852 | Unclassified | 1036 |
| 647 | Ga0307406_10283571 | 3300031901 | Bacteria | 1265 |
| 648 | Ga0307406_10813340 | 3300031901 | Bacteria | 789 |
| 649 | Ga0307407_10125131 | 3300031903 | Bacteria | 1636 |
| 650 | Ga0307412_10071470 | 3300031911 | Bacteria | 2369 |
| 651 | Ga0307412_11905926 | 3300031911 | Bacteria | 548 |
| 652 | Ga0307409_100832962 | 3300031995 | Bacteria | 932 |
| 653 | Ga0307416_100406253 | 3300032002 | Bacteria | 1401 |
| 654 | Ga0307416_100457337 | 3300032002 | Bacteria | 1331 |
| 655 | Ga0307414_10005408 | 3300032004 | Bacteria | 7032 |
| 656 | Ga0307414_10077234 | 3300032004 | Bacteria | 2423 |
| 657 | Ga0307411_10002403 | 3300032005 | Bacteria | 8259 |
| 658 | Ga0307411_10046584 | 3300032005 | Bacteria | 2797 |
| 659 | Ga0307411_10059237 | 3300032005 | Bacteria | 2538 |
| 660 | Ga0307411_10098512 | 3300032005 | Bacteria | 2061 |
| 661 | Ga0307411_11054269 | 3300032005 | Bacteria | 730 |
| 662 | Ga0307411_11527810 | 3300032005 | Bacteria | 614 |
| 663 | Ga0307415_100972357 | 3300032126 | Bacteria | 787 |
| 664 | Ga0307415_101463994 | 3300032126 | Bacteria | 652 |
| 665 | Ga0316583_10000505 | 3300032133 | Bacteria | 11690 |
| 666 | Ga0316583_10046522 | 3300032133 | Bacteria | 1531 |
| 667 | Ga0316585_10090382 | 3300032137 | Bacteria | 1000 |
| 668 | Ga0316580_10006497 | 3300032139 | Bacteria | 3456 |
| 669 | Ga0316593_10017449 | 3300032168 | Bacteria | 2189 |
| 670 | Ga0316593_10075960 | 3300032168 | Bacteria | 1167 |
| 671 | Ga0316593_10339833 | 3300032168 | Bacteria | 573 |
| 672 | Ga0307510_10010932 | 3300033180 | Bacteria | 10784 |
| 673 | Ga0316592_1009074 | 3300033524 | Bacteria | 1984 |
| 674 | Ga0316592_1011917 | 3300033524 | Bacteria | 1776 |
| 675 | Ga0316592_1066976 | 3300033524 | Bacteria | 809 |
| 676 | Ga0316588_1011413 | 3300033528 | Bacteria | 1895 |
| 677 | Ga0316588_1030504 | 3300033528 | Bacteria | 1264 |
| 678 | Ga0316588_1082867 | 3300033528 | Bacteria | 795 |
| 679 | Ga0316588_1159407 | 3300033528 | Bacteria | 581 |
| 680 | Ga0316596_1008073 | 3300033541 | Bacteria | 2500 |
| 681 | Ga0316596_1015318 | 3300033541 | Bacteria | 1909 |
| 682 | Ga0316596_1023247 | 3300033541 | Bacteria | 1587 |
| 683 | Ga0316596_1091781 | 3300033541 | Bacteria | 819 |
| 684 | Ga0373948_0013571 | 3300034817 | Bacteria | 1473 |
| 685 | Ga0373948_0177691 | 3300034817 | Bacteria | 545 |
| 686 | Ga0373950_0004828 | 3300034818 | Bacteria | 1989 |
| 687 | Ga0373959_0011480 | 3300034820 | Bacteria | 1566 |
| 688 | Ga0373940_0360028 | 3300035088 | Bacteria | 512 |
| 689 | Ga0373944_0056740 | 3300035089 | Bacteria | 1247 |
| 690 | Ga0373936_0044210 | 3300035113 | Bacteria | 1792 |
| 691 | Ga0373939_0000087 | 3300035114 | Bacteria | 29365 |
| 692 | Ga0373939_0046994 | 3300035114 | Bacteria | 1324 |
| 693 | Ga0373960_0001671 | 3300035121 | Bacteria | 4958 |
| 694 | Ga0373943_0006120 | 3300035170 | Bacteria | 5407 |
| 695 | Ga0373943_0329173 | 3300035170 | Bacteria | 872 |
| 696 | Ga0373955_0317179 | 3300035172 | Bacteria | 941 |
| 697 | Ga0373955_0832678 | 3300035172 | Bacteria | 567 |
| 698 | Ga0316574_0123163 | 3300035398 | Bacteria | 1665 |
| 699 | Ga0373931_0028446 | 3300035691 | Bacteria | 2862 |
| 700 | Ga0373935_0260506 | 3300035692 | Bacteria | 1216 |
| 701 | Ga0373935_0374048 | 3300035692 | Bacteria | 1019 |
| 702 | Ga0373935_1164537 | 3300035692 | Bacteria | 574 |
| 703 | Ga0373933_0155594 | 3300035724 | Bacteria | 1450 |
| 704 | Ga0373933_0230600 | 3300035724 | Bacteria | 1189 |
| 705 | Ga0373933_0895212 | 3300035724 | Bacteria | 584 |
| 706 | Ga0373933_0896887 | 3300035724 | Bacteria | 584 |
| 707 | Ga0373937_0264803 | 3300036401 | Bacteria | 1621 |
| 708 | Ga0373937_0637354 | 3300036401 | Bacteria | 1011 |
| 709 | Ga0265778_045304 | 3300036457 | Bacteria | 593 |
| 710 | Ga0316582_0011992 | 3300036647 | Bacteria | 4821 |
| 711 | Ga0316582_0139318 | 3300036647 | Bacteria | 1635 |
| 712 | Ga0316582_0256101 | 3300036647 | Bacteria | 1200 |
| 713 | Ga0316582_0802616 | 3300036647 | Bacteria | 645 |
| 714 | Ga0316582_0836391 | 3300036647 | Bacteria | 630 |
| 715 | Ga0316584_0191418 | 3300036712 | Bacteria | 1512 |
| 716 | Ga0316584_0313368 | 3300036712 | Bacteria | 1134 |
| 717 | Ga0373925_0003208 | 3300037068 | Bacteria | 12787 |
| 718 | Ga0373925_0018461 | 3300037068 | Bacteria | 5069 |
| 719 | Ga0373925_0158168 | 3300037068 | Bacteria | 1783 |
| 720 | Ga0373925_0158692 | 3300037068 | Bacteria | 1780 |
| 721 | Ga0395899_0001756 | 3300037312 | Bacteria | 17997 |
| 722 | Ga0395899_0222706 | 3300037312 | Bacteria | 1306 |
| 723 | Ga0395899_0983985 | 3300037312 | Bacteria | 510 |
| 724 | Ga0395900_0004771 | 3300037418 | Bacteria | 14288 |
| 725 | Ga0395900_0026850 | 3300037418 | Bacteria | 5892 |
| 726 | Ga0395900_0124112 | 3300037418 | Bacteria | 2648 |
| 727 | Ga0395900_0403427 | 3300037418 | Bacteria | 1331 |
| 728 | Ga0395900_1845541 | 3300037418 | Bacteria | 515 |
| 729 | Ga0395898_0009054 | 3300037466 | Bacteria | 10483 |
| 730 | Ga0395898_0010085 | 3300037466 | Bacteria | 9887 |
| 731 | Ga0395898_0517414 | 3300037466 | Bacteria | 1134 |
| 732 | Ga0395905_0000766 | 3300037471 | Bacteria | 42342 |
| 733 | Ga0395905_0001291 | 3300037471 | Bacteria | 30780 |
| 734 | Ga0395905_0004548 | 3300037471 | Bacteria | 14362 |
| 735 | Ga0395905_0052309 | 3300037471 | Bacteria | 3823 |
| 736 | Ga0395905_0059255 | 3300037471 | Bacteria | 3579 |
| 737 | Ga0395905_1032633 | 3300037471 | Bacteria | 725 |
| 738 | Ga0395905_1759121 | 3300037471 | Bacteria | 525 |
| 739 | Ga0395905_1783186 | 3300037471 | Bacteria | 521 |
| 740 | Ga0395901_0007642 | 3300038443 | Bacteria | 10911 |
| 741 | Ga0395901_0019770 | 3300038443 | Bacteria | 6886 |
| 742 | Ga0395901_0117284 | 3300038443 | Bacteria | 2797 |
| 743 | Ga0395901_0356645 | 3300038443 | Bacteria | 1509 |
| 744 | Ga0395901_0360516 | 3300038443 | Bacteria | 1499 |
| 745 | Ga0400489_45479 | 3300039093 | Bacteria | 11750 |
| 746 | Ga0436360_0744003 | 3300039438 | Bacteria | 1670 |
| 747 | Ga0436360_1242945 | 3300039438 | Bacteria | 594 |
| 748 | Ga0436361_0279516 | 3300039447 | Bacteria | 4326 |
| 749 | Ga0436361_0287447 | 3300039447 | Bacteria | 113524 |
| 750 | Ga0436361_0678114 | 3300039447 | Bacteria | 29523 |
| 751 | Ga0436361_0705591 | 3300039447 | Bacteria | 695 |
| 752 | Ga0436363_0441867 | 3300039450 | Bacteria | 976 |
| 753 | Ga0436363_0596578 | 3300039450 | Bacteria | 796 |
| 754 | Ga0436363_0815012 | 3300039450 | Bacteria | 632 |
| 755 | Ga0436363_1031840 | 3300039450 | Bacteria | 570 |
| 756 | Ga0436363_1464495 | 3300039450 | Bacteria | 1052 |
| 757 | Ga0436362_1021080 | 3300039453 | Bacteria | 588 |
| 758 | Ga0439466_0082200 | 3300041411 | Bacteria | 1015 |
| 759 | Ga0451787_030105 | 3300041441 | Bacteria | 544 |
| 760 | Ga0451787_668171 | 3300041441 | Bacteria | 1255 |
| 761 | Ga0451791_1086428 | 3300041451 | Bacteria | 603 |
| 762 | Ga0451802_0131515 | 3300041460 | Bacteria | 1008 |
| 763 | Ga0451807_2119567 | 3300041486 | Bacteria | 2241 |
| 764 | Ga0451837_0043705 | 3300041494 | Bacteria | 524 |
| 765 | Ga0451837_0666052 | 3300041494 | Bacteria | 583 |
| 766 | Ga0451837_1120325 | 3300041494 | Bacteria | 646 |
| 767 | Ga0451841_0206002 | 3300041498 | Bacteria | 566 |
| 768 | Ga0451845_0380090 | 3300041501 | Bacteria | 600 |
| 769 | Ga0451845_0830242 | 3300041501 | Bacteria | 599 |
| 770 | Ga0451855_0132408 | 3300041511 | Bacteria | 571 |
| 771 | Ga0451853_1463132 | 3300041512 | Bacteria | 868 |
| 772 | Ga0450911_000894 | 3300042115 | Bacteria | 8015 |
| 773 | Ga0450917_001378 | 3300042120 | Bacteria | 1739 |
| 774 | Ga0450888_005029 | 3300042126 | Bacteria | 1398 |
| 775 | Ga0450890_001901 | 3300042127 | Bacteria | 2959 |
| 776 | Ga0450890_004383 | 3300042127 | Bacteria | 1845 |
| 777 | Ga0450891_001710 | 3300042129 | Bacteria | 2256 |
| 778 | Ga0450892_001476 | 3300042130 | Bacteria | 2269 |
| 779 | Ga0450898_024633 | 3300042134 | Bacteria | 1076 |
| 780 | Ga0450902_006744 | 3300042137 | Bacteria | 1764 |
| 781 | Ga0450903_007325 | 3300042138 | Bacteria | 1817 |
| 782 | Ga0439459_0003448 | 3300042438 | Bacteria | 2511 |
| 783 | Ga0439459_0103217 | 3300042438 | Bacteria | 700 |
| 784 | Ga0439460_0264163 | 3300042461 | Bacteria | 597 |
| 785 | Ga0450893_0006035 | 3300042532 | Bacteria | 1952 |
| 786 | Ga0451577_0000114 | 3300042876 | Bacteria | 175957 |
| 787 | Ga0451577_0000794 | 3300042876 | Bacteria | 47578 |
| 788 | Ga0451577_0159878 | 3300042876 | Bacteria | 2028 |
| 789 | Ga0451577_0631408 | 3300042876 | Bacteria | 972 |
| 790 | Ga0451577_0687709 | 3300042876 | Bacteria | 927 |
| 791 | Ga0451577_0962168 | 3300042876 | Bacteria | 768 |
| 792 | Ga0466972_0084766 | 3300044658 | Bacteria | 1506 |
| 793 | Ga0453683_0180180 | 3300044673 | Bacteria | 1340 |
| 794 | Ga0453683_0629555 | 3300044673 | Bacteria | 701 |
| 795 | Ga0466965_0117317 | 3300044683 | Bacteria | 1372 |
| 796 | Ga0466965_0505387 | 3300044683 | Bacteria | 678 |
| 797 | Ga0466966_0103684 | 3300044684 | Bacteria | 1758 |
| 798 | Ga0466966_0198910 | 3300044684 | Bacteria | 1213 |
| 799 | Ga0466963_0145702 | 3300044694 | Bacteria | 1643 |
| 800 | Ga0466963_0371434 | 3300044694 | Bacteria | 1008 |
| 801 | Ga0453684_0001710 | 3300044712 | Bacteria | 59044 |
| 802 | Ga0453684_0068382 | 3300044712 | Bacteria | 4511 |
| 803 | Ga0453684_0326156 | 3300044712 | Bacteria | 1737 |
| 804 | Ga0453684_1349225 | 3300044712 | Bacteria | 742 |
| 805 | Ga0453684_2004800 | 3300044712 | Unclassified | 583 |
| 806 | Ga0453684_2054193 | 3300044712 | Bacteria | 574 |
| 807 | Ga0466968_0147808 | 3300044735 | Bacteria | 1078 |
| 808 | Ga0466968_0306713 | 3300044735 | Bacteria | 764 |
| 809 | Ga0466957_0216089 | 3300044842 | Bacteria | 1264 |
| 810 | Ga0466960_0089877 | 3300044901 | Bacteria | 1563 |
| 811 | Ga0466960_0746211 | 3300044901 | Bacteria | 590 |
| 812 | Ga0451576_0000099 | 3300045051 | Bacteria | 220245 |
| 813 | Ga0451576_0000335 | 3300045051 | Bacteria | 113806 |
| 814 | Ga0451576_0006435 | 3300045051 | Bacteria | 14400 |
| 815 | Ga0451576_0012757 | 3300045051 | Bacteria | 9431 |
| 816 | Ga0451576_0104147 | 3300045051 | Bacteria | 2951 |
| 817 | Ga0451576_0239277 | 3300045051 | Bacteria | 1896 |
| 818 | Ga0451576_0504691 | 3300045051 | Bacteria | 1271 |
| 819 | Ga0451576_1363199 | 3300045051 | Unclassified | 739 |
| 820 | Ga0466967_1369738 | 3300045976 | Bacteria | 705 |
| 821 | Ga0495603_0321590 | 3300046455 | Bacteria | 888 |
| 822 | Ga0495590_0001778 | 3300046457 | Bacteria | 9154 |
| 823 | Ga0495590_0059944 | 3300046457 | Bacteria | 1332 |
| 824 | Ga0495590_0096535 | 3300046457 | Bacteria | 1048 |
| 825 | Ga0495629_0256849 | 3300046459 | Bacteria | 1201 |
| 826 | Ga0495629_0483610 | 3300046459 | Bacteria | 836 |
| 827 | Ga0495653_0111372 | 3300046463 | Bacteria | 1966 |
| 828 | Ga0495650_0044940 | 3300046471 | Bacteria | 1863 |
| 829 | Ga0495662_0048356 | 3300046476 | Bacteria | 2053 |
| 830 | Ga0495664_0007416 | 3300046477 | Bacteria | 6089 |
| 831 | Ga0495664_0060716 | 3300046477 | Bacteria | 2251 |
| 832 | Ga0495594_0586819 | 3300046499 | Bacteria | 632 |
| 833 | Ga0495596_0056108 | 3300046500 | Bacteria | 1539 |
| 834 | Ga0495607_0000128 | 3300046501 | Bacteria | 80585 |
| 835 | Ga0495606_0005133 | 3300046507 | Bacteria | 12701 |
| 836 | Ga0495606_0007947 | 3300046507 | Bacteria | 9343 |
| 837 | Ga0495608_0283582 | 3300046511 | Bacteria | 1028 |
| 838 | Ga0495608_0737903 | 3300046511 | Bacteria | 584 |
| 839 | Ga0495618_0144220 | 3300046514 | Bacteria | 1523 |
| 840 | Ga0495620_0060161 | 3300046515 | Bacteria | 1584 |
| 841 | Ga0495628_0056722 | 3300046516 | Bacteria | 3082 |
| 842 | Ga0495628_0367036 | 3300046516 | Bacteria | 1056 |
| 843 | Ga0495632_0177607 | 3300046519 | Bacteria | 976 |
| 844 | Ga0495643_0000363 | 3300046522 | Bacteria | 61710 |
| 845 | Ga0495644_0341347 | 3300046523 | Bacteria | 589 |
| 846 | Ga0495652_0117812 | 3300046529 | Bacteria | 2123 |
| 847 | Ga0495654_0020792 | 3300046530 | Bacteria | 3418 |
| 848 | Ga0495654_0033445 | 3300046530 | Bacteria | 2602 |
| 849 | Ga0495654_0265227 | 3300046530 | Bacteria | 711 |
| 850 | Ga0495665_0078186 | 3300046531 | Bacteria | 1740 |
| 851 | Ga0495586_0261995 | 3300046535 | Bacteria | 987 |
| 852 | Ga0495587_0148275 | 3300046536 | Bacteria | 1337 |
| 853 | Ga0495597_0006061 | 3300046542 | Bacteria | 6294 |
| 854 | Ga0495645_0019385 | 3300046543 | Bacteria | 4897 |
| 855 | Ga0495645_0079259 | 3300046543 | Bacteria | 2359 |
| 856 | Ga0495645_0114708 | 3300046543 | Bacteria | 1903 |
| 857 | Ga0495645_0424570 | 3300046543 | Bacteria | 843 |
| 858 | Ga0495622_0157320 | 3300046557 | Bacteria | 1026 |
| 859 | Ga0495667_0635068 | 3300046559 | Bacteria | 664 |
| 860 | Ga0495611_0472353 | 3300046648 | Bacteria | 571 |
| 861 | Ga0495625_0008095 | 3300046660 | Bacteria | 9014 |
| 862 | Ga0495625_0181815 | 3300046660 | Bacteria | 1397 |
| 863 | Ga0495635_0322791 | 3300046663 | Bacteria | 1033 |
| 864 | Ga0495635_0345849 | 3300046663 | Bacteria | 992 |
| 865 | Ga0495588_0320519 | 3300046674 | Bacteria | 815 |
| 866 | Ga0495588_0339750 | 3300046674 | Bacteria | 789 |
| 867 | Ga0495657_0038484 | 3300046675 | Bacteria | 3291 |
| 868 | Ga0495599_0217271 | 3300046678 | Bacteria | 1171 |
| 869 | Ga0495599_0707098 | 3300046678 | Bacteria | 580 |
| 870 | Ga0495623_0057100 | 3300046679 | Bacteria | 2456 |
| 871 | Ga0495646_0076728 | 3300046680 | Bacteria | 1956 |
| 872 | Ga0495646_0169371 | 3300046680 | Bacteria | 1204 |
| 873 | Ga0495658_0158634 | 3300046683 | Bacteria | 1394 |
| 874 | Ga0495658_0594809 | 3300046683 | Bacteria | 709 |
| 875 | Ga0495624_0065050 | 3300046690 | Bacteria | 2278 |
| 876 | Ga0495624_0235589 | 3300046690 | Bacteria | 1108 |
| 877 | Ga0495671_0080454 | 3300046692 | Bacteria | 1596 |
| 878 | Ga0495649_0005791 | 3300046694 | Bacteria | 7787 |
| 879 | Ga0495649_0040011 | 3300046694 | Bacteria | 2569 |
| 880 | Ga0495649_0040733 | 3300046694 | Bacteria | 2542 |
| 881 | Ga0495649_0249808 | 3300046694 | Bacteria | 911 |
| 882 | Ga0495600_0156726 | 3300046809 | Bacteria | 1473 |
| 883 | Ga0495660_0183393 | 3300046810 | Bacteria | 1011 |
| 884 | Ga0495604_0118990 | 3300047317 | Bacteria | 1914 |
| 885 | Ga0495674_0034424 | 3300047319 | Bacteria | 4581 |
| 886 | Ga0495674_0794830 | 3300047319 | Bacteria | 736 |
| 887 | Ga0495672_0000330 | 3300047320 | Bacteria | 62176 |
| 888 | Ga0495680_0202234 | 3300047322 | Bacteria | 1424 |
| 889 | Ga0495680_0628364 | 3300047322 | Bacteria | 716 |
| 890 | Ga0495680_0927895 | 3300047322 | Bacteria | 561 |
| 891 | Ga0495683_0001439 | 3300047323 | Bacteria | 15648 |
| 892 | Ga0495683_0040580 | 3300047323 | Bacteria | 2351 |
| 893 | Ga0495683_0175268 | 3300047323 | Bacteria | 983 |
| 894 | Ga0495687_000011 | 3300047443 | Bacteria | 397225 |
| 895 | Ga0495687_039572 | 3300047443 | Bacteria | 2085 |
| 896 | Ga0495687_130333 | 3300047443 | Bacteria | 891 |
| 897 | Ga0495675_0191475 | 3300047444 | Bacteria | 1248 |
| 898 | Ga0495675_0792198 | 3300047444 | Bacteria | 525 |
| 899 | Ga0495673_0189758 | 3300047469 | Bacteria | 774 |
| 900 | Ga0495684_0135088 | 3300047471 | Bacteria | 1851 |
| 901 | Ga0495684_0472858 | 3300047471 | Bacteria | 867 |
| 902 | Ga0495686_0011473 | 3300047472 | Bacteria | 6239 |
| 903 | Ga0495686_0157648 | 3300047472 | Bacteria | 1328 |
| 904 | Ga0495593_0056524 | 3300047673 | Bacteria | 2062 |
| 905 | Ga0495593_0135404 | 3300047673 | Bacteria | 1249 |
| 906 | Ga0495593_0141152 | 3300047673 | Bacteria | 1220 |
| 907 | Ga0495602_0084270 | 3300048088 | Bacteria | 2660 |
| 908 | Ga0495602_0178179 | 3300048088 | Bacteria | 1642 |
| 909 | Ga0495626_0221612 | 3300048091 | Bacteria | 768 |
| 910 | Ga0496100_0028622 | 3300048903 | Bacteria | 3438 |
| 911 | Ga0496100_0321480 | 3300048903 | Bacteria | 1162 |
| 912 | Ga0496100_1124069 | 3300048903 | Bacteria | 619 |
| 913 | Ga0496100_1366102 | 3300048903 | Bacteria | 559 |
| 914 | Ga0496101_0014863 | 3300048904 | Bacteria | 5239 |
| 915 | Ga0496101_0179631 | 3300048904 | Bacteria | 1629 |
| 916 | Ga0496101_0402812 | 3300048904 | Bacteria | 1077 |
| 917 | Ga0496102_0010175 | 3300048905 | Bacteria | 8088 |
| 918 | Ga0496102_0095352 | 3300048905 | Bacteria | 2757 |
| 919 | Ga0496102_0254979 | 3300048905 | Bacteria | 1654 |
| 920 | Ga0496103_0009526 | 3300048906 | Bacteria | 5750 |
| 921 | Ga0496103_0097531 | 3300048906 | Bacteria | 1858 |
| 922 | Ga0496104_0228353 | 3300048907 | Bacteria | 1773 |
| 923 | Ga0496104_0501831 | 3300048907 | Bacteria | 1124 |
| 924 | Ga0496104_0766574 | 3300048907 | Bacteria | 871 |
| 925 | Ga0496105_0090234 | 3300048908 | Bacteria | 2531 |
| 926 | Ga0496105_0249069 | 3300048908 | Bacteria | 1440 |
| 927 | Ga0496105_0261635 | 3300048908 | Bacteria | 1399 |
| 928 | Ga0496105_0626065 | 3300048908 | Bacteria | 833 |
| 929 | Ga0496106_0002491 | 3300048909 | Bacteria | 13709 |
| 930 | Ga0496106_0250470 | 3300048909 | Bacteria | 1416 |
| 931 | Ga0496106_1480719 | 3300048909 | Bacteria | 523 |
| 932 | Ga0496107_0015993 | 3300048910 | Bacteria | 5264 |
| 933 | Ga0496107_0917383 | 3300048910 | Bacteria | 638 |
| 934 | Ga0496108_0192950 | 3300048911 | Bacteria | 1766 |
| 935 | Ga0496108_0472425 | 3300048911 | Bacteria | 1096 |
| 936 | Ga0496108_0876541 | 3300048911 | Bacteria | 771 |
| 937 | Ga0496109_0082395 | 3300048912 | Bacteria | 2965 |
| 938 | Ga0496109_0110266 | 3300048912 | Bacteria | 2559 |
| 939 | Ga0496109_0171369 | 3300048912 | Bacteria | 2036 |
| 940 | Ga0496109_1033871 | 3300048912 | Bacteria | 759 |
| 941 | Ga0496109_1809612 | 3300048912 | Bacteria | 544 |
| 942 | Ga0496110_0003972 | 3300048913 | Bacteria | 11386 |
| 943 | Ga0496111_0132611 | 3300048914 | Bacteria | 1844 |
| 944 | Ga0496111_0152600 | 3300048914 | Bacteria | 1714 |
| 945 | Ga0496112_0019328 | 3300048915 | Bacteria | 6428 |
| 946 | Ga0496112_0982063 | 3300048915 | Bacteria | 765 |
| 947 | Ga0496112_1632226 | 3300048915 | Bacteria | 558 |
| 948 | Ga0496113_0132535 | 3300048916 | Bacteria | 1956 |
| 949 | Ga0496113_0453903 | 3300048916 | Bacteria | 1030 |
| 950 | Ga0496114_0038689 | 3300048917 | Bacteria | 3947 |
| 951 | Ga0496114_0738500 | 3300048917 | Bacteria | 861 |
| 952 | Ga0496114_0739676 | 3300048917 | Bacteria | 860 |
| 953 | Ga0496115_0604957 | 3300048918 | Bacteria | 871 |
| 954 | Ga0496115_1193498 | 3300048918 | Bacteria | 572 |
| 955 | Ga0496116_0009193 | 3300048919 | Bacteria | 8459 |
| 956 | Ga0496117_0026874 | 3300048920 | Bacteria | 4494 |
| 957 | Ga0496117_0507096 | 3300048920 | Bacteria | 583 |
| 958 | Ga0496118_0041832 | 3300048921 | Bacteria | 3622 |
| 959 | Ga0496119_0026780 | 3300048922 | Bacteria | 3986 |
| 960 | Ga0496120_0224537 | 3300048923 | Bacteria | 895 |
| 961 | Ga0496121_0019078 | 3300048924 | Bacteria | 6879 |
| 962 | Ga0496121_0039345 | 3300048924 | Bacteria | 4170 |
| 963 | Ga0496122_0004945 | 3300048925 | Bacteria | 16161 |
| 964 | Ga0496122_0184625 | 3300048925 | Bacteria | 1239 |
| 965 | Ga0496123_0039281 | 3300048926 | Bacteria | 3312 |
| 966 | Ga0496124_0092106 | 3300048927 | Bacteria | 2469 |
| 967 | Ga0496125_0018804 | 3300048928 | Bacteria | 6545 |
| 968 | Ga0496125_0022128 | 3300048928 | Bacteria | 5909 |
| 969 | Ga0496125_0076660 | 3300048928 | Bacteria | 2580 |
| 970 | Ga0496125_0180485 | 3300048928 | Bacteria | 1407 |
| 971 | Ga0496126_0117688 | 3300048929 | Bacteria | 2308 |
| 972 | Ga0496126_0217715 | 3300048929 | Bacteria | 1606 |
| 973 | Ga0496126_0241750 | 3300048929 | Bacteria | 1508 |
| 974 | Ga0501309_041843 | 3300049129 | Bacteria | 702 |
| 975 | Ga0501304_034299 | 3300049160 | Bacteria | 550 |
| 976 | Ga0501305_018980 | 3300049161 | Bacteria | 1000 |
| 977 | Ga0501293_019775 | 3300049516 | Bacteria | 652 |
| 978 | Ga0501294_019481 | 3300049517 | Bacteria | 726 |
| 979 | Ga0501295_068977 | 3300049518 | Bacteria | 787 |
| 980 | Ga0501296_058137 | 3300049519 | Bacteria | 580 |
| 981 | Ga0501298_015382 | 3300049521 | Bacteria | 1377 |
| 982 | Ga0501298_085417 | 3300049521 | Bacteria | 700 |
| 983 | Ga0501300_001083 | 3300049523 | Bacteria | 4132 |
| 984 | Ga0501300_057153 | 3300049523 | Unclassified | 612 |
| 985 | Ga0501301_004146 | 3300049524 | Bacteria | 1019 |
| 986 | Ga0501311_052383 | 3300049527 | Bacteria | 642 |
| 987 | Ga0501314_004795 | 3300049530 | Bacteria | 1134 |
| 988 | Ga0501315_024162 | 3300049531 | Bacteria | 839 |
| 989 | Ga0501032_0125834 | 3300049569 | Bacteria | 1693 |
| 990 | Ga0501034_0001279 | 3300049571 | Bacteria | 34010 |
| 991 | Ga0501034_0048885 | 3300049571 | Bacteria | 4268 |
| 992 | Ga0501034_0057761 | 3300049571 | Bacteria | 3900 |
| 993 | Ga0501034_0354738 | 3300049571 | Bacteria | 1394 |
| 994 | Ga0501036_0227629 | 3300049572 | Bacteria | 1565 |
| 995 | Ga0501036_1719121 | 3300049572 | Bacteria | 505 |
| 996 | Ga0501038_0201101 | 3300049574 | Bacteria | 1599 |
| 997 | Ga0501039_0111979 | 3300049575 | Bacteria | 2134 |
| 998 | Ga0501039_0407647 | 3300049575 | Bacteria | 1068 |
| 999 | Ga0501041_0247270 | 3300049577 | Bacteria | 1121 |
| 1000 | Ga0501043_0174669 | 3300049579 | Bacteria | 1675 |
| 1001 | Ga0501046_0174512 | 3300049580 | Bacteria | 1611 |
| 1002 | Ga0501046_0646528 | 3300049580 | Bacteria | 748 |
| 1003 | Ga0501046_1061848 | 3300049580 | Bacteria | 560 |
| 1004 | Ga0501047_0062974 | 3300049581 | Bacteria | 3578 |
| 1005 | Ga0501048_0645028 | 3300049582 | Bacteria | 760 |
| 1006 | Ga0501067_0300921 | 3300049583 | Bacteria | 893 |
| 1007 | Ga0501068_0008164 | 3300049584 | Bacteria | 5816 |
| 1008 | Ga0501070_0014948 | 3300049586 | Bacteria | 6530 |
| 1009 | Ga0501070_0036866 | 3300049586 | Bacteria | 4083 |
| 1010 | Ga0501072_0016016 | 3300049588 | Bacteria | 5749 |
| 1011 | Ga0501072_0026626 | 3300049588 | Bacteria | 4509 |
| 1012 | Ga0501073_0005603 | 3300049589 | Bacteria | 9397 |
| 1013 | Ga0501073_0042689 | 3300049589 | Bacteria | 3199 |
| 1014 | Ga0501074_0054209 | 3300049590 | Bacteria | 2892 |
| 1015 | Ga0501074_0130885 | 3300049590 | Bacteria | 1795 |
| 1016 | Ga0501201_000859 | 3300049651 | Bacteria | 2848 |
| 1017 | Ga0501201_036779 | 3300049651 | Bacteria | 576 |
| 1018 | Ga0501202_038852 | 3300049652 | Bacteria | 1021 |
| 1019 | Ga0501206_052465 | 3300049653 | Bacteria | 652 |
| 1020 | Ga0501207_081301 | 3300049654 | Bacteria | 624 |
| 1021 | Ga0501211_000781 | 3300049658 | Bacteria | 3272 |
| 1022 | Ga0501222_007027 | 3300049662 | Bacteria | 1507 |
| 1023 | Ga0501227_016101 | 3300049665 | Bacteria | 1677 |
| 1024 | Ga0501227_120054 | 3300049665 | Bacteria | 709 |
| 1025 | Ga0501233_095703 | 3300049668 | Bacteria | 780 |
| 1026 | Ga0501235_005194 | 3300049669 | Bacteria | 2831 |
| 1027 | Ga0501257_241715 | 3300049686 | Bacteria | 532 |
| 1028 | Ga0501258_031822 | 3300049687 | Bacteria | 670 |
| 1029 | Ga0501261_026506 | 3300049690 | Bacteria | 858 |
| 1030 | Ga0501221_002565 | 3300049704 | Bacteria | 2994 |
| 1031 | Ga0501225_0007329 | 3300049705 | Bacteria | 3197 |
| 1032 | Ga0501225_0151083 | 3300049705 | Bacteria | 708 |
| 1033 | Ga0501229_003048 | 3300049706 | Bacteria | 1993 |
| 1034 | Ga0501079_1403461 | 3300049741 | Bacteria | 549 |
| 1035 | Ga0501080_0005258 | 3300049742 | Bacteria | 11527 |
| 1036 | Ga0501080_0069393 | 3300049742 | Bacteria | 3278 |
| 1037 | Ga0501080_0516962 | 3300049742 | Bacteria | 1065 |
| 1038 | Ga0501080_1837926 | 3300049742 | Bacteria | 508 |
| 1039 | Ga0501083_0178203 | 3300049744 | Bacteria | 1388 |
| 1040 | Ga0501262_015777 | 3300049759 | Bacteria | 994 |
| 1041 | Ga0501262_075898 | 3300049759 | Bacteria | 556 |
| 1042 | Ga0501263_015469 | 3300049760 | Bacteria | 986 |
| 1043 | Ga0501265_001438 | 3300049762 | Bacteria | 2696 |
| 1044 | Ga0501265_061022 | 3300049762 | Bacteria | 616 |
| 1045 | Ga0501267_005593 | 3300049764 | Bacteria | 1192 |
| 1046 | Ga0501269_002880 | 3300049766 | Bacteria | 2097 |
| 1047 | Ga0501270_054354 | 3300049767 | Bacteria | 734 |
| 1048 | Ga0501272_011539 | 3300049769 | Bacteria | 996 |
| 1049 | Ga0501035_0040039 | 3300049822 | Bacteria | 4237 |
| 1050 | Ga0501044_0085617 | 3300049823 | Bacteria | 3185 |
| 1051 | Ga0501044_0466820 | 3300049823 | Bacteria | 1167 |
| 1052 | Ga0501045_0132772 | 3300049824 | Bacteria | 1851 |
| 1053 | Ga0501045_1314721 | 3300049824 | Bacteria | 526 |
| 1054 | nmdc:mga0k408_135732_c1 | 3300050493 | Bacteria | 1462 |
| 1055 | nmdc:mga0k408_4965_c1 | 3300050493 | Bacteria | 7050 |
| 1056 | nmdc:mga0k408_53793_c1 | 3300050493 | Bacteria | 2333 |
| 1057 | nmdc:mga0k408_560699_c1 | 3300050493 | Bacteria | 675 |
| 1058 | nmdc:mga0k408_75037_c1 | 3300050493 | Bacteria | 1976 |
| 1059 | nmdc:mga06z11_567089_c1 | 3300050494 | Bacteria | 690 |
| 1060 | nmdc:mga07m45_11043_c1 | 3300050496 | Bacteria | 4735 |
| 1061 | nmdc:mga07m45_13378_c2 | 3300050496 | Bacteria | 3567 |
| 1062 | nmdc:mga07m45_5516_c1 | 3300050496 | Bacteria | 6304 |
| 1063 | nmdc:mga07m45_68942_c1 | 3300050496 | Bacteria | 1248 |
| 1064 | nmdc:mga05p37_1031235_c1 | 3300050507 | Bacteria | 870 |
| 1065 | nmdc:mga05p37_17657_c1 | 3300050507 | Bacteria | 8610 |
| 1066 | nmdc:mga05p37_2063341_c1 | 3300050507 | Unclassified | 536 |
| 1067 | nmdc:mga05p37_316962_c1 | 3300050507 | Bacteria | 1847 |
| 1068 | nmdc:mga05p37_38293_c1 | 3300050507 | Bacteria | 5882 |
| 1069 | nmdc:mga05p37_3859_c1 | 3300050507 | Bacteria | 17541 |
| 1070 | nmdc:mga05p37_809731_c1 | 3300050507 | Bacteria | 1023 |
| 1071 | nmdc:mga05p37_90325_c1 | 3300050507 | Bacteria | 3775 |
| 1072 | nmdc:mga09592_227045_c1 | 3300050508 | Bacteria | 1618 |
| 1073 | nmdc:mga09592_448440_c1 | 3300050508 | Unclassified | 1113 |
| 1074 | nmdc:mga09592_547183_c1 | 3300050508 | Bacteria | 994 |
| 1075 | nmdc:mga09592_9225_c1 | 3300050508 | Bacteria | 8023 |
| 1076 | nmdc:mga0qj67_1374977_c1 | 3300050509 | Bacteria | 545 |
| 1077 | nmdc:mga0qj67_519531_c1 | 3300050509 | Unclassified | 956 |
| 1078 | nmdc:mga06r32_33320_c1 | 3300050510 | Bacteria | 4852 |
| 1079 | nmdc:mga08y16_1724283_c1 | 3300050511 | Bacteria | 581 |
| 1080 | nmdc:mga08y16_44605_c1 | 3300050511 | Bacteria | 4645 |
| 1081 | nmdc:mga0n895_24727_c1 | 3300050512 | Bacteria | 5663 |
| 1082 | nmdc:mga0n895_880590_c1 | 3300050512 | Bacteria | 882 |
| 1083 | nmdc:mga0n895_912803_c1 | 3300050512 | Bacteria | 863 |
| 1084 | nmdc:mga0rr50_1085303_c1 | 3300050513 | Bacteria | 681 |
| 1085 | nmdc:mga0rr50_152126_c1 | 3300050513 | Bacteria | 1871 |
| 1086 | nmdc:mga08x19_46492_c1 | 3300050514 | Bacteria | 2776 |
| 1087 | nmdc:mga0a205_31268_c1 | 3300050515 | Bacteria | 5100 |
| 1088 | nmdc:mga0a205_566832_c1 | 3300050515 | Bacteria | 990 |
| 1089 | nmdc:mga0sz30_57096_c2 | 3300050516 | Bacteria | 937 |
| 1090 | Ga0495612_0026745 | 3300053078 | Bacteria | 2318 |
| 1091 | Ga0500578_0043481 | 3300053086 | Bacteria | 2884 |
| 1092 | Ga0500607_084959 | 3300053121 | Bacteria | 1606 |
| 1093 | Ga0500636_0536665 | 3300053177 | Bacteria | 509 |
| 1094 | Ga0500645_003647 | 3300053730 | Bacteria | 6157 |
| 1095 | Ga0500587_010883 | 3300053739 | Bacteria | 1152 |
| 1096 | Ga0501084_0081891 | 3300054114 | Bacteria | 2708 |
| 1097 | Ga0501084_0421750 | 3300054114 | Bacteria | 1128 |
| 1098 | Ga0587125_016601 | 3300059607 | Bacteria | 828 |
| 1099 | Ga0587111_0280390 | 3300060346 | Bacteria | 503 |
| 1100 | Ga0501082_0112905 | 3300060353 | Bacteria | 2353 |
| 1101 | Ga0501082_0375736 | 3300060353 | Bacteria | 1240 |
| 1102 | Ga0501082_0381022 | 3300060353 | Bacteria | 1231 |
| 1103 | Ga0501082_0735769 | 3300060353 | Bacteria | 863 |
| 1104 | Ga0501082_1557610 | 3300060353 | Bacteria | 577 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0962168 | Ga0451577_0962168_448_750 | 100 |
| 2 | 3300037418 | Ga0395900_1845541 | Ga0395900_1845541_111_449 | 105 |
| 3 | 3300038443 | Ga0395901_0356645 | Ga0395901_0356645_520_858 | 105 |
| 4 | 3300042134 | Ga0450898_024633 | Ga0450898_024633_243_566 | 107 |
| 5 | iso_pu_bacteria | 2643221544 | 2643742746 | 108 |
| 6 | iso_pu_bacteria | 2643221585 | 2643936267 | 108 |
| 7 | iso_pu_bacteria | 2643221639 | 2644217638 | 108 |
| 8 | iso_pu_bacteria | 2643221646 | 2644258627 | 108 |
| 9 | iso_pu_bacteria | 2643221654 | 2644304956 | 108 |
| 10 | iso_pu_bacteria | 2643221656 | 2644316912 | 108 |
| 11 | iso_pu_bacteria | 2738541337 | 2739056673 | 108 |
| 12 | iso_pu_bacteria | 2881927736 | 2881931439 | 108 |
| 13 | iso_pu_bacteria | 2886848708 | 2886853515 | 108 |
| 14 | iso_pu_bacteria | 2919704043 | 2919705496 | 108 |
| 15 | 3300060353 | Ga0501082_1557610 | Ga0501082_1557610_66_398 | 110 |
| 16 | 3300001989 | JGI24739J22299_10025768 | JGI24739J22299_100257683 | 112 |
| 17 | 3300001990 | JGI24737J22298_10096788 | JGI24737J22298_100967881 | 112 |
| 18 | 3300002067 | JGI24735J21928_10011789 | JGI24735J21928_100117892 | 112 |
| 19 | 3300002077 | JGI24744J21845_10006067 | JGI24744J21845_100060672 | 112 |
| 20 | 3300002705 | JGI25156J39149_1001412 | JGI25156J39149_100141210 | 112 |
| 21 | 3300002738 | JGI25154J39366_1002457 | JGI25154J39366_10024576 | 112 |
| 22 | 3300002741 | JGI25157J39369_1000423 | JGI25157J39369_100042330 | 112 |
| 23 | 3300002772 | JGI25164J39214_1003965 | JGI25164J39214_10039652 | 112 |
| 24 | 3300003162 | Ga0006778J45830_1096314 | Ga0006778J45830_10963141 | 112 |
| 25 | 3300003308 | Ga0006777J48905_1063803 | Ga0006777J48905_10638031 | 112 |
| 26 | 3300003322 | rootL2_10006260 | rootL2_100062609 | 112 |
| 27 | 3300003354 | JGI25160J50197_1091470 | JGI25160J50197_10914701 | 112 |
| 28 | 3300003752 | Ga0055539_1000874 | Ga0055539_10008747 | 112 |
| 29 | 3300003752 | Ga0055539_1001489 | Ga0055539_10014892 | 112 |
| 30 | 3300003756 | Ga0055533_1000006 | Ga0055533_1000006138 | 112 |
| 31 | 3300003761 | Ga0055535_1010743 | Ga0055535_10107432 | 112 |
| 32 | 3300003775 | Ga0055524_1003908 | Ga0055524_10039085 | 112 |
| 33 | 3300003775 | Ga0055524_1011613 | Ga0055524_10116133 | 112 |
| 34 | 3300003791 | Ga0055530_10043228 | Ga0055530_100432283 | 112 |
| 35 | 3300003792 | Ga0055540_1033015 | Ga0055540_10330151 | 112 |
| 36 | 3300003794 | Ga0055531_10000313 | Ga0055531_1000031332 | 112 |
| 37 | 3300003794 | Ga0055531_10004052 | Ga0055531_100040526 | 112 |
| 38 | 3300003794 | Ga0055531_10009008 | Ga0055531_100090085 | 112 |
| 39 | 3300004800 | Ga0058861_11642297 | Ga0058861_116422971 | 112 |
| 40 | 3300005262 | Ga0065165_1000184 | Ga0065165_100018464 | 112 |
| 41 | 3300005289 | Ga0065704_10169711 | Ga0065704_101697112 | 112 |
| 42 | 3300005289 | Ga0065704_10475728 | Ga0065704_104757281 | 112 |
| 43 | 3300005293 | Ga0065715_10304726 | Ga0065715_103047262 | 112 |
| 44 | 3300005293 | Ga0065715_10423716 | Ga0065715_104237162 | 112 |
| 45 | 3300005293 | Ga0065715_10657363 | Ga0065715_106573632 | 112 |
| 46 | 3300005295 | Ga0065707_10002367 | Ga0065707_100023674 | 112 |
| 47 | 3300005295 | Ga0065707_11073738 | Ga0065707_110737381 | 112 |
| 48 | 3300005327 | Ga0070658_10045045 | Ga0070658_100450454 | 112 |
| 49 | 3300005327 | Ga0070658_10231457 | Ga0070658_102314572 | 112 |
| 50 | 3300005327 | Ga0070658_10453221 | Ga0070658_104532212 | 112 |
| 51 | 3300005328 | Ga0070676_10005714 | Ga0070676_100057143 | 112 |
| 52 | 3300005328 | Ga0070676_10107903 | Ga0070676_101079033 | 112 |
| 53 | 3300005328 | Ga0070676_10340037 | Ga0070676_103400372 | 112 |
| 54 | 3300005328 | Ga0070676_10786420 | Ga0070676_107864201 | 112 |
| 55 | 3300005329 | Ga0070683_100239506 | Ga0070683_1002395062 | 112 |
| 56 | 3300005329 | Ga0070683_100674772 | Ga0070683_1006747722 | 112 |
| 57 | 3300005330 | Ga0070690_100001971 | Ga0070690_1000019716 | 112 |
| 58 | 3300005330 | Ga0070690_100018981 | Ga0070690_1000189813 | 112 |
| 59 | 3300005331 | Ga0070670_100006292 | Ga0070670_1000062929 | 112 |
| 60 | 3300005331 | Ga0070670_100025014 | Ga0070670_1000250145 | 112 |
| 61 | 3300005331 | Ga0070670_100227875 | Ga0070670_1002278753 | 112 |
| 62 | 3300005331 | Ga0070670_100517913 | Ga0070670_1005179131 | 112 |
| 63 | 3300005331 | Ga0070670_100560409 | Ga0070670_1005604092 | 112 |
| 64 | 3300005331 | Ga0070670_101343585 | Ga0070670_1013435852 | 112 |
| 65 | 3300005333 | Ga0070677_10087336 | Ga0070677_100873361 | 112 |
| 66 | 3300005333 | Ga0070677_10251214 | Ga0070677_102512141 | 112 |
| 67 | 3300005334 | Ga0068869_100002581 | Ga0068869_1000025814 | 112 |
| 68 | 3300005334 | Ga0068869_100040418 | Ga0068869_1000404183 | 112 |
| 69 | 3300005334 | Ga0068869_100049953 | Ga0068869_1000499532 | 112 |
| 70 | 3300005334 | Ga0068869_100074593 | Ga0068869_1000745932 | 112 |
| 71 | 3300005334 | Ga0068869_100890308 | Ga0068869_1008903082 | 112 |
| 72 | 3300005334 | Ga0068869_101311655 | Ga0068869_1013116551 | 112 |
| 73 | 3300005337 | Ga0070682_100061679 | Ga0070682_1000616792 | 112 |
| 74 | 3300005338 | Ga0068868_100004780 | Ga0068868_1000047808 | 112 |
| 75 | 3300005338 | Ga0068868_100113852 | Ga0068868_1001138523 | 112 |
| 76 | 3300005338 | Ga0068868_100416010 | Ga0068868_1004160102 | 112 |
| 77 | 3300005338 | Ga0068868_100750939 | Ga0068868_1007509391 | 112 |
| 78 | 3300005339 | Ga0070660_100414090 | Ga0070660_1004140902 | 112 |
| 79 | 3300005340 | Ga0070689_100005903 | Ga0070689_10000590311 | 112 |
| 80 | 3300005341 | Ga0070691_10011042 | Ga0070691_100110421 | 112 |
| 81 | 3300005344 | Ga0070661_100110585 | Ga0070661_1001105852 | 112 |
| 82 | 3300005345 | Ga0070692_10042501 | Ga0070692_100425012 | 112 |
| 83 | 3300005345 | Ga0070692_10462025 | Ga0070692_104620252 | 112 |
| 84 | 3300005345 | Ga0070692_10576267 | Ga0070692_105762672 | 112 |
| 85 | 3300005347 | Ga0070668_100003380 | Ga0070668_1000033806 | 112 |
| 86 | 3300005347 | Ga0070668_100040416 | Ga0070668_1000404163 | 112 |
| 87 | 3300005347 | Ga0070668_100100591 | Ga0070668_1001005912 | 112 |
| 88 | 3300005347 | Ga0070668_100255410 | Ga0070668_1002554102 | 112 |
| 89 | 3300005347 | Ga0070668_100729319 | Ga0070668_1007293192 | 112 |
| 90 | 3300005353 | Ga0070669_100013932 | Ga0070669_1000139324 | 112 |
| 91 | 3300005353 | Ga0070669_100029809 | Ga0070669_1000298093 | 112 |
| 92 | 3300005353 | Ga0070669_100234526 | Ga0070669_1002345261 | 112 |
| 93 | 3300005354 | Ga0070675_100011427 | Ga0070675_1000114275 | 112 |
| 94 | 3300005354 | Ga0070675_100059003 | Ga0070675_1000590032 | 112 |
| 95 | 3300005354 | Ga0070675_100230942 | Ga0070675_1002309422 | 112 |
| 96 | 3300005354 | Ga0070675_100760156 | Ga0070675_1007601562 | 112 |
| 97 | 3300005354 | Ga0070675_100973166 | Ga0070675_1009731661 | 112 |
| 98 | 3300005355 | Ga0070671_100078732 | Ga0070671_1000787323 | 112 |
| 99 | 3300005355 | Ga0070671_100131713 | Ga0070671_1001317133 | 112 |
| 100 | 3300005356 | Ga0070674_100064999 | Ga0070674_1000649992 | 112 |
| 101 | 3300005364 | Ga0070673_100262558 | Ga0070673_1002625582 | 112 |
| 102 | 3300005365 | Ga0070688_100109170 | Ga0070688_1001091703 | 112 |
| 103 | 3300005365 | Ga0070688_100854879 | Ga0070688_1008548791 | 112 |
| 104 | 3300005366 | Ga0070659_100083453 | Ga0070659_1000834532 | 112 |
| 105 | 3300005366 | Ga0070659_100093911 | Ga0070659_1000939112 | 112 |
| 106 | 3300005366 | Ga0070659_100694396 | Ga0070659_1006943962 | 112 |
| 107 | 3300005367 | Ga0070667_100006231 | Ga0070667_1000062314 | 112 |
| 108 | 3300005367 | Ga0070667_100018932 | Ga0070667_1000189322 | 112 |
| 109 | 3300005367 | Ga0070667_101426982 | Ga0070667_1014269821 | 112 |
| 110 | 3300005436 | Ga0070713_100365386 | Ga0070713_1003653862 | 112 |
| 111 | 3300005438 | Ga0070701_10004252 | Ga0070701_100042522 | 112 |
| 112 | 3300005439 | Ga0070711_100871702 | Ga0070711_1008717022 | 112 |
| 113 | 3300005439 | Ga0070711_100995868 | Ga0070711_1009958682 | 112 |
| 114 | 3300005440 | Ga0070705_100077812 | Ga0070705_1000778123 | 112 |
| 115 | 3300005441 | Ga0070700_100001276 | Ga0070700_10000127610 | 112 |
| 116 | 3300005441 | Ga0070700_100623604 | Ga0070700_1006236041 | 112 |
| 117 | 3300005441 | Ga0070700_101374993 | Ga0070700_1013749931 | 112 |
| 118 | 3300005441 | Ga0070700_101495590 | Ga0070700_1014955901 | 112 |
| 119 | 3300005445 | Ga0070708_100000726 | Ga0070708_1000007265 | 112 |
| 120 | 3300005445 | Ga0070708_100114581 | Ga0070708_1001145811 | 112 |
| 121 | 3300005445 | Ga0070708_100617810 | Ga0070708_1006178101 | 112 |
| 122 | 3300005455 | Ga0070663_100012072 | Ga0070663_1000120722 | 112 |
| 123 | 3300005455 | Ga0070663_100060237 | Ga0070663_1000602373 | 112 |
| 124 | 3300005455 | Ga0070663_100822870 | Ga0070663_1008228701 | 112 |
| 125 | 3300005455 | Ga0070663_100837994 | Ga0070663_1008379942 | 112 |
| 126 | 3300005456 | Ga0070678_100011210 | Ga0070678_1000112104 | 112 |
| 127 | 3300005456 | Ga0070678_100175503 | Ga0070678_1001755032 | 112 |
| 128 | 3300005456 | Ga0070678_100390947 | Ga0070678_1003909472 | 112 |
| 129 | 3300005457 | Ga0070662_100089481 | Ga0070662_1000894812 | 112 |
| 130 | 3300005457 | Ga0070662_100662984 | Ga0070662_1006629842 | 112 |
| 131 | 3300005459 | Ga0068867_100000610 | Ga0068867_10000061021 | 112 |
| 132 | 3300005459 | Ga0068867_100001706 | Ga0068867_1000017064 | 112 |
| 133 | 3300005459 | Ga0068867_100008197 | Ga0068867_1000081974 | 112 |
| 134 | 3300005459 | Ga0068867_100008463 | Ga0068867_1000084635 | 112 |
| 135 | 3300005459 | Ga0068867_100317408 | Ga0068867_1003174082 | 112 |
| 136 | 3300005459 | Ga0068867_100378813 | Ga0068867_1003788132 | 112 |
| 137 | 3300005459 | Ga0068867_100386264 | Ga0068867_1003862642 | 112 |
| 138 | 3300005459 | Ga0068867_100387353 | Ga0068867_1003873532 | 112 |
| 139 | 3300005466 | Ga0070685_10321549 | Ga0070685_103215492 | 112 |
| 140 | 3300005467 | Ga0070706_100396687 | Ga0070706_1003966872 | 112 |
| 141 | 3300005467 | Ga0070706_101015595 | Ga0070706_1010155951 | 112 |
| 142 | 3300005468 | Ga0070707_100098346 | Ga0070707_1000983462 | 112 |
| 143 | 3300005471 | Ga0070698_100174328 | Ga0070698_1001743282 | 112 |
| 144 | 3300005471 | Ga0070698_100249367 | Ga0070698_1002493673 | 112 |
| 145 | 3300005471 | Ga0070698_100862335 | Ga0070698_1008623351 | 112 |
| 146 | 3300005518 | Ga0070699_100099649 | Ga0070699_1000996492 | 112 |
| 147 | 3300005535 | Ga0070684_100937387 | Ga0070684_1009373872 | 112 |
| 148 | 3300005536 | Ga0070697_100510661 | Ga0070697_1005106612 | 112 |
| 149 | 3300005539 | Ga0068853_100399837 | Ga0068853_1003998372 | 112 |
| 150 | 3300005539 | Ga0068853_100731849 | Ga0068853_1007318491 | 112 |
| 151 | 3300005543 | Ga0070672_100005096 | Ga0070672_1000050966 | 112 |
| 152 | 3300005543 | Ga0070672_100018094 | Ga0070672_1000180943 | 112 |
| 153 | 3300005543 | Ga0070672_100026372 | Ga0070672_1000263724 | 112 |
| 154 | 3300005543 | Ga0070672_100365888 | Ga0070672_1003658882 | 112 |
| 155 | 3300005543 | Ga0070672_100400917 | Ga0070672_1004009173 | 112 |
| 156 | 3300005543 | Ga0070672_100710640 | Ga0070672_1007106401 | 112 |
| 157 | 3300005544 | Ga0070686_100026545 | Ga0070686_1000265453 | 112 |
| 158 | 3300005545 | Ga0070695_100043274 | Ga0070695_1000432741 | 112 |
| 159 | 3300005545 | Ga0070695_100280176 | Ga0070695_1002801762 | 112 |
| 160 | 3300005546 | Ga0070696_100417909 | Ga0070696_1004179092 | 112 |
| 161 | 3300005547 | Ga0070693_100457333 | Ga0070693_1004573331 | 112 |
| 162 | 3300005548 | Ga0070665_100029400 | Ga0070665_1000294002 | 112 |
| 163 | 3300005548 | Ga0070665_100085416 | Ga0070665_1000854163 | 112 |
| 164 | 3300005548 | Ga0070665_100305599 | Ga0070665_1003055992 | 112 |
| 165 | 3300005548 | Ga0070665_100450514 | Ga0070665_1004505142 | 112 |
| 166 | 3300005549 | Ga0070704_100309738 | Ga0070704_1003097382 | 112 |
| 167 | 3300005549 | Ga0070704_100384762 | Ga0070704_1003847622 | 112 |
| 168 | 3300005563 | Ga0068855_100056261 | Ga0068855_1000562612 | 112 |
| 169 | 3300005563 | Ga0068855_100342735 | Ga0068855_1003427352 | 112 |
| 170 | 3300005563 | Ga0068855_100750014 | Ga0068855_1007500141 | 112 |
| 171 | 3300005564 | Ga0070664_100010288 | Ga0070664_1000102882 | 112 |
| 172 | 3300005564 | Ga0070664_100065829 | Ga0070664_1000658291 | 112 |
| 173 | 3300005564 | Ga0070664_100179946 | Ga0070664_1001799462 | 112 |
| 174 | 3300005564 | Ga0070664_100460415 | Ga0070664_1004604152 | 112 |
| 175 | 3300005564 | Ga0070664_100593119 | Ga0070664_1005931192 | 112 |
| 176 | 3300005564 | Ga0070664_100699584 | Ga0070664_1006995842 | 112 |
| 177 | 3300005577 | Ga0068857_100007291 | Ga0068857_1000072913 | 112 |
| 178 | 3300005577 | Ga0068857_100019102 | Ga0068857_1000191021 | 112 |
| 179 | 3300005577 | Ga0068857_100198181 | Ga0068857_1001981813 | 112 |
| 180 | 3300005577 | Ga0068857_100227840 | Ga0068857_1002278402 | 112 |
| 181 | 3300005578 | Ga0068854_100011530 | Ga0068854_1000115303 | 112 |
| 182 | 3300005578 | Ga0068854_100024015 | Ga0068854_1000240154 | 112 |
| 183 | 3300005578 | Ga0068854_100040406 | Ga0068854_1000404063 | 112 |
| 184 | 3300005578 | Ga0068854_100577809 | Ga0068854_1005778092 | 112 |
| 185 | 3300005614 | Ga0068856_100002869 | Ga0068856_10000286911 | 112 |
| 186 | 3300005615 | Ga0070702_100010963 | Ga0070702_1000109633 | 112 |
| 187 | 3300005616 | Ga0068852_100022906 | Ga0068852_1000229065 | 112 |
| 188 | 3300005616 | Ga0068852_100066636 | Ga0068852_1000666363 | 112 |
| 189 | 3300005616 | Ga0068852_100410913 | Ga0068852_1004109131 | 112 |
| 190 | 3300005616 | Ga0068852_101009828 | Ga0068852_1010098281 | 112 |
| 191 | 3300005617 | Ga0068859_100002465 | Ga0068859_1000024656 | 112 |
| 192 | 3300005617 | Ga0068859_100118538 | Ga0068859_1001185383 | 112 |
| 193 | 3300005617 | Ga0068859_100294143 | Ga0068859_1002941432 | 112 |
| 194 | 3300005617 | Ga0068859_100713096 | Ga0068859_1007130961 | 112 |
| 195 | 3300005617 | Ga0068859_100748041 | Ga0068859_1007480412 | 112 |
| 196 | 3300005618 | Ga0068864_100003756 | Ga0068864_1000037568 | 112 |
| 197 | 3300005618 | Ga0068864_100005694 | Ga0068864_1000056946 | 112 |
| 198 | 3300005618 | Ga0068864_100149765 | Ga0068864_1001497652 | 112 |
| 199 | 3300005618 | Ga0068864_100300491 | Ga0068864_1003004913 | 112 |
| 200 | 3300005618 | Ga0068864_101072137 | Ga0068864_1010721371 | 112 |
| 201 | 3300005718 | Ga0068866_10013782 | Ga0068866_100137823 | 112 |
| 202 | 3300005718 | Ga0068866_10225756 | Ga0068866_102257562 | 112 |
| 203 | 3300005719 | Ga0068861_100003054 | Ga0068861_1000030545 | 112 |
| 204 | 3300005719 | Ga0068861_100285963 | Ga0068861_1002859633 | 112 |
| 205 | 3300005719 | Ga0068861_100470782 | Ga0068861_1004707822 | 112 |
| 206 | 3300005719 | Ga0068861_100536719 | Ga0068861_1005367192 | 112 |
| 207 | 3300005834 | Ga0068851_10185924 | Ga0068851_101859242 | 112 |
| 208 | 3300005834 | Ga0068851_10974760 | Ga0068851_109747602 | 112 |
| 209 | 3300005840 | Ga0068870_10023946 | Ga0068870_100239463 | 112 |
| 210 | 3300005840 | Ga0068870_10127882 | Ga0068870_101278823 | 112 |
| 211 | 3300005840 | Ga0068870_10548644 | Ga0068870_105486442 | 112 |
| 212 | 3300005841 | Ga0068863_100067683 | Ga0068863_1000676832 | 112 |
| 213 | 3300005841 | Ga0068863_100127860 | Ga0068863_1001278604 | 112 |
| 214 | 3300005841 | Ga0068863_100224774 | Ga0068863_1002247742 | 112 |
| 215 | 3300005841 | Ga0068863_100249319 | Ga0068863_1002493192 | 112 |
| 216 | 3300005841 | Ga0068863_100663312 | Ga0068863_1006633121 | 112 |
| 217 | 3300005841 | Ga0068863_101049664 | Ga0068863_1010496642 | 112 |
| 218 | 3300005842 | Ga0068858_100003435 | Ga0068858_10000343511 | 112 |
| 219 | 3300005842 | Ga0068858_100009536 | Ga0068858_1000095363 | 112 |
| 220 | 3300005842 | Ga0068858_100009830 | Ga0068858_1000098308 | 112 |
| 221 | 3300005842 | Ga0068858_100348196 | Ga0068858_1003481962 | 112 |
| 222 | 3300005842 | Ga0068858_101929513 | Ga0068858_1019295131 | 112 |
| 223 | 3300005843 | Ga0068860_100003281 | Ga0068860_10000328112 | 112 |
| 224 | 3300005843 | Ga0068860_100034146 | Ga0068860_1000341464 | 112 |
| 225 | 3300005843 | Ga0068860_100222236 | Ga0068860_1002222362 | 112 |
| 226 | 3300005843 | Ga0068860_100302226 | Ga0068860_1003022262 | 112 |
| 227 | 3300005843 | Ga0068860_100886657 | Ga0068860_1008866572 | 112 |
| 228 | 3300005843 | Ga0068860_100941884 | Ga0068860_1009418842 | 112 |
| 229 | 3300005844 | Ga0068862_100023698 | Ga0068862_1000236983 | 112 |
| 230 | 3300005844 | Ga0068862_100033125 | Ga0068862_1000331255 | 112 |
| 231 | 3300005844 | Ga0068862_100238659 | Ga0068862_1002386592 | 112 |
| 232 | 3300006173 | Ga0070716_100602882 | Ga0070716_1006028821 | 112 |
| 233 | 3300006173 | Ga0070716_100994372 | Ga0070716_1009943721 | 112 |
| 234 | 3300006173 | Ga0070716_101313075 | Ga0070716_1013130752 | 112 |
| 235 | 3300006177 | Ga0075362_10374219 | Ga0075362_103742192 | 112 |
| 236 | 3300006178 | Ga0075367_10555632 | Ga0075367_105556322 | 112 |
| 237 | 3300006194 | Ga0075427_10002958 | Ga0075427_100029581 | 112 |
| 238 | 3300006194 | Ga0075427_10023948 | Ga0075427_100239481 | 112 |
| 239 | 3300006195 | Ga0075366_10013383 | Ga0075366_100133832 | 112 |
| 240 | 3300006195 | Ga0075366_10064639 | Ga0075366_100646392 | 112 |
| 241 | 3300006195 | Ga0075366_10081396 | Ga0075366_100813962 | 112 |
| 242 | 3300006195 | Ga0075366_10144212 | Ga0075366_101442122 | 112 |
| 243 | 3300006195 | Ga0075366_10383142 | Ga0075366_103831422 | 112 |
| 244 | 3300006195 | Ga0075366_10426097 | Ga0075366_104260971 | 112 |
| 245 | 3300006195 | Ga0075366_10842144 | Ga0075366_108421441 | 112 |
| 246 | 3300006237 | Ga0097621_100047387 | Ga0097621_1000473873 | 112 |
| 247 | 3300006237 | Ga0097621_100245659 | Ga0097621_1002456592 | 112 |
| 248 | 3300006237 | Ga0097621_101331335 | Ga0097621_1013313352 | 112 |
| 249 | 3300006353 | Ga0075370_10015045 | Ga0075370_100150452 | 112 |
| 250 | 3300006353 | Ga0075370_10018575 | Ga0075370_100185753 | 112 |
| 251 | 3300006353 | Ga0075370_10036940 | Ga0075370_100369402 | 112 |
| 252 | 3300006353 | Ga0075370_10476620 | Ga0075370_104766202 | 112 |
| 253 | 3300006358 | Ga0068871_100015936 | Ga0068871_1000159361 | 112 |
| 254 | 3300006358 | Ga0068871_100018412 | Ga0068871_1000184122 | 112 |
| 255 | 3300006358 | Ga0068871_101240659 | Ga0068871_1012406592 | 112 |
| 256 | 3300006358 | Ga0068871_101619352 | Ga0068871_1016193521 | 112 |
| 257 | 3300006844 | Ga0075428_100054190 | Ga0075428_1000541902 | 112 |
| 258 | 3300006844 | Ga0075428_100288887 | Ga0075428_1002888872 | 112 |
| 259 | 3300006844 | Ga0075428_100609698 | Ga0075428_1006096982 | 112 |
| 260 | 3300006844 | Ga0075428_100893231 | Ga0075428_1008932311 | 112 |
| 261 | 3300006844 | Ga0075428_101531957 | Ga0075428_1015319572 | 112 |
| 262 | 3300006846 | Ga0075430_100320684 | Ga0075430_1003206842 | 112 |
| 263 | 3300006846 | Ga0075430_100564827 | Ga0075430_1005648272 | 112 |
| 264 | 3300006847 | Ga0075431_100061108 | Ga0075431_1000611082 | 112 |
| 265 | 3300006852 | Ga0075433_10079733 | Ga0075433_100797334 | 112 |
| 266 | 3300006852 | Ga0075433_10430172 | Ga0075433_104301723 | 112 |
| 267 | 3300006852 | Ga0075433_10646754 | Ga0075433_106467541 | 112 |
| 268 | 3300006871 | Ga0075434_100035518 | Ga0075434_1000355185 | 112 |
| 269 | 3300006871 | Ga0075434_100326253 | Ga0075434_1003262533 | 112 |
| 270 | 3300006871 | Ga0075434_101078018 | Ga0075434_1010780182 | 112 |
| 271 | 3300006880 | Ga0075429_100001462 | Ga0075429_1000014626 | 112 |
| 272 | 3300006880 | Ga0075429_100062270 | Ga0075429_1000622702 | 112 |
| 273 | 3300006880 | Ga0075429_100097238 | Ga0075429_1000972381 | 112 |
| 274 | 3300006880 | Ga0075429_100959157 | Ga0075429_1009591571 | 112 |
| 275 | 3300006881 | Ga0068865_100004028 | Ga0068865_1000040284 | 112 |
| 276 | 3300006881 | Ga0068865_100023534 | Ga0068865_1000235343 | 112 |
| 277 | 3300006881 | Ga0068865_100129605 | Ga0068865_1001296051 | 112 |
| 278 | 3300006881 | Ga0068865_101192388 | Ga0068865_1011923881 | 112 |
| 279 | 3300006914 | Ga0075436_100041282 | Ga0075436_1000412822 | 112 |
| 280 | 3300006931 | Ga0097620_100002465 | Ga0097620_1000024656 | 112 |
| 281 | 3300006931 | Ga0097620_100118535 | Ga0097620_1001185353 | 112 |
| 282 | 3300006931 | Ga0097620_100294133 | Ga0097620_1002941332 | 112 |
| 283 | 3300006931 | Ga0097620_100713090 | Ga0097620_1007130901 | 112 |
| 284 | 3300006931 | Ga0097620_100747970 | Ga0097620_1007479702 | 112 |
| 285 | 3300006944 | Ga0099823_1000039 | Ga0099823_100003930 | 112 |
| 286 | 3300007076 | Ga0075435_100093531 | Ga0075435_1000935312 | 112 |
| 287 | 3300007076 | Ga0075435_100882729 | Ga0075435_1008827292 | 112 |
| 288 | 3300009011 | Ga0105251_10002039 | Ga0105251_1000203912 | 112 |
| 289 | 3300009011 | Ga0105251_10004772 | Ga0105251_100047727 | 112 |
| 290 | 3300009093 | Ga0105240_10066599 | Ga0105240_100665992 | 112 |
| 291 | 3300009093 | Ga0105240_10167932 | Ga0105240_101679324 | 112 |
| 292 | 3300009093 | Ga0105240_10650979 | Ga0105240_106509792 | 112 |
| 293 | 3300009094 | Ga0111539_10056418 | Ga0111539_100564182 | 112 |
| 294 | 3300009094 | Ga0111539_10527171 | Ga0111539_105271712 | 112 |
| 295 | 3300009094 | Ga0111539_10527406 | Ga0111539_105274061 | 112 |
| 296 | 3300009098 | Ga0105245_10026425 | Ga0105245_100264252 | 112 |
| 297 | 3300009098 | Ga0105245_10404071 | Ga0105245_104040712 | 112 |
| 298 | 3300009098 | Ga0105245_11262081 | Ga0105245_112620812 | 112 |
| 299 | 3300009101 | Ga0105247_10007966 | Ga0105247_100079666 | 112 |
| 300 | 3300009147 | Ga0114129_10014043 | Ga0114129_100140435 | 112 |
| 301 | 3300009147 | Ga0114129_10025476 | Ga0114129_100254766 | 112 |
| 302 | 3300009147 | Ga0114129_10095326 | Ga0114129_100953261 | 112 |
| 303 | 3300009147 | Ga0114129_10141482 | Ga0114129_101414823 | 112 |
| 304 | 3300009147 | Ga0114129_10334723 | Ga0114129_103347232 | 112 |
| 305 | 3300009147 | Ga0114129_10809372 | Ga0114129_108093722 | 112 |
| 306 | 3300009147 | Ga0114129_12239859 | Ga0114129_122398591 | 112 |
| 307 | 3300009148 | Ga0105243_10008116 | Ga0105243_100081165 | 112 |
| 308 | 3300009148 | Ga0105243_10010621 | Ga0105243_100106219 | 112 |
| 309 | 3300009148 | Ga0105243_10235877 | Ga0105243_102358773 | 112 |
| 310 | 3300009148 | Ga0105243_11397151 | Ga0105243_113971512 | 112 |
| 311 | 3300009148 | Ga0105243_12713615 | Ga0105243_127136152 | 112 |
| 312 | 3300009174 | Ga0105241_10213554 | Ga0105241_102135542 | 112 |
| 313 | 3300009174 | Ga0105241_11051791 | Ga0105241_110517912 | 112 |
| 314 | 3300009174 | Ga0105241_11295995 | Ga0105241_112959952 | 112 |
| 315 | 3300009174 | Ga0105241_11772186 | Ga0105241_117721861 | 112 |
| 316 | 3300009176 | Ga0105242_10066853 | Ga0105242_100668533 | 112 |
| 317 | 3300009176 | Ga0105242_10990887 | Ga0105242_109908872 | 112 |
| 318 | 3300009177 | Ga0105248_10005793 | Ga0105248_1000579313 | 112 |
| 319 | 3300009177 | Ga0105248_10108265 | Ga0105248_101082652 | 112 |
| 320 | 3300009177 | Ga0105248_10180048 | Ga0105248_101800483 | 112 |
| 321 | 3300009177 | Ga0105248_10965075 | Ga0105248_109650751 | 112 |
| 322 | 3300009545 | Ga0105237_10231349 | Ga0105237_102313492 | 112 |
| 323 | 3300009551 | Ga0105238_10108475 | Ga0105238_101084753 | 112 |
| 324 | 3300009551 | Ga0105238_10626530 | Ga0105238_106265302 | 112 |
| 325 | 3300009551 | Ga0105238_11353320 | Ga0105238_113533201 | 112 |
| 326 | 3300009553 | Ga0105249_10063404 | Ga0105249_100634042 | 112 |
| 327 | 3300009553 | Ga0105249_10324206 | Ga0105249_103242062 | 112 |
| 328 | 3300009553 | Ga0105249_10736290 | Ga0105249_107362902 | 112 |
| 329 | 3300010375 | Ga0105239_10036788 | Ga0105239_100367887 | 112 |
| 330 | 3300010375 | Ga0105239_10243351 | Ga0105239_102433512 | 112 |
| 331 | 3300010375 | Ga0105239_11516147 | Ga0105239_115161471 | 112 |
| 332 | 3300011119 | Ga0105246_10169149 | Ga0105246_101691492 | 112 |
| 333 | 3300012475 | Ga0157317_1000744 | Ga0157317_10007442 | 112 |
| 334 | 3300012491 | Ga0157329_1028350 | Ga0157329_10283502 | 112 |
| 335 | 3300012497 | Ga0157319_1000009 | Ga0157319_100000974 | 112 |
| 336 | 3300012513 | Ga0157326_1072398 | Ga0157326_10723982 | 112 |
| 337 | 3300013100 | Ga0157373_10180537 | Ga0157373_101805372 | 112 |
| 338 | 3300013100 | Ga0157373_10508701 | Ga0157373_105087012 | 112 |
| 339 | 3300013102 | Ga0157371_11472322 | Ga0157371_114723221 | 112 |
| 340 | 3300013104 | Ga0157370_10082879 | Ga0157370_100828793 | 112 |
| 341 | 3300013104 | Ga0157370_10496245 | Ga0157370_104962452 | 112 |
| 342 | 3300013105 | Ga0157369_10024322 | Ga0157369_100243223 | 112 |
| 343 | 3300013105 | Ga0157369_10393451 | Ga0157369_103934512 | 112 |
| 344 | 3300013105 | Ga0157369_10461657 | Ga0157369_104616572 | 112 |
| 345 | 3300013105 | Ga0157369_10569797 | Ga0157369_105697971 | 112 |
| 346 | 3300013296 | Ga0157374_10004327 | Ga0157374_100043273 | 112 |
| 347 | 3300013296 | Ga0157374_10020860 | Ga0157374_100208605 | 112 |
| 348 | 3300013296 | Ga0157374_10062072 | Ga0157374_100620722 | 112 |
| 349 | 3300013296 | Ga0157374_10192598 | Ga0157374_101925983 | 112 |
| 350 | 3300013296 | Ga0157374_11278967 | Ga0157374_112789672 | 112 |
| 351 | 3300013296 | Ga0157374_11359201 | Ga0157374_113592012 | 112 |
| 352 | 3300013297 | Ga0157378_10014439 | Ga0157378_100144395 | 112 |
| 353 | 3300013297 | Ga0157378_10066087 | Ga0157378_100660873 | 112 |
| 354 | 3300013297 | Ga0157378_10122241 | Ga0157378_101222413 | 112 |
| 355 | 3300013297 | Ga0157378_10482280 | Ga0157378_104822802 | 112 |
| 356 | 3300013297 | Ga0157378_11101428 | Ga0157378_111014282 | 112 |
| 357 | 3300013306 | Ga0163162_10086943 | Ga0163162_100869433 | 112 |
| 358 | 3300013306 | Ga0163162_13259084 | Ga0163162_132590841 | 112 |
| 359 | 3300013307 | Ga0157372_10313070 | Ga0157372_103130704 | 112 |
| 360 | 3300013307 | Ga0157372_11498347 | Ga0157372_114983472 | 112 |
| 361 | 3300013308 | Ga0157375_10194638 | Ga0157375_101946382 | 112 |
| 362 | 3300013308 | Ga0157375_10329761 | Ga0157375_103297611 | 112 |
| 363 | 3300013308 | Ga0157375_10750598 | Ga0157375_107505982 | 112 |
| 364 | 3300013308 | Ga0157375_10980943 | Ga0157375_109809432 | 112 |
| 365 | 3300014325 | Ga0163163_10001673 | Ga0163163_1000167313 | 112 |
| 366 | 3300014325 | Ga0163163_12787259 | Ga0163163_127872592 | 112 |
| 367 | 3300014326 | Ga0157380_10041059 | Ga0157380_100410594 | 112 |
| 368 | 3300014326 | Ga0157380_10187073 | Ga0157380_101870732 | 112 |
| 369 | 3300014326 | Ga0157380_10634255 | Ga0157380_106342552 | 112 |
| 370 | 3300014497 | Ga0182008_10037099 | Ga0182008_100370992 | 112 |
| 371 | 3300014497 | Ga0182008_10180800 | Ga0182008_101808002 | 112 |
| 372 | 3300014745 | Ga0157377_10000014 | Ga0157377_10000014113 | 112 |
| 373 | 3300014745 | Ga0157377_10081716 | Ga0157377_100817163 | 112 |
| 374 | 3300014968 | Ga0157379_10000219 | Ga0157379_1000021927 | 112 |
| 375 | 3300014968 | Ga0157379_10030507 | Ga0157379_100305073 | 112 |
| 376 | 3300014968 | Ga0157379_10124167 | Ga0157379_101241673 | 112 |
| 377 | 3300014968 | Ga0157379_10254490 | Ga0157379_102544903 | 112 |
| 378 | 3300014968 | Ga0157379_11705899 | Ga0157379_117058991 | 112 |
| 379 | 3300014968 | Ga0157379_12678901 | Ga0157379_126789011 | 112 |
| 380 | 3300014969 | Ga0157376_10054088 | Ga0157376_100540882 | 112 |
| 381 | 3300014969 | Ga0157376_10236378 | Ga0157376_102363782 | 112 |
| 382 | 3300014969 | Ga0157376_10265575 | Ga0157376_102655752 | 112 |
| 383 | 3300014969 | Ga0157376_10534013 | Ga0157376_105340132 | 112 |
| 384 | 3300014969 | Ga0157376_10810522 | Ga0157376_108105222 | 112 |
| 385 | 3300014969 | Ga0157376_11595455 | Ga0157376_115954552 | 112 |
| 386 | 3300017792 | Ga0163161_10072368 | Ga0163161_100723683 | 112 |
| 387 | 3300017792 | Ga0163161_10326148 | Ga0163161_103261481 | 112 |
| 388 | 3300020081 | Ga0206354_11614687 | Ga0206354_116146872 | 112 |
| 389 | 3300021361 | Ga0213872_10000003 | Ga0213872_1000000312 | 112 |
| 390 | 3300021361 | Ga0213872_10000004 | Ga0213872_10000004144 | 112 |
| 391 | 3300021361 | Ga0213872_10145217 | Ga0213872_101452172 | 112 |
| 392 | 3300021384 | Ga0213876_10631559 | Ga0213876_106315591 | 112 |
| 393 | 3300022467 | Ga0224712_10291944 | Ga0224712_102919441 | 112 |
| 394 | 3300022467 | Ga0224712_10465848 | Ga0224712_104658481 | 112 |
| 395 | 3300025225 | Ga0209566_119113 | Ga0209566_1191132 | 112 |
| 396 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031198 | 112 |
| 397 | 3300025230 | Ga0209563_100010 | Ga0209563_100010926 | 112 |
| 398 | 3300025231 | Ga0207427_100190 | Ga0207427_1001904 | 112 |
| 399 | 3300025242 | Ga0209258_101187 | Ga0209258_10118711 | 112 |
| 400 | 3300025246 | Ga0209646_1000376 | Ga0209646_100037631 | 112 |
| 401 | 3300025250 | Ga0209026_1000179 | Ga0209026_100017960 | 112 |
| 402 | 3300025253 | Ga0209677_100026 | Ga0209677_1000269 | 112 |
| 403 | 3300025253 | Ga0209677_101024 | Ga0209677_1010248 | 112 |
| 404 | 3300025256 | Ga0209759_1000196 | Ga0209759_100019660 | 112 |
| 405 | 3300025256 | Ga0209759_1018777 | Ga0209759_10187772 | 112 |
| 406 | 3300025261 | Ga0209233_1048389 | Ga0209233_10483892 | 112 |
| 407 | 3300025272 | Ga0209455_1016722 | Ga0209455_10167221 | 112 |
| 408 | 3300025273 | Ga0209673_1002939 | Ga0209673_10029398 | 112 |
| 409 | 3300025298 | Ga0209050_1005985 | Ga0209050_10059856 | 112 |
| 410 | 3300025299 | Ga0209256_1001390 | Ga0209256_10013907 | 112 |
| 411 | 3300025299 | Ga0209256_1003868 | Ga0209256_10038686 | 112 |
| 412 | 3300025302 | Ga0207426_1053188 | Ga0207426_10531882 | 112 |
| 413 | 3300025303 | Ga0209051_1001698 | Ga0209051_100169810 | 112 |
| 414 | 3300025303 | Ga0209051_1009070 | Ga0209051_10090703 | 112 |
| 415 | 3300025304 | Ga0209257_1000021 | Ga0209257_1000021438 | 112 |
| 416 | 3300025304 | Ga0209257_1001619 | Ga0209257_100161917 | 112 |
| 417 | 3300025304 | Ga0209257_1002501 | Ga0209257_10025017 | 112 |
| 418 | 3300025304 | Ga0209257_1028703 | Ga0209257_10287033 | 112 |
| 419 | 3300025315 | Ga0207697_10015713 | Ga0207697_100157133 | 112 |
| 420 | 3300025315 | Ga0207697_10515293 | Ga0207697_105152931 | 112 |
| 421 | 3300025321 | Ga0207656_10005381 | Ga0207656_100053816 | 112 |
| 422 | 3300025321 | Ga0207656_10076829 | Ga0207656_100768293 | 112 |
| 423 | 3300025321 | Ga0207656_10178703 | Ga0207656_101787032 | 112 |
| 424 | 3300025321 | Ga0207656_10526283 | Ga0207656_105262831 | 112 |
| 425 | 3300025735 | Ga0207713_1004561 | Ga0207713_10045616 | 112 |
| 426 | 3300025893 | Ga0207682_10255469 | Ga0207682_102554692 | 112 |
| 427 | 3300025899 | Ga0207642_10006837 | Ga0207642_100068373 | 112 |
| 428 | 3300025899 | Ga0207642_10074052 | Ga0207642_100740522 | 112 |
| 429 | 3300025899 | Ga0207642_11133081 | Ga0207642_111330811 | 112 |
| 430 | 3300025900 | Ga0207710_10007106 | Ga0207710_100071064 | 112 |
| 431 | 3300025903 | Ga0207680_11068510 | Ga0207680_110685102 | 112 |
| 432 | 3300025904 | Ga0207647_10051489 | Ga0207647_100514893 | 112 |
| 433 | 3300025907 | Ga0207645_10006139 | Ga0207645_100061394 | 112 |
| 434 | 3300025907 | Ga0207645_10033936 | Ga0207645_100339362 | 112 |
| 435 | 3300025907 | Ga0207645_10078391 | Ga0207645_100783913 | 112 |
| 436 | 3300025908 | Ga0207643_10086392 | Ga0207643_100863924 | 112 |
| 437 | 3300025908 | Ga0207643_10269398 | Ga0207643_102693983 | 112 |
| 438 | 3300025909 | Ga0207705_10020768 | Ga0207705_100207685 | 112 |
| 439 | 3300025909 | Ga0207705_10126668 | Ga0207705_101266682 | 112 |
| 440 | 3300025909 | Ga0207705_10269535 | Ga0207705_102695351 | 112 |
| 441 | 3300025910 | Ga0207684_10024612 | Ga0207684_100246122 | 112 |
| 442 | 3300025913 | Ga0207695_10074919 | Ga0207695_100749192 | 112 |
| 443 | 3300025913 | Ga0207695_10096986 | Ga0207695_100969861 | 112 |
| 444 | 3300025914 | Ga0207671_10170734 | Ga0207671_101707344 | 112 |
| 445 | 3300025914 | Ga0207671_10215547 | Ga0207671_102155473 | 112 |
| 446 | 3300025916 | Ga0207663_10759310 | Ga0207663_107593102 | 112 |
| 447 | 3300025916 | Ga0207663_11319003 | Ga0207663_113190032 | 112 |
| 448 | 3300025918 | Ga0207662_10284952 | Ga0207662_102849521 | 112 |
| 449 | 3300025919 | Ga0207657_10603296 | Ga0207657_106032962 | 112 |
| 450 | 3300025920 | Ga0207649_10051542 | Ga0207649_100515424 | 112 |
| 451 | 3300025920 | Ga0207649_10167688 | Ga0207649_101676882 | 112 |
| 452 | 3300025920 | Ga0207649_10226266 | Ga0207649_102262663 | 112 |
| 453 | 3300025921 | Ga0207652_11703011 | Ga0207652_117030112 | 112 |
| 454 | 3300025922 | Ga0207646_10327844 | Ga0207646_103278441 | 112 |
| 455 | 3300025922 | Ga0207646_10865572 | Ga0207646_108655722 | 112 |
| 456 | 3300025923 | Ga0207681_10009728 | Ga0207681_100097282 | 112 |
| 457 | 3300025923 | Ga0207681_10266132 | Ga0207681_102661323 | 112 |
| 458 | 3300025923 | Ga0207681_10337164 | Ga0207681_103371641 | 112 |
| 459 | 3300025923 | Ga0207681_11359215 | Ga0207681_113592151 | 112 |
| 460 | 3300025924 | Ga0207694_10010892 | Ga0207694_100108922 | 112 |
| 461 | 3300025924 | Ga0207694_10025050 | Ga0207694_100250503 | 112 |
| 462 | 3300025924 | Ga0207694_10903853 | Ga0207694_109038532 | 112 |
| 463 | 3300025925 | Ga0207650_10036058 | Ga0207650_100360582 | 112 |
| 464 | 3300025925 | Ga0207650_10100444 | Ga0207650_101004442 | 112 |
| 465 | 3300025925 | Ga0207650_10254922 | Ga0207650_102549222 | 112 |
| 466 | 3300025925 | Ga0207650_10410741 | Ga0207650_104107412 | 112 |
| 467 | 3300025925 | Ga0207650_10423425 | Ga0207650_104234252 | 112 |
| 468 | 3300025926 | Ga0207659_10013120 | Ga0207659_100131204 | 112 |
| 469 | 3300025926 | Ga0207659_10300693 | Ga0207659_103006932 | 112 |
| 470 | 3300025926 | Ga0207659_10506020 | Ga0207659_105060202 | 112 |
| 471 | 3300025926 | Ga0207659_10519516 | Ga0207659_105195162 | 112 |
| 472 | 3300025926 | Ga0207659_10861505 | Ga0207659_108615052 | 112 |
| 473 | 3300025927 | Ga0207687_10008565 | Ga0207687_100085654 | 112 |
| 474 | 3300025927 | Ga0207687_10355086 | Ga0207687_103550862 | 112 |
| 475 | 3300025927 | Ga0207687_10409440 | Ga0207687_104094402 | 112 |
| 476 | 3300025927 | Ga0207687_10606097 | Ga0207687_106060972 | 112 |
| 477 | 3300025927 | Ga0207687_11720477 | Ga0207687_117204771 | 112 |
| 478 | 3300025927 | Ga0207687_11844587 | Ga0207687_118445871 | 112 |
| 479 | 3300025928 | Ga0207700_10368001 | Ga0207700_103680012 | 112 |
| 480 | 3300025929 | Ga0207664_10306616 | Ga0207664_103066162 | 112 |
| 481 | 3300025931 | Ga0207644_10015963 | Ga0207644_100159634 | 112 |
| 482 | 3300025931 | Ga0207644_10254235 | Ga0207644_102542352 | 112 |
| 483 | 3300025931 | Ga0207644_10860453 | Ga0207644_108604532 | 112 |
| 484 | 3300025933 | Ga0207706_10117651 | Ga0207706_101176512 | 112 |
| 485 | 3300025933 | Ga0207706_10154164 | Ga0207706_101541642 | 112 |
| 486 | 3300025933 | Ga0207706_10676719 | Ga0207706_106767192 | 112 |
| 487 | 3300025934 | Ga0207686_10011200 | Ga0207686_100112002 | 112 |
| 488 | 3300025935 | Ga0207709_10003260 | Ga0207709_100032602 | 112 |
| 489 | 3300025935 | Ga0207709_10015301 | Ga0207709_100153015 | 112 |
| 490 | 3300025935 | Ga0207709_10092039 | Ga0207709_100920392 | 112 |
| 491 | 3300025935 | Ga0207709_11533997 | Ga0207709_115339972 | 112 |
| 492 | 3300025935 | Ga0207709_11677443 | Ga0207709_116774432 | 112 |
| 493 | 3300025936 | Ga0207670_10010371 | Ga0207670_100103716 | 112 |
| 494 | 3300025937 | Ga0207669_10019511 | Ga0207669_100195111 | 112 |
| 495 | 3300025937 | Ga0207669_11789508 | Ga0207669_117895081 | 112 |
| 496 | 3300025938 | Ga0207704_10064689 | Ga0207704_100646892 | 112 |
| 497 | 3300025938 | Ga0207704_10118500 | Ga0207704_101185001 | 112 |
| 498 | 3300025938 | Ga0207704_10702727 | Ga0207704_107027271 | 112 |
| 499 | 3300025939 | Ga0207665_10621534 | Ga0207665_106215341 | 112 |
| 500 | 3300025940 | Ga0207691_10004487 | Ga0207691_1000448711 | 112 |
| 501 | 3300025940 | Ga0207691_10033350 | Ga0207691_100333503 | 112 |
| 502 | 3300025940 | Ga0207691_10060567 | Ga0207691_100605674 | 112 |
| 503 | 3300025940 | Ga0207691_10091311 | Ga0207691_100913112 | 112 |
| 504 | 3300025940 | Ga0207691_10193180 | Ga0207691_101931802 | 112 |
| 505 | 3300025940 | Ga0207691_10873224 | Ga0207691_108732242 | 112 |
| 506 | 3300025941 | Ga0207711_10243081 | Ga0207711_102430812 | 112 |
| 507 | 3300025941 | Ga0207711_10253640 | Ga0207711_102536402 | 112 |
| 508 | 3300025941 | Ga0207711_10336820 | Ga0207711_103368201 | 112 |
| 509 | 3300025941 | Ga0207711_10357472 | Ga0207711_103574723 | 112 |
| 510 | 3300025941 | Ga0207711_11098577 | Ga0207711_110985772 | 112 |
| 511 | 3300025941 | Ga0207711_11225471 | Ga0207711_112254712 | 112 |
| 512 | 3300025942 | Ga0207689_10001602 | Ga0207689_1000160214 | 112 |
| 513 | 3300025942 | Ga0207689_10002140 | Ga0207689_1000214021 | 112 |
| 514 | 3300025942 | Ga0207689_10022610 | Ga0207689_100226105 | 112 |
| 515 | 3300025942 | Ga0207689_10134055 | Ga0207689_101340553 | 112 |
| 516 | 3300025942 | Ga0207689_10439543 | Ga0207689_104395432 | 112 |
| 517 | 3300025944 | Ga0207661_10068140 | Ga0207661_100681404 | 112 |
| 518 | 3300025944 | Ga0207661_10138200 | Ga0207661_101382002 | 112 |
| 519 | 3300025945 | Ga0207679_10008635 | Ga0207679_100086352 | 112 |
| 520 | 3300025945 | Ga0207679_10040313 | Ga0207679_100403132 | 112 |
| 521 | 3300025945 | Ga0207679_10515944 | Ga0207679_105159442 | 112 |
| 522 | 3300025945 | Ga0207679_10748737 | Ga0207679_107487372 | 112 |
| 523 | 3300025945 | Ga0207679_10925411 | Ga0207679_109254111 | 112 |
| 524 | 3300025945 | Ga0207679_11384647 | Ga0207679_113846472 | 112 |
| 525 | 3300025949 | Ga0207667_10018765 | Ga0207667_100187657 | 112 |
| 526 | 3300025949 | Ga0207667_10047346 | Ga0207667_100473462 | 112 |
| 527 | 3300025949 | Ga0207667_10611192 | Ga0207667_106111922 | 112 |
| 528 | 3300025960 | Ga0207651_10223928 | Ga0207651_102239282 | 112 |
| 529 | 3300025960 | Ga0207651_10606709 | Ga0207651_106067092 | 112 |
| 530 | 3300025960 | Ga0207651_11282564 | Ga0207651_112825642 | 112 |
| 531 | 3300025961 | Ga0207712_10164157 | Ga0207712_101641572 | 112 |
| 532 | 3300025961 | Ga0207712_10269282 | Ga0207712_102692822 | 112 |
| 533 | 3300025961 | Ga0207712_10288885 | Ga0207712_102888852 | 112 |
| 534 | 3300025961 | Ga0207712_11853793 | Ga0207712_118537931 | 112 |
| 535 | 3300025961 | Ga0207712_11854197 | Ga0207712_118541971 | 112 |
| 536 | 3300025972 | Ga0207668_10039842 | Ga0207668_100398422 | 112 |
| 537 | 3300025972 | Ga0207668_10212146 | Ga0207668_102121462 | 112 |
| 538 | 3300025972 | Ga0207668_10571838 | Ga0207668_105718381 | 112 |
| 539 | 3300025972 | Ga0207668_10617292 | Ga0207668_106172922 | 112 |
| 540 | 3300025981 | Ga0207640_10010078 | Ga0207640_100100784 | 112 |
| 541 | 3300025981 | Ga0207640_10057871 | Ga0207640_100578713 | 112 |
| 542 | 3300025981 | Ga0207640_10061867 | Ga0207640_100618672 | 112 |
| 543 | 3300025981 | Ga0207640_10173292 | Ga0207640_101732922 | 112 |
| 544 | 3300025986 | Ga0207658_10013887 | Ga0207658_100138878 | 112 |
| 545 | 3300025986 | Ga0207658_10039087 | Ga0207658_100390871 | 112 |
| 546 | 3300025986 | Ga0207658_10154139 | Ga0207658_101541392 | 112 |
| 547 | 3300025986 | Ga0207658_10354194 | Ga0207658_103541943 | 112 |
| 548 | 3300025986 | Ga0207658_10389701 | Ga0207658_103897012 | 112 |
| 549 | 3300025986 | Ga0207658_11127817 | Ga0207658_111278171 | 112 |
| 550 | 3300026023 | Ga0207677_10008875 | Ga0207677_100088758 | 112 |
| 551 | 3300026023 | Ga0207677_10059362 | Ga0207677_100593622 | 112 |
| 552 | 3300026023 | Ga0207677_10104206 | Ga0207677_101042062 | 112 |
| 553 | 3300026023 | Ga0207677_10116499 | Ga0207677_101164993 | 112 |
| 554 | 3300026035 | Ga0207703_10001278 | Ga0207703_1000127817 | 112 |
| 555 | 3300026035 | Ga0207703_10029403 | Ga0207703_100294031 | 112 |
| 556 | 3300026035 | Ga0207703_10078750 | Ga0207703_100787502 | 112 |
| 557 | 3300026041 | Ga0207639_10693086 | Ga0207639_106930862 | 112 |
| 558 | 3300026041 | Ga0207639_10697948 | Ga0207639_106979482 | 112 |
| 559 | 3300026067 | Ga0207678_10000473 | Ga0207678_1000047310 | 112 |
| 560 | 3300026067 | Ga0207678_10205504 | Ga0207678_102055042 | 112 |
| 561 | 3300026067 | Ga0207678_10208716 | Ga0207678_102087162 | 112 |
| 562 | 3300026067 | Ga0207678_10312398 | Ga0207678_103123982 | 112 |
| 563 | 3300026067 | Ga0207678_10375123 | Ga0207678_103751232 | 112 |
| 564 | 3300026067 | Ga0207678_10937314 | Ga0207678_109373141 | 112 |
| 565 | 3300026075 | Ga0207708_10000303 | Ga0207708_100003032 | 112 |
| 566 | 3300026078 | Ga0207702_10000199 | Ga0207702_1000019940 | 112 |
| 567 | 3300026078 | Ga0207702_10769020 | Ga0207702_107690202 | 112 |
| 568 | 3300026078 | Ga0207702_10779771 | Ga0207702_107797712 | 112 |
| 569 | 3300026088 | Ga0207641_10069900 | Ga0207641_100699003 | 112 |
| 570 | 3300026088 | Ga0207641_10152819 | Ga0207641_101528193 | 112 |
| 571 | 3300026088 | Ga0207641_10709242 | Ga0207641_107092422 | 112 |
| 572 | 3300026088 | Ga0207641_10824435 | Ga0207641_108244351 | 112 |
| 573 | 3300026088 | Ga0207641_11636214 | Ga0207641_116362141 | 112 |
| 574 | 3300026089 | Ga0207648_10000989 | Ga0207648_100009899 | 112 |
| 575 | 3300026089 | Ga0207648_10001210 | Ga0207648_1000121025 | 112 |
| 576 | 3300026089 | Ga0207648_10002261 | Ga0207648_100022614 | 112 |
| 577 | 3300026089 | Ga0207648_10005878 | Ga0207648_1000587812 | 112 |
| 578 | 3300026089 | Ga0207648_10023717 | Ga0207648_100237173 | 112 |
| 579 | 3300026089 | Ga0207648_10177063 | Ga0207648_101770633 | 112 |
| 580 | 3300026089 | Ga0207648_10211059 | Ga0207648_102110592 | 112 |
| 581 | 3300026089 | Ga0207648_11358921 | Ga0207648_113589212 | 112 |
| 582 | 3300026095 | Ga0207676_10001174 | Ga0207676_1000117417 | 112 |
| 583 | 3300026095 | Ga0207676_10444026 | Ga0207676_104440262 | 112 |
| 584 | 3300026095 | Ga0207676_10838016 | Ga0207676_108380161 | 112 |
| 585 | 3300026095 | Ga0207676_11955823 | Ga0207676_119558231 | 112 |
| 586 | 3300026116 | Ga0207674_10002529 | Ga0207674_1000252910 | 112 |
| 587 | 3300026116 | Ga0207674_10002678 | Ga0207674_1000267819 | 112 |
| 588 | 3300026116 | Ga0207674_10223653 | Ga0207674_102236533 | 112 |
| 589 | 3300026116 | Ga0207674_10346593 | Ga0207674_103465932 | 112 |
| 590 | 3300026118 | Ga0207675_100007517 | Ga0207675_1000075175 | 112 |
| 591 | 3300026118 | Ga0207675_100012286 | Ga0207675_10001228611 | 112 |
| 592 | 3300026118 | Ga0207675_100053002 | Ga0207675_1000530022 | 112 |
| 593 | 3300026118 | Ga0207675_100490497 | Ga0207675_1004904973 | 112 |
| 594 | 3300026118 | Ga0207675_100785176 | Ga0207675_1007851761 | 112 |
| 595 | 3300026121 | Ga0207683_10003640 | Ga0207683_1000364011 | 112 |
| 596 | 3300026121 | Ga0207683_10019235 | Ga0207683_100192357 | 112 |
| 597 | 3300026121 | Ga0207683_10134817 | Ga0207683_101348172 | 112 |
| 598 | 3300026121 | Ga0207683_10455791 | Ga0207683_104557912 | 112 |
| 599 | 3300026121 | Ga0207683_10722411 | Ga0207683_107224112 | 112 |
| 600 | 3300026142 | Ga0207698_10011109 | Ga0207698_100111096 | 112 |
| 601 | 3300026142 | Ga0207698_10047615 | Ga0207698_100476152 | 112 |
| 602 | 3300026142 | Ga0207698_10054580 | Ga0207698_100545804 | 112 |
| 603 | 3300026142 | Ga0207698_11001758 | Ga0207698_110017582 | 112 |
| 604 | 3300027296 | Ga0209389_1016990 | Ga0209389_10169904 | 112 |
| 605 | 3300027312 | Ga0209371_1041869 | Ga0209371_10418691 | 112 |
| 606 | 3300027614 | Ga0209970_1000375 | Ga0209970_10003756 | 112 |
| 607 | 3300027876 | Ga0209974_10018581 | Ga0209974_100185812 | 112 |
| 608 | 3300027876 | Ga0209974_10026701 | Ga0209974_100267012 | 112 |
| 609 | 3300027907 | Ga0207428_10128569 | Ga0207428_101285692 | 112 |
| 610 | 3300028379 | Ga0268266_10063069 | Ga0268266_100630692 | 112 |
| 611 | 3300028379 | Ga0268266_10159918 | Ga0268266_101599183 | 112 |
| 612 | 3300028379 | Ga0268266_11460086 | Ga0268266_114600861 | 112 |
| 613 | 3300028380 | Ga0268265_10016585 | Ga0268265_100165853 | 112 |
| 614 | 3300028380 | Ga0268265_10069764 | Ga0268265_100697643 | 112 |
| 615 | 3300028380 | Ga0268265_10907858 | Ga0268265_109078582 | 112 |
| 616 | 3300028380 | Ga0268265_12089455 | Ga0268265_120894551 | 112 |
| 617 | 3300028381 | Ga0268264_10002240 | Ga0268264_100022405 | 112 |
| 618 | 3300028381 | Ga0268264_10280643 | Ga0268264_102806432 | 112 |
| 619 | 3300028381 | Ga0268264_10365844 | Ga0268264_103658441 | 112 |
| 620 | 3300028381 | Ga0268264_10622522 | Ga0268264_106225221 | 112 |
| 621 | 3300028381 | Ga0268264_10815731 | Ga0268264_108157312 | 112 |
| 622 | 3300028381 | Ga0268264_11228319 | Ga0268264_112283192 | 112 |
| 623 | 3300028381 | Ga0268264_12426213 | Ga0268264_124262131 | 112 |
| 624 | 3300028558 | Ga0265326_10044657 | Ga0265326_100446572 | 112 |
| 625 | 3300028794 | Ga0307515_10015579 | Ga0307515_1001557910 | 112 |
| 626 | 3300028794 | Ga0307515_10034448 | Ga0307515_100344484 | 112 |
| 627 | 3300028794 | Ga0307515_10319825 | Ga0307515_103198252 | 112 |
| 628 | 3300028800 | Ga0265338_11029938 | Ga0265338_110299381 | 112 |
| 629 | 3300030500 | Ga0268256_1035716 | Ga0268256_10357162 | 112 |
| 630 | 3300031235 | Ga0265330_10104424 | Ga0265330_101044242 | 112 |
| 631 | 3300031238 | Ga0265332_10000003 | Ga0265332_10000003215 | 112 |
| 632 | 3300031238 | Ga0265332_10047978 | Ga0265332_100479781 | 112 |
| 633 | 3300031239 | Ga0265328_10056596 | Ga0265328_100565962 | 112 |
| 634 | 3300031250 | Ga0265331_10009862 | Ga0265331_100098624 | 112 |
| 635 | 3300031250 | Ga0265331_10152723 | Ga0265331_101527232 | 112 |
| 636 | 3300031250 | Ga0265331_10393606 | Ga0265331_103936062 | 112 |
| 637 | 3300031251 | Ga0265327_10000639 | Ga0265327_1000063948 | 112 |
| 638 | 3300031251 | Ga0265327_10281483 | Ga0265327_102814831 | 112 |
| 639 | 3300031251 | Ga0265327_10291881 | Ga0265327_102918812 | 112 |
| 640 | 3300031344 | Ga0265316_10299230 | Ga0265316_102992302 | 112 |
| 641 | 3300031456 | Ga0307513_10886298 | Ga0307513_108862981 | 112 |
| 642 | 3300031548 | Ga0307408_100000008 | Ga0307408_100000008157 | 112 |
| 643 | 3300031548 | Ga0307408_100010784 | Ga0307408_1000107842 | 112 |
| 644 | 3300031548 | Ga0307408_100139882 | Ga0307408_1001398823 | 112 |
| 645 | 3300031548 | Ga0307408_100166112 | Ga0307408_1001661122 | 112 |
| 646 | 3300031548 | Ga0307408_100500722 | Ga0307408_1005007221 | 112 |
| 647 | 3300031548 | Ga0307408_100810674 | Ga0307408_1008106741 | 112 |
| 648 | 3300031548 | Ga0307408_101869776 | Ga0307408_1018697761 | 112 |
| 649 | 3300031649 | Ga0307514_10009729 | Ga0307514_100097297 | 112 |
| 650 | 3300031711 | Ga0265314_10006842 | Ga0265314_100068426 | 112 |
| 651 | 3300031711 | Ga0265314_10173303 | Ga0265314_101733032 | 112 |
| 652 | 3300031728 | Ga0316578_10297624 | Ga0316578_102976242 | 112 |
| 653 | 3300031728 | Ga0316578_10734005 | Ga0316578_107340051 | 112 |
| 654 | 3300031730 | Ga0307516_10046181 | Ga0307516_100461813 | 112 |
| 655 | 3300031730 | Ga0307516_10489805 | Ga0307516_104898051 | 112 |
| 656 | 3300031731 | Ga0307405_11081714 | Ga0307405_110817142 | 112 |
| 657 | 3300031733 | Ga0316577_10112505 | Ga0316577_101125052 | 112 |
| 658 | 3300031824 | Ga0307413_10066854 | Ga0307413_100668543 | 112 |
| 659 | 3300031824 | Ga0307413_11824667 | Ga0307413_118246671 | 112 |
| 660 | 3300031852 | Ga0307410_10233903 | Ga0307410_102339032 | 112 |
| 661 | 3300031852 | Ga0307410_10463845 | Ga0307410_104638452 | 112 |
| 662 | 3300031901 | Ga0307406_10283571 | Ga0307406_102835711 | 112 |
| 663 | 3300031901 | Ga0307406_10813340 | Ga0307406_108133401 | 112 |
| 664 | 3300031903 | Ga0307407_10125131 | Ga0307407_101251313 | 112 |
| 665 | 3300031911 | Ga0307412_10071470 | Ga0307412_100714703 | 112 |
| 666 | 3300031911 | Ga0307412_11905926 | Ga0307412_119059261 | 112 |
| 667 | 3300031995 | Ga0307409_100832962 | Ga0307409_1008329622 | 112 |
| 668 | 3300032002 | Ga0307416_100406253 | Ga0307416_1004062532 | 112 |
| 669 | 3300032002 | Ga0307416_100457337 | Ga0307416_1004573372 | 112 |
| 670 | 3300032004 | Ga0307414_10005408 | Ga0307414_100054085 | 112 |
| 671 | 3300032004 | Ga0307414_10077234 | Ga0307414_100772341 | 112 |
| 672 | 3300032005 | Ga0307411_10002403 | Ga0307411_100024033 | 112 |
| 673 | 3300032005 | Ga0307411_10046584 | Ga0307411_100465842 | 112 |
| 674 | 3300032005 | Ga0307411_10059237 | Ga0307411_100592373 | 112 |
| 675 | 3300032005 | Ga0307411_10098512 | Ga0307411_100985122 | 112 |
| 676 | 3300032005 | Ga0307411_11054269 | Ga0307411_110542691 | 112 |
| 677 | 3300032005 | Ga0307411_11527810 | Ga0307411_115278101 | 112 |
| 678 | 3300032126 | Ga0307415_100972357 | Ga0307415_1009723572 | 112 |
| 679 | 3300032126 | Ga0307415_101463994 | Ga0307415_1014639942 | 112 |
| 680 | 3300032133 | Ga0316583_10000505 | Ga0316583_100005056 | 112 |
| 681 | 3300032133 | Ga0316583_10046522 | Ga0316583_100465222 | 112 |
| 682 | 3300032137 | Ga0316585_10090382 | Ga0316585_100903822 | 112 |
| 683 | 3300032139 | Ga0316580_10006497 | Ga0316580_100064972 | 112 |
| 684 | 3300032168 | Ga0316593_10017449 | Ga0316593_100174492 | 112 |
| 685 | 3300032168 | Ga0316593_10075960 | Ga0316593_100759602 | 112 |
| 686 | 3300032168 | Ga0316593_10339833 | Ga0316593_103398331 | 112 |
| 687 | 3300033180 | Ga0307510_10010932 | Ga0307510_100109327 | 112 |
| 688 | 3300033524 | Ga0316592_1009074 | Ga0316592_10090742 | 112 |
| 689 | 3300033524 | Ga0316592_1011917 | Ga0316592_10119171 | 112 |
| 690 | 3300033524 | Ga0316592_1066976 | Ga0316592_10669762 | 112 |
| 691 | 3300033528 | Ga0316588_1011413 | Ga0316588_10114132 | 112 |
| 692 | 3300033528 | Ga0316588_1030504 | Ga0316588_10305041 | 112 |
| 693 | 3300033528 | Ga0316588_1082867 | Ga0316588_10828672 | 112 |
| 694 | 3300033528 | Ga0316588_1159407 | Ga0316588_11594071 | 112 |
| 695 | 3300033541 | Ga0316596_1008073 | Ga0316596_10080732 | 112 |
| 696 | 3300033541 | Ga0316596_1015318 | Ga0316596_10153182 | 112 |
| 697 | 3300033541 | Ga0316596_1023247 | Ga0316596_10232472 | 112 |
| 698 | 3300033541 | Ga0316596_1091781 | Ga0316596_10917812 | 112 |
| 699 | 3300034817 | Ga0373948_0013571 | Ga0373948_0013571_187_525 | 112 |
| 700 | 3300034817 | Ga0373948_0177691 | Ga0373948_0177691_81_434 | 112 |
| 701 | 3300034818 | Ga0373950_0004828 | Ga0373950_0004828_1386_1724 | 112 |
| 702 | 3300034820 | Ga0373959_0011480 | Ga0373959_0011480_1000_1338 | 112 |
| 703 | 3300035088 | Ga0373940_0360028 | Ga0373940_0360028_53_391 | 112 |
| 704 | 3300035089 | Ga0373944_0056740 | Ga0373944_0056740_654_992 | 112 |
| 705 | 3300035113 | Ga0373936_0044210 | Ga0373936_0044210_183_521 | 112 |
| 706 | 3300035114 | Ga0373939_0000087 | Ga0373939_0000087_28412_28750 | 112 |
| 707 | 3300035114 | Ga0373939_0046994 | Ga0373939_0046994_371_709 | 112 |
| 708 | 3300035121 | Ga0373960_0001671 | Ga0373960_0001671_2140_2478 | 112 |
| 709 | 3300035170 | Ga0373943_0006120 | Ga0373943_0006120_4987_5325 | 112 |
| 710 | 3300035170 | Ga0373943_0329173 | Ga0373943_0329173_191_529 | 112 |
| 711 | 3300035172 | Ga0373955_0317179 | Ga0373955_0317179_476_868 | 112 |
| 712 | 3300035172 | Ga0373955_0832678 | Ga0373955_0832678_132_470 | 112 |
| 713 | 3300035398 | Ga0316574_0123163 | Ga0316574_0123163_872_1210 | 112 |
| 714 | 3300035691 | Ga0373931_0028446 | Ga0373931_0028446_2054_2392 | 112 |
| 715 | 3300035692 | Ga0373935_0260506 | Ga0373935_0260506_411_749 | 112 |
| 716 | 3300035692 | Ga0373935_0374048 | Ga0373935_0374048_309_647 | 112 |
| 717 | 3300035692 | Ga0373935_1164537 | Ga0373935_1164537_108_446 | 112 |
| 718 | 3300035724 | Ga0373933_0155594 | Ga0373933_0155594_900_1244 | 112 |
| 719 | 3300035724 | Ga0373933_0230600 | Ga0373933_0230600_228_566 | 112 |
| 720 | 3300035724 | Ga0373933_0895212 | Ga0373933_0895212_20_412 | 112 |
| 721 | 3300035724 | Ga0373933_0896887 | Ga0373933_0896887_192_530 | 112 |
| 722 | 3300036401 | Ga0373937_0264803 | Ga0373937_0264803_1024_1416 | 112 |
| 723 | 3300036401 | Ga0373937_0637354 | Ga0373937_0637354_185_523 | 112 |
| 724 | 3300036457 | Ga0265778_045304 | Ga0265778_045304_67_405 | 112 |
| 725 | 3300036647 | Ga0316582_0011992 | Ga0316582_0011992_2175_2513 | 112 |
| 726 | 3300036647 | Ga0316582_0139318 | Ga0316582_0139318_1184_1522 | 112 |
| 727 | 3300036647 | Ga0316582_0256101 | Ga0316582_0256101_97_465 | 112 |
| 728 | 3300036647 | Ga0316582_0802616 | Ga0316582_0802616_257_625 | 112 |
| 729 | 3300036647 | Ga0316582_0836391 | Ga0316582_0836391_39_377 | 112 |
| 730 | 3300036712 | Ga0316584_0191418 | Ga0316584_0191418_29_367 | 112 |
| 731 | 3300036712 | Ga0316584_0313368 | Ga0316584_0313368_343_681 | 112 |
| 732 | 3300037068 | Ga0373925_0003208 | Ga0373925_0003208_1108_1446 | 112 |
| 733 | 3300037068 | Ga0373925_0018461 | Ga0373925_0018461_1185_1523 | 112 |
| 734 | 3300037068 | Ga0373925_0158168 | Ga0373925_0158168_1384_1722 | 112 |
| 735 | 3300037068 | Ga0373925_0158692 | Ga0373925_0158692_1149_1487 | 112 |
| 736 | 3300037312 | Ga0395899_0001756 | Ga0395899_0001756_2293_2631 | 112 |
| 737 | 3300037312 | Ga0395899_0222706 | Ga0395899_0222706_460_798 | 112 |
| 738 | 3300037312 | Ga0395899_0983985 | Ga0395899_0983985_136_474 | 112 |
| 739 | 3300037418 | Ga0395900_0004771 | Ga0395900_0004771_6322_6660 | 112 |
| 740 | 3300037418 | Ga0395900_0026850 | Ga0395900_0026850_5424_5762 | 112 |
| 741 | 3300037418 | Ga0395900_0124112 | Ga0395900_0124112_1713_2051 | 112 |
| 742 | 3300037418 | Ga0395900_0403427 | Ga0395900_0403427_867_1205 | 112 |
| 743 | 3300037466 | Ga0395898_0009054 | Ga0395898_0009054_3492_3830 | 112 |
| 744 | 3300037466 | Ga0395898_0010085 | Ga0395898_0010085_8359_8697 | 112 |
| 745 | 3300037466 | Ga0395898_0517414 | Ga0395898_0517414_102_440 | 112 |
| 746 | 3300037471 | Ga0395905_0000766 | Ga0395905_0000766_38438_38776 | 112 |
| 747 | 3300037471 | Ga0395905_0001291 | Ga0395905_0001291_5644_5982 | 112 |
| 748 | 3300037471 | Ga0395905_0004548 | Ga0395905_0004548_7614_7952 | 112 |
| 749 | 3300037471 | Ga0395905_0052309 | Ga0395905_0052309_2910_3248 | 112 |
| 750 | 3300037471 | Ga0395905_0059255 | Ga0395905_0059255_1474_1812 | 112 |
| 751 | 3300037471 | Ga0395905_1032633 | Ga0395905_1032633_53_391 | 112 |
| 752 | 3300037471 | Ga0395905_1759121 | Ga0395905_1759121_13_351 | 112 |
| 753 | 3300037471 | Ga0395905_1783186 | Ga0395905_1783186_25_363 | 112 |
| 754 | 3300038443 | Ga0395901_0007642 | Ga0395901_0007642_7295_7633 | 112 |
| 755 | 3300038443 | Ga0395901_0019770 | Ga0395901_0019770_3728_4066 | 112 |
| 756 | 3300038443 | Ga0395901_0117284 | Ga0395901_0117284_114_452 | 112 |
| 757 | 3300038443 | Ga0395901_0360516 | Ga0395901_0360516_746_1084 | 112 |
| 758 | 3300039093 | Ga0400489_45479 | Ga0400489_45479_8735_9106 | 112 |
| 759 | 3300039438 | Ga0436360_0744003 | Ga0436360_0744003_96_434 | 112 |
| 760 | 3300039438 | Ga0436360_1242945 | Ga0436360_1242945_47_385 | 112 |
| 761 | 3300039447 | Ga0436361_0279516 | Ga0436361_0279516_1726_2064 | 112 |
| 762 | 3300039447 | Ga0436361_0287447 | Ga0436361_0287447_95946_96284 | 112 |
| 763 | 3300039447 | Ga0436361_0678114 | Ga0436361_0678114_5960_6298 | 112 |
| 764 | 3300039447 | Ga0436361_0705591 | Ga0436361_0705591_288_626 | 112 |
| 765 | 3300039450 | Ga0436363_0441867 | Ga0436363_0441867_472_810 | 112 |
| 766 | 3300039450 | Ga0436363_0596578 | Ga0436363_0596578_99_437 | 112 |
| 767 | 3300039450 | Ga0436363_0815012 | Ga0436363_0815012_83_421 | 112 |
| 768 | 3300039450 | Ga0436363_1031840 | Ga0436363_1031840_135_473 | 112 |
| 769 | 3300039450 | Ga0436363_1464495 | Ga0436363_1464495_367_705 | 112 |
| 770 | 3300039453 | Ga0436362_1021080 | Ga0436362_1021080_160_498 | 112 |
| 771 | 3300041411 | Ga0439466_0082200 | Ga0439466_0082200_136_474 | 112 |
| 772 | 3300041441 | Ga0451787_030105 | Ga0451787_030105_196_534 | 112 |
| 773 | 3300041441 | Ga0451787_668171 | Ga0451787_668171_32_370 | 112 |
| 774 | 3300041451 | Ga0451791_1086428 | Ga0451791_1086428_32_370 | 112 |
| 775 | 3300041460 | Ga0451802_0131515 | Ga0451802_0131515_367_705 | 112 |
| 776 | 3300041486 | Ga0451807_2119567 | Ga0451807_2119567_555_893 | 112 |
| 777 | 3300041494 | Ga0451837_0043705 | Ga0451837_0043705_152_490 | 112 |
| 778 | 3300041494 | Ga0451837_0666052 | Ga0451837_0666052_120_458 | 112 |
| 779 | 3300041494 | Ga0451837_1120325 | Ga0451837_1120325_176_514 | 112 |
| 780 | 3300041498 | Ga0451841_0206002 | Ga0451841_0206002_207_545 | 112 |
| 781 | 3300041501 | Ga0451845_0380090 | Ga0451845_0380090_44_382 | 112 |
| 782 | 3300041501 | Ga0451845_0830242 | Ga0451845_0830242_41_379 | 112 |
| 783 | 3300041511 | Ga0451855_0132408 | Ga0451855_0132408_132_470 | 112 |
| 784 | 3300041512 | Ga0451853_1463132 | Ga0451853_1463132_512_850 | 112 |
| 785 | 3300042115 | Ga0450911_000894 | Ga0450911_000894_3724_4062 | 112 |
| 786 | 3300042120 | Ga0450917_001378 | Ga0450917_001378_1254_1592 | 112 |
| 787 | 3300042126 | Ga0450888_005029 | Ga0450888_005029_642_980 | 112 |
| 788 | 3300042127 | Ga0450890_001901 | Ga0450890_001901_1340_1678 | 112 |
| 789 | 3300042127 | Ga0450890_004383 | Ga0450890_004383_207_545 | 112 |
| 790 | 3300042129 | Ga0450891_001710 | Ga0450891_001710_1239_1577 | 112 |
| 791 | 3300042130 | Ga0450892_001476 | Ga0450892_001476_1562_1900 | 112 |
| 792 | 3300042137 | Ga0450902_006744 | Ga0450902_006744_555_893 | 112 |
| 793 | 3300042138 | Ga0450903_007325 | Ga0450903_007325_136_474 | 112 |
| 794 | 3300042438 | Ga0439459_0003448 | Ga0439459_0003448_1112_1450 | 112 |
| 795 | 3300042438 | Ga0439459_0103217 | Ga0439459_0103217_26_364 | 112 |
| 796 | 3300042461 | Ga0439460_0264163 | Ga0439460_0264163_139_534 | 112 |
| 797 | 3300042532 | Ga0450893_0006035 | Ga0450893_0006035_985_1323 | 112 |
| 798 | 3300042876 | Ga0451577_0000114 | Ga0451577_0000114_15119_15457 | 112 |
| 799 | 3300042876 | Ga0451577_0000794 | Ga0451577_0000794_4189_4527 | 112 |
| 800 | 3300042876 | Ga0451577_0159878 | Ga0451577_0159878_1197_1535 | 112 |
| 801 | 3300042876 | Ga0451577_0631408 | Ga0451577_0631408_407_745 | 112 |
| 802 | 3300042876 | Ga0451577_0687709 | Ga0451577_0687709_552_890 | 112 |
| 803 | 3300044658 | Ga0466972_0084766 | Ga0466972_0084766_614_952 | 112 |
| 804 | 3300044673 | Ga0453683_0180180 | Ga0453683_0180180_20_358 | 112 |
| 805 | 3300044673 | Ga0453683_0629555 | Ga0453683_0629555_334_672 | 112 |
| 806 | 3300044683 | Ga0466965_0117317 | Ga0466965_0117317_346_684 | 112 |
| 807 | 3300044683 | Ga0466965_0505387 | Ga0466965_0505387_321_659 | 112 |
| 808 | 3300044684 | Ga0466966_0103684 | Ga0466966_0103684_682_1020 | 112 |
| 809 | 3300044684 | Ga0466966_0198910 | Ga0466966_0198910_201_539 | 112 |
| 810 | 3300044694 | Ga0466963_0145702 | Ga0466963_0145702_206_544 | 112 |
| 811 | 3300044694 | Ga0466963_0371434 | Ga0466963_0371434_447_785 | 112 |
| 812 | 3300044712 | Ga0453684_0001710 | Ga0453684_0001710_15184_15522 | 112 |
| 813 | 3300044712 | Ga0453684_0068382 | Ga0453684_0068382_3635_3973 | 112 |
| 814 | 3300044712 | Ga0453684_0326156 | Ga0453684_0326156_1029_1367 | 112 |
| 815 | 3300044712 | Ga0453684_1349225 | Ga0453684_1349225_133_471 | 112 |
| 816 | 3300044712 | Ga0453684_2004800 | Ga0453684_2004800_94_489 | 112 |
| 817 | 3300044712 | Ga0453684_2054193 | Ga0453684_2054193_96_434 | 112 |
| 818 | 3300044735 | Ga0466968_0147808 | Ga0466968_0147808_645_983 | 112 |
| 819 | 3300044735 | Ga0466968_0306713 | Ga0466968_0306713_96_434 | 112 |
| 820 | 3300044842 | Ga0466957_0216089 | Ga0466957_0216089_162_500 | 112 |
| 821 | 3300044901 | Ga0466960_0089877 | Ga0466960_0089877_744_1082 | 112 |
| 822 | 3300044901 | Ga0466960_0746211 | Ga0466960_0746211_21_359 | 112 |
| 823 | 3300045051 | Ga0451576_0000099 | Ga0451576_0000099_198636_198974 | 112 |
| 824 | 3300045051 | Ga0451576_0000335 | Ga0451576_0000335_12341_12679 | 112 |
| 825 | 3300045051 | Ga0451576_0006435 | Ga0451576_0006435_3353_3691 | 112 |
| 826 | 3300045051 | Ga0451576_0012757 | Ga0451576_0012757_3190_3528 | 112 |
| 827 | 3300045051 | Ga0451576_0104147 | Ga0451576_0104147_54_392 | 112 |
| 828 | 3300045051 | Ga0451576_0239277 | Ga0451576_0239277_1520_1858 | 112 |
| 829 | 3300045051 | Ga0451576_0504691 | Ga0451576_0504691_321_659 | 112 |
| 830 | 3300045051 | Ga0451576_1363199 | Ga0451576_1363199_211_606 | 112 |
| 831 | 3300045976 | Ga0466967_1369738 | Ga0466967_1369738_324_662 | 112 |
| 832 | 3300046455 | Ga0495603_0321590 | Ga0495603_0321590_183_521 | 112 |
| 833 | 3300046457 | Ga0495590_0001778 | Ga0495590_0001778_4307_4645 | 112 |
| 834 | 3300046457 | Ga0495590_0059944 | Ga0495590_0059944_731_1069 | 112 |
| 835 | 3300046457 | Ga0495590_0096535 | Ga0495590_0096535_345_683 | 112 |
| 836 | 3300046459 | Ga0495629_0256849 | Ga0495629_0256849_460_798 | 112 |
| 837 | 3300046459 | Ga0495629_0483610 | Ga0495629_0483610_480_818 | 112 |
| 838 | 3300046463 | Ga0495653_0111372 | Ga0495653_0111372_843_1181 | 112 |
| 839 | 3300046471 | Ga0495650_0044940 | Ga0495650_0044940_151_489 | 112 |
| 840 | 3300046476 | Ga0495662_0048356 | Ga0495662_0048356_1216_1554 | 112 |
| 841 | 3300046477 | Ga0495664_0007416 | Ga0495664_0007416_3574_3912 | 112 |
| 842 | 3300046477 | Ga0495664_0060716 | Ga0495664_0060716_1176_1514 | 112 |
| 843 | 3300046499 | Ga0495594_0586819 | Ga0495594_0586819_74_412 | 112 |
| 844 | 3300046500 | Ga0495596_0056108 | Ga0495596_0056108_897_1235 | 112 |
| 845 | 3300046501 | Ga0495607_0000128 | Ga0495607_0000128_79969_80307 | 112 |
| 846 | 3300046507 | Ga0495606_0005133 | Ga0495606_0005133_4908_5246 | 112 |
| 847 | 3300046507 | Ga0495606_0007947 | Ga0495606_0007947_6702_7040 | 112 |
| 848 | 3300046511 | Ga0495608_0283582 | Ga0495608_0283582_597_941 | 112 |
| 849 | 3300046511 | Ga0495608_0737903 | Ga0495608_0737903_181_519 | 112 |
| 850 | 3300046514 | Ga0495618_0144220 | Ga0495618_0144220_198_536 | 112 |
| 851 | 3300046515 | Ga0495620_0060161 | Ga0495620_0060161_109_447 | 112 |
| 852 | 3300046516 | Ga0495628_0056722 | Ga0495628_0056722_837_1175 | 112 |
| 853 | 3300046516 | Ga0495628_0367036 | Ga0495628_0367036_346_690 | 112 |
| 854 | 3300046519 | Ga0495632_0177607 | Ga0495632_0177607_538_876 | 112 |
| 855 | 3300046522 | Ga0495643_0000363 | Ga0495643_0000363_503_847 | 112 |
| 856 | 3300046523 | Ga0495644_0341347 | Ga0495644_0341347_78_461 | 112 |
| 857 | 3300046529 | Ga0495652_0117812 | Ga0495652_0117812_600_938 | 112 |
| 858 | 3300046530 | Ga0495654_0020792 | Ga0495654_0020792_1317_1655 | 112 |
| 859 | 3300046530 | Ga0495654_0033445 | Ga0495654_0033445_63_401 | 112 |
| 860 | 3300046530 | Ga0495654_0265227 | Ga0495654_0265227_302_640 | 112 |
| 861 | 3300046531 | Ga0495665_0078186 | Ga0495665_0078186_666_1004 | 112 |
| 862 | 3300046535 | Ga0495586_0261995 | Ga0495586_0261995_52_390 | 112 |
| 863 | 3300046536 | Ga0495587_0148275 | Ga0495587_0148275_35_373 | 112 |
| 864 | 3300046542 | Ga0495597_0006061 | Ga0495597_0006061_913_1251 | 112 |
| 865 | 3300046543 | Ga0495645_0019385 | Ga0495645_0019385_2855_3193 | 112 |
| 866 | 3300046543 | Ga0495645_0079259 | Ga0495645_0079259_1243_1581 | 112 |
| 867 | 3300046543 | Ga0495645_0114708 | Ga0495645_0114708_1510_1848 | 112 |
| 868 | 3300046543 | Ga0495645_0424570 | Ga0495645_0424570_479_817 | 112 |
| 869 | 3300046557 | Ga0495622_0157320 | Ga0495622_0157320_184_522 | 112 |
| 870 | 3300046559 | Ga0495667_0635068 | Ga0495667_0635068_113_457 | 112 |
| 871 | 3300046648 | Ga0495611_0472353 | Ga0495611_0472353_128_502 | 112 |
| 872 | 3300046660 | Ga0495625_0008095 | Ga0495625_0008095_340_684 | 112 |
| 873 | 3300046660 | Ga0495625_0181815 | Ga0495625_0181815_480_824 | 112 |
| 874 | 3300046663 | Ga0495635_0322791 | Ga0495635_0322791_524_862 | 112 |
| 875 | 3300046663 | Ga0495635_0345849 | Ga0495635_0345849_592_930 | 112 |
| 876 | 3300046674 | Ga0495588_0320519 | Ga0495588_0320519_439_777 | 112 |
| 877 | 3300046674 | Ga0495588_0339750 | Ga0495588_0339750_432_770 | 112 |
| 878 | 3300046675 | Ga0495657_0038484 | Ga0495657_0038484_2271_2663 | 112 |
| 879 | 3300046678 | Ga0495599_0217271 | Ga0495599_0217271_742_1080 | 112 |
| 880 | 3300046678 | Ga0495599_0707098 | Ga0495599_0707098_120_458 | 112 |
| 881 | 3300046679 | Ga0495623_0057100 | Ga0495623_0057100_491_829 | 112 |
| 882 | 3300046680 | Ga0495646_0076728 | Ga0495646_0076728_1272_1610 | 112 |
| 883 | 3300046680 | Ga0495646_0169371 | Ga0495646_0169371_654_992 | 112 |
| 884 | 3300046683 | Ga0495658_0158634 | Ga0495658_0158634_777_1115 | 112 |
| 885 | 3300046683 | Ga0495658_0594809 | Ga0495658_0594809_227_565 | 112 |
| 886 | 3300046690 | Ga0495624_0065050 | Ga0495624_0065050_1108_1446 | 112 |
| 887 | 3300046690 | Ga0495624_0235589 | Ga0495624_0235589_317_655 | 112 |
| 888 | 3300046692 | Ga0495671_0080454 | Ga0495671_0080454_1198_1536 | 112 |
| 889 | 3300046694 | Ga0495649_0005791 | Ga0495649_0005791_950_1288 | 112 |
| 890 | 3300046694 | Ga0495649_0040011 | Ga0495649_0040011_1118_1456 | 112 |
| 891 | 3300046694 | Ga0495649_0040733 | Ga0495649_0040733_705_1043 | 112 |
| 892 | 3300046694 | Ga0495649_0249808 | Ga0495649_0249808_55_393 | 112 |
| 893 | 3300046809 | Ga0495600_0156726 | Ga0495600_0156726_1057_1395 | 112 |
| 894 | 3300046810 | Ga0495660_0183393 | Ga0495660_0183393_53_391 | 112 |
| 895 | 3300047317 | Ga0495604_0118990 | Ga0495604_0118990_266_604 | 112 |
| 896 | 3300047319 | Ga0495674_0034424 | Ga0495674_0034424_4202_4540 | 112 |
| 897 | 3300047319 | Ga0495674_0794830 | Ga0495674_0794830_38_376 | 112 |
| 898 | 3300047320 | Ga0495672_0000330 | Ga0495672_0000330_745_1089 | 112 |
| 899 | 3300047322 | Ga0495680_0202234 | Ga0495680_0202234_347_685 | 112 |
| 900 | 3300047322 | Ga0495680_0628364 | Ga0495680_0628364_335_673 | 112 |
| 901 | 3300047322 | Ga0495680_0927895 | Ga0495680_0927895_168_506 | 112 |
| 902 | 3300047323 | Ga0495683_0001439 | Ga0495683_0001439_11905_12243 | 112 |
| 903 | 3300047323 | Ga0495683_0040580 | Ga0495683_0040580_1228_1566 | 112 |
| 904 | 3300047323 | Ga0495683_0175268 | Ga0495683_0175268_446_784 | 112 |
| 905 | 3300047443 | Ga0495687_000011 | Ga0495687_000011_78081_78419 | 112 |
| 906 | 3300047443 | Ga0495687_039572 | Ga0495687_039572_1032_1370 | 112 |
| 907 | 3300047443 | Ga0495687_130333 | Ga0495687_130333_418_756 | 112 |
| 908 | 3300047444 | Ga0495675_0191475 | Ga0495675_0191475_679_1017 | 112 |
| 909 | 3300047444 | Ga0495675_0792198 | Ga0495675_0792198_137_481 | 112 |
| 910 | 3300047469 | Ga0495673_0189758 | Ga0495673_0189758_329_667 | 112 |
| 911 | 3300047471 | Ga0495684_0135088 | Ga0495684_0135088_92_430 | 112 |
| 912 | 3300047471 | Ga0495684_0472858 | Ga0495684_0472858_188_526 | 112 |
| 913 | 3300047472 | Ga0495686_0011473 | Ga0495686_0011473_1468_1806 | 112 |
| 914 | 3300047472 | Ga0495686_0157648 | Ga0495686_0157648_489_833 | 112 |
| 915 | 3300047673 | Ga0495593_0056524 | Ga0495593_0056524_479_817 | 112 |
| 916 | 3300047673 | Ga0495593_0135404 | Ga0495593_0135404_49_387 | 112 |
| 917 | 3300047673 | Ga0495593_0141152 | Ga0495593_0141152_773_1111 | 112 |
| 918 | 3300048088 | Ga0495602_0084270 | Ga0495602_0084270_449_793 | 112 |
| 919 | 3300048088 | Ga0495602_0178179 | Ga0495602_0178179_1043_1381 | 112 |
| 920 | 3300048091 | Ga0495626_0221612 | Ga0495626_0221612_301_639 | 112 |
| 921 | 3300048903 | Ga0496100_0028622 | Ga0496100_0028622_631_969 | 112 |
| 922 | 3300048903 | Ga0496100_0321480 | Ga0496100_0321480_477_815 | 112 |
| 923 | 3300048903 | Ga0496100_1124069 | Ga0496100_1124069_255_593 | 112 |
| 924 | 3300048903 | Ga0496100_1366102 | Ga0496100_1366102_208_546 | 112 |
| 925 | 3300048904 | Ga0496101_0014863 | Ga0496101_0014863_183_521 | 112 |
| 926 | 3300048904 | Ga0496101_0179631 | Ga0496101_0179631_23_361 | 112 |
| 927 | 3300048904 | Ga0496101_0402812 | Ga0496101_0402812_42_380 | 112 |
| 928 | 3300048905 | Ga0496102_0010175 | Ga0496102_0010175_3579_3917 | 112 |
| 929 | 3300048905 | Ga0496102_0095352 | Ga0496102_0095352_2209_2547 | 112 |
| 930 | 3300048905 | Ga0496102_0254979 | Ga0496102_0254979_756_1094 | 112 |
| 931 | 3300048906 | Ga0496103_0009526 | Ga0496103_0009526_4790_5128 | 112 |
| 932 | 3300048906 | Ga0496103_0097531 | Ga0496103_0097531_1328_1666 | 112 |
| 933 | 3300048907 | Ga0496104_0228353 | Ga0496104_0228353_1007_1345 | 112 |
| 934 | 3300048907 | Ga0496104_0501831 | Ga0496104_0501831_23_361 | 112 |
| 935 | 3300048907 | Ga0496104_0766574 | Ga0496104_0766574_45_383 | 112 |
| 936 | 3300048908 | Ga0496105_0090234 | Ga0496105_0090234_837_1175 | 112 |
| 937 | 3300048908 | Ga0496105_0249069 | Ga0496105_0249069_590_928 | 112 |
| 938 | 3300048908 | Ga0496105_0261635 | Ga0496105_0261635_83_421 | 112 |
| 939 | 3300048908 | Ga0496105_0626065 | Ga0496105_0626065_202_540 | 112 |
| 940 | 3300048909 | Ga0496106_0002491 | Ga0496106_0002491_3808_4146 | 112 |
| 941 | 3300048909 | Ga0496106_0250470 | Ga0496106_0250470_919_1257 | 112 |
| 942 | 3300048909 | Ga0496106_1480719 | Ga0496106_1480719_151_489 | 112 |
| 943 | 3300048910 | Ga0496107_0015993 | Ga0496107_0015993_1479_1817 | 112 |
| 944 | 3300048910 | Ga0496107_0917383 | Ga0496107_0917383_115_453 | 112 |
| 945 | 3300048911 | Ga0496108_0192950 | Ga0496108_0192950_30_368 | 112 |
| 946 | 3300048911 | Ga0496108_0472425 | Ga0496108_0472425_540_878 | 112 |
| 947 | 3300048911 | Ga0496108_0876541 | Ga0496108_0876541_36_374 | 112 |
| 948 | 3300048912 | Ga0496109_0082395 | Ga0496109_0082395_313_651 | 112 |
| 949 | 3300048912 | Ga0496109_0110266 | Ga0496109_0110266_2187_2525 | 112 |
| 950 | 3300048912 | Ga0496109_0171369 | Ga0496109_0171369_526_864 | 112 |
| 951 | 3300048912 | Ga0496109_1033871 | Ga0496109_1033871_243_581 | 112 |
| 952 | 3300048912 | Ga0496109_1809612 | Ga0496109_1809612_19_357 | 112 |
| 953 | 3300048913 | Ga0496110_0003972 | Ga0496110_0003972_5473_5811 | 112 |
| 954 | 3300048914 | Ga0496111_0132611 | Ga0496111_0132611_496_834 | 112 |
| 955 | 3300048914 | Ga0496111_0152600 | Ga0496111_0152600_640_978 | 112 |
| 956 | 3300048915 | Ga0496112_0019328 | Ga0496112_0019328_3503_3841 | 112 |
| 957 | 3300048915 | Ga0496112_0982063 | Ga0496112_0982063_413_751 | 112 |
| 958 | 3300048915 | Ga0496112_1632226 | Ga0496112_1632226_171_509 | 112 |
| 959 | 3300048916 | Ga0496113_0132535 | Ga0496113_0132535_1481_1819 | 112 |
| 960 | 3300048916 | Ga0496113_0453903 | Ga0496113_0453903_202_540 | 112 |
| 961 | 3300048917 | Ga0496114_0038689 | Ga0496114_0038689_699_1037 | 112 |
| 962 | 3300048917 | Ga0496114_0738500 | Ga0496114_0738500_238_576 | 112 |
| 963 | 3300048917 | Ga0496114_0739676 | Ga0496114_0739676_416_754 | 112 |
| 964 | 3300048918 | Ga0496115_0604957 | Ga0496115_0604957_338_676 | 112 |
| 965 | 3300048918 | Ga0496115_1193498 | Ga0496115_1193498_175_513 | 112 |
| 966 | 3300048919 | Ga0496116_0009193 | Ga0496116_0009193_2813_3151 | 112 |
| 967 | 3300048920 | Ga0496117_0026874 | Ga0496117_0026874_3420_3758 | 112 |
| 968 | 3300048920 | Ga0496117_0507096 | Ga0496117_0507096_77_415 | 112 |
| 969 | 3300048921 | Ga0496118_0041832 | Ga0496118_0041832_2416_2754 | 112 |
| 970 | 3300048922 | Ga0496119_0026780 | Ga0496119_0026780_173_511 | 112 |
| 971 | 3300048923 | Ga0496120_0224537 | Ga0496120_0224537_365_703 | 112 |
| 972 | 3300048924 | Ga0496121_0019078 | Ga0496121_0019078_4200_4538 | 112 |
| 973 | 3300048924 | Ga0496121_0039345 | Ga0496121_0039345_3631_3969 | 112 |
| 974 | 3300048925 | Ga0496122_0004945 | Ga0496122_0004945_12421_12759 | 112 |
| 975 | 3300048925 | Ga0496122_0184625 | Ga0496122_0184625_567_905 | 112 |
| 976 | 3300048926 | Ga0496123_0039281 | Ga0496123_0039281_2413_2751 | 112 |
| 977 | 3300048927 | Ga0496124_0092106 | Ga0496124_0092106_847_1185 | 112 |
| 978 | 3300048928 | Ga0496125_0018804 | Ga0496125_0018804_2702_3040 | 112 |
| 979 | 3300048928 | Ga0496125_0022128 | Ga0496125_0022128_603_941 | 112 |
| 980 | 3300048928 | Ga0496125_0076660 | Ga0496125_0076660_1356_1694 | 112 |
| 981 | 3300048928 | Ga0496125_0180485 | Ga0496125_0180485_552_890 | 112 |
| 982 | 3300048929 | Ga0496126_0117688 | Ga0496126_0117688_227_565 | 112 |
| 983 | 3300048929 | Ga0496126_0217715 | Ga0496126_0217715_459_797 | 112 |
| 984 | 3300048929 | Ga0496126_0241750 | Ga0496126_0241750_503_841 | 112 |
| 985 | 3300049129 | Ga0501309_041843 | Ga0501309_041843_258_596 | 112 |
| 986 | 3300049160 | Ga0501304_034299 | Ga0501304_034299_14_352 | 112 |
| 987 | 3300049161 | Ga0501305_018980 | Ga0501305_018980_309_647 | 112 |
| 988 | 3300049516 | Ga0501293_019775 | Ga0501293_019775_147_485 | 112 |
| 989 | 3300049517 | Ga0501294_019481 | Ga0501294_019481_346_684 | 112 |
| 990 | 3300049518 | Ga0501295_068977 | Ga0501295_068977_144_482 | 112 |
| 991 | 3300049519 | Ga0501296_058137 | Ga0501296_058137_134_472 | 112 |
| 992 | 3300049521 | Ga0501298_015382 | Ga0501298_015382_383_721 | 112 |
| 993 | 3300049521 | Ga0501298_085417 | Ga0501298_085417_40_378 | 112 |
| 994 | 3300049523 | Ga0501300_001083 | Ga0501300_001083_2455_2793 | 112 |
| 995 | 3300049523 | Ga0501300_057153 | Ga0501300_057153_94_489 | 112 |
| 996 | 3300049524 | Ga0501301_004146 | Ga0501301_004146_351_689 | 112 |
| 997 | 3300049527 | Ga0501311_052383 | Ga0501311_052383_276_614 | 112 |
| 998 | 3300049530 | Ga0501314_004795 | Ga0501314_004795_539_877 | 112 |
| 999 | 3300049531 | Ga0501315_024162 | Ga0501315_024162_176_514 | 112 |
| 1000 | 3300049569 | Ga0501032_0125834 | Ga0501032_0125834_1163_1501 | 112 |
| 1001 | 3300049571 | Ga0501034_0001279 | Ga0501034_0001279_15272_15610 | 112 |
| 1002 | 3300049571 | Ga0501034_0048885 | Ga0501034_0048885_187_525 | 112 |
| 1003 | 3300049571 | Ga0501034_0057761 | Ga0501034_0057761_550_888 | 112 |
| 1004 | 3300049571 | Ga0501034_0354738 | Ga0501034_0354738_195_533 | 112 |
| 1005 | 3300049572 | Ga0501036_0227629 | Ga0501036_0227629_1183_1521 | 112 |
| 1006 | 3300049572 | Ga0501036_1719121 | Ga0501036_1719121_108_446 | 112 |
| 1007 | 3300049574 | Ga0501038_0201101 | Ga0501038_0201101_99_437 | 112 |
| 1008 | 3300049575 | Ga0501039_0111979 | Ga0501039_0111979_245_583 | 112 |
| 1009 | 3300049575 | Ga0501039_0407647 | Ga0501039_0407647_254_592 | 112 |
| 1010 | 3300049577 | Ga0501041_0247270 | Ga0501041_0247270_437_775 | 112 |
| 1011 | 3300049579 | Ga0501043_0174669 | Ga0501043_0174669_1193_1531 | 112 |
| 1012 | 3300049580 | Ga0501046_0174512 | Ga0501046_0174512_274_612 | 112 |
| 1013 | 3300049580 | Ga0501046_0646528 | Ga0501046_0646528_11_349 | 112 |
| 1014 | 3300049580 | Ga0501046_1061848 | Ga0501046_1061848_55_393 | 112 |
| 1015 | 3300049581 | Ga0501047_0062974 | Ga0501047_0062974_1103_1441 | 112 |
| 1016 | 3300049582 | Ga0501048_0645028 | Ga0501048_0645028_35_430 | 112 |
| 1017 | 3300049583 | Ga0501067_0300921 | Ga0501067_0300921_73_411 | 112 |
| 1018 | 3300049584 | Ga0501068_0008164 | Ga0501068_0008164_373_711 | 112 |
| 1019 | 3300049586 | Ga0501070_0014948 | Ga0501070_0014948_1256_1594 | 112 |
| 1020 | 3300049586 | Ga0501070_0036866 | Ga0501070_0036866_895_1233 | 112 |
| 1021 | 3300049588 | Ga0501072_0016016 | Ga0501072_0016016_3088_3426 | 112 |
| 1022 | 3300049588 | Ga0501072_0026626 | Ga0501072_0026626_2160_2498 | 112 |
| 1023 | 3300049589 | Ga0501073_0005603 | Ga0501073_0005603_6092_6430 | 112 |
| 1024 | 3300049589 | Ga0501073_0042689 | Ga0501073_0042689_411_749 | 112 |
| 1025 | 3300049590 | Ga0501074_0054209 | Ga0501074_0054209_1708_2046 | 112 |
| 1026 | 3300049590 | Ga0501074_0130885 | Ga0501074_0130885_498_836 | 112 |
| 1027 | 3300049651 | Ga0501201_000859 | Ga0501201_000859_1838_2176 | 112 |
| 1028 | 3300049651 | Ga0501201_036779 | Ga0501201_036779_111_449 | 112 |
| 1029 | 3300049652 | Ga0501202_038852 | Ga0501202_038852_106_444 | 112 |
| 1030 | 3300049653 | Ga0501206_052465 | Ga0501206_052465_168_506 | 112 |
| 1031 | 3300049654 | Ga0501207_081301 | Ga0501207_081301_133_471 | 112 |
| 1032 | 3300049658 | Ga0501211_000781 | Ga0501211_000781_262_600 | 112 |
| 1033 | 3300049662 | Ga0501222_007027 | Ga0501222_007027_1049_1387 | 112 |
| 1034 | 3300049665 | Ga0501227_016101 | Ga0501227_016101_1264_1602 | 112 |
| 1035 | 3300049665 | Ga0501227_120054 | Ga0501227_120054_266_661 | 112 |
| 1036 | 3300049668 | Ga0501233_095703 | Ga0501233_095703_316_654 | 112 |
| 1037 | 3300049669 | Ga0501235_005194 | Ga0501235_005194_1460_1798 | 112 |
| 1038 | 3300049686 | Ga0501257_241715 | Ga0501257_241715_128_466 | 112 |
| 1039 | 3300049687 | Ga0501258_031822 | Ga0501258_031822_49_387 | 112 |
| 1040 | 3300049690 | Ga0501261_026506 | Ga0501261_026506_350_688 | 112 |
| 1041 | 3300049704 | Ga0501221_002565 | Ga0501221_002565_1610_1948 | 112 |
| 1042 | 3300049705 | Ga0501225_0007329 | Ga0501225_0007329_1906_2244 | 112 |
| 1043 | 3300049705 | Ga0501225_0151083 | Ga0501225_0151083_200_538 | 112 |
| 1044 | 3300049706 | Ga0501229_003048 | Ga0501229_003048_597_935 | 112 |
| 1045 | 3300049741 | Ga0501079_1403461 | Ga0501079_1403461_86_424 | 112 |
| 1046 | 3300049742 | Ga0501080_0005258 | Ga0501080_0005258_2680_3018 | 112 |
| 1047 | 3300049742 | Ga0501080_0069393 | Ga0501080_0069393_1150_1488 | 112 |
| 1048 | 3300049742 | Ga0501080_0516962 | Ga0501080_0516962_290_628 | 112 |
| 1049 | 3300049742 | Ga0501080_1837926 | Ga0501080_1837926_20_358 | 112 |
| 1050 | 3300049744 | Ga0501083_0178203 | Ga0501083_0178203_799_1137 | 112 |
| 1051 | 3300049759 | Ga0501262_015777 | Ga0501262_015777_122_460 | 112 |
| 1052 | 3300049759 | Ga0501262_075898 | Ga0501262_075898_96_434 | 112 |
| 1053 | 3300049760 | Ga0501263_015469 | Ga0501263_015469_493_831 | 112 |
| 1054 | 3300049762 | Ga0501265_001438 | Ga0501265_001438_131_469 | 112 |
| 1055 | 3300049762 | Ga0501265_061022 | Ga0501265_061022_222_560 | 112 |
| 1056 | 3300049764 | Ga0501267_005593 | Ga0501267_005593_601_939 | 112 |
| 1057 | 3300049766 | Ga0501269_002880 | Ga0501269_002880_619_957 | 112 |
| 1058 | 3300049767 | Ga0501270_054354 | Ga0501270_054354_284_622 | 112 |
| 1059 | 3300049769 | Ga0501272_011539 | Ga0501272_011539_403_741 | 112 |
| 1060 | 3300049822 | Ga0501035_0040039 | Ga0501035_0040039_3857_4195 | 112 |
| 1061 | 3300049823 | Ga0501044_0085617 | Ga0501044_0085617_2545_2883 | 112 |
| 1062 | 3300049823 | Ga0501044_0466820 | Ga0501044_0466820_581_919 | 112 |
| 1063 | 3300049824 | Ga0501045_0132772 | Ga0501045_0132772_850_1188 | 112 |
| 1064 | 3300049824 | Ga0501045_1314721 | Ga0501045_1314721_67_462 | 112 |
| 1065 | 3300050493 | nmdc:mga0k408_135732_c1 | nmdc:mga0k408_135732_c1_456_794 | 112 |
| 1066 | 3300050493 | nmdc:mga0k408_4965_c1 | nmdc:mga0k408_4965_c1_3258_3596 | 112 |
| 1067 | 3300050493 | nmdc:mga0k408_53793_c1 | nmdc:mga0k408_53793_c1_1040_1378 | 112 |
| 1068 | 3300050493 | nmdc:mga0k408_560699_c1 | nmdc:mga0k408_560699_c1_273_611 | 112 |
| 1069 | 3300050493 | nmdc:mga0k408_75037_c1 | nmdc:mga0k408_75037_c1_1016_1354 | 112 |
| 1070 | 3300050494 | nmdc:mga06z11_567089_c1 | nmdc:mga06z11_567089_c1_195_533 | 112 |
| 1071 | 3300050496 | nmdc:mga07m45_11043_c1 | nmdc:mga07m45_11043_c1_3463_3801 | 112 |
| 1072 | 3300050496 | nmdc:mga07m45_13378_c2 | nmdc:mga07m45_13378_c2_1205_1543 | 112 |
| 1073 | 3300050496 | nmdc:mga07m45_5516_c1 | nmdc:mga07m45_5516_c1_3306_3644 | 112 |
| 1074 | 3300050496 | nmdc:mga07m45_68942_c1 | nmdc:mga07m45_68942_c1_751_1089 | 112 |
| 1075 | 3300050507 | nmdc:mga05p37_1031235_c1 | nmdc:mga05p37_1031235_c1_244_582 | 112 |
| 1076 | 3300050507 | nmdc:mga05p37_17657_c1 | nmdc:mga05p37_17657_c1_547_942 | 112 |
| 1077 | 3300050507 | nmdc:mga05p37_2063341_c1 | nmdc:mga05p37_2063341_c1_64_459 | 112 |
| 1078 | 3300050507 | nmdc:mga05p37_316962_c1 | nmdc:mga05p37_316962_c1_351_746 | 112 |
| 1079 | 3300050507 | nmdc:mga05p37_38293_c1 | nmdc:mga05p37_38293_c1_5379_5774 | 112 |
| 1080 | 3300050507 | nmdc:mga05p37_3859_c1 | nmdc:mga05p37_3859_c1_1196_1591 | 112 |
| 1081 | 3300050507 | nmdc:mga05p37_809731_c1 | nmdc:mga05p37_809731_c1_420_758 | 112 |
| 1082 | 3300050507 | nmdc:mga05p37_90325_c1 | nmdc:mga05p37_90325_c1_3110_3505 | 112 |
| 1083 | 3300050508 | nmdc:mga09592_227045_c1 | nmdc:mga09592_227045_c1_207_602 | 112 |
| 1084 | 3300050508 | nmdc:mga09592_448440_c1 | nmdc:mga09592_448440_c1_690_1085 | 112 |
| 1085 | 3300050508 | nmdc:mga09592_547183_c1 | nmdc:mga09592_547183_c1_451_789 | 112 |
| 1086 | 3300050508 | nmdc:mga09592_9225_c1 | nmdc:mga09592_9225_c1_1565_1960 | 112 |
| 1087 | 3300050509 | nmdc:mga0qj67_1374977_c1 | nmdc:mga0qj67_1374977_c1_46_459 | 112 |
| 1088 | 3300050509 | nmdc:mga0qj67_519531_c1 | nmdc:mga0qj67_519531_c1_548_943 | 112 |
| 1089 | 3300050510 | nmdc:mga06r32_33320_c1 | nmdc:mga06r32_33320_c1_2682_3077 | 112 |
| 1090 | 3300050511 | nmdc:mga08y16_1724283_c1 | nmdc:mga08y16_1724283_c1_83_421 | 112 |
| 1091 | 3300050511 | nmdc:mga08y16_44605_c1 | nmdc:mga08y16_44605_c1_372_710 | 112 |
| 1092 | 3300050512 | nmdc:mga0n895_24727_c1 | nmdc:mga0n895_24727_c1_3849_4187 | 112 |
| 1093 | 3300050512 | nmdc:mga0n895_880590_c1 | nmdc:mga0n895_880590_c1_297_635 | 112 |
| 1094 | 3300050512 | nmdc:mga0n895_912803_c1 | nmdc:mga0n895_912803_c1_436_774 | 112 |
| 1095 | 3300050513 | nmdc:mga0rr50_1085303_c1 | nmdc:mga0rr50_1085303_c1_196_534 | 112 |
| 1096 | 3300050513 | nmdc:mga0rr50_152126_c1 | nmdc:mga0rr50_152126_c1_224_562 | 112 |
| 1097 | 3300050514 | nmdc:mga08x19_46492_c1 | nmdc:mga08x19_46492_c1_1366_1704 | 112 |
| 1098 | 3300050515 | nmdc:mga0a205_31268_c1 | nmdc:mga0a205_31268_c1_2623_2961 | 112 |
| 1099 | 3300050515 | nmdc:mga0a205_566832_c1 | nmdc:mga0a205_566832_c1_79_417 | 112 |
| 1100 | 3300050516 | nmdc:mga0sz30_57096_c2 | nmdc:mga0sz30_57096_c2_31_369 | 112 |
| 1101 | 3300053078 | Ga0495612_0026745 | Ga0495612_0026745_583_921 | 112 |
| 1102 | 3300053086 | Ga0500578_0043481 | Ga0500578_0043481_414_752 | 112 |
| 1103 | 3300053121 | Ga0500607_084959 | Ga0500607_084959_249_587 | 112 |
| 1104 | 3300053177 | Ga0500636_0536665 | Ga0500636_0536665_74_412 | 112 |
| 1105 | 3300053730 | Ga0500645_003647 | Ga0500645_003647_4001_4339 | 112 |
| 1106 | 3300053739 | Ga0500587_010883 | Ga0500587_010883_240_578 | 112 |
| 1107 | 3300054114 | Ga0501084_0081891 | Ga0501084_0081891_602_940 | 112 |
| 1108 | 3300054114 | Ga0501084_0421750 | Ga0501084_0421750_62_400 | 112 |
| 1109 | 3300059607 | Ga0587125_016601 | Ga0587125_016601_15_353 | 112 |
| 1110 | 3300060346 | Ga0587111_0280390 | Ga0587111_0280390_135_473 | 112 |
| 1111 | 3300060353 | Ga0501082_0112905 | Ga0501082_0112905_1123_1518 | 112 |
| 1112 | 3300060353 | Ga0501082_0375736 | Ga0501082_0375736_60_398 | 112 |
| 1113 | 3300060353 | Ga0501082_0381022 | Ga0501082_0381022_882_1220 | 112 |
| 1114 | 3300060353 | Ga0501082_0735769 | Ga0501082_0735769_181_519 | 112 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1hwu-assembly3.cif.gz_C | structure of pii protein from herbaspirillum seropedicae | 0.9757 | 1 | 112 |
| 5l9n-assembly1.cif.gz_A | structure of uridylylated glnb from escherichia coli bound to atp | 0.974 | 1 | 108 |
| 4co4-assembly1.cif.gz_A | structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate | 0.9726 | 1 | 108 |
| 3t9z-assembly1.cif.gz_B | a. fulgidus glnk3, ligand-free | 0.9697 | 1 | 108 |
| 1ul3-assembly3.cif.gz_A-5 | crystal structure of pii from synechocystis sp. pcc 6803 | 0.9692 | 1 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4c3kE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.941 | 1 | 111 | 3.30.70.120 |
| 2o66C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9366 | 2 | 111 | 3.30.70.120 |
| 4oznB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9361 | 2 | 112 | 3.30.70.120 |
| 4c3kE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9317 | 1 | 111 | 3.30.70.120 |
| 2xulB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8989 | 1 | 111 | 3.30.70.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q4DS82-F1-model_v4 | Transcriptional regulator | 0.9661 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A1Q4DS82-F1-model_v4 | Transcriptional regulator | 0.9561 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A836T1U7-F1-model_v4 | P-II family nitrogen regulator | 0.9165 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0RYL7-F1-model_v4 | Nitrogen regulatory protein PII | 0.9147 | 2 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A1F7F2C5-F1-model_v4 | Transcriptional regulator | 0.9091 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar