F490201

General Info

Members Datasets Scaffolds Average Seq Length
1109 432 2218 215

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0040371|Ga0373935_0040371_90_743
Length 217
Sequence MSDTPEYQLYCFAQSGNAYRVALMLNLIGADWKPVFVDFFIGGETRTAKYRTEINEMGEVPVLAHGERKLSQSAVCLTYLAERSGKFRPEGDDERLECLRWIVFDNQKVNGFLGPYRFLKNFAPAPNPGGEAFLLGRIGGNLAIVDKRLTKAPYLLGPRPTIADISLAGYLYYPADEFGFDIAKDHPAIGAWMERIKALPGWKHPYDLMPGYPLNRG

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
20 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
25 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
63 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
74 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
75 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
83 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
97 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
111 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
130 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
133 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
134 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
135 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
137 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
149 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
150 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
151 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
152 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
165 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
166 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
167 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
168 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
171 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
173 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
243 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
245 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
249 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
250 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
251 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
252 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
253 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
254 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
255 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
256 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
257 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
258 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
259 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
260 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
261 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
262 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
263 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
264 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
265 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
266 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
267 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
268 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
269 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
270 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
271 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
272 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
274 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
275 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
276 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
277 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
278 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
279 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
280 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
281 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
282 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
283 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
284 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
285 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
286 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
287 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
288 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
289 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
290 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
291 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
292 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
293 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
294 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
299 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
300 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
301 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
302 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
303 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
304 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
305 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
306 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
307 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
308 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
309 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
310 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
311 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
312 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
313 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
316 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
317 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
318 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
319 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
320 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
321 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
322 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
323 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
324 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
325 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
326 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
327 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
328 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
329 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
330 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
333 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
334 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
335 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
336 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
337 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
338 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
339 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
340 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
341 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
342 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
343 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
344 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
345 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
346 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
347 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
348 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
349 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
350 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
351 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
352 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
353 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
354 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
355 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
356 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
357 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
358 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
359 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
360 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
361 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
362 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
363 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
364 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
365 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
366 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
370 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
374 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
375 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
376 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
377 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
378 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
381 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
382 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
383 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
384 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
385 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
386 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
387 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
388 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
389 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
390 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
391 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
394 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
395 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
396 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
397 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
398 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
399 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
400 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
401 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
402 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
403 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
404 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
405 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
406 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
407 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
408 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
409 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
410 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
411 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
412 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
413 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
414 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
415 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
416 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
417 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
418 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
419 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
420 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
421 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
422 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
423 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
424 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
425 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
426 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
427 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
428 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
429 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
430 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
431 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
432 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.22
Nodule 0
Rhizoplane 6.76
Rhizosphere 86.74
Stem 0
Stem Tuber 0
Unclassified 4.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0040371 3300035692 Bacteria 2929
2 SwRhRL2b_contig_902337 2162886007 Bacteria 1422
3 2214856321 2209111006 Bacteria 7943
4 ARSoilYngRDRAFT_c00224 3300000042 Bacteria 9130
5 ARcpr5yngRDRAFT_c000200 3300000043 Bacteria 9195
6 ARSoilOldRDRAFT_c000038 3300000044 Bacteria 30035
7 ARCol0oldRDRAFT_c00169 3300000045 Bacteria 5931
8 ARCol0yngRDRAFT_1000396 3300000652 Bacteria 5908
9 JGI24746J21847_1002569 3300001977 Bacteria 2884
10 JGI24740J21852_10050257 3300001979 Bacteria 1200
11 JGI24739J22299_10000144 3300001989 Bacteria 22757
12 JGI24737J22298_10001737 3300001990 Bacteria 7782
13 JGI24737J22298_10001829 3300001990 Bacteria 7616
14 JGI24750J21931_1000014 3300002070 Bacteria 21435
15 JGI24745J21846_1000270 3300002073 Bacteria 4396
16 JGI24748J21848_1002358 3300002074 Bacteria 2130
17 JGI24738J21930_10000574 3300002075 Bacteria 10530
18 JGI24749J21850_1001045 3300002076 Bacteria 3943
19 JGI24744J21845_10000166 3300002077 Bacteria 9770
20 JGI24035J26624_1008271 3300002126 Bacteria 1017
21 JGI24033J26618_1001410 3300002155 Bacteria 2388
22 JGI24034J26672_10000281 3300002239 Bacteria 6735
23 JGI24742J22300_10001185 3300002244 Bacteria 4065
24 JGI25405J52794_10053938 3300003911 Bacteria 864
25 Ga0065717_1004781 3300005276 Bacteria 979
26 Ga0065716_1000005 3300005277 Bacteria 8806
27 Ga0065704_10093949 3300005289 Bacteria 2569
28 Ga0065712_10068670 3300005290 Bacteria 9422
29 Ga0065712_10069916 3300005290 Bacteria 6516
30 Ga0065712_10070787 3300005290 Bacteria 5706
31 Ga0065715_10000266 3300005293 Bacteria 26217
32 Ga0065715_10001896 3300005293 Bacteria 10555
33 Ga0065707_10091685 3300005295 Bacteria 3896
34 Ga0070658_10091260 3300005327 Bacteria 2510
35 Ga0070658_10104180 3300005327 Bacteria 2347
36 Ga0070658_10254651 3300005327 Bacteria 1490
37 Ga0070676_10000663 3300005328 Bacteria 16752
38 Ga0070676_10266539 3300005328 Bacteria 1149
39 Ga0070683_100000152 3300005329 Bacteria 44662
40 Ga0070683_100203801 3300005329 Bacteria 1879
41 Ga0070683_100721663 3300005329 Bacteria 955
42 Ga0070690_100000388 3300005330 Bacteria 22360
43 Ga0070690_100024975 3300005330 Bacteria 3678
44 Ga0070690_100194217 3300005330 Bacteria 1409
45 Ga0070690_100209192 3300005330 Bacteria 1361
46 Ga0070670_100004481 3300005331 Bacteria 11702
47 Ga0070670_100027603 3300005331 Bacteria 4883
48 Ga0070677_10000363 3300005333 Bacteria 15928
49 Ga0068869_100000020 3300005334 Bacteria 66561
50 Ga0068869_100186397 3300005334 Bacteria 1629
51 Ga0070666_10007376 3300005335 Bacteria 6774
52 Ga0070666_10025663 3300005335 Bacteria 3843
53 Ga0070666_10157207 3300005335 Bacteria 1588
54 Ga0070666_10167189 3300005335 Bacteria 1539
55 Ga0070680_100025550 3300005336 Bacteria 4721
56 Ga0070680_100029923 3300005336 Bacteria 4372
57 Ga0070680_100045232 3300005336 Bacteria 3579
58 Ga0070680_100148337 3300005336 Bacteria 1968
59 Ga0070680_100367123 3300005336 Bacteria 1224
60 Ga0070682_100000264 3300005337 Bacteria 37644
61 Ga0070682_100081444 3300005337 Bacteria 2096
62 Ga0070682_100180629 3300005337 Bacteria 1474
63 Ga0070682_100541510 3300005337 Bacteria 909
64 Ga0068868_100035892 3300005338 Bacteria 3834
65 Ga0070660_100000394 3300005339 Bacteria 29011
66 Ga0070660_100165750 3300005339 Bacteria 1783
67 Ga0070689_100004384 3300005340 Bacteria 9528
68 Ga0070689_100008724 3300005340 Bacteria 7155
69 Ga0070689_100318122 3300005340 Bacteria 1299
70 Ga0070691_10008871 3300005341 Bacteria 4604
71 Ga0070691_10037541 3300005341 Bacteria 2286
72 Ga0070687_100000122 3300005343 Bacteria 26655
73 Ga0070687_100011710 3300005343 Bacteria 3848
74 Ga0070661_100048239 3300005344 Bacteria 3117
75 Ga0070661_100117365 3300005344 Bacteria 1991
76 Ga0070661_100146774 3300005344 Bacteria 1781
77 Ga0070692_10006038 3300005345 Bacteria 5224
78 Ga0070668_100009693 3300005347 Bacteria 7142
79 Ga0070668_100104819 3300005347 Bacteria 2245
80 Ga0070669_100001081 3300005353 Bacteria 19935
81 Ga0070669_100009434 3300005353 Bacteria 6949
82 Ga0070669_100610788 3300005353 Bacteria 914
83 Ga0070675_100009824 3300005354 Bacteria 7457
84 Ga0070675_100084251 3300005354 Bacteria 2655
85 Ga0070675_100118185 3300005354 Bacteria 2251
86 Ga0070671_100000718 3300005355 Bacteria 23716
87 Ga0070671_100005908 3300005355 Bacteria 9752
88 Ga0070671_100017008 3300005355 Bacteria 5882
89 Ga0070674_100000152 3300005356 Bacteria 32268
90 Ga0070674_100059626 3300005356 Bacteria 2657
91 Ga0070674_100197344 3300005356 Bacteria 1552
92 Ga0070673_100000042 3300005364 Bacteria 52952
93 Ga0070673_100029549 3300005364 Bacteria 4088
94 Ga0070673_100053237 3300005364 Bacteria 3178
95 Ga0070673_100147229 3300005364 Bacteria 1991
96 Ga0070688_100009484 3300005365 Bacteria 5325
97 Ga0070688_100021617 3300005365 Bacteria 3760
98 Ga0070688_100024369 3300005365 Bacteria 3570
99 Ga0070659_100000348 3300005366 Bacteria 35172
100 Ga0070659_100043222 3300005366 Bacteria 3524
101 Ga0070667_100000775 3300005367 Bacteria 30249
102 Ga0070667_100009286 3300005367 Bacteria 8149
103 Ga0070667_100036295 3300005367 Bacteria 4132
104 Ga0070667_100213919 3300005367 Bacteria 1714
105 Ga0070703_10000842 3300005406 Bacteria 9936
106 Ga0070709_10001300 3300005434 Bacteria 13613
107 Ga0070709_10218353 3300005434 Bacteria 1358
108 Ga0070709_10618141 3300005434 Unclassified 836
109 Ga0070714_100503063 3300005435 Bacteria 1156
110 Ga0070713_100008767 3300005436 Bacteria 7196
111 Ga0070713_100134124 3300005436 Bacteria 2186
112 Ga0070713_100309654 3300005436 Bacteria 1456
113 Ga0070713_100725904 3300005436 Bacteria 949
114 Ga0070710_10107906 3300005437 Bacteria 1668
115 Ga0070710_10271487 3300005437 Bacteria 1097
116 Ga0070710_10365314 3300005437 Bacteria 959
117 Ga0070701_10000042 3300005438 Bacteria 32304
118 Ga0070701_10012698 3300005438 Bacteria 3806
119 Ga0070701_10375582 3300005438 Bacteria 894
120 Ga0070711_100060988 3300005439 Bacteria 2624
121 Ga0070711_100206865 3300005439 Bacteria 1517
122 Ga0070705_100004068 3300005440 Bacteria 7142
123 Ga0070705_100035155 3300005440 Bacteria 2807
124 Ga0070705_100171146 3300005440 Bacteria 1462
125 Ga0070705_100402711 3300005440 Unclassified 1014
126 Ga0070700_100001033 3300005441 Bacteria 13764
127 Ga0070700_100014365 3300005441 Bacteria 4470
128 Ga0070694_100010969 3300005444 Bacteria 5606
129 Ga0070694_100040785 3300005444 Bacteria 3095
130 Ga0070708_100277788 3300005445 Bacteria 1576
131 Ga0070663_100000301 3300005455 Bacteria 25350
132 Ga0070663_100004327 3300005455 Bacteria 8325
133 Ga0070678_100003715 3300005456 Bacteria 8542
134 Ga0070678_100008818 3300005456 Bacteria 6063
135 Ga0070678_100224918 3300005456 Bacteria 1561
136 Ga0070662_100008262 3300005457 Bacteria 6779
137 Ga0070662_100142225 3300005457 Bacteria 1861
138 Ga0070662_100152940 3300005457 Bacteria 1798
139 Ga0070662_100308806 3300005457 Bacteria 1287
140 Ga0070681_10017746 3300005458 Bacteria 7112
141 Ga0070681_10060503 3300005458 Bacteria 3764
142 Ga0070681_10303919 3300005458 Bacteria 1505
143 Ga0070681_10397229 3300005458 Bacteria 1290
144 Ga0070681_10412927 3300005458 Bacteria 1261
145 Ga0068867_100013330 3300005459 Bacteria 5823
146 Ga0068867_100195914 3300005459 Bacteria 1615
147 Ga0068867_100539515 3300005459 Unclassified 1009
148 Ga0070685_10009477 3300005466 Bacteria 5035
149 Ga0070685_10109392 3300005466 Bacteria 1700
150 Ga0070706_100713122 3300005467 Bacteria 930
151 Ga0070707_100167400 3300005468 Bacteria 2142
152 Ga0074259_11284140 3300005507 Bacteria 808
153 Ga0070679_100080878 3300005530 Bacteria 3238
154 Ga0070679_100103023 3300005530 Bacteria 2840
155 Ga0070679_100222059 3300005530 Bacteria 1850
156 Ga0070679_100637315 3300005530 Unclassified 1009
157 Ga0070679_100695431 3300005530 Bacteria 959
158 Ga0070684_100003011 3300005535 Bacteria 12551
159 Ga0070684_100059646 3300005535 Bacteria 3336
160 Ga0070684_100338020 3300005535 Bacteria 1384
161 Ga0070697_100000842 3300005536 Bacteria 23057
162 Ga0070697_100043536 3300005536 Bacteria 3636
163 Ga0070697_100383813 3300005536 Bacteria 1217
164 Ga0068853_100001269 3300005539 Bacteria 18080
165 Ga0068853_100057813 3300005539 Bacteria 3348
166 Ga0068853_100437203 3300005539 Bacteria 1229
167 Ga0070672_100000011 3300005543 Bacteria 80761
168 Ga0070672_100077533 3300005543 Bacteria 2658
169 Ga0070686_100000889 3300005544 Bacteria 17366
170 Ga0070686_100049720 3300005544 Bacteria 2662
171 Ga0070686_100072996 3300005544 Bacteria 2252
172 Ga0070686_100370083 3300005544 Bacteria 1082
173 Ga0070686_100489992 3300005544 Bacteria 952
174 Ga0070695_100000088 3300005545 Bacteria 38984
175 Ga0070695_100019733 3300005545 Bacteria 4109
176 Ga0070695_100051983 3300005545 Bacteria 2631
177 Ga0070695_100350010 3300005545 Unclassified 1106
178 Ga0070696_100003446 3300005546 Bacteria 10527
179 Ga0070696_100036825 3300005546 Bacteria 3374
180 Ga0070696_100040114 3300005546 Bacteria 3233
181 Ga0070696_100137583 3300005546 Bacteria 1782
182 Ga0070693_100000273 3300005547 Bacteria 24376
183 Ga0070693_100175206 3300005547 Bacteria 1377
184 Ga0070665_100849634 3300005548 Bacteria 926
185 Ga0070704_100000809 3300005549 Bacteria 15517
186 Ga0068855_100003933 3300005563 Bacteria 18135
187 Ga0068855_100019728 3300005563 Bacteria 8096
188 Ga0068855_100044053 3300005563 Bacteria 5282
189 Ga0068855_100490984 3300005563 Bacteria 1335
190 Ga0070664_100000263 3300005564 Bacteria 37910
191 Ga0068857_100002138 3300005577 Bacteria 16066
192 Ga0068854_100001243 3300005578 Bacteria 15301
193 Ga0068854_100068458 3300005578 Bacteria 2589
194 Ga0068854_100189162 3300005578 Bacteria 1612
195 Ga0068854_100261846 3300005578 Bacteria 1385
196 Ga0068856_100000803 3300005614 Bacteria 33893
197 Ga0068856_100091579 3300005614 Bacteria 3025
198 Ga0068856_100601258 3300005614 Bacteria 1121
199 Ga0068856_100655819 3300005614 Bacteria 1070
200 Ga0070702_100000131 3300005615 Bacteria 22818
201 Ga0070702_100326021 3300005615 Bacteria 1072
202 Ga0068852_100001912 3300005616 Bacteria 14182
203 Ga0068852_100067472 3300005616 Bacteria 3127
204 Ga0068852_100113124 3300005616 Bacteria 2471
205 Ga0068852_101028762 3300005616 Bacteria 843
206 Ga0068859_100004279 3300005617 Bacteria 14575
207 Ga0068859_100011885 3300005617 Bacteria 8746
208 Ga0068864_100000112 3300005618 Bacteria 79688
209 Ga0068864_100077589 3300005618 Bacteria 2905
210 Ga0068864_100591741 3300005618 Bacteria 1076
211 Ga0068864_100774973 3300005618 Bacteria 941
212 Ga0068866_10000300 3300005718 Bacteria 23587
213 Ga0068866_10132080 3300005718 Bacteria 1421
214 Ga0068866_10216397 3300005718 Bacteria 1153
215 Ga0068866_10352975 3300005718 Unclassified 935
216 Ga0068861_100004433 3300005719 Bacteria 9419
217 Ga0068861_100034013 3300005719 Bacteria 3766
218 Ga0068861_100134220 3300005719 Bacteria 2012
219 Ga0068870_10000021 3300005840 Bacteria 56319
220 Ga0068863_100000491 3300005841 Bacteria 40157
221 Ga0068858_100000419 3300005842 Bacteria 44155
222 Ga0068858_100032586 3300005842 Bacteria 4839
223 Ga0068858_100055067 3300005842 Bacteria 3677
224 Ga0068860_100001036 3300005843 Bacteria 30573
225 Ga0068860_100080488 3300005843 Bacteria 3097
226 Ga0068860_100173883 3300005843 Bacteria 2081
227 Ga0068862_100002612 3300005844 Bacteria 15858
228 Ga0068862_100008885 3300005844 Bacteria 8320
229 Ga0081455_10000153 3300005937 Bacteria 83186
230 Ga0081540_1008782 3300005983 Bacteria 7021
231 Ga0070717_10000489 3300006028 Bacteria 25208
232 Ga0070717_10082514 3300006028 Bacteria 2701
233 Ga0070717_10173587 3300006028 Bacteria 1876
234 Ga0070717_10528913 3300006028 Bacteria 1067
235 Ga0075365_10084008 3300006038 Bacteria 2160
236 Ga0075365_10198539 3300006038 Bacteria 1405
237 Ga0075365_10483059 3300006038 Bacteria 875
238 Ga0075368_10009150 3300006042 Bacteria 3558
239 Ga0075368_10035823 3300006042 Bacteria 1937
240 Ga0075368_10092399 3300006042 Bacteria 1238
241 Ga0075363_100020442 3300006048 Bacteria 3320
242 Ga0075363_100062795 3300006048 Bacteria 2003
243 Ga0075363_100248258 3300006048 Bacteria 1024
244 Ga0075364_10044114 3300006051 Bacteria 2899
245 Ga0075364_10079403 3300006051 Bacteria 2168
246 Ga0075364_10467518 3300006051 Bacteria 862
247 Ga0070715_10210005 3300006163 Unclassified 994
248 Ga0070716_100005054 3300006173 Bacteria 6363
249 Ga0070716_100114189 3300006173 Bacteria 1679
250 Ga0070716_100484676 3300006173 Bacteria 909
251 Ga0070712_100007472 3300006175 Bacteria 6822
252 Ga0070712_100031589 3300006175 Bacteria 3569
253 Ga0070712_100105746 3300006175 Bacteria 2091
254 Ga0070712_100251324 3300006175 Bacteria 1413
255 Ga0075362_10007566 3300006177 Bacteria 4121
256 Ga0075362_10038049 3300006177 Bacteria 2112
257 Ga0075367_10016120 3300006178 Bacteria 4076
258 Ga0075367_10084258 3300006178 Bacteria 1927
259 Ga0075367_10094496 3300006178 Bacteria 1823
260 Ga0075367_10101366 3300006178 Bacteria 1760
261 Ga0075367_10176802 3300006178 Bacteria 1330
262 Ga0075427_10001653 3300006194 Bacteria 2895
263 Ga0075366_10122066 3300006195 Bacteria 1570
264 Ga0097621_100000115 3300006237 Bacteria 45694
265 Ga0097621_100036012 3300006237 Bacteria 3956
266 Ga0097621_100126539 3300006237 Bacteria 2171
267 Ga0097621_101219761 3300006237 Bacteria 709
268 Ga0075370_10067781 3300006353 Bacteria 2037
269 Ga0075370_10099123 3300006353 Bacteria 1685
270 Ga0075370_10305564 3300006353 Bacteria 946
271 Ga0068871_100000498 3300006358 Bacteria 26857
272 Ga0068871_100002187 3300006358 Bacteria 13285
273 Ga0068871_100020585 3300006358 Bacteria 5056
274 Ga0068871_101069032 3300006358 Bacteria 754
275 Ga0075428_100000363 3300006844 Bacteria 45033
276 Ga0075430_100000717 3300006846 Bacteria 25305
277 Ga0075431_100000990 3300006847 Bacteria 25307
278 Ga0075433_10000187 3300006852 Bacteria 34883
279 Ga0075433_10004386 3300006852 Bacteria 10973
280 Ga0075433_10085234 3300006852 Bacteria 2789
281 Ga0075433_10198210 3300006852 Bacteria 1785
282 Ga0075434_100002790 3300006871 Bacteria 15468
283 Ga0075434_100026793 3300006871 Bacteria 5653
284 Ga0075434_100473895 3300006871 Bacteria 1273
285 Ga0075429_100000846 3300006880 Bacteria 24030
286 Ga0068865_100000978 3300006881 Bacteria 16336
287 Ga0068865_100014929 3300006881 Bacteria 4946
288 Ga0068865_100251174 3300006881 Bacteria 1396
289 Ga0075436_100007352 3300006914 Bacteria 7527
290 Ga0075436_100359877 3300006914 Bacteria 1050
291 Ga0097620_100004280 3300006931 Bacteria 14575
292 Ga0097620_100011886 3300006931 Bacteria 8746
293 Ga0075435_100005765 3300007076 Bacteria 8698
294 Ga0075435_100045776 3300007076 Bacteria 3509
295 Ga0075435_100064842 3300007076 Bacteria 2969
296 Ga0075435_100121929 3300007076 Bacteria 2176
297 Ga0075435_100233276 3300007076 Bacteria 1564
298 Ga0075435_100730676 3300007076 Bacteria 861
299 Ga0099795_10064277 3300007788 Bacteria 1370
300 Ga0105251_10016489 3300009011 Bacteria 3990
301 Ga0105251_10041976 3300009011 Bacteria 2223
302 Ga0105244_10082458 3300009036 Bacteria 1590
303 Ga0105250_10014064 3300009092 Bacteria 3295
304 Ga0105240_10134473 3300009093 Bacteria 2962
305 Ga0105240_10179296 3300009093 Bacteria 2502
306 Ga0105240_10733264 3300009093 Bacteria 1076
307 Ga0111539_10000196 3300009094 Bacteria 70998
308 Ga0111539_10000376 3300009094 Bacteria 55320
309 Ga0111539_10003800 3300009094 Bacteria 19864
310 Ga0111539_10143834 3300009094 Bacteria 2791
311 Ga0111539_10472322 3300009094 Bacteria 1460
312 Ga0105245_10001838 3300009098 Bacteria 19304
313 Ga0105245_10006498 3300009098 Bacteria 10274
314 Ga0105245_10016640 3300009098 Bacteria 6420
315 Ga0105245_10079716 3300009098 Bacteria 2990
316 Ga0105245_11140041 3300009098 Bacteria 827
317 Ga0105247_10000844 3300009101 Bacteria 23209
318 Ga0105247_10002518 3300009101 Bacteria 12449
319 Ga0105247_10093881 3300009101 Bacteria 1908
320 Ga0105247_10097375 3300009101 Bacteria 1877
321 Ga0114129_10002010 3300009147 Bacteria 27861
322 Ga0114129_10241321 3300009147 Bacteria 2429
323 Ga0114129_10480924 3300009147 Bacteria 1625
324 Ga0105243_10006208 3300009148 Bacteria 9241
325 Ga0105243_10009505 3300009148 Bacteria 7402
326 Ga0105243_10014565 3300009148 Bacteria 5950
327 Ga0105243_10057964 3300009148 Bacteria 3085
328 Ga0105241_10002564 3300009174 Bacteria 13641
329 Ga0105241_10025770 3300009174 Bacteria 4371
330 Ga0105242_10002293 3300009176 Bacteria 15111
331 Ga0105242_10022560 3300009176 Bacteria 4953
332 Ga0105242_10038425 3300009176 Bacteria 3849
333 Ga0105248_10000500 3300009177 Bacteria 44664
334 Ga0105248_10004770 3300009177 Bacteria 15005
335 Ga0105248_10042372 3300009177 Bacteria 5105
336 Ga0105248_10085829 3300009177 Bacteria 3542
337 Ga0105248_10200414 3300009177 Bacteria 2249
338 Ga0105237_10008730 3300009545 Bacteria 10943
339 Ga0105237_10048166 3300009545 Bacteria 4284
340 Ga0105237_10069141 3300009545 Bacteria 3526
341 Ga0105237_10141717 3300009545 Bacteria 2398
342 Ga0105238_10033617 3300009551 Bacteria 5219
343 Ga0105238_10044749 3300009551 Bacteria 4474
344 Ga0105238_10044976 3300009551 Bacteria 4461
345 Ga0105238_10059560 3300009551 Bacteria 3825
346 Ga0105238_10164644 3300009551 Bacteria 2193
347 Ga0105238_10427704 3300009551 Bacteria 1319
348 Ga0105249_10001469 3300009553 Bacteria 20681
349 Ga0105249_10030586 3300009553 Bacteria 4868
350 Ga0105249_10106073 3300009553 Bacteria 2650
351 Ga0105239_10042105 3300010375 Bacteria 5004
352 Ga0105239_10086621 3300010375 Bacteria 3452
353 Ga0105239_10197881 3300010375 Bacteria 2251
354 Ga0105239_10613774 3300010375 Bacteria 1241
355 Ga0105239_10701616 3300010375 Bacteria 1157
356 Ga0105239_11679067 3300010375 Bacteria 735
357 Ga0105246_10000033 3300011119 Bacteria 50575
358 Ga0105246_10021948 3300011119 Bacteria 4115
359 Ga0105246_10064937 3300011119 Bacteria 2551
360 Ga0105246_10603112 3300011119 Bacteria 949
361 Ga0157343_1002860 3300012488 Bacteria 971
362 Ga0157341_1006572 3300012494 Unclassified 904
363 Ga0157342_1002420 3300012507 Bacteria 1513
364 Ga0157326_1003431 3300012513 Bacteria 1668
365 Ga0157338_1002670 3300012515 Bacteria 1419
366 Ga0157338_1005608 3300012515 Bacteria 1134
367 Ga0157373_10135546 3300013100 Bacteria 1731
368 Ga0157371_10032991 3300013102 Bacteria 3722
369 Ga0157371_10091631 3300013102 Unclassified 2153
370 Ga0157371_10186041 3300013102 Bacteria 1486
371 Ga0157371_10550999 3300013102 Bacteria 855
372 Ga0157370_10074523 3300013104 Bacteria 3201
373 Ga0157370_10261911 3300013104 Bacteria 1598
374 Ga0157369_10320562 3300013105 Bacteria 1611
375 Ga0157369_11079085 3300013105 Unclassified 821
376 Ga0157369_11198389 3300013105 Bacteria 775
377 Ga0157374_10000092 3300013296 Bacteria 85738
378 Ga0157378_10055006 3300013297 Bacteria 3544
379 Ga0157378_10965564 3300013297 Unclassified 885
380 Ga0163162_10004452 3300013306 Bacteria 13496
381 Ga0163162_10014395 3300013306 Bacteria 7729
382 Ga0163162_10072042 3300013306 Bacteria 3509
383 Ga0157372_10005853 3300013307 Bacteria 13089
384 Ga0157372_10168116 3300013307 Bacteria 2536
385 Ga0157372_11087296 3300013307 Unclassified 925
386 Ga0157375_10000124 3300013308 Bacteria 76003
387 Ga0157375_10058863 3300013308 Bacteria 3803
388 Ga0157375_10990574 3300013308 Bacteria 981
389 Ga0163163_10012287 3300014325 Bacteria 7797
390 Ga0163163_10264303 3300014325 Bacteria 1772
391 Ga0163163_10892036 3300014325 Bacteria 953
392 Ga0157380_10005052 3300014326 Bacteria 9205
393 Ga0157377_10000117 3300014745 Bacteria 53219
394 Ga0157379_10001950 3300014968 Bacteria 17074
395 Ga0157379_10015688 3300014968 Bacteria 6657
396 Ga0157379_10129455 3300014968 Bacteria 2271
397 Ga0157376_10000034 3300014969 Bacteria 161526
398 Ga0163161_10000448 3300017792 Bacteria 34334
399 Ga0163161_10159459 3300017792 Bacteria 1720
400 Ga0206356_11418804 3300020070 Bacteria 1572
401 Ga0206353_11397207 3300020082 Bacteria 2647
402 Ga0228598_1000969 3300024227 Bacteria 6257
403 Ga0207666_1000017 3300025271 Bacteria 40049
404 Ga0207666_1005711 3300025271 Bacteria 1595
405 Ga0207673_1000126 3300025290 Bacteria 7246
406 Ga0207697_10000009 3300025315 Bacteria 67526
407 Ga0207697_10004737 3300025315 Bacteria 6445
408 Ga0207653_10004111 3300025885 Bacteria 4578
409 Ga0207653_10031345 3300025885 Bacteria 1717
410 Ga0207682_10000016 3300025893 Bacteria 78971
411 Ga0207692_10000310 3300025898 Bacteria 16888
412 Ga0207692_10153055 3300025898 Unclassified 1322
413 Ga0207692_10221782 3300025898 Bacteria 1121
414 Ga0207642_10000097 3300025899 Bacteria 23215
415 Ga0207642_10160538 3300025899 Bacteria 1206
416 Ga0207710_10001326 3300025900 Bacteria 12441
417 Ga0207710_10076117 3300025900 Bacteria 1548
418 Ga0207688_10000012 3300025901 Bacteria 60353
419 Ga0207688_10011852 3300025901 Bacteria 4745
420 Ga0207688_10087395 3300025901 Bacteria 1787
421 Ga0207680_10014461 3300025903 Bacteria 4086
422 Ga0207680_10136129 3300025903 Bacteria 1624
423 Ga0207680_10550498 3300025903 Unclassified 824
424 Ga0207647_10000675 3300025904 Bacteria 26752
425 Ga0207647_10037972 3300025904 Bacteria 3049
426 Ga0207647_10272082 3300025904 Bacteria 968
427 Ga0207699_10000471 3300025906 Bacteria 20543
428 Ga0207699_10203018 3300025906 Bacteria 1344
429 Ga0207645_10000124 3300025907 Bacteria 58746
430 Ga0207645_10017212 3300025907 Bacteria 4774
431 Ga0207643_10000075 3300025908 Bacteria 64981
432 Ga0207705_10054831 3300025909 Bacteria 2873
433 Ga0207705_10110648 3300025909 Bacteria 2029
434 Ga0207654_10001202 3300025911 Bacteria 13880
435 Ga0207654_10007738 3300025911 Bacteria 5423
436 Ga0207654_10063142 3300025911 Bacteria 2173
437 Ga0207654_10219197 3300025911 Bacteria 1261
438 Ga0207707_10017942 3300025912 Bacteria 6170
439 Ga0207707_10152349 3300025912 Bacteria 2021
440 Ga0207707_10384701 3300025912 Bacteria 1206
441 Ga0207707_10518322 3300025912 Bacteria 1015
442 Ga0207707_10574292 3300025912 Unclassified 956
443 Ga0207695_10048617 3300025913 Bacteria 4478
444 Ga0207695_10123825 3300025913 Bacteria 2550
445 Ga0207671_10008594 3300025914 Bacteria 8633
446 Ga0207671_10035231 3300025914 Bacteria 3716
447 Ga0207671_10204142 3300025914 Bacteria 1544
448 Ga0207693_10003324 3300025915 Bacteria 13761
449 Ga0207693_10004737 3300025915 Bacteria 11439
450 Ga0207693_10010263 3300025915 Bacteria 7601
451 Ga0207693_10021842 3300025915 Bacteria 5088
452 Ga0207693_10040963 3300025915 Bacteria 3648
453 Ga0207693_10124954 3300025915 Bacteria 2021
454 Ga0207693_10278041 3300025915 Bacteria 1312
455 Ga0207663_10066051 3300025916 Bacteria 2314
456 Ga0207663_10077737 3300025916 Bacteria 2161
457 Ga0207663_10179644 3300025916 Bacteria 1510
458 Ga0207663_10198854 3300025916 Bacteria 1444
459 Ga0207660_10000489 3300025917 Bacteria 26431
460 Ga0207660_10035183 3300025917 Bacteria 3475
461 Ga0207660_10073606 3300025917 Bacteria 2491
462 Ga0207660_10140859 3300025917 Bacteria 1844
463 Ga0207660_10762473 3300025917 Unclassified 790
464 Ga0207662_10001610 3300025918 Bacteria 11050
465 Ga0207662_10006081 3300025918 Bacteria 6495
466 Ga0207662_10057105 3300025918 Bacteria 2332
467 Ga0207662_10579180 3300025918 Bacteria 779
468 Ga0207657_10000162 3300025919 Bacteria 68121
469 Ga0207657_10017061 3300025919 Bacteria 6983
470 Ga0207657_10020743 3300025919 Bacteria 6202
471 Ga0207657_10125457 3300025919 Bacteria 2109
472 Ga0207657_10141255 3300025919 Bacteria 1967
473 Ga0207649_10000411 3300025920 Bacteria 31667
474 Ga0207649_10030727 3300025920 Bacteria 3185
475 Ga0207649_10109678 3300025920 Bacteria 1842
476 Ga0207649_10167420 3300025920 Bacteria 1528
477 Ga0207649_10516412 3300025920 Unclassified 910
478 Ga0207652_10001140 3300025921 Bacteria 23920
479 Ga0207652_10074697 3300025921 Bacteria 2952
480 Ga0207652_10253929 3300025921 Bacteria 1585
481 Ga0207652_10307336 3300025921 Bacteria 1431
482 Ga0207681_10000240 3300025923 Bacteria 42226
483 Ga0207681_10026130 3300025923 Bacteria 3763
484 Ga0207694_10073933 3300025924 Bacteria 2667
485 Ga0207694_10358316 3300025924 Bacteria 1208
486 Ga0207694_10608225 3300025924 Bacteria 919
487 Ga0207650_10001431 3300025925 Bacteria 17214
488 Ga0207659_10000017 3300025926 Bacteria 159908
489 Ga0207659_10083765 3300025926 Bacteria 2365
490 Ga0207687_10000417 3300025927 Bacteria 28902
491 Ga0207687_10004146 3300025927 Bacteria 9709
492 Ga0207687_10114298 3300025927 Bacteria 2009
493 Ga0207687_10464209 3300025927 Bacteria 1052
494 Ga0207700_10001311 3300025928 Bacteria 14107
495 Ga0207700_10035316 3300025928 Bacteria 3599
496 Ga0207700_10111760 3300025928 Bacteria 2200
497 Ga0207700_10224766 3300025928 Bacteria 1593
498 Ga0207664_10154464 3300025929 Bacteria 1952
499 Ga0207664_10289103 3300025929 Bacteria 1440
500 Ga0207644_10001407 3300025931 Bacteria 15495
501 Ga0207644_10001531 3300025931 Bacteria 14893
502 Ga0207690_10000151 3300025932 Bacteria 54897
503 Ga0207706_10000368 3300025933 Bacteria 48834
504 Ga0207706_10002253 3300025933 Bacteria 18837
505 Ga0207706_10015959 3300025933 Bacteria 6787
506 Ga0207706_10053322 3300025933 Bacteria 3570
507 Ga0207706_10080678 3300025933 Bacteria 2860
508 Ga0207686_10021340 3300025934 Bacteria 3716
509 Ga0207709_10000256 3300025935 Bacteria 63853
510 Ga0207709_10022259 3300025935 Bacteria 3594
511 Ga0207709_10384996 3300025935 Bacteria 1068
512 Ga0207670_10000086 3300025936 Bacteria 63570
513 Ga0207670_10005957 3300025936 Bacteria 6730
514 Ga0207670_10043022 3300025936 Bacteria 2980
515 Ga0207670_10068068 3300025936 Bacteria 2452
516 Ga0207669_10000423 3300025937 Bacteria 18505
517 Ga0207669_10058911 3300025937 Bacteria 2346
518 Ga0207704_10000139 3300025938 Bacteria 38829
519 Ga0207665_10000330 3300025939 Bacteria 32779
520 Ga0207665_10122123 3300025939 Bacteria 1841
521 Ga0207665_10177699 3300025939 Bacteria 1540
522 Ga0207691_10000303 3300025940 Bacteria 48873
523 Ga0207691_10043840 3300025940 Bacteria 4120
524 Ga0207691_10064509 3300025940 Bacteria 3318
525 Ga0207691_10067755 3300025940 Bacteria 3226
526 Ga0207711_10005029 3300025941 Bacteria 11217
527 Ga0207711_10044071 3300025941 Bacteria 3807
528 Ga0207711_10557180 3300025941 Unclassified 1069
529 Ga0207689_10000109 3300025942 Bacteria 67941
530 Ga0207689_10019901 3300025942 Bacteria 5653
531 Ga0207661_10000074 3300025944 Bacteria 68047
532 Ga0207661_10234227 3300025944 Bacteria 1627
533 Ga0207679_10000031 3300025945 Bacteria 165962
534 Ga0207679_10021114 3300025945 Bacteria 4406
535 Ga0207667_10013372 3300025949 Bacteria 9392
536 Ga0207667_10042411 3300025949 Bacteria 4836
537 Ga0207667_10239868 3300025949 Bacteria 1855
538 Ga0207667_10880201 3300025949 Bacteria 888
539 Ga0207651_10000044 3300025960 Bacteria 58072
540 Ga0207651_10160231 3300025960 Bacteria 1763
541 Ga0207651_10209166 3300025960 Bacteria 1569
542 Ga0207651_10232182 3300025960 Bacteria 1498
543 Ga0207712_10000279 3300025961 Bacteria 48635
544 Ga0207712_10031340 3300025961 Bacteria 3580
545 Ga0207668_10000345 3300025972 Bacteria 30182
546 Ga0207668_10106714 3300025972 Bacteria 2093
547 Ga0207640_10006780 3300025981 Bacteria 6301
548 Ga0207640_10316784 3300025981 Bacteria 1240
549 Ga0207658_10005668 3300025986 Bacteria 8542
550 Ga0207658_10064861 3300025986 Bacteria 2741
551 Ga0207658_10185927 3300025986 Bacteria 1723
552 Ga0207677_10000318 3300026023 Bacteria 35197
553 Ga0207677_10096674 3300026023 Bacteria 2162
554 Ga0207703_10001459 3300026035 Bacteria 21570
555 Ga0207703_10065807 3300026035 Bacteria 2980
556 Ga0207703_10838199 3300026035 Bacteria 879
557 Ga0207639_10000693 3300026041 Bacteria 23172
558 Ga0207639_10056656 3300026041 Bacteria 3005
559 Ga0207678_10000158 3300026067 Bacteria 56255
560 Ga0207678_10012404 3300026067 Bacteria 7480
561 Ga0207678_10018793 3300026067 Bacteria 6070
562 Ga0207678_10078154 3300026067 Bacteria 2834
563 Ga0207678_10458465 3300026067 Bacteria 1109
564 Ga0207708_10000098 3300026075 Bacteria 67005
565 Ga0207708_10001262 3300026075 Bacteria 19058
566 Ga0207702_10000835 3300026078 Bacteria 32256
567 Ga0207702_10201126 3300026078 Bacteria 1847
568 Ga0207702_10762576 3300026078 Bacteria 955
569 Ga0207641_10000408 3300026088 Bacteria 50477
570 Ga0207641_10109301 3300026088 Bacteria 2449
571 Ga0207641_10555422 3300026088 Bacteria 1120
572 Ga0207641_10742855 3300026088 Bacteria 968
573 Ga0207648_10000696 3300026089 Bacteria 37592
574 Ga0207648_10150924 3300026089 Bacteria 2050
575 Ga0207648_10212042 3300026089 Bacteria 1719
576 Ga0207676_10000133 3300026095 Bacteria 65766
577 Ga0207676_10794029 3300026095 Bacteria 923
578 Ga0207674_10000420 3300026116 Bacteria 55287
579 Ga0207675_100001505 3300026118 Bacteria 23351
580 Ga0207675_100011221 3300026118 Bacteria 8390
581 Ga0207675_100108270 3300026118 Bacteria 2621
582 Ga0207683_10000004 3300026121 Bacteria 188086
583 Ga0207683_10003260 3300026121 Bacteria 14152
584 Ga0207683_10155593 3300026121 Bacteria 2064
585 Ga0207698_10001253 3300026142 Bacteria 14832
586 Ga0207698_10104274 3300026142 Bacteria 2359
587 Ga0209179_1007189 3300027512 Bacteria 1830
588 Ga0210002_1029466 3300027617 Bacteria 908
589 Ga0209971_1010785 3300027682 Unclassified 2164
590 Ga0209971_1030214 3300027682 Bacteria 1297
591 Ga0209966_1000495 3300027695 Bacteria 10461
592 Ga0209998_10003496 3300027717 Bacteria 3431
593 Ga0209998_10006820 3300027717 Bacteria 2369
594 Ga0209813_10015509 3300027866 Bacteria 2066
595 Ga0209813_10027138 3300027866 Bacteria 1661
596 Ga0209813_10036383 3300027866 Bacteria 1478
597 Ga0209813_10053904 3300027866 Bacteria 1266
598 Ga0209974_10001709 3300027876 Bacteria 7966
599 Ga0209974_10041401 3300027876 Bacteria 1533
600 Ga0209974_10082143 3300027876 Unclassified 1110
601 Ga0207428_10000218 3300027907 Bacteria 79728
602 Ga0207428_10000250 3300027907 Bacteria 73217
603 Ga0268266_10126666 3300028379 Unclassified 2280
604 Ga0268266_10168682 3300028379 Bacteria 1985
605 Ga0268266_10497274 3300028379 Unclassified 1164
606 Ga0268265_10000752 3300028380 Bacteria 31485
607 Ga0268265_10038150 3300028380 Bacteria 3532
608 Ga0268264_10003892 3300028381 Bacteria 12796
609 Ga0268264_10088498 3300028381 Bacteria 2665
610 Ga0268264_10124325 3300028381 Bacteria 2278
611 Ga0265318_10025387 3300028577 Bacteria 2340
612 Ga0265336_10073931 3300028666 Bacteria 1019
613 Ga0265338_10135833 3300028800 Bacteria 1933
614 Ga0265338_10212036 3300028800 Bacteria 1453
615 Ga0265338_10342383 3300028800 Bacteria 1077
616 Ga0265330_10041814 3300031235 Bacteria 2031
617 Ga0265325_10000039 3300031241 Bacteria 93014
618 Ga0265325_10002499 3300031241 Bacteria 12381
619 Ga0265325_10003850 3300031241 Bacteria 9641
620 Ga0265325_10018367 3300031241 Bacteria 3877
621 Ga0265340_10118966 3300031247 Bacteria 1216
622 Ga0265339_10005148 3300031249 Bacteria 8770
623 Ga0265339_10095646 3300031249 Bacteria 1551
624 Ga0265316_10063336 3300031344 Bacteria 2868
625 Ga0265316_10096941 3300031344 Bacteria 2245
626 Ga0265316_10138819 3300031344 Bacteria 1827
627 Ga0265313_10002016 3300031595 Bacteria 18226
628 Ga0265313_10021637 3300031595 Bacteria 3513
629 Ga0265313_10070796 3300031595 Bacteria 1606
630 Ga0265342_10011239 3300031712 Bacteria 6141
631 Ga0265342_10021361 3300031712 Bacteria 4136
632 Ga0265342_10029333 3300031712 Bacteria 3416
633 Ga0373930_0000117 3300034816 Bacteria 8515
634 Ga0373930_0025651 3300034816 Bacteria 1184
635 Ga0373948_0000584 3300034817 Bacteria 4657
636 Ga0373948_0006817 3300034817 Unclassified 1902
637 Ga0373950_0000126 3300034818 Bacteria 13244
638 Ga0373958_0002830 3300034819 Bacteria 2467
639 Ga0373958_0005324 3300034819 Bacteria 1949
640 Ga0373938_0000052 3300034957 Bacteria 15127
641 Ga0373926_0010334 3300035083 Bacteria 3128
642 Ga0373928_0000217 3300035084 Bacteria 11150
643 Ga0373929_0000370 3300035085 Bacteria 8436
644 Ga0373934_0019849 3300035086 Bacteria 2582
645 Ga0373934_0179651 3300035086 Unclassified 869
646 Ga0373940_0000132 3300035088 Bacteria 9571
647 Ga0373940_0008405 3300035088 Bacteria 2366
648 Ga0373944_0011156 3300035089 Bacteria 2458
649 Ga0373949_0003535 3300035090 Bacteria 3698
650 Ga0373951_0000378 3300035091 Bacteria 13435
651 Ga0373951_0007297 3300035091 Bacteria 2515
652 Ga0373952_0000048 3300035092 Bacteria 14691
653 Ga0373952_0002317 3300035092 Bacteria 3431
654 Ga0373952_0035487 3300035092 Unclassified 1129
655 Ga0373952_0051761 3300035092 Bacteria 981
656 Ga0373923_0038581 3300035111 Bacteria 1958
657 Ga0373932_0000094 3300035112 Bacteria 23612
658 Ga0373936_0068812 3300035113 Bacteria 1456
659 Ga0373936_0079795 3300035113 Bacteria 1361
660 Ga0373936_0109211 3300035113 Unclassified 1173
661 Ga0373936_0255070 3300035113 Unclassified 784
662 Ga0373939_0000345 3300035114 Bacteria 11857
663 Ga0373939_0014164 3300035114 Bacteria 2064
664 Ga0373941_0000890 3300035115 Bacteria 6157
665 Ga0373941_0007367 3300035115 Bacteria 2690
666 Ga0373945_0019298 3300035116 Bacteria 2327
667 Ga0373953_0001519 3300035117 Bacteria 6738
668 Ga0373953_0012165 3300035117 Bacteria 3041
669 Ga0373954_0013676 3300035118 Bacteria 3616
670 Ga0373954_0026627 3300035118 Bacteria 2651
671 Ga0373954_0053670 3300035118 Bacteria 1895
672 Ga0373954_0069289 3300035118 Bacteria 1674
673 Ga0373956_0012857 3300035119 Bacteria 3477
674 Ga0373956_0063681 3300035119 Bacteria 1673
675 Ga0373957_0007335 3300035120 Bacteria 3526
676 Ga0373957_0032589 3300035120 Bacteria 1920
677 Ga0373957_0132586 3300035120 Bacteria 1015
678 Ga0373957_0139113 3300035120 Unclassified 992
679 Ga0373960_0000760 3300035121 Bacteria 6747
680 Ga0373960_0002160 3300035121 Bacteria 4428
681 Ga0373943_0012555 3300035170 Bacteria 3817
682 Ga0373943_0053351 3300035170 Bacteria 1996
683 Ga0373943_0059638 3300035170 Bacteria 1902
684 Ga0373943_0193211 3300035170 Unclassified 1123
685 Ga0373943_0195312 3300035170 Bacteria 1118
686 Ga0373943_0237462 3300035170 Bacteria 1020
687 Ga0373946_0012866 3300035171 Bacteria 3137
688 Ga0373955_0000848 3300035172 Bacteria 13090
689 Ga0373955_0002018 3300035172 Bacteria 8733
690 Ga0373955_0002468 3300035172 Bacteria 8082
691 Ga0373955_0022836 3300035172 Bacteria 3179
692 Ga0373955_0037242 3300035172 Bacteria 2585
693 Ga0373955_0348984 3300035172 Bacteria 896
694 Ga0373942_0001114 3300035207 Bacteria 7143
695 Ga0373942_0019511 3300035207 Bacteria 1693
696 Ga0373942_0178472 3300035207 Unclassified 695
697 Ga0373961_0003766 3300035241 Bacteria 3706
698 Ga0373961_0016311 3300035241 Bacteria 1912
699 Ga0373962_0000137 3300035242 Bacteria 15079
700 Ga0373962_0010224 3300035242 Unclassified 2335
701 Ga0373924_0002913 3300035410 Bacteria 5801
702 Ga0373924_0008057 3300035410 Bacteria 3816
703 Ga0373931_0000034 3300035691 Bacteria 86665
704 Ga0373931_0006073 3300035691 Bacteria 5626
705 Ga0373931_0051263 3300035691 Bacteria 2198
706 Ga0373931_0106833 3300035691 Bacteria 1582
707 Ga0373935_0008682 3300035692 Bacteria 6084
708 Ga0373935_0014967 3300035692 Bacteria 4684
709 Ga0373935_0172448 3300035692 Bacteria 1480
710 Ga0373935_0236094 3300035692 Bacteria 1275
711 Ga0373935_0309937 3300035692 Unclassified 1117
712 Ga0373927_0000518 3300035695 Bacteria 29311
713 Ga0373927_0023682 3300035695 Bacteria 4019
714 Ga0373927_0164926 3300035695 Bacteria 1452
715 Ga0373927_0169537 3300035695 Bacteria 1431
716 Ga0373927_0346741 3300035695 Bacteria 978
717 Ga0373933_0003681 3300035724 Bacteria 8483
718 Ga0373933_0006901 3300035724 Bacteria 6187
719 Ga0373947_0000606 3300035725 Bacteria 21112
720 Ga0373947_0031697 3300035725 Bacteria 3112
721 Ga0373937_0002639 3300036401 Bacteria 14942
722 Ga0373937_0019623 3300036401 Bacteria 6051
723 Ga0373937_0060477 3300036401 Bacteria 3481
724 Ga0373937_0089875 3300036401 Bacteria 2844
725 Ga0373937_0112968 3300036401 Bacteria 2527
726 Ga0373937_0180069 3300036401 Bacteria 1984
727 Ga0373937_0504975 3300036401 Bacteria 1149
728 Ga0373937_0681645 3300036401 Bacteria 974
729 Ga0373925_0019706 3300037068 Bacteria 4909
730 Ga0373925_0044441 3300037068 Bacteria 3298
731 Ga0373925_0165024 3300037068 Bacteria 1746
732 Ga0373925_0204147 3300037068 Bacteria 1572
733 Ga0373925_0426251 3300037068 Bacteria 1084
734 Ga0395900_0013393 3300037418 Bacteria 8379
735 Ga0395898_0294195 3300037466 Unclassified 1549
736 Ga0395898_0316277 3300037466 Bacteria 1489
737 Ga0395901_0059834 3300038443 Bacteria 3963
738 Ga0242420_000894 3300038996 Bacteria 3705
739 Ga0436365_0725518 3300039437 Bacteria 1986
740 Ga0436365_1202710 3300039437 Bacteria 2694
741 Ga0439453_0005812 3300041408 Bacteria 1896
742 Ga0439463_037591 3300042016 Bacteria 1228
743 Ga0439460_0023172 3300042461 Bacteria 1710
744 Ga0450893_0032341 3300042532 Bacteria 936
745 Ga0451577_0530788 3300042876 Bacteria 1069
746 Ga0453684_0083691 3300044712 Bacteria 3970
747 Ga0466971_0161189 3300044719 Bacteria 1050
748 Ga0495617_060354 3300046452 Bacteria 1255
749 Ga0495592_0006010 3300046454 Bacteria 9023
750 Ga0495592_0044080 3300046454 Bacteria 3334
751 Ga0495592_0051338 3300046454 Bacteria 3063
752 Ga0495603_0056384 3300046455 Bacteria 2326
753 Ga0495603_0067844 3300046455 Bacteria 2098
754 Ga0495591_035974 3300046458 Bacteria 1445
755 Ga0495629_0005522 3300046459 Bacteria 9436
756 Ga0495629_0015898 3300046459 Bacteria 5406
757 Ga0495629_0057586 3300046459 Bacteria 2717
758 Ga0495629_0078241 3300046459 Bacteria 2309
759 Ga0495629_0086732 3300046459 Bacteria 2183
760 Ga0495629_0176118 3300046459 Bacteria 1483
761 Ga0495641_0010400 3300046461 Bacteria 5397
762 Ga0495641_0038589 3300046461 Bacteria 2231
763 Ga0495651_0000953 3300046462 Bacteria 22378
764 Ga0495651_0006662 3300046462 Bacteria 8830
765 Ga0495651_0106700 3300046462 Bacteria 2076
766 Ga0495651_0134921 3300046462 Bacteria 1797
767 Ga0495653_0001996 3300046463 Bacteria 16043
768 Ga0495653_0007423 3300046463 Bacteria 8977
769 Ga0495653_0055817 3300046463 Bacteria 3013
770 Ga0495653_0071132 3300046463 Bacteria 2602
771 Ga0495580_0098533 3300046472 Bacteria 2033
772 Ga0495580_0113272 3300046472 Bacteria 1884
773 Ga0495580_0278454 3300046472 Unclassified 1141
774 Ga0495582_0007172 3300046473 Bacteria 6188
775 Ga0495582_0015476 3300046473 Bacteria 4189
776 Ga0495582_0067342 3300046473 Bacteria 1978
777 Ga0495582_0214357 3300046473 Bacteria 1101
778 Ga0495639_0064239 3300046475 Bacteria 1686
779 Ga0495639_0081179 3300046475 Bacteria 1510
780 Ga0495662_0030423 3300046476 Bacteria 2606
781 Ga0495662_0032044 3300046476 Bacteria 2539
782 Ga0495664_0000976 3300046477 Bacteria 14715
783 Ga0495664_0006476 3300046477 Bacteria 6470
784 Ga0495664_0023101 3300046477 Bacteria 3606
785 Ga0495664_0127974 3300046477 Bacteria 1537
786 Ga0495664_0164433 3300046477 Unclassified 1346
787 Ga0495584_0053537 3300046491 Bacteria 2031
788 Ga0495585_0001710 3300046492 Bacteria 16728
789 Ga0495594_0003748 3300046499 Bacteria 7795
790 Ga0495594_0036053 3300046499 Bacteria 2696
791 Ga0495594_0273832 3300046499 Bacteria 962
792 Ga0495607_0001556 3300046501 Bacteria 20100
793 Ga0495608_0003982 3300046511 Bacteria 10606
794 Ga0495608_0017623 3300046511 Bacteria 4939
795 Ga0495608_0038614 3300046511 Bacteria 3205
796 Ga0495618_0004731 3300046514 Bacteria 8322
797 Ga0495618_0022404 3300046514 Bacteria 3901
798 Ga0495618_0043310 3300046514 Unclassified 2840
799 Ga0495618_0240630 3300046514 Bacteria 1138
800 Ga0495628_0013061 3300046516 Bacteria 6994
801 Ga0495628_0022252 3300046516 Bacteria 5209
802 Ga0495628_0047170 3300046516 Bacteria 3419
803 Ga0495628_0079907 3300046516 Unclassified 2542
804 Ga0495630_0023873 3300046517 Bacteria 4520
805 Ga0495630_0063762 3300046517 Bacteria 2768
806 Ga0495630_0091602 3300046517 Bacteria 2297
807 Ga0495630_0218917 3300046517 Bacteria 1453
808 Ga0495644_0007809 3300046523 Bacteria 4123
809 Ga0495666_0036237 3300046526 Bacteria 2403
810 Ga0495666_0074186 3300046526 Bacteria 1614
811 Ga0495652_0007587 3300046529 Bacteria 9995
812 Ga0495652_0039727 3300046529 Bacteria 4068
813 Ga0495652_0046128 3300046529 Bacteria 3742
814 Ga0495652_0048465 3300046529 Bacteria 3640
815 Ga0495652_0050450 3300046529 Unclassified 3557
816 Ga0495652_0238850 3300046529 Bacteria 1354
817 Ga0495665_0005230 3300046531 Bacteria 6993
818 Ga0495665_0015212 3300046531 Bacteria 4146
819 Ga0495665_0029221 3300046531 Unclassified 2953
820 Ga0495640_0000406 3300046533 Bacteria 31017
821 Ga0495640_0006464 3300046533 Bacteria 9267
822 Ga0495640_0007428 3300046533 Bacteria 8619
823 Ga0495586_0179796 3300046535 Unclassified 1196
824 Ga0495587_0000784 3300046536 Bacteria 21237
825 Ga0495587_0021777 3300046536 Bacteria 3955
826 Ga0495587_0042701 3300046536 Bacteria 2703
827 Ga0495587_0140122 3300046536 Bacteria 1381
828 Ga0495645_0000656 3300046543 Bacteria 23844
829 Ga0495645_0026011 3300046543 Bacteria 4247
830 Ga0495645_0295504 3300046543 Unclassified 1060
831 Ga0495622_0003340 3300046557 Bacteria 7573
832 Ga0495633_0001919 3300046558 Bacteria 15133
833 Ga0495667_0001270 3300046559 Bacteria 16534
834 Ga0495667_0012253 3300046559 Bacteria 5811
835 Ga0495667_0025707 3300046559 Bacteria 3966
836 Ga0495667_0028685 3300046559 Bacteria 3748
837 Ga0495667_0074298 3300046559 Bacteria 2213
838 Ga0495656_0000503 3300046615 Bacteria 12828
839 Ga0495634_0008180 3300046642 Bacteria 7794
840 Ga0495634_0021259 3300046642 Bacteria 4589
841 Ga0495634_0022715 3300046642 Bacteria 4419
842 Ga0495635_0001701 3300046663 Bacteria 14818
843 Ga0495635_0003774 3300046663 Bacteria 10521
844 Ga0495635_0007304 3300046663 Bacteria 7716
845 Ga0495635_0027249 3300046663 Bacteria 3975
846 Ga0495635_0032148 3300046663 Bacteria 3641
847 Ga0495635_0092813 3300046663 Bacteria 2064
848 Ga0495635_0101464 3300046663 Bacteria 1967
849 Ga0495635_0195139 3300046663 Bacteria 1374
850 Ga0495659_0156620 3300046664 Bacteria 917
851 Ga0495661_0023514 3300046665 Bacteria 4000
852 Ga0495588_0029047 3300046674 Bacteria 2771
853 Ga0495657_0000582 3300046675 Bacteria 33505
854 Ga0495657_0027053 3300046675 Bacteria 4053
855 Ga0495599_0000980 3300046678 Bacteria 15973
856 Ga0495599_0013722 3300046678 Bacteria 5010
857 Ga0495599_0056893 3300046678 Bacteria 2447
858 Ga0495623_0000585 3300046679 Bacteria 24290
859 Ga0495623_0046809 3300046679 Bacteria 2745
860 Ga0495623_0073176 3300046679 Bacteria 2130
861 Ga0495646_0000200 3300046680 Bacteria 29769
862 Ga0495646_0204047 3300046680 Bacteria 1075
863 Ga0495647_0001263 3300046681 Bacteria 7804
864 Ga0495647_0004820 3300046681 Bacteria 4405
865 Ga0495647_0048997 3300046681 Bacteria 1635
866 Ga0495647_0078147 3300046681 Bacteria 1337
867 Ga0495658_0000278 3300046683 Bacteria 29065
868 Ga0495658_0008696 3300046683 Bacteria 5041
869 Ga0495658_0034527 3300046683 Bacteria 2776
870 Ga0495613_0032552 3300046689 Bacteria 3874
871 Ga0495613_0153955 3300046689 Bacteria 1638
872 Ga0495613_0222855 3300046689 Bacteria 1323
873 Ga0495624_0004272 3300046690 Bacteria 10497
874 Ga0495624_0023760 3300046690 Bacteria 4039
875 Ga0495624_0057326 3300046690 Bacteria 2449
876 Ga0495624_0314071 3300046690 Bacteria 944
877 Ga0495670_0002792 3300046691 Bacteria 8636
878 Ga0495600_0016272 3300046809 Bacteria 4717
879 Ga0495600_0020754 3300046809 Bacteria 4202
880 Ga0495600_0051308 3300046809 Bacteria 2693
881 Ga0495581_0004217 3300047315 Bacteria 8283
882 Ga0495581_0059975 3300047315 Bacteria 2199
883 Ga0495581_0068347 3300047315 Bacteria 2054
884 Ga0495581_0082785 3300047315 Bacteria 1859
885 Ga0495581_0093078 3300047315 Bacteria 1749
886 Ga0495604_0005558 3300047317 Bacteria 9995
887 Ga0495604_0020211 3300047317 Bacteria 5321
888 Ga0495604_0041535 3300047317 Bacteria 3607
889 Ga0495604_0065864 3300047317 Bacteria 2757
890 Ga0495604_0220351 3300047317 Unclassified 1306
891 Ga0495674_0001289 3300047319 Bacteria 24350
892 Ga0495674_0003539 3300047319 Bacteria 15202
893 Ga0495674_0018544 3300047319 Bacteria 6476
894 Ga0495674_0026786 3300047319 Bacteria 5273
895 Ga0495674_0095990 3300047319 Bacteria 2527
896 Ga0495674_0254218 3300047319 Bacteria 1445
897 Ga0495676_0058982 3300047321 Bacteria 3017
898 Ga0495676_0080731 3300047321 Bacteria 2468
899 Ga0495676_0098045 3300047321 Bacteria 2175
900 Ga0495676_0101647 3300047321 Bacteria 2126
901 Ga0495680_0001872 3300047322 Bacteria 22140
902 Ga0495680_0003975 3300047322 Bacteria 14284
903 Ga0495680_0005700 3300047322 Bacteria 11659
904 Ga0495680_0006567 3300047322 Bacteria 10792
905 Ga0495680_0022426 3300047322 Bacteria 5261
906 Ga0495680_0190146 3300047322 Bacteria 1477
907 Ga0495675_0003810 3300047444 Bacteria 9131
908 Ga0495675_0050829 3300047444 Bacteria 2634
909 Ga0495675_0399334 3300047444 Unclassified 802
910 Ga0495684_0000713 3300047471 Bacteria 26743
911 Ga0495684_0001047 3300047471 Bacteria 22374
912 Ga0495684_0029275 3300047471 Bacteria 4227
913 Ga0495684_0031351 3300047471 Bacteria 4081
914 Ga0495684_0069210 3300047471 Bacteria 2684
915 Ga0495684_0131646 3300047471 Bacteria 1878
916 Ga0495593_0005474 3300047673 Bacteria 7496
917 Ga0495593_0100935 3300047673 Bacteria 1480
918 Ga0495593_0131849 3300047673 Bacteria 1268
919 Ga0495602_0008181 3300048088 Bacteria 10926
920 Ga0495602_0013918 3300048088 Bacteria 8197
921 Ga0495602_0022737 3300048088 Bacteria 6131
922 Ga0495602_0461589 3300048088 Bacteria 894
923 Ga0495614_0011762 3300048089 Bacteria 3847
924 Ga0496100_0000050 3300048903 Bacteria 75449
925 Ga0496100_0045393 3300048903 Unclassified 2820
926 Ga0496100_0055828 3300048903 Bacteria 2582
927 Ga0496100_0068894 3300048903 Bacteria 2354
928 Ga0496100_0196240 3300048903 Bacteria 1468
929 Ga0496100_0568079 3300048903 Unclassified 879
930 Ga0496100_0634135 3300048903 Bacteria 831
931 Ga0496101_0000121 3300048904 Bacteria 76264
932 Ga0496101_0016049 3300048904 Bacteria 5055
933 Ga0496101_0058342 3300048904 Bacteria 2795
934 Ga0496101_0106920 3300048904 Bacteria 2101
935 Ga0496102_0042762 3300048905 Bacteria 4107
936 Ga0496102_0359562 3300048905 Bacteria 1371
937 Ga0496102_0393924 3300048905 Bacteria 1302
938 Ga0496102_0443848 3300048905 Bacteria 1217
939 Ga0496103_0004803 3300048906 Bacteria 8169
940 Ga0496103_0051978 3300048906 Bacteria 2537
941 Ga0496103_0309559 3300048906 Bacteria 1016
942 Ga0496104_0001467 3300048907 Bacteria 20349
943 Ga0496104_0015855 3300048907 Bacteria 6836
944 Ga0496104_0060294 3300048907 Bacteria 3594
945 Ga0496104_0072728 3300048907 Bacteria 3270
946 Ga0496104_0281725 3300048907 Bacteria 1575
947 Ga0496104_0642052 3300048907 Bacteria 971
948 Ga0496104_0735788 3300048907 Bacteria 894
949 Ga0496105_0056163 3300048908 Archaea 3250
950 Ga0496105_0056440 3300048908 Bacteria 3241
951 Ga0496105_0098428 3300048908 Bacteria 2415
952 Ga0496106_0000133 3300048909 Bacteria 55926
953 Ga0496106_0080367 3300048909 Bacteria 2504
954 Ga0496107_0006506 3300048910 Bacteria 8033
955 Ga0496107_0013988 3300048910 Bacteria 5615
956 Ga0496107_0083499 3300048910 Bacteria 2329
957 Ga0496107_0716626 3300048910 Bacteria 735
958 Ga0496108_0013476 3300048911 Bacteria 6671
959 Ga0496108_0068226 3300048911 Bacteria 3000
960 Ga0496108_0228818 3300048911 Archaea 1616
961 Ga0496109_0001741 3300048912 Bacteria 18178
962 Ga0496109_0002099 3300048912 Bacteria 16567
963 Ga0496109_0009353 3300048912 Bacteria 8349
964 Ga0496109_0064809 3300048912 Bacteria 3344
965 Ga0496109_0174145 3300048912 Bacteria 2019
966 Ga0496109_0184564 3300048912 Bacteria 1960
967 Ga0496109_0545768 3300048912 Bacteria 1093
968 Ga0496110_0141017 3300048913 Unclassified 2179
969 Ga0496110_0210718 3300048913 Bacteria 1766
970 Ga0496110_0454615 3300048913 Bacteria 1167
971 Ga0496110_0801623 3300048913 Unclassified 846
972 Ga0496111_0010401 3300048914 Bacteria 6243
973 Ga0496111_0128454 3300048914 Archaea 1874
974 Ga0496111_0150250 3300048914 Bacteria 1727
975 Ga0496111_0291593 3300048914 Bacteria 1210
976 Ga0496111_0413963 3300048914 Bacteria 996
977 Ga0496112_0044099 3300048915 Bacteria 4368
978 Ga0496112_0065541 3300048915 Bacteria 3584
979 Ga0496112_0124052 3300048915 Bacteria 2553
980 Ga0496112_0147191 3300048915 Bacteria 2323
981 Ga0496112_0203642 3300048915 Bacteria 1937
982 Ga0496112_0328383 3300048915 Bacteria 1474
983 Ga0496112_0468855 3300048915 Unclassified 1196
984 Ga0496112_0594839 3300048915 Bacteria 1038
985 Ga0496112_0635420 3300048915 Bacteria 998
986 Ga0496113_0008981 3300048916 Bacteria 6542
987 Ga0496113_0078278 3300048916 Bacteria 2530
988 Ga0496113_0079275 3300048916 Bacteria 2514
989 Ga0496113_0138203 3300048916 Bacteria 1916
990 Ga0496113_0437016 3300048916 Bacteria 1051
991 Ga0496114_0003778 3300048917 Bacteria 11671
992 Ga0496114_0040751 3300048917 Bacteria 3846
993 Ga0496114_0077920 3300048917 Bacteria 2795
994 Ga0496114_0267030 3300048917 Bacteria 1507
995 Ga0496114_0664054 3300048917 Bacteria 916
996 Ga0496115_0005713 3300048918 Bacteria 9055
997 Ga0496115_0034569 3300048918 Bacteria 3995
998 Ga0496115_0341722 3300048918 Bacteria 1221
999 Ga0496126_0052179 3300048929 Bacteria 3718
1000 Ga0501070_0089954 3300049586 Bacteria 2541
1001 Ga0501071_0105363 3300049587 Bacteria 2082
1002 Ga0501073_0015726 3300049589 Bacteria 5484
1003 Ga0501073_0018153 3300049589 Bacteria 5085
1004 Ga0501073_0315151 3300049589 Bacteria 1079
1005 Ga0501073_0361681 3300049589 Bacteria 1002
1006 Ga0501075_0244801 3300049591 Bacteria 1367
1007 Ga0501075_0824734 3300049591 Bacteria 706
1008 Ga0501076_0039609 3300049592 Unclassified 3700
1009 Ga0501076_0070354 3300049592 Bacteria 2797
1010 Ga0501076_0267914 3300049592 Bacteria 1399
1011 Ga0501079_0635210 3300049741 Bacteria 841
1012 Ga0501081_0156198 3300049743 Bacteria 1642
1013 Ga0501083_0192574 3300049744 Bacteria 1331
1014 Ga0501083_0390590 3300049744 Unclassified 905
1015 Ga0501035_0402446 3300049822 Bacteria 1139
1016 Ga0501044_0401187 3300049823 Bacteria 1284
1017 Ga0501045_0126255 3300049824 Bacteria 1901
1018 nmdc:mga03683_112841_c1 3300050489 Bacteria 1203
1019 nmdc:mga03683_31760_c1 3300050489 Bacteria 2121
1020 nmdc:mga03n38_17324_c1 3300050490 Bacteria 2819
1021 nmdc:mga03n38_282230_c1 3300050490 Bacteria 887
1022 nmdc:mga00v17_273275_c1 3300050491 Bacteria 1097
1023 nmdc:mga00v17_420723_c1 3300050491 Bacteria 868
1024 nmdc:mga0yw44_18637_c1 3300050492 Bacteria 2370
1025 nmdc:mga0yw44_271705_c1 3300050492 Bacteria 1132
1026 nmdc:mga0yw44_500149_c1 3300050492 Bacteria 825
1027 nmdc:mga0yw44_500294_c1 3300050492 Bacteria 825
1028 nmdc:mga0k408_220012_c1 3300050493 Bacteria 1134
1029 nmdc:mga06z11_115767_c1 3300050494 Bacteria 1490
1030 nmdc:mga06z11_20423_c1 3300050494 Bacteria 3062
1031 nmdc:mga06z11_332237_c1 3300050494 Bacteria 908
1032 nmdc:mga06z11_399052_c1 3300050494 Bacteria 828
1033 nmdc:mga06z11_72502_c1 3300050494 Bacteria 1826
1034 nmdc:mga04h51_17826_c1 3300050495 Bacteria 1653
1035 nmdc:mga04h51_26133_c1 3300050495 Bacteria 1803
1036 nmdc:mga04h51_31780_c1 3300050495 Bacteria 1670
1037 nmdc:mga04h51_37823_c1 3300050495 Bacteria 1560
1038 nmdc:mga07m45_30137_c1 3300050496 Bacteria 3004
1039 nmdc:mga05p37_106164_c1 3300050507 Bacteria 3455
1040 nmdc:mga05p37_354_c1 3300050507 Bacteria 49188
1041 nmdc:mga09592_4746_c1 3300050508 Bacteria 11013
1042 nmdc:mga0qj67_935_c1 3300050509 Bacteria 20095
1043 nmdc:mga06r32_147_c1 3300050510 Bacteria 53171
1044 nmdc:mga08y16_26007_c1 3300050511 Bacteria 6175
1045 nmdc:mga08y16_289_c1 3300050511 Bacteria 45654
1046 nmdc:mga08y16_3527_c1 3300050511 Bacteria 16242
1047 nmdc:mga08y16_707067_c1 3300050511 Bacteria 1007
1048 nmdc:mga0n895_2125_c1 3300050512 Bacteria 15305
1049 nmdc:mga0n895_414471_c1 3300050512 Bacteria 1362
1050 nmdc:mga0n895_537262_c1 3300050512 Bacteria 1176
1051 nmdc:mga0n895_545_c1 3300050512 Bacteria 25797
1052 nmdc:mga0rr50_1020138_c1 3300050513 Bacteria 705
1053 nmdc:mga0rr50_1502_c1 3300050513 Bacteria 12829
1054 nmdc:mga0rr50_160947_c1 3300050513 Bacteria 1822
1055 nmdc:mga0rr50_219355_c1 3300050513 Bacteria 1570
1056 nmdc:mga0rr50_9459_c2 3300050513 Bacteria 1775
1057 nmdc:mga0rr50_98743_c1 3300050513 Bacteria 2289
1058 nmdc:mga08x19_24_c1 3300050514 Bacteria 245940
1059 nmdc:mga08x19_378558_c1 3300050514 Bacteria 991
1060 nmdc:mga0a205_131106_c1 3300050515 Bacteria 2092
1061 nmdc:mga0a205_140696_c1 3300050515 Bacteria 2313
1062 nmdc:mga0a205_270347_c1 3300050515 Bacteria 1577
1063 nmdc:mga0a205_4915_c1 3300050515 Bacteria 12023
1064 nmdc:mga0a205_60_c1 3300050515 Bacteria 60202
1065 nmdc:mga0sz30_26694_c1 3300050516 Bacteria 2369
1066 Ga0495601_0000068 3300053077 Bacteria 56524
1067 Ga0495601_0001006 3300053077 Bacteria 15442
1068 Ga0495601_0002256 3300053077 Bacteria 10868
1069 Ga0495601_0003844 3300053077 Bacteria 8644
1070 Ga0495601_0027708 3300053077 Bacteria 3504
1071 Ga0495601_0041400 3300053077 Bacteria 2887
1072 Ga0495612_0001267 3300053078 Bacteria 10423
1073 Ga0495612_0003612 3300053078 Bacteria 6417
1074 Ga0495612_0004139 3300053078 Bacteria 6006
1075 Ga0500610_0104431 3300053079 Bacteria 1463
1076 Ga0495595_0001160 3300053084 Bacteria 10205
1077 Ga0495595_0002637 3300053084 Bacteria 7039
1078 Ga0495595_0005061 3300053084 Bacteria 5324
1079 Ga0495595_0010358 3300053084 Bacteria 3873
1080 Ga0495595_0099662 3300053084 Bacteria 1401
1081 Ga0495619_0000136 3300053085 Bacteria 54722
1082 Ga0495619_0000154 3300053085 Bacteria 50900
1083 Ga0495619_0000996 3300053085 Bacteria 18589
1084 Ga0495619_0001694 3300053085 Bacteria 14589
1085 Ga0495619_0002254 3300053085 Bacteria 12749
1086 Ga0495619_0128664 3300053085 Bacteria 1739
1087 Ga0495619_0149955 3300053085 Bacteria 1608
1088 Ga0495619_0303114 3300053085 Unclassified 1107
1089 Ga0500643_001473 3300053087 Bacteria 13507
1090 Ga0500644_0000904 3300053088 Bacteria 9477
1091 Ga0500646_0163067 3300053090 Bacteria 745
1092 Ga0500651_0085571 3300053093 Bacteria 1948
1093 Ga0500566_0057215 3300053094 Bacteria 2215
1094 Ga0500641_0001418 3300053096 Bacteria 8550
1095 Ga0500641_0005479 3300053096 Bacteria 4496
1096 Ga0500641_0175613 3300053096 Bacteria 921
1097 Ga0500650_0044907 3300053098 Bacteria 2046
1098 Ga0500595_000002 3300053119 Bacteria 1074388
1099 Ga0500595_015845 3300053119 Bacteria 2820
1100 Ga0500597_105718 3300053120 Bacteria 1223
1101 Ga0500652_000003 3300053131 Bacteria 221528
1102 Ga0500652_026516 3300053131 Bacteria 2232
1103 Ga0500658_0096881 3300053134 Bacteria 1283
1104 Ga0500588_0216757 3300053146 Bacteria 713
1105 Ga0500616_0000002 3300053153 Bacteria 1611257
1106 Ga0500636_0010026 3300053177 Bacteria 5516
1107 Ga0500645_000086 3300053730 Bacteria 74512
1108 Ga0501084_0174604 3300054114 Bacteria 1814
1109 Ga0501084_0201921 3300054114 Bacteria 1677
1110 Ga0373935_0040371
1111 SwRhRL2b_contig_902337
1112 2214856321
1113 ARSoilYngRDRAFT_c00224
1114 ARcpr5yngRDRAFT_c000200
1115 ARSoilOldRDRAFT_c000038
1116 ARCol0oldRDRAFT_c00169
1117 ARCol0yngRDRAFT_1000396
1118 JGI24746J21847_1002569
1119 JGI24740J21852_10050257
1120 JGI24739J22299_10000144
1121 JGI24737J22298_10001737
1122 JGI24737J22298_10001829
1123 JGI24750J21931_1000014
1124 JGI24745J21846_1000270
1125 JGI24748J21848_1002358
1126 JGI24738J21930_10000574
1127 JGI24749J21850_1001045
1128 JGI24744J21845_10000166
1129 JGI24035J26624_1008271
1130 JGI24033J26618_1001410
1131 JGI24034J26672_10000281
1132 JGI24742J22300_10001185
1133 JGI25405J52794_10053938
1134 Ga0065717_1004781
1135 Ga0065716_1000005
1136 Ga0065704_10093949
1137 Ga0065712_10068670
1138 Ga0065712_10069916
1139 Ga0065712_10070787
1140 Ga0065715_10000266
1141 Ga0065715_10001896
1142 Ga0065707_10091685
1143 Ga0070658_10091260
1144 Ga0070658_10104180
1145 Ga0070658_10254651
1146 Ga0070676_10000663
1147 Ga0070676_10266539
1148 Ga0070683_100000152
1149 Ga0070683_100203801
1150 Ga0070683_100721663
1151 Ga0070690_100000388
1152 Ga0070690_100024975
1153 Ga0070690_100194217
1154 Ga0070690_100209192
1155 Ga0070670_100004481
1156 Ga0070670_100027603
1157 Ga0070677_10000363
1158 Ga0068869_100000020
1159 Ga0068869_100186397
1160 Ga0070666_10007376
1161 Ga0070666_10025663
1162 Ga0070666_10157207
1163 Ga0070666_10167189
1164 Ga0070680_100025550
1165 Ga0070680_100029923
1166 Ga0070680_100045232
1167 Ga0070680_100148337
1168 Ga0070680_100367123
1169 Ga0070682_100000264
1170 Ga0070682_100081444
1171 Ga0070682_100180629
1172 Ga0070682_100541510
1173 Ga0068868_100035892
1174 Ga0070660_100000394
1175 Ga0070660_100165750
1176 Ga0070689_100004384
1177 Ga0070689_100008724
1178 Ga0070689_100318122
1179 Ga0070691_10008871
1180 Ga0070691_10037541
1181 Ga0070687_100000122
1182 Ga0070687_100011710
1183 Ga0070661_100048239
1184 Ga0070661_100117365
1185 Ga0070661_100146774
1186 Ga0070692_10006038
1187 Ga0070668_100009693
1188 Ga0070668_100104819
1189 Ga0070669_100001081
1190 Ga0070669_100009434
1191 Ga0070669_100610788
1192 Ga0070675_100009824
1193 Ga0070675_100084251
1194 Ga0070675_100118185
1195 Ga0070671_100000718
1196 Ga0070671_100005908
1197 Ga0070671_100017008
1198 Ga0070674_100000152
1199 Ga0070674_100059626
1200 Ga0070674_100197344
1201 Ga0070673_100000042
1202 Ga0070673_100029549
1203 Ga0070673_100053237
1204 Ga0070673_100147229
1205 Ga0070688_100009484
1206 Ga0070688_100021617
1207 Ga0070688_100024369
1208 Ga0070659_100000348
1209 Ga0070659_100043222
1210 Ga0070667_100000775
1211 Ga0070667_100009286
1212 Ga0070667_100036295
1213 Ga0070667_100213919
1214 Ga0070703_10000842
1215 Ga0070709_10001300
1216 Ga0070709_10218353
1217 Ga0070709_10618141
1218 Ga0070714_100503063
1219 Ga0070713_100008767
1220 Ga0070713_100134124
1221 Ga0070713_100309654
1222 Ga0070713_100725904
1223 Ga0070710_10107906
1224 Ga0070710_10271487
1225 Ga0070710_10365314
1226 Ga0070701_10000042
1227 Ga0070701_10012698
1228 Ga0070701_10375582
1229 Ga0070711_100060988
1230 Ga0070711_100206865
1231 Ga0070705_100004068
1232 Ga0070705_100035155
1233 Ga0070705_100171146
1234 Ga0070705_100402711
1235 Ga0070700_100001033
1236 Ga0070700_100014365
1237 Ga0070694_100010969
1238 Ga0070694_100040785
1239 Ga0070708_100277788
1240 Ga0070663_100000301
1241 Ga0070663_100004327
1242 Ga0070678_100003715
1243 Ga0070678_100008818
1244 Ga0070678_100224918
1245 Ga0070662_100008262
1246 Ga0070662_100142225
1247 Ga0070662_100152940
1248 Ga0070662_100308806
1249 Ga0070681_10017746
1250 Ga0070681_10060503
1251 Ga0070681_10303919
1252 Ga0070681_10397229
1253 Ga0070681_10412927
1254 Ga0068867_100013330
1255 Ga0068867_100195914
1256 Ga0068867_100539515
1257 Ga0070685_10009477
1258 Ga0070685_10109392
1259 Ga0070706_100713122
1260 Ga0070707_100167400
1261 Ga0074259_11284140
1262 Ga0070679_100080878
1263 Ga0070679_100103023
1264 Ga0070679_100222059
1265 Ga0070679_100637315
1266 Ga0070679_100695431
1267 Ga0070684_100003011
1268 Ga0070684_100059646
1269 Ga0070684_100338020
1270 Ga0070697_100000842
1271 Ga0070697_100043536
1272 Ga0070697_100383813
1273 Ga0068853_100001269
1274 Ga0068853_100057813
1275 Ga0068853_100437203
1276 Ga0070672_100000011
1277 Ga0070672_100077533
1278 Ga0070686_100000889
1279 Ga0070686_100049720
1280 Ga0070686_100072996
1281 Ga0070686_100370083
1282 Ga0070686_100489992
1283 Ga0070695_100000088
1284 Ga0070695_100019733
1285 Ga0070695_100051983
1286 Ga0070695_100350010
1287 Ga0070696_100003446
1288 Ga0070696_100036825
1289 Ga0070696_100040114
1290 Ga0070696_100137583
1291 Ga0070693_100000273
1292 Ga0070693_100175206
1293 Ga0070665_100849634
1294 Ga0070704_100000809
1295 Ga0068855_100003933
1296 Ga0068855_100019728
1297 Ga0068855_100044053
1298 Ga0068855_100490984
1299 Ga0070664_100000263
1300 Ga0068857_100002138
1301 Ga0068854_100001243
1302 Ga0068854_100068458
1303 Ga0068854_100189162
1304 Ga0068854_100261846
1305 Ga0068856_100000803
1306 Ga0068856_100091579
1307 Ga0068856_100601258
1308 Ga0068856_100655819
1309 Ga0070702_100000131
1310 Ga0070702_100326021
1311 Ga0068852_100001912
1312 Ga0068852_100067472
1313 Ga0068852_100113124
1314 Ga0068852_101028762
1315 Ga0068859_100004279
1316 Ga0068859_100011885
1317 Ga0068864_100000112
1318 Ga0068864_100077589
1319 Ga0068864_100591741
1320 Ga0068864_100774973
1321 Ga0068866_10000300
1322 Ga0068866_10132080
1323 Ga0068866_10216397
1324 Ga0068866_10352975
1325 Ga0068861_100004433
1326 Ga0068861_100034013
1327 Ga0068861_100134220
1328 Ga0068870_10000021
1329 Ga0068863_100000491
1330 Ga0068858_100000419
1331 Ga0068858_100032586
1332 Ga0068858_100055067
1333 Ga0068860_100001036
1334 Ga0068860_100080488
1335 Ga0068860_100173883
1336 Ga0068862_100002612
1337 Ga0068862_100008885
1338 Ga0081455_10000153
1339 Ga0081540_1008782
1340 Ga0070717_10000489
1341 Ga0070717_10082514
1342 Ga0070717_10173587
1343 Ga0070717_10528913
1344 Ga0075365_10084008
1345 Ga0075365_10198539
1346 Ga0075365_10483059
1347 Ga0075368_10009150
1348 Ga0075368_10035823
1349 Ga0075368_10092399
1350 Ga0075363_100020442
1351 Ga0075363_100062795
1352 Ga0075363_100248258
1353 Ga0075364_10044114
1354 Ga0075364_10079403
1355 Ga0075364_10467518
1356 Ga0070715_10210005
1357 Ga0070716_100005054
1358 Ga0070716_100114189
1359 Ga0070716_100484676
1360 Ga0070712_100007472
1361 Ga0070712_100031589
1362 Ga0070712_100105746
1363 Ga0070712_100251324
1364 Ga0075362_10007566
1365 Ga0075362_10038049
1366 Ga0075367_10016120
1367 Ga0075367_10084258
1368 Ga0075367_10094496
1369 Ga0075367_10101366
1370 Ga0075367_10176802
1371 Ga0075427_10001653
1372 Ga0075366_10122066
1373 Ga0097621_100000115
1374 Ga0097621_100036012
1375 Ga0097621_100126539
1376 Ga0097621_101219761
1377 Ga0075370_10067781
1378 Ga0075370_10099123
1379 Ga0075370_10305564
1380 Ga0068871_100000498
1381 Ga0068871_100002187
1382 Ga0068871_100020585
1383 Ga0068871_101069032
1384 Ga0075428_100000363
1385 Ga0075430_100000717
1386 Ga0075431_100000990
1387 Ga0075433_10000187
1388 Ga0075433_10004386
1389 Ga0075433_10085234
1390 Ga0075433_10198210
1391 Ga0075434_100002790
1392 Ga0075434_100026793
1393 Ga0075434_100473895
1394 Ga0075429_100000846
1395 Ga0068865_100000978
1396 Ga0068865_100014929
1397 Ga0068865_100251174
1398 Ga0075436_100007352
1399 Ga0075436_100359877
1400 Ga0097620_100004280
1401 Ga0097620_100011886
1402 Ga0075435_100005765
1403 Ga0075435_100045776
1404 Ga0075435_100064842
1405 Ga0075435_100121929
1406 Ga0075435_100233276
1407 Ga0075435_100730676
1408 Ga0099795_10064277
1409 Ga0105251_10016489
1410 Ga0105251_10041976
1411 Ga0105244_10082458
1412 Ga0105250_10014064
1413 Ga0105240_10134473
1414 Ga0105240_10179296
1415 Ga0105240_10733264
1416 Ga0111539_10000196
1417 Ga0111539_10000376
1418 Ga0111539_10003800
1419 Ga0111539_10143834
1420 Ga0111539_10472322
1421 Ga0105245_10001838
1422 Ga0105245_10006498
1423 Ga0105245_10016640
1424 Ga0105245_10079716
1425 Ga0105245_11140041
1426 Ga0105247_10000844
1427 Ga0105247_10002518
1428 Ga0105247_10093881
1429 Ga0105247_10097375
1430 Ga0114129_10002010
1431 Ga0114129_10241321
1432 Ga0114129_10480924
1433 Ga0105243_10006208
1434 Ga0105243_10009505
1435 Ga0105243_10014565
1436 Ga0105243_10057964
1437 Ga0105241_10002564
1438 Ga0105241_10025770
1439 Ga0105242_10002293
1440 Ga0105242_10022560
1441 Ga0105242_10038425
1442 Ga0105248_10000500
1443 Ga0105248_10004770
1444 Ga0105248_10042372
1445 Ga0105248_10085829
1446 Ga0105248_10200414
1447 Ga0105237_10008730
1448 Ga0105237_10048166
1449 Ga0105237_10069141
1450 Ga0105237_10141717
1451 Ga0105238_10033617
1452 Ga0105238_10044749
1453 Ga0105238_10044976
1454 Ga0105238_10059560
1455 Ga0105238_10164644
1456 Ga0105238_10427704
1457 Ga0105249_10001469
1458 Ga0105249_10030586
1459 Ga0105249_10106073
1460 Ga0105239_10042105
1461 Ga0105239_10086621
1462 Ga0105239_10197881
1463 Ga0105239_10613774
1464 Ga0105239_10701616
1465 Ga0105239_11679067
1466 Ga0105246_10000033
1467 Ga0105246_10021948
1468 Ga0105246_10064937
1469 Ga0105246_10603112
1470 Ga0157343_1002860
1471 Ga0157341_1006572
1472 Ga0157342_1002420
1473 Ga0157326_1003431
1474 Ga0157338_1002670
1475 Ga0157338_1005608
1476 Ga0157373_10135546
1477 Ga0157371_10032991
1478 Ga0157371_10091631
1479 Ga0157371_10186041
1480 Ga0157371_10550999
1481 Ga0157370_10074523
1482 Ga0157370_10261911
1483 Ga0157369_10320562
1484 Ga0157369_11079085
1485 Ga0157369_11198389
1486 Ga0157374_10000092
1487 Ga0157378_10055006
1488 Ga0157378_10965564
1489 Ga0163162_10004452
1490 Ga0163162_10014395
1491 Ga0163162_10072042
1492 Ga0157372_10005853
1493 Ga0157372_10168116
1494 Ga0157372_11087296
1495 Ga0157375_10000124
1496 Ga0157375_10058863
1497 Ga0157375_10990574
1498 Ga0163163_10012287
1499 Ga0163163_10264303
1500 Ga0163163_10892036
1501 Ga0157380_10005052
1502 Ga0157377_10000117
1503 Ga0157379_10001950
1504 Ga0157379_10015688
1505 Ga0157379_10129455
1506 Ga0157376_10000034
1507 Ga0163161_10000448
1508 Ga0163161_10159459
1509 Ga0206356_11418804
1510 Ga0206353_11397207
1511 Ga0228598_1000969
1512 Ga0207666_1000017
1513 Ga0207666_1005711
1514 Ga0207673_1000126
1515 Ga0207697_10000009
1516 Ga0207697_10004737
1517 Ga0207653_10004111
1518 Ga0207653_10031345
1519 Ga0207682_10000016
1520 Ga0207692_10000310
1521 Ga0207692_10153055
1522 Ga0207692_10221782
1523 Ga0207642_10000097
1524 Ga0207642_10160538
1525 Ga0207710_10001326
1526 Ga0207710_10076117
1527 Ga0207688_10000012
1528 Ga0207688_10011852
1529 Ga0207688_10087395
1530 Ga0207680_10014461
1531 Ga0207680_10136129
1532 Ga0207680_10550498
1533 Ga0207647_10000675
1534 Ga0207647_10037972
1535 Ga0207647_10272082
1536 Ga0207699_10000471
1537 Ga0207699_10203018
1538 Ga0207645_10000124
1539 Ga0207645_10017212
1540 Ga0207643_10000075
1541 Ga0207705_10054831
1542 Ga0207705_10110648
1543 Ga0207654_10001202
1544 Ga0207654_10007738
1545 Ga0207654_10063142
1546 Ga0207654_10219197
1547 Ga0207707_10017942
1548 Ga0207707_10152349
1549 Ga0207707_10384701
1550 Ga0207707_10518322
1551 Ga0207707_10574292
1552 Ga0207695_10048617
1553 Ga0207695_10123825
1554 Ga0207671_10008594
1555 Ga0207671_10035231
1556 Ga0207671_10204142
1557 Ga0207693_10003324
1558 Ga0207693_10004737
1559 Ga0207693_10010263
1560 Ga0207693_10021842
1561 Ga0207693_10040963
1562 Ga0207693_10124954
1563 Ga0207693_10278041
1564 Ga0207663_10066051
1565 Ga0207663_10077737
1566 Ga0207663_10179644
1567 Ga0207663_10198854
1568 Ga0207660_10000489
1569 Ga0207660_10035183
1570 Ga0207660_10073606
1571 Ga0207660_10140859
1572 Ga0207660_10762473
1573 Ga0207662_10001610
1574 Ga0207662_10006081
1575 Ga0207662_10057105
1576 Ga0207662_10579180
1577 Ga0207657_10000162
1578 Ga0207657_10017061
1579 Ga0207657_10020743
1580 Ga0207657_10125457
1581 Ga0207657_10141255
1582 Ga0207649_10000411
1583 Ga0207649_10030727
1584 Ga0207649_10109678
1585 Ga0207649_10167420
1586 Ga0207649_10516412
1587 Ga0207652_10001140
1588 Ga0207652_10074697
1589 Ga0207652_10253929
1590 Ga0207652_10307336
1591 Ga0207681_10000240
1592 Ga0207681_10026130
1593 Ga0207694_10073933
1594 Ga0207694_10358316
1595 Ga0207694_10608225
1596 Ga0207650_10001431
1597 Ga0207659_10000017
1598 Ga0207659_10083765
1599 Ga0207687_10000417
1600 Ga0207687_10004146
1601 Ga0207687_10114298
1602 Ga0207687_10464209
1603 Ga0207700_10001311
1604 Ga0207700_10035316
1605 Ga0207700_10111760
1606 Ga0207700_10224766
1607 Ga0207664_10154464
1608 Ga0207664_10289103
1609 Ga0207644_10001407
1610 Ga0207644_10001531
1611 Ga0207690_10000151
1612 Ga0207706_10000368
1613 Ga0207706_10002253
1614 Ga0207706_10015959
1615 Ga0207706_10053322
1616 Ga0207706_10080678
1617 Ga0207686_10021340
1618 Ga0207709_10000256
1619 Ga0207709_10022259
1620 Ga0207709_10384996
1621 Ga0207670_10000086
1622 Ga0207670_10005957
1623 Ga0207670_10043022
1624 Ga0207670_10068068
1625 Ga0207669_10000423
1626 Ga0207669_10058911
1627 Ga0207704_10000139
1628 Ga0207665_10000330
1629 Ga0207665_10122123
1630 Ga0207665_10177699
1631 Ga0207691_10000303
1632 Ga0207691_10043840
1633 Ga0207691_10064509
1634 Ga0207691_10067755
1635 Ga0207711_10005029
1636 Ga0207711_10044071
1637 Ga0207711_10557180
1638 Ga0207689_10000109
1639 Ga0207689_10019901
1640 Ga0207661_10000074
1641 Ga0207661_10234227
1642 Ga0207679_10000031
1643 Ga0207679_10021114
1644 Ga0207667_10013372
1645 Ga0207667_10042411
1646 Ga0207667_10239868
1647 Ga0207667_10880201
1648 Ga0207651_10000044
1649 Ga0207651_10160231
1650 Ga0207651_10209166
1651 Ga0207651_10232182
1652 Ga0207712_10000279
1653 Ga0207712_10031340
1654 Ga0207668_10000345
1655 Ga0207668_10106714
1656 Ga0207640_10006780
1657 Ga0207640_10316784
1658 Ga0207658_10005668
1659 Ga0207658_10064861
1660 Ga0207658_10185927
1661 Ga0207677_10000318
1662 Ga0207677_10096674
1663 Ga0207703_10001459
1664 Ga0207703_10065807
1665 Ga0207703_10838199
1666 Ga0207639_10000693
1667 Ga0207639_10056656
1668 Ga0207678_10000158
1669 Ga0207678_10012404
1670 Ga0207678_10018793
1671 Ga0207678_10078154
1672 Ga0207678_10458465
1673 Ga0207708_10000098
1674 Ga0207708_10001262
1675 Ga0207702_10000835
1676 Ga0207702_10201126
1677 Ga0207702_10762576
1678 Ga0207641_10000408
1679 Ga0207641_10109301
1680 Ga0207641_10555422
1681 Ga0207641_10742855
1682 Ga0207648_10000696
1683 Ga0207648_10150924
1684 Ga0207648_10212042
1685 Ga0207676_10000133
1686 Ga0207676_10794029
1687 Ga0207674_10000420
1688 Ga0207675_100001505
1689 Ga0207675_100011221
1690 Ga0207675_100108270
1691 Ga0207683_10000004
1692 Ga0207683_10003260
1693 Ga0207683_10155593
1694 Ga0207698_10001253
1695 Ga0207698_10104274
1696 Ga0209179_1007189
1697 Ga0210002_1029466
1698 Ga0209971_1010785
1699 Ga0209971_1030214
1700 Ga0209966_1000495
1701 Ga0209998_10003496
1702 Ga0209998_10006820
1703 Ga0209813_10015509
1704 Ga0209813_10027138
1705 Ga0209813_10036383
1706 Ga0209813_10053904
1707 Ga0209974_10001709
1708 Ga0209974_10041401
1709 Ga0209974_10082143
1710 Ga0207428_10000218
1711 Ga0207428_10000250
1712 Ga0268266_10126666
1713 Ga0268266_10168682
1714 Ga0268266_10497274
1715 Ga0268265_10000752
1716 Ga0268265_10038150
1717 Ga0268264_10003892
1718 Ga0268264_10088498
1719 Ga0268264_10124325
1720 Ga0265318_10025387
1721 Ga0265336_10073931
1722 Ga0265338_10135833
1723 Ga0265338_10212036
1724 Ga0265338_10342383
1725 Ga0265330_10041814
1726 Ga0265325_10000039
1727 Ga0265325_10002499
1728 Ga0265325_10003850
1729 Ga0265325_10018367
1730 Ga0265340_10118966
1731 Ga0265339_10005148
1732 Ga0265339_10095646
1733 Ga0265316_10063336
1734 Ga0265316_10096941
1735 Ga0265316_10138819
1736 Ga0265313_10002016
1737 Ga0265313_10021637
1738 Ga0265313_10070796
1739 Ga0265342_10011239
1740 Ga0265342_10021361
1741 Ga0265342_10029333
1742 Ga0373930_0000117
1743 Ga0373930_0025651
1744 Ga0373948_0000584
1745 Ga0373948_0006817
1746 Ga0373950_0000126
1747 Ga0373958_0002830
1748 Ga0373958_0005324
1749 Ga0373938_0000052
1750 Ga0373926_0010334
1751 Ga0373928_0000217
1752 Ga0373929_0000370
1753 Ga0373934_0019849
1754 Ga0373934_0179651
1755 Ga0373940_0000132
1756 Ga0373940_0008405
1757 Ga0373944_0011156
1758 Ga0373949_0003535
1759 Ga0373951_0000378
1760 Ga0373951_0007297
1761 Ga0373952_0000048
1762 Ga0373952_0002317
1763 Ga0373952_0035487
1764 Ga0373952_0051761
1765 Ga0373923_0038581
1766 Ga0373932_0000094
1767 Ga0373936_0068812
1768 Ga0373936_0079795
1769 Ga0373936_0109211
1770 Ga0373936_0255070
1771 Ga0373939_0000345
1772 Ga0373939_0014164
1773 Ga0373941_0000890
1774 Ga0373941_0007367
1775 Ga0373945_0019298
1776 Ga0373953_0001519
1777 Ga0373953_0012165
1778 Ga0373954_0013676
1779 Ga0373954_0026627
1780 Ga0373954_0053670
1781 Ga0373954_0069289
1782 Ga0373956_0012857
1783 Ga0373956_0063681
1784 Ga0373957_0007335
1785 Ga0373957_0032589
1786 Ga0373957_0132586
1787 Ga0373957_0139113
1788 Ga0373960_0000760
1789 Ga0373960_0002160
1790 Ga0373943_0012555
1791 Ga0373943_0053351
1792 Ga0373943_0059638
1793 Ga0373943_0193211
1794 Ga0373943_0195312
1795 Ga0373943_0237462
1796 Ga0373946_0012866
1797 Ga0373955_0000848
1798 Ga0373955_0002018
1799 Ga0373955_0002468
1800 Ga0373955_0022836
1801 Ga0373955_0037242
1802 Ga0373955_0348984
1803 Ga0373942_0001114
1804 Ga0373942_0019511
1805 Ga0373942_0178472
1806 Ga0373961_0003766
1807 Ga0373961_0016311
1808 Ga0373962_0000137
1809 Ga0373962_0010224
1810 Ga0373924_0002913
1811 Ga0373924_0008057
1812 Ga0373931_0000034
1813 Ga0373931_0006073
1814 Ga0373931_0051263
1815 Ga0373931_0106833
1816 Ga0373935_0008682
1817 Ga0373935_0014967
1818 Ga0373935_0172448
1819 Ga0373935_0236094
1820 Ga0373935_0309937
1821 Ga0373927_0000518
1822 Ga0373927_0023682
1823 Ga0373927_0164926
1824 Ga0373927_0169537
1825 Ga0373927_0346741
1826 Ga0373933_0003681
1827 Ga0373933_0006901
1828 Ga0373947_0000606
1829 Ga0373947_0031697
1830 Ga0373937_0002639
1831 Ga0373937_0019623
1832 Ga0373937_0060477
1833 Ga0373937_0089875
1834 Ga0373937_0112968
1835 Ga0373937_0180069
1836 Ga0373937_0504975
1837 Ga0373937_0681645
1838 Ga0373925_0019706
1839 Ga0373925_0044441
1840 Ga0373925_0165024
1841 Ga0373925_0204147
1842 Ga0373925_0426251
1843 Ga0395900_0013393
1844 Ga0395898_0294195
1845 Ga0395898_0316277
1846 Ga0395901_0059834
1847 Ga0242420_000894
1848 Ga0436365_0725518
1849 Ga0436365_1202710
1850 Ga0439453_0005812
1851 Ga0439463_037591
1852 Ga0439460_0023172
1853 Ga0450893_0032341
1854 Ga0451577_0530788
1855 Ga0453684_0083691
1856 Ga0466971_0161189
1857 Ga0495617_060354
1858 Ga0495592_0006010
1859 Ga0495592_0044080
1860 Ga0495592_0051338
1861 Ga0495603_0056384
1862 Ga0495603_0067844
1863 Ga0495591_035974
1864 Ga0495629_0005522
1865 Ga0495629_0015898
1866 Ga0495629_0057586
1867 Ga0495629_0078241
1868 Ga0495629_0086732
1869 Ga0495629_0176118
1870 Ga0495641_0010400
1871 Ga0495641_0038589
1872 Ga0495651_0000953
1873 Ga0495651_0006662
1874 Ga0495651_0106700
1875 Ga0495651_0134921
1876 Ga0495653_0001996
1877 Ga0495653_0007423
1878 Ga0495653_0055817
1879 Ga0495653_0071132
1880 Ga0495580_0098533
1881 Ga0495580_0113272
1882 Ga0495580_0278454
1883 Ga0495582_0007172
1884 Ga0495582_0015476
1885 Ga0495582_0067342
1886 Ga0495582_0214357
1887 Ga0495639_0064239
1888 Ga0495639_0081179
1889 Ga0495662_0030423
1890 Ga0495662_0032044
1891 Ga0495664_0000976
1892 Ga0495664_0006476
1893 Ga0495664_0023101
1894 Ga0495664_0127974
1895 Ga0495664_0164433
1896 Ga0495584_0053537
1897 Ga0495585_0001710
1898 Ga0495594_0003748
1899 Ga0495594_0036053
1900 Ga0495594_0273832
1901 Ga0495607_0001556
1902 Ga0495608_0003982
1903 Ga0495608_0017623
1904 Ga0495608_0038614
1905 Ga0495618_0004731
1906 Ga0495618_0022404
1907 Ga0495618_0043310
1908 Ga0495618_0240630
1909 Ga0495628_0013061
1910 Ga0495628_0022252
1911 Ga0495628_0047170
1912 Ga0495628_0079907
1913 Ga0495630_0023873
1914 Ga0495630_0063762
1915 Ga0495630_0091602
1916 Ga0495630_0218917
1917 Ga0495644_0007809
1918 Ga0495666_0036237
1919 Ga0495666_0074186
1920 Ga0495652_0007587
1921 Ga0495652_0039727
1922 Ga0495652_0046128
1923 Ga0495652_0048465
1924 Ga0495652_0050450
1925 Ga0495652_0238850
1926 Ga0495665_0005230
1927 Ga0495665_0015212
1928 Ga0495665_0029221
1929 Ga0495640_0000406
1930 Ga0495640_0006464
1931 Ga0495640_0007428
1932 Ga0495586_0179796
1933 Ga0495587_0000784
1934 Ga0495587_0021777
1935 Ga0495587_0042701
1936 Ga0495587_0140122
1937 Ga0495645_0000656
1938 Ga0495645_0026011
1939 Ga0495645_0295504
1940 Ga0495622_0003340
1941 Ga0495633_0001919
1942 Ga0495667_0001270
1943 Ga0495667_0012253
1944 Ga0495667_0025707
1945 Ga0495667_0028685
1946 Ga0495667_0074298
1947 Ga0495656_0000503
1948 Ga0495634_0008180
1949 Ga0495634_0021259
1950 Ga0495634_0022715
1951 Ga0495635_0001701
1952 Ga0495635_0003774
1953 Ga0495635_0007304
1954 Ga0495635_0027249
1955 Ga0495635_0032148
1956 Ga0495635_0092813
1957 Ga0495635_0101464
1958 Ga0495635_0195139
1959 Ga0495659_0156620
1960 Ga0495661_0023514
1961 Ga0495588_0029047
1962 Ga0495657_0000582
1963 Ga0495657_0027053
1964 Ga0495599_0000980
1965 Ga0495599_0013722
1966 Ga0495599_0056893
1967 Ga0495623_0000585
1968 Ga0495623_0046809
1969 Ga0495623_0073176
1970 Ga0495646_0000200
1971 Ga0495646_0204047
1972 Ga0495647_0001263
1973 Ga0495647_0004820
1974 Ga0495647_0048997
1975 Ga0495647_0078147
1976 Ga0495658_0000278
1977 Ga0495658_0008696
1978 Ga0495658_0034527
1979 Ga0495613_0032552
1980 Ga0495613_0153955
1981 Ga0495613_0222855
1982 Ga0495624_0004272
1983 Ga0495624_0023760
1984 Ga0495624_0057326
1985 Ga0495624_0314071
1986 Ga0495670_0002792
1987 Ga0495600_0016272
1988 Ga0495600_0020754
1989 Ga0495600_0051308
1990 Ga0495581_0004217
1991 Ga0495581_0059975
1992 Ga0495581_0068347
1993 Ga0495581_0082785
1994 Ga0495581_0093078
1995 Ga0495604_0005558
1996 Ga0495604_0020211
1997 Ga0495604_0041535
1998 Ga0495604_0065864
1999 Ga0495604_0220351
2000 Ga0495674_0001289
2001 Ga0495674_0003539
2002 Ga0495674_0018544
2003 Ga0495674_0026786
2004 Ga0495674_0095990
2005 Ga0495674_0254218
2006 Ga0495676_0058982
2007 Ga0495676_0080731
2008 Ga0495676_0098045
2009 Ga0495676_0101647
2010 Ga0495680_0001872
2011 Ga0495680_0003975
2012 Ga0495680_0005700
2013 Ga0495680_0006567
2014 Ga0495680_0022426
2015 Ga0495680_0190146
2016 Ga0495675_0003810
2017 Ga0495675_0050829
2018 Ga0495675_0399334
2019 Ga0495684_0000713
2020 Ga0495684_0001047
2021 Ga0495684_0029275
2022 Ga0495684_0031351
2023 Ga0495684_0069210
2024 Ga0495684_0131646
2025 Ga0495593_0005474
2026 Ga0495593_0100935
2027 Ga0495593_0131849
2028 Ga0495602_0008181
2029 Ga0495602_0013918
2030 Ga0495602_0022737
2031 Ga0495602_0461589
2032 Ga0495614_0011762
2033 Ga0496100_0000050
2034 Ga0496100_0045393
2035 Ga0496100_0055828
2036 Ga0496100_0068894
2037 Ga0496100_0196240
2038 Ga0496100_0568079
2039 Ga0496100_0634135
2040 Ga0496101_0000121
2041 Ga0496101_0016049
2042 Ga0496101_0058342
2043 Ga0496101_0106920
2044 Ga0496102_0042762
2045 Ga0496102_0359562
2046 Ga0496102_0393924
2047 Ga0496102_0443848
2048 Ga0496103_0004803
2049 Ga0496103_0051978
2050 Ga0496103_0309559
2051 Ga0496104_0001467
2052 Ga0496104_0015855
2053 Ga0496104_0060294
2054 Ga0496104_0072728
2055 Ga0496104_0281725
2056 Ga0496104_0642052
2057 Ga0496104_0735788
2058 Ga0496105_0056163
2059 Ga0496105_0056440
2060 Ga0496105_0098428
2061 Ga0496106_0000133
2062 Ga0496106_0080367
2063 Ga0496107_0006506
2064 Ga0496107_0013988
2065 Ga0496107_0083499
2066 Ga0496107_0716626
2067 Ga0496108_0013476
2068 Ga0496108_0068226
2069 Ga0496108_0228818
2070 Ga0496109_0001741
2071 Ga0496109_0002099
2072 Ga0496109_0009353
2073 Ga0496109_0064809
2074 Ga0496109_0174145
2075 Ga0496109_0184564
2076 Ga0496109_0545768
2077 Ga0496110_0141017
2078 Ga0496110_0210718
2079 Ga0496110_0454615
2080 Ga0496110_0801623
2081 Ga0496111_0010401
2082 Ga0496111_0128454
2083 Ga0496111_0150250
2084 Ga0496111_0291593
2085 Ga0496111_0413963
2086 Ga0496112_0044099
2087 Ga0496112_0065541
2088 Ga0496112_0124052
2089 Ga0496112_0147191
2090 Ga0496112_0203642
2091 Ga0496112_0328383
2092 Ga0496112_0468855
2093 Ga0496112_0594839
2094 Ga0496112_0635420
2095 Ga0496113_0008981
2096 Ga0496113_0078278
2097 Ga0496113_0079275
2098 Ga0496113_0138203
2099 Ga0496113_0437016
2100 Ga0496114_0003778
2101 Ga0496114_0040751
2102 Ga0496114_0077920
2103 Ga0496114_0267030
2104 Ga0496114_0664054
2105 Ga0496115_0005713
2106 Ga0496115_0034569
2107 Ga0496115_0341722
2108 Ga0496126_0052179
2109 Ga0501070_0089954
2110 Ga0501071_0105363
2111 Ga0501073_0015726
2112 Ga0501073_0018153
2113 Ga0501073_0315151
2114 Ga0501073_0361681
2115 Ga0501075_0244801
2116 Ga0501075_0824734
2117 Ga0501076_0039609
2118 Ga0501076_0070354
2119 Ga0501076_0267914
2120 Ga0501079_0635210
2121 Ga0501081_0156198
2122 Ga0501083_0192574
2123 Ga0501083_0390590
2124 Ga0501035_0402446
2125 Ga0501044_0401187
2126 Ga0501045_0126255
2127 nmdc:mga03683_112841_c1
2128 nmdc:mga03683_31760_c1
2129 nmdc:mga03n38_17324_c1
2130 nmdc:mga03n38_282230_c1
2131 nmdc:mga00v17_273275_c1
2132 nmdc:mga00v17_420723_c1
2133 nmdc:mga0yw44_18637_c1
2134 nmdc:mga0yw44_271705_c1
2135 nmdc:mga0yw44_500149_c1
2136 nmdc:mga0yw44_500294_c1
2137 nmdc:mga0k408_220012_c1
2138 nmdc:mga06z11_115767_c1
2139 nmdc:mga06z11_20423_c1
2140 nmdc:mga06z11_332237_c1
2141 nmdc:mga06z11_399052_c1
2142 nmdc:mga06z11_72502_c1
2143 nmdc:mga04h51_17826_c1
2144 nmdc:mga04h51_26133_c1
2145 nmdc:mga04h51_31780_c1
2146 nmdc:mga04h51_37823_c1
2147 nmdc:mga07m45_30137_c1
2148 nmdc:mga05p37_106164_c1
2149 nmdc:mga05p37_354_c1
2150 nmdc:mga09592_4746_c1
2151 nmdc:mga0qj67_935_c1
2152 nmdc:mga06r32_147_c1
2153 nmdc:mga08y16_26007_c1
2154 nmdc:mga08y16_289_c1
2155 nmdc:mga08y16_3527_c1
2156 nmdc:mga08y16_707067_c1
2157 nmdc:mga0n895_2125_c1
2158 nmdc:mga0n895_414471_c1
2159 nmdc:mga0n895_537262_c1
2160 nmdc:mga0n895_545_c1
2161 nmdc:mga0rr50_1020138_c1
2162 nmdc:mga0rr50_1502_c1
2163 nmdc:mga0rr50_160947_c1
2164 nmdc:mga0rr50_219355_c1
2165 nmdc:mga0rr50_9459_c2
2166 nmdc:mga0rr50_98743_c1
2167 nmdc:mga08x19_24_c1
2168 nmdc:mga08x19_378558_c1
2169 nmdc:mga0a205_131106_c1
2170 nmdc:mga0a205_140696_c1
2171 nmdc:mga0a205_270347_c1
2172 nmdc:mga0a205_4915_c1
2173 nmdc:mga0a205_60_c1
2174 nmdc:mga0sz30_26694_c1
2175 Ga0495601_0000068
2176 Ga0495601_0001006
2177 Ga0495601_0002256
2178 Ga0495601_0003844
2179 Ga0495601_0027708
2180 Ga0495601_0041400
2181 Ga0495612_0001267
2182 Ga0495612_0003612
2183 Ga0495612_0004139
2184 Ga0500610_0104431
2185 Ga0495595_0001160
2186 Ga0495595_0002637
2187 Ga0495595_0005061
2188 Ga0495595_0010358
2189 Ga0495595_0099662
2190 Ga0495619_0000136
2191 Ga0495619_0000154
2192 Ga0495619_0000996
2193 Ga0495619_0001694
2194 Ga0495619_0002254
2195 Ga0495619_0128664
2196 Ga0495619_0149955
2197 Ga0495619_0303114
2198 Ga0500643_001473
2199 Ga0500644_0000904
2200 Ga0500646_0163067
2201 Ga0500651_0085571
2202 Ga0500566_0057215
2203 Ga0500641_0001418
2204 Ga0500641_0005479
2205 Ga0500641_0175613
2206 Ga0500650_0044907
2207 Ga0500595_000002
2208 Ga0500595_015845
2209 Ga0500597_105718
2210 Ga0500652_000003
2211 Ga0500652_026516
2212 Ga0500658_0096881
2213 Ga0500588_0216757
2214 Ga0500616_0000002
2215 Ga0500636_0010026
2216 Ga0500645_000086
2217 Ga0501084_0174604
2218 Ga0501084_0201921

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

124

195

0.93

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

118

204

0.91

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

134

200

0.9

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

5

82

0.89

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

9

89

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.916 2 204
4hz2-assembly1.cif.gz_A crystal structure of glutathione s-transferase xaut_3756 (target efi-507152) from xanthobacter autotrophicus py2 0.9138 4 201
3m8n-assembly1.cif.gz_A crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9106 2 203
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9074 2 204
3m8n-assembly1.cif.gz_B crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9051 2 204
ID Description Score Start End Superfamily
af_Q9C6C8_6_89_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9692 5 82 3.40.30.10
5zfgB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9469 4 81 3.40.30.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9466 4 81 3.40.30.10
af_Q9SRY6_37_122_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9397 3 81 3.40.30.10
4ke3D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9368 4 82 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A512NPG9-F1-model_v4 Glutathione S-transferase 0.982 1 207 GO:0016740
AF-A0A7T7Y4T2-F1-model_v4 deleted 0.981 1 208
AF-A0A537C7K6-F1-model_v4 Glutathione S-transferase family protein 0.9804 1 212 GO:0016740
AF-A0A6J4P5P9-F1-model_v4 Maleylacetoacetate isomerase / Glutathione S-transferase (EC 5.2.1.2) 0.9798 67 209 GO:0016034
GO:0016740
AF-A0A4V1VAY0-F1-model_v4 deleted 0.9781 2 209

Map