F490201
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1109 | 432 | 2218 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300035692|Ga0373935_0040371|Ga0373935_0040371_90_743 |
| Length | 217 |
| Sequence | MSDTPEYQLYCFAQSGNAYRVALMLNLIGADWKPVFVDFFIGGETRTAKYRTEINEMGEVPVLAHGERKLSQSAVCLTYLAERSGKFRPEGDDERLECLRWIVFDNQKVNGFLGPYRFLKNFAPAPNPGGEAFLLGRIGGNLAIVDKRLTKAPYLLGPRPTIADISLAGYLYYPADEFGFDIAKDHPAIGAWMERIKALPGWKHPYDLMPGYPLNRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 18 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 19 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 20 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 21 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 22 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 23 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 25 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 72 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 96 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 97 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 121 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 122 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 123 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 124 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 125 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 130 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 131 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 149 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 150 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 151 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 152 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 171 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 245 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 249 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 250 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 251 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 253 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 254 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 255 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 256 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 258 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 259 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 260 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 261 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 262 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 263 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 264 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 266 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 270 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 272 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 275 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 276 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 278 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 279 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 280 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 282 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 284 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 286 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 289 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 290 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 291 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 292 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 293 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 294 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 297 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 298 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 299 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 300 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 301 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 302 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 303 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 304 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 305 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 306 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 307 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 308 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 370 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 371 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 372 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 373 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 374 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 377 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 378 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 379 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 380 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 381 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 382 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 383 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 397 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 399 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 401 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 415 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 418 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 419 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 420 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 421 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 422 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 423 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 424 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 425 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 426 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 427 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 428 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 429 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 430 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 432 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.22 |
| Nodule | 0 |
| Rhizoplane | 6.76 |
| Rhizosphere | 86.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373935_0040371 | 3300035692 | Bacteria | 2929 |
| 2 | SwRhRL2b_contig_902337 | 2162886007 | Bacteria | 1422 |
| 3 | 2214856321 | 2209111006 | Bacteria | 7943 |
| 4 | ARSoilYngRDRAFT_c00224 | 3300000042 | Bacteria | 9130 |
| 5 | ARcpr5yngRDRAFT_c000200 | 3300000043 | Bacteria | 9195 |
| 6 | ARSoilOldRDRAFT_c000038 | 3300000044 | Bacteria | 30035 |
| 7 | ARCol0oldRDRAFT_c00169 | 3300000045 | Bacteria | 5931 |
| 8 | ARCol0yngRDRAFT_1000396 | 3300000652 | Bacteria | 5908 |
| 9 | JGI24746J21847_1002569 | 3300001977 | Bacteria | 2884 |
| 10 | JGI24740J21852_10050257 | 3300001979 | Bacteria | 1200 |
| 11 | JGI24739J22299_10000144 | 3300001989 | Bacteria | 22757 |
| 12 | JGI24737J22298_10001737 | 3300001990 | Bacteria | 7782 |
| 13 | JGI24737J22298_10001829 | 3300001990 | Bacteria | 7616 |
| 14 | JGI24750J21931_1000014 | 3300002070 | Bacteria | 21435 |
| 15 | JGI24745J21846_1000270 | 3300002073 | Bacteria | 4396 |
| 16 | JGI24748J21848_1002358 | 3300002074 | Bacteria | 2130 |
| 17 | JGI24738J21930_10000574 | 3300002075 | Bacteria | 10530 |
| 18 | JGI24749J21850_1001045 | 3300002076 | Bacteria | 3943 |
| 19 | JGI24744J21845_10000166 | 3300002077 | Bacteria | 9770 |
| 20 | JGI24035J26624_1008271 | 3300002126 | Bacteria | 1017 |
| 21 | JGI24033J26618_1001410 | 3300002155 | Bacteria | 2388 |
| 22 | JGI24034J26672_10000281 | 3300002239 | Bacteria | 6735 |
| 23 | JGI24742J22300_10001185 | 3300002244 | Bacteria | 4065 |
| 24 | JGI25405J52794_10053938 | 3300003911 | Bacteria | 864 |
| 25 | Ga0065717_1004781 | 3300005276 | Bacteria | 979 |
| 26 | Ga0065716_1000005 | 3300005277 | Bacteria | 8806 |
| 27 | Ga0065704_10093949 | 3300005289 | Bacteria | 2569 |
| 28 | Ga0065712_10068670 | 3300005290 | Bacteria | 9422 |
| 29 | Ga0065712_10069916 | 3300005290 | Bacteria | 6516 |
| 30 | Ga0065712_10070787 | 3300005290 | Bacteria | 5706 |
| 31 | Ga0065715_10000266 | 3300005293 | Bacteria | 26217 |
| 32 | Ga0065715_10001896 | 3300005293 | Bacteria | 10555 |
| 33 | Ga0065707_10091685 | 3300005295 | Bacteria | 3896 |
| 34 | Ga0070658_10091260 | 3300005327 | Bacteria | 2510 |
| 35 | Ga0070658_10104180 | 3300005327 | Bacteria | 2347 |
| 36 | Ga0070658_10254651 | 3300005327 | Bacteria | 1490 |
| 37 | Ga0070676_10000663 | 3300005328 | Bacteria | 16752 |
| 38 | Ga0070676_10266539 | 3300005328 | Bacteria | 1149 |
| 39 | Ga0070683_100000152 | 3300005329 | Bacteria | 44662 |
| 40 | Ga0070683_100203801 | 3300005329 | Bacteria | 1879 |
| 41 | Ga0070683_100721663 | 3300005329 | Bacteria | 955 |
| 42 | Ga0070690_100000388 | 3300005330 | Bacteria | 22360 |
| 43 | Ga0070690_100024975 | 3300005330 | Bacteria | 3678 |
| 44 | Ga0070690_100194217 | 3300005330 | Bacteria | 1409 |
| 45 | Ga0070690_100209192 | 3300005330 | Bacteria | 1361 |
| 46 | Ga0070670_100004481 | 3300005331 | Bacteria | 11702 |
| 47 | Ga0070670_100027603 | 3300005331 | Bacteria | 4883 |
| 48 | Ga0070677_10000363 | 3300005333 | Bacteria | 15928 |
| 49 | Ga0068869_100000020 | 3300005334 | Bacteria | 66561 |
| 50 | Ga0068869_100186397 | 3300005334 | Bacteria | 1629 |
| 51 | Ga0070666_10007376 | 3300005335 | Bacteria | 6774 |
| 52 | Ga0070666_10025663 | 3300005335 | Bacteria | 3843 |
| 53 | Ga0070666_10157207 | 3300005335 | Bacteria | 1588 |
| 54 | Ga0070666_10167189 | 3300005335 | Bacteria | 1539 |
| 55 | Ga0070680_100025550 | 3300005336 | Bacteria | 4721 |
| 56 | Ga0070680_100029923 | 3300005336 | Bacteria | 4372 |
| 57 | Ga0070680_100045232 | 3300005336 | Bacteria | 3579 |
| 58 | Ga0070680_100148337 | 3300005336 | Bacteria | 1968 |
| 59 | Ga0070680_100367123 | 3300005336 | Bacteria | 1224 |
| 60 | Ga0070682_100000264 | 3300005337 | Bacteria | 37644 |
| 61 | Ga0070682_100081444 | 3300005337 | Bacteria | 2096 |
| 62 | Ga0070682_100180629 | 3300005337 | Bacteria | 1474 |
| 63 | Ga0070682_100541510 | 3300005337 | Bacteria | 909 |
| 64 | Ga0068868_100035892 | 3300005338 | Bacteria | 3834 |
| 65 | Ga0070660_100000394 | 3300005339 | Bacteria | 29011 |
| 66 | Ga0070660_100165750 | 3300005339 | Bacteria | 1783 |
| 67 | Ga0070689_100004384 | 3300005340 | Bacteria | 9528 |
| 68 | Ga0070689_100008724 | 3300005340 | Bacteria | 7155 |
| 69 | Ga0070689_100318122 | 3300005340 | Bacteria | 1299 |
| 70 | Ga0070691_10008871 | 3300005341 | Bacteria | 4604 |
| 71 | Ga0070691_10037541 | 3300005341 | Bacteria | 2286 |
| 72 | Ga0070687_100000122 | 3300005343 | Bacteria | 26655 |
| 73 | Ga0070687_100011710 | 3300005343 | Bacteria | 3848 |
| 74 | Ga0070661_100048239 | 3300005344 | Bacteria | 3117 |
| 75 | Ga0070661_100117365 | 3300005344 | Bacteria | 1991 |
| 76 | Ga0070661_100146774 | 3300005344 | Bacteria | 1781 |
| 77 | Ga0070692_10006038 | 3300005345 | Bacteria | 5224 |
| 78 | Ga0070668_100009693 | 3300005347 | Bacteria | 7142 |
| 79 | Ga0070668_100104819 | 3300005347 | Bacteria | 2245 |
| 80 | Ga0070669_100001081 | 3300005353 | Bacteria | 19935 |
| 81 | Ga0070669_100009434 | 3300005353 | Bacteria | 6949 |
| 82 | Ga0070669_100610788 | 3300005353 | Bacteria | 914 |
| 83 | Ga0070675_100009824 | 3300005354 | Bacteria | 7457 |
| 84 | Ga0070675_100084251 | 3300005354 | Bacteria | 2655 |
| 85 | Ga0070675_100118185 | 3300005354 | Bacteria | 2251 |
| 86 | Ga0070671_100000718 | 3300005355 | Bacteria | 23716 |
| 87 | Ga0070671_100005908 | 3300005355 | Bacteria | 9752 |
| 88 | Ga0070671_100017008 | 3300005355 | Bacteria | 5882 |
| 89 | Ga0070674_100000152 | 3300005356 | Bacteria | 32268 |
| 90 | Ga0070674_100059626 | 3300005356 | Bacteria | 2657 |
| 91 | Ga0070674_100197344 | 3300005356 | Bacteria | 1552 |
| 92 | Ga0070673_100000042 | 3300005364 | Bacteria | 52952 |
| 93 | Ga0070673_100029549 | 3300005364 | Bacteria | 4088 |
| 94 | Ga0070673_100053237 | 3300005364 | Bacteria | 3178 |
| 95 | Ga0070673_100147229 | 3300005364 | Bacteria | 1991 |
| 96 | Ga0070688_100009484 | 3300005365 | Bacteria | 5325 |
| 97 | Ga0070688_100021617 | 3300005365 | Bacteria | 3760 |
| 98 | Ga0070688_100024369 | 3300005365 | Bacteria | 3570 |
| 99 | Ga0070659_100000348 | 3300005366 | Bacteria | 35172 |
| 100 | Ga0070659_100043222 | 3300005366 | Bacteria | 3524 |
| 101 | Ga0070667_100000775 | 3300005367 | Bacteria | 30249 |
| 102 | Ga0070667_100009286 | 3300005367 | Bacteria | 8149 |
| 103 | Ga0070667_100036295 | 3300005367 | Bacteria | 4132 |
| 104 | Ga0070667_100213919 | 3300005367 | Bacteria | 1714 |
| 105 | Ga0070703_10000842 | 3300005406 | Bacteria | 9936 |
| 106 | Ga0070709_10001300 | 3300005434 | Bacteria | 13613 |
| 107 | Ga0070709_10218353 | 3300005434 | Bacteria | 1358 |
| 108 | Ga0070709_10618141 | 3300005434 | Unclassified | 836 |
| 109 | Ga0070714_100503063 | 3300005435 | Bacteria | 1156 |
| 110 | Ga0070713_100008767 | 3300005436 | Bacteria | 7196 |
| 111 | Ga0070713_100134124 | 3300005436 | Bacteria | 2186 |
| 112 | Ga0070713_100309654 | 3300005436 | Bacteria | 1456 |
| 113 | Ga0070713_100725904 | 3300005436 | Bacteria | 949 |
| 114 | Ga0070710_10107906 | 3300005437 | Bacteria | 1668 |
| 115 | Ga0070710_10271487 | 3300005437 | Bacteria | 1097 |
| 116 | Ga0070710_10365314 | 3300005437 | Bacteria | 959 |
| 117 | Ga0070701_10000042 | 3300005438 | Bacteria | 32304 |
| 118 | Ga0070701_10012698 | 3300005438 | Bacteria | 3806 |
| 119 | Ga0070701_10375582 | 3300005438 | Bacteria | 894 |
| 120 | Ga0070711_100060988 | 3300005439 | Bacteria | 2624 |
| 121 | Ga0070711_100206865 | 3300005439 | Bacteria | 1517 |
| 122 | Ga0070705_100004068 | 3300005440 | Bacteria | 7142 |
| 123 | Ga0070705_100035155 | 3300005440 | Bacteria | 2807 |
| 124 | Ga0070705_100171146 | 3300005440 | Bacteria | 1462 |
| 125 | Ga0070705_100402711 | 3300005440 | Unclassified | 1014 |
| 126 | Ga0070700_100001033 | 3300005441 | Bacteria | 13764 |
| 127 | Ga0070700_100014365 | 3300005441 | Bacteria | 4470 |
| 128 | Ga0070694_100010969 | 3300005444 | Bacteria | 5606 |
| 129 | Ga0070694_100040785 | 3300005444 | Bacteria | 3095 |
| 130 | Ga0070708_100277788 | 3300005445 | Bacteria | 1576 |
| 131 | Ga0070663_100000301 | 3300005455 | Bacteria | 25350 |
| 132 | Ga0070663_100004327 | 3300005455 | Bacteria | 8325 |
| 133 | Ga0070678_100003715 | 3300005456 | Bacteria | 8542 |
| 134 | Ga0070678_100008818 | 3300005456 | Bacteria | 6063 |
| 135 | Ga0070678_100224918 | 3300005456 | Bacteria | 1561 |
| 136 | Ga0070662_100008262 | 3300005457 | Bacteria | 6779 |
| 137 | Ga0070662_100142225 | 3300005457 | Bacteria | 1861 |
| 138 | Ga0070662_100152940 | 3300005457 | Bacteria | 1798 |
| 139 | Ga0070662_100308806 | 3300005457 | Bacteria | 1287 |
| 140 | Ga0070681_10017746 | 3300005458 | Bacteria | 7112 |
| 141 | Ga0070681_10060503 | 3300005458 | Bacteria | 3764 |
| 142 | Ga0070681_10303919 | 3300005458 | Bacteria | 1505 |
| 143 | Ga0070681_10397229 | 3300005458 | Bacteria | 1290 |
| 144 | Ga0070681_10412927 | 3300005458 | Bacteria | 1261 |
| 145 | Ga0068867_100013330 | 3300005459 | Bacteria | 5823 |
| 146 | Ga0068867_100195914 | 3300005459 | Bacteria | 1615 |
| 147 | Ga0068867_100539515 | 3300005459 | Unclassified | 1009 |
| 148 | Ga0070685_10009477 | 3300005466 | Bacteria | 5035 |
| 149 | Ga0070685_10109392 | 3300005466 | Bacteria | 1700 |
| 150 | Ga0070706_100713122 | 3300005467 | Bacteria | 930 |
| 151 | Ga0070707_100167400 | 3300005468 | Bacteria | 2142 |
| 152 | Ga0074259_11284140 | 3300005507 | Bacteria | 808 |
| 153 | Ga0070679_100080878 | 3300005530 | Bacteria | 3238 |
| 154 | Ga0070679_100103023 | 3300005530 | Bacteria | 2840 |
| 155 | Ga0070679_100222059 | 3300005530 | Bacteria | 1850 |
| 156 | Ga0070679_100637315 | 3300005530 | Unclassified | 1009 |
| 157 | Ga0070679_100695431 | 3300005530 | Bacteria | 959 |
| 158 | Ga0070684_100003011 | 3300005535 | Bacteria | 12551 |
| 159 | Ga0070684_100059646 | 3300005535 | Bacteria | 3336 |
| 160 | Ga0070684_100338020 | 3300005535 | Bacteria | 1384 |
| 161 | Ga0070697_100000842 | 3300005536 | Bacteria | 23057 |
| 162 | Ga0070697_100043536 | 3300005536 | Bacteria | 3636 |
| 163 | Ga0070697_100383813 | 3300005536 | Bacteria | 1217 |
| 164 | Ga0068853_100001269 | 3300005539 | Bacteria | 18080 |
| 165 | Ga0068853_100057813 | 3300005539 | Bacteria | 3348 |
| 166 | Ga0068853_100437203 | 3300005539 | Bacteria | 1229 |
| 167 | Ga0070672_100000011 | 3300005543 | Bacteria | 80761 |
| 168 | Ga0070672_100077533 | 3300005543 | Bacteria | 2658 |
| 169 | Ga0070686_100000889 | 3300005544 | Bacteria | 17366 |
| 170 | Ga0070686_100049720 | 3300005544 | Bacteria | 2662 |
| 171 | Ga0070686_100072996 | 3300005544 | Bacteria | 2252 |
| 172 | Ga0070686_100370083 | 3300005544 | Bacteria | 1082 |
| 173 | Ga0070686_100489992 | 3300005544 | Bacteria | 952 |
| 174 | Ga0070695_100000088 | 3300005545 | Bacteria | 38984 |
| 175 | Ga0070695_100019733 | 3300005545 | Bacteria | 4109 |
| 176 | Ga0070695_100051983 | 3300005545 | Bacteria | 2631 |
| 177 | Ga0070695_100350010 | 3300005545 | Unclassified | 1106 |
| 178 | Ga0070696_100003446 | 3300005546 | Bacteria | 10527 |
| 179 | Ga0070696_100036825 | 3300005546 | Bacteria | 3374 |
| 180 | Ga0070696_100040114 | 3300005546 | Bacteria | 3233 |
| 181 | Ga0070696_100137583 | 3300005546 | Bacteria | 1782 |
| 182 | Ga0070693_100000273 | 3300005547 | Bacteria | 24376 |
| 183 | Ga0070693_100175206 | 3300005547 | Bacteria | 1377 |
| 184 | Ga0070665_100849634 | 3300005548 | Bacteria | 926 |
| 185 | Ga0070704_100000809 | 3300005549 | Bacteria | 15517 |
| 186 | Ga0068855_100003933 | 3300005563 | Bacteria | 18135 |
| 187 | Ga0068855_100019728 | 3300005563 | Bacteria | 8096 |
| 188 | Ga0068855_100044053 | 3300005563 | Bacteria | 5282 |
| 189 | Ga0068855_100490984 | 3300005563 | Bacteria | 1335 |
| 190 | Ga0070664_100000263 | 3300005564 | Bacteria | 37910 |
| 191 | Ga0068857_100002138 | 3300005577 | Bacteria | 16066 |
| 192 | Ga0068854_100001243 | 3300005578 | Bacteria | 15301 |
| 193 | Ga0068854_100068458 | 3300005578 | Bacteria | 2589 |
| 194 | Ga0068854_100189162 | 3300005578 | Bacteria | 1612 |
| 195 | Ga0068854_100261846 | 3300005578 | Bacteria | 1385 |
| 196 | Ga0068856_100000803 | 3300005614 | Bacteria | 33893 |
| 197 | Ga0068856_100091579 | 3300005614 | Bacteria | 3025 |
| 198 | Ga0068856_100601258 | 3300005614 | Bacteria | 1121 |
| 199 | Ga0068856_100655819 | 3300005614 | Bacteria | 1070 |
| 200 | Ga0070702_100000131 | 3300005615 | Bacteria | 22818 |
| 201 | Ga0070702_100326021 | 3300005615 | Bacteria | 1072 |
| 202 | Ga0068852_100001912 | 3300005616 | Bacteria | 14182 |
| 203 | Ga0068852_100067472 | 3300005616 | Bacteria | 3127 |
| 204 | Ga0068852_100113124 | 3300005616 | Bacteria | 2471 |
| 205 | Ga0068852_101028762 | 3300005616 | Bacteria | 843 |
| 206 | Ga0068859_100004279 | 3300005617 | Bacteria | 14575 |
| 207 | Ga0068859_100011885 | 3300005617 | Bacteria | 8746 |
| 208 | Ga0068864_100000112 | 3300005618 | Bacteria | 79688 |
| 209 | Ga0068864_100077589 | 3300005618 | Bacteria | 2905 |
| 210 | Ga0068864_100591741 | 3300005618 | Bacteria | 1076 |
| 211 | Ga0068864_100774973 | 3300005618 | Bacteria | 941 |
| 212 | Ga0068866_10000300 | 3300005718 | Bacteria | 23587 |
| 213 | Ga0068866_10132080 | 3300005718 | Bacteria | 1421 |
| 214 | Ga0068866_10216397 | 3300005718 | Bacteria | 1153 |
| 215 | Ga0068866_10352975 | 3300005718 | Unclassified | 935 |
| 216 | Ga0068861_100004433 | 3300005719 | Bacteria | 9419 |
| 217 | Ga0068861_100034013 | 3300005719 | Bacteria | 3766 |
| 218 | Ga0068861_100134220 | 3300005719 | Bacteria | 2012 |
| 219 | Ga0068870_10000021 | 3300005840 | Bacteria | 56319 |
| 220 | Ga0068863_100000491 | 3300005841 | Bacteria | 40157 |
| 221 | Ga0068858_100000419 | 3300005842 | Bacteria | 44155 |
| 222 | Ga0068858_100032586 | 3300005842 | Bacteria | 4839 |
| 223 | Ga0068858_100055067 | 3300005842 | Bacteria | 3677 |
| 224 | Ga0068860_100001036 | 3300005843 | Bacteria | 30573 |
| 225 | Ga0068860_100080488 | 3300005843 | Bacteria | 3097 |
| 226 | Ga0068860_100173883 | 3300005843 | Bacteria | 2081 |
| 227 | Ga0068862_100002612 | 3300005844 | Bacteria | 15858 |
| 228 | Ga0068862_100008885 | 3300005844 | Bacteria | 8320 |
| 229 | Ga0081455_10000153 | 3300005937 | Bacteria | 83186 |
| 230 | Ga0081540_1008782 | 3300005983 | Bacteria | 7021 |
| 231 | Ga0070717_10000489 | 3300006028 | Bacteria | 25208 |
| 232 | Ga0070717_10082514 | 3300006028 | Bacteria | 2701 |
| 233 | Ga0070717_10173587 | 3300006028 | Bacteria | 1876 |
| 234 | Ga0070717_10528913 | 3300006028 | Bacteria | 1067 |
| 235 | Ga0075365_10084008 | 3300006038 | Bacteria | 2160 |
| 236 | Ga0075365_10198539 | 3300006038 | Bacteria | 1405 |
| 237 | Ga0075365_10483059 | 3300006038 | Bacteria | 875 |
| 238 | Ga0075368_10009150 | 3300006042 | Bacteria | 3558 |
| 239 | Ga0075368_10035823 | 3300006042 | Bacteria | 1937 |
| 240 | Ga0075368_10092399 | 3300006042 | Bacteria | 1238 |
| 241 | Ga0075363_100020442 | 3300006048 | Bacteria | 3320 |
| 242 | Ga0075363_100062795 | 3300006048 | Bacteria | 2003 |
| 243 | Ga0075363_100248258 | 3300006048 | Bacteria | 1024 |
| 244 | Ga0075364_10044114 | 3300006051 | Bacteria | 2899 |
| 245 | Ga0075364_10079403 | 3300006051 | Bacteria | 2168 |
| 246 | Ga0075364_10467518 | 3300006051 | Bacteria | 862 |
| 247 | Ga0070715_10210005 | 3300006163 | Unclassified | 994 |
| 248 | Ga0070716_100005054 | 3300006173 | Bacteria | 6363 |
| 249 | Ga0070716_100114189 | 3300006173 | Bacteria | 1679 |
| 250 | Ga0070716_100484676 | 3300006173 | Bacteria | 909 |
| 251 | Ga0070712_100007472 | 3300006175 | Bacteria | 6822 |
| 252 | Ga0070712_100031589 | 3300006175 | Bacteria | 3569 |
| 253 | Ga0070712_100105746 | 3300006175 | Bacteria | 2091 |
| 254 | Ga0070712_100251324 | 3300006175 | Bacteria | 1413 |
| 255 | Ga0075362_10007566 | 3300006177 | Bacteria | 4121 |
| 256 | Ga0075362_10038049 | 3300006177 | Bacteria | 2112 |
| 257 | Ga0075367_10016120 | 3300006178 | Bacteria | 4076 |
| 258 | Ga0075367_10084258 | 3300006178 | Bacteria | 1927 |
| 259 | Ga0075367_10094496 | 3300006178 | Bacteria | 1823 |
| 260 | Ga0075367_10101366 | 3300006178 | Bacteria | 1760 |
| 261 | Ga0075367_10176802 | 3300006178 | Bacteria | 1330 |
| 262 | Ga0075427_10001653 | 3300006194 | Bacteria | 2895 |
| 263 | Ga0075366_10122066 | 3300006195 | Bacteria | 1570 |
| 264 | Ga0097621_100000115 | 3300006237 | Bacteria | 45694 |
| 265 | Ga0097621_100036012 | 3300006237 | Bacteria | 3956 |
| 266 | Ga0097621_100126539 | 3300006237 | Bacteria | 2171 |
| 267 | Ga0097621_101219761 | 3300006237 | Bacteria | 709 |
| 268 | Ga0075370_10067781 | 3300006353 | Bacteria | 2037 |
| 269 | Ga0075370_10099123 | 3300006353 | Bacteria | 1685 |
| 270 | Ga0075370_10305564 | 3300006353 | Bacteria | 946 |
| 271 | Ga0068871_100000498 | 3300006358 | Bacteria | 26857 |
| 272 | Ga0068871_100002187 | 3300006358 | Bacteria | 13285 |
| 273 | Ga0068871_100020585 | 3300006358 | Bacteria | 5056 |
| 274 | Ga0068871_101069032 | 3300006358 | Bacteria | 754 |
| 275 | Ga0075428_100000363 | 3300006844 | Bacteria | 45033 |
| 276 | Ga0075430_100000717 | 3300006846 | Bacteria | 25305 |
| 277 | Ga0075431_100000990 | 3300006847 | Bacteria | 25307 |
| 278 | Ga0075433_10000187 | 3300006852 | Bacteria | 34883 |
| 279 | Ga0075433_10004386 | 3300006852 | Bacteria | 10973 |
| 280 | Ga0075433_10085234 | 3300006852 | Bacteria | 2789 |
| 281 | Ga0075433_10198210 | 3300006852 | Bacteria | 1785 |
| 282 | Ga0075434_100002790 | 3300006871 | Bacteria | 15468 |
| 283 | Ga0075434_100026793 | 3300006871 | Bacteria | 5653 |
| 284 | Ga0075434_100473895 | 3300006871 | Bacteria | 1273 |
| 285 | Ga0075429_100000846 | 3300006880 | Bacteria | 24030 |
| 286 | Ga0068865_100000978 | 3300006881 | Bacteria | 16336 |
| 287 | Ga0068865_100014929 | 3300006881 | Bacteria | 4946 |
| 288 | Ga0068865_100251174 | 3300006881 | Bacteria | 1396 |
| 289 | Ga0075436_100007352 | 3300006914 | Bacteria | 7527 |
| 290 | Ga0075436_100359877 | 3300006914 | Bacteria | 1050 |
| 291 | Ga0097620_100004280 | 3300006931 | Bacteria | 14575 |
| 292 | Ga0097620_100011886 | 3300006931 | Bacteria | 8746 |
| 293 | Ga0075435_100005765 | 3300007076 | Bacteria | 8698 |
| 294 | Ga0075435_100045776 | 3300007076 | Bacteria | 3509 |
| 295 | Ga0075435_100064842 | 3300007076 | Bacteria | 2969 |
| 296 | Ga0075435_100121929 | 3300007076 | Bacteria | 2176 |
| 297 | Ga0075435_100233276 | 3300007076 | Bacteria | 1564 |
| 298 | Ga0075435_100730676 | 3300007076 | Bacteria | 861 |
| 299 | Ga0099795_10064277 | 3300007788 | Bacteria | 1370 |
| 300 | Ga0105251_10016489 | 3300009011 | Bacteria | 3990 |
| 301 | Ga0105251_10041976 | 3300009011 | Bacteria | 2223 |
| 302 | Ga0105244_10082458 | 3300009036 | Bacteria | 1590 |
| 303 | Ga0105250_10014064 | 3300009092 | Bacteria | 3295 |
| 304 | Ga0105240_10134473 | 3300009093 | Bacteria | 2962 |
| 305 | Ga0105240_10179296 | 3300009093 | Bacteria | 2502 |
| 306 | Ga0105240_10733264 | 3300009093 | Bacteria | 1076 |
| 307 | Ga0111539_10000196 | 3300009094 | Bacteria | 70998 |
| 308 | Ga0111539_10000376 | 3300009094 | Bacteria | 55320 |
| 309 | Ga0111539_10003800 | 3300009094 | Bacteria | 19864 |
| 310 | Ga0111539_10143834 | 3300009094 | Bacteria | 2791 |
| 311 | Ga0111539_10472322 | 3300009094 | Bacteria | 1460 |
| 312 | Ga0105245_10001838 | 3300009098 | Bacteria | 19304 |
| 313 | Ga0105245_10006498 | 3300009098 | Bacteria | 10274 |
| 314 | Ga0105245_10016640 | 3300009098 | Bacteria | 6420 |
| 315 | Ga0105245_10079716 | 3300009098 | Bacteria | 2990 |
| 316 | Ga0105245_11140041 | 3300009098 | Bacteria | 827 |
| 317 | Ga0105247_10000844 | 3300009101 | Bacteria | 23209 |
| 318 | Ga0105247_10002518 | 3300009101 | Bacteria | 12449 |
| 319 | Ga0105247_10093881 | 3300009101 | Bacteria | 1908 |
| 320 | Ga0105247_10097375 | 3300009101 | Bacteria | 1877 |
| 321 | Ga0114129_10002010 | 3300009147 | Bacteria | 27861 |
| 322 | Ga0114129_10241321 | 3300009147 | Bacteria | 2429 |
| 323 | Ga0114129_10480924 | 3300009147 | Bacteria | 1625 |
| 324 | Ga0105243_10006208 | 3300009148 | Bacteria | 9241 |
| 325 | Ga0105243_10009505 | 3300009148 | Bacteria | 7402 |
| 326 | Ga0105243_10014565 | 3300009148 | Bacteria | 5950 |
| 327 | Ga0105243_10057964 | 3300009148 | Bacteria | 3085 |
| 328 | Ga0105241_10002564 | 3300009174 | Bacteria | 13641 |
| 329 | Ga0105241_10025770 | 3300009174 | Bacteria | 4371 |
| 330 | Ga0105242_10002293 | 3300009176 | Bacteria | 15111 |
| 331 | Ga0105242_10022560 | 3300009176 | Bacteria | 4953 |
| 332 | Ga0105242_10038425 | 3300009176 | Bacteria | 3849 |
| 333 | Ga0105248_10000500 | 3300009177 | Bacteria | 44664 |
| 334 | Ga0105248_10004770 | 3300009177 | Bacteria | 15005 |
| 335 | Ga0105248_10042372 | 3300009177 | Bacteria | 5105 |
| 336 | Ga0105248_10085829 | 3300009177 | Bacteria | 3542 |
| 337 | Ga0105248_10200414 | 3300009177 | Bacteria | 2249 |
| 338 | Ga0105237_10008730 | 3300009545 | Bacteria | 10943 |
| 339 | Ga0105237_10048166 | 3300009545 | Bacteria | 4284 |
| 340 | Ga0105237_10069141 | 3300009545 | Bacteria | 3526 |
| 341 | Ga0105237_10141717 | 3300009545 | Bacteria | 2398 |
| 342 | Ga0105238_10033617 | 3300009551 | Bacteria | 5219 |
| 343 | Ga0105238_10044749 | 3300009551 | Bacteria | 4474 |
| 344 | Ga0105238_10044976 | 3300009551 | Bacteria | 4461 |
| 345 | Ga0105238_10059560 | 3300009551 | Bacteria | 3825 |
| 346 | Ga0105238_10164644 | 3300009551 | Bacteria | 2193 |
| 347 | Ga0105238_10427704 | 3300009551 | Bacteria | 1319 |
| 348 | Ga0105249_10001469 | 3300009553 | Bacteria | 20681 |
| 349 | Ga0105249_10030586 | 3300009553 | Bacteria | 4868 |
| 350 | Ga0105249_10106073 | 3300009553 | Bacteria | 2650 |
| 351 | Ga0105239_10042105 | 3300010375 | Bacteria | 5004 |
| 352 | Ga0105239_10086621 | 3300010375 | Bacteria | 3452 |
| 353 | Ga0105239_10197881 | 3300010375 | Bacteria | 2251 |
| 354 | Ga0105239_10613774 | 3300010375 | Bacteria | 1241 |
| 355 | Ga0105239_10701616 | 3300010375 | Bacteria | 1157 |
| 356 | Ga0105239_11679067 | 3300010375 | Bacteria | 735 |
| 357 | Ga0105246_10000033 | 3300011119 | Bacteria | 50575 |
| 358 | Ga0105246_10021948 | 3300011119 | Bacteria | 4115 |
| 359 | Ga0105246_10064937 | 3300011119 | Bacteria | 2551 |
| 360 | Ga0105246_10603112 | 3300011119 | Bacteria | 949 |
| 361 | Ga0157343_1002860 | 3300012488 | Bacteria | 971 |
| 362 | Ga0157341_1006572 | 3300012494 | Unclassified | 904 |
| 363 | Ga0157342_1002420 | 3300012507 | Bacteria | 1513 |
| 364 | Ga0157326_1003431 | 3300012513 | Bacteria | 1668 |
| 365 | Ga0157338_1002670 | 3300012515 | Bacteria | 1419 |
| 366 | Ga0157338_1005608 | 3300012515 | Bacteria | 1134 |
| 367 | Ga0157373_10135546 | 3300013100 | Bacteria | 1731 |
| 368 | Ga0157371_10032991 | 3300013102 | Bacteria | 3722 |
| 369 | Ga0157371_10091631 | 3300013102 | Unclassified | 2153 |
| 370 | Ga0157371_10186041 | 3300013102 | Bacteria | 1486 |
| 371 | Ga0157371_10550999 | 3300013102 | Bacteria | 855 |
| 372 | Ga0157370_10074523 | 3300013104 | Bacteria | 3201 |
| 373 | Ga0157370_10261911 | 3300013104 | Bacteria | 1598 |
| 374 | Ga0157369_10320562 | 3300013105 | Bacteria | 1611 |
| 375 | Ga0157369_11079085 | 3300013105 | Unclassified | 821 |
| 376 | Ga0157369_11198389 | 3300013105 | Bacteria | 775 |
| 377 | Ga0157374_10000092 | 3300013296 | Bacteria | 85738 |
| 378 | Ga0157378_10055006 | 3300013297 | Bacteria | 3544 |
| 379 | Ga0157378_10965564 | 3300013297 | Unclassified | 885 |
| 380 | Ga0163162_10004452 | 3300013306 | Bacteria | 13496 |
| 381 | Ga0163162_10014395 | 3300013306 | Bacteria | 7729 |
| 382 | Ga0163162_10072042 | 3300013306 | Bacteria | 3509 |
| 383 | Ga0157372_10005853 | 3300013307 | Bacteria | 13089 |
| 384 | Ga0157372_10168116 | 3300013307 | Bacteria | 2536 |
| 385 | Ga0157372_11087296 | 3300013307 | Unclassified | 925 |
| 386 | Ga0157375_10000124 | 3300013308 | Bacteria | 76003 |
| 387 | Ga0157375_10058863 | 3300013308 | Bacteria | 3803 |
| 388 | Ga0157375_10990574 | 3300013308 | Bacteria | 981 |
| 389 | Ga0163163_10012287 | 3300014325 | Bacteria | 7797 |
| 390 | Ga0163163_10264303 | 3300014325 | Bacteria | 1772 |
| 391 | Ga0163163_10892036 | 3300014325 | Bacteria | 953 |
| 392 | Ga0157380_10005052 | 3300014326 | Bacteria | 9205 |
| 393 | Ga0157377_10000117 | 3300014745 | Bacteria | 53219 |
| 394 | Ga0157379_10001950 | 3300014968 | Bacteria | 17074 |
| 395 | Ga0157379_10015688 | 3300014968 | Bacteria | 6657 |
| 396 | Ga0157379_10129455 | 3300014968 | Bacteria | 2271 |
| 397 | Ga0157376_10000034 | 3300014969 | Bacteria | 161526 |
| 398 | Ga0163161_10000448 | 3300017792 | Bacteria | 34334 |
| 399 | Ga0163161_10159459 | 3300017792 | Bacteria | 1720 |
| 400 | Ga0206356_11418804 | 3300020070 | Bacteria | 1572 |
| 401 | Ga0206353_11397207 | 3300020082 | Bacteria | 2647 |
| 402 | Ga0228598_1000969 | 3300024227 | Bacteria | 6257 |
| 403 | Ga0207666_1000017 | 3300025271 | Bacteria | 40049 |
| 404 | Ga0207666_1005711 | 3300025271 | Bacteria | 1595 |
| 405 | Ga0207673_1000126 | 3300025290 | Bacteria | 7246 |
| 406 | Ga0207697_10000009 | 3300025315 | Bacteria | 67526 |
| 407 | Ga0207697_10004737 | 3300025315 | Bacteria | 6445 |
| 408 | Ga0207653_10004111 | 3300025885 | Bacteria | 4578 |
| 409 | Ga0207653_10031345 | 3300025885 | Bacteria | 1717 |
| 410 | Ga0207682_10000016 | 3300025893 | Bacteria | 78971 |
| 411 | Ga0207692_10000310 | 3300025898 | Bacteria | 16888 |
| 412 | Ga0207692_10153055 | 3300025898 | Unclassified | 1322 |
| 413 | Ga0207692_10221782 | 3300025898 | Bacteria | 1121 |
| 414 | Ga0207642_10000097 | 3300025899 | Bacteria | 23215 |
| 415 | Ga0207642_10160538 | 3300025899 | Bacteria | 1206 |
| 416 | Ga0207710_10001326 | 3300025900 | Bacteria | 12441 |
| 417 | Ga0207710_10076117 | 3300025900 | Bacteria | 1548 |
| 418 | Ga0207688_10000012 | 3300025901 | Bacteria | 60353 |
| 419 | Ga0207688_10011852 | 3300025901 | Bacteria | 4745 |
| 420 | Ga0207688_10087395 | 3300025901 | Bacteria | 1787 |
| 421 | Ga0207680_10014461 | 3300025903 | Bacteria | 4086 |
| 422 | Ga0207680_10136129 | 3300025903 | Bacteria | 1624 |
| 423 | Ga0207680_10550498 | 3300025903 | Unclassified | 824 |
| 424 | Ga0207647_10000675 | 3300025904 | Bacteria | 26752 |
| 425 | Ga0207647_10037972 | 3300025904 | Bacteria | 3049 |
| 426 | Ga0207647_10272082 | 3300025904 | Bacteria | 968 |
| 427 | Ga0207699_10000471 | 3300025906 | Bacteria | 20543 |
| 428 | Ga0207699_10203018 | 3300025906 | Bacteria | 1344 |
| 429 | Ga0207645_10000124 | 3300025907 | Bacteria | 58746 |
| 430 | Ga0207645_10017212 | 3300025907 | Bacteria | 4774 |
| 431 | Ga0207643_10000075 | 3300025908 | Bacteria | 64981 |
| 432 | Ga0207705_10054831 | 3300025909 | Bacteria | 2873 |
| 433 | Ga0207705_10110648 | 3300025909 | Bacteria | 2029 |
| 434 | Ga0207654_10001202 | 3300025911 | Bacteria | 13880 |
| 435 | Ga0207654_10007738 | 3300025911 | Bacteria | 5423 |
| 436 | Ga0207654_10063142 | 3300025911 | Bacteria | 2173 |
| 437 | Ga0207654_10219197 | 3300025911 | Bacteria | 1261 |
| 438 | Ga0207707_10017942 | 3300025912 | Bacteria | 6170 |
| 439 | Ga0207707_10152349 | 3300025912 | Bacteria | 2021 |
| 440 | Ga0207707_10384701 | 3300025912 | Bacteria | 1206 |
| 441 | Ga0207707_10518322 | 3300025912 | Bacteria | 1015 |
| 442 | Ga0207707_10574292 | 3300025912 | Unclassified | 956 |
| 443 | Ga0207695_10048617 | 3300025913 | Bacteria | 4478 |
| 444 | Ga0207695_10123825 | 3300025913 | Bacteria | 2550 |
| 445 | Ga0207671_10008594 | 3300025914 | Bacteria | 8633 |
| 446 | Ga0207671_10035231 | 3300025914 | Bacteria | 3716 |
| 447 | Ga0207671_10204142 | 3300025914 | Bacteria | 1544 |
| 448 | Ga0207693_10003324 | 3300025915 | Bacteria | 13761 |
| 449 | Ga0207693_10004737 | 3300025915 | Bacteria | 11439 |
| 450 | Ga0207693_10010263 | 3300025915 | Bacteria | 7601 |
| 451 | Ga0207693_10021842 | 3300025915 | Bacteria | 5088 |
| 452 | Ga0207693_10040963 | 3300025915 | Bacteria | 3648 |
| 453 | Ga0207693_10124954 | 3300025915 | Bacteria | 2021 |
| 454 | Ga0207693_10278041 | 3300025915 | Bacteria | 1312 |
| 455 | Ga0207663_10066051 | 3300025916 | Bacteria | 2314 |
| 456 | Ga0207663_10077737 | 3300025916 | Bacteria | 2161 |
| 457 | Ga0207663_10179644 | 3300025916 | Bacteria | 1510 |
| 458 | Ga0207663_10198854 | 3300025916 | Bacteria | 1444 |
| 459 | Ga0207660_10000489 | 3300025917 | Bacteria | 26431 |
| 460 | Ga0207660_10035183 | 3300025917 | Bacteria | 3475 |
| 461 | Ga0207660_10073606 | 3300025917 | Bacteria | 2491 |
| 462 | Ga0207660_10140859 | 3300025917 | Bacteria | 1844 |
| 463 | Ga0207660_10762473 | 3300025917 | Unclassified | 790 |
| 464 | Ga0207662_10001610 | 3300025918 | Bacteria | 11050 |
| 465 | Ga0207662_10006081 | 3300025918 | Bacteria | 6495 |
| 466 | Ga0207662_10057105 | 3300025918 | Bacteria | 2332 |
| 467 | Ga0207662_10579180 | 3300025918 | Bacteria | 779 |
| 468 | Ga0207657_10000162 | 3300025919 | Bacteria | 68121 |
| 469 | Ga0207657_10017061 | 3300025919 | Bacteria | 6983 |
| 470 | Ga0207657_10020743 | 3300025919 | Bacteria | 6202 |
| 471 | Ga0207657_10125457 | 3300025919 | Bacteria | 2109 |
| 472 | Ga0207657_10141255 | 3300025919 | Bacteria | 1967 |
| 473 | Ga0207649_10000411 | 3300025920 | Bacteria | 31667 |
| 474 | Ga0207649_10030727 | 3300025920 | Bacteria | 3185 |
| 475 | Ga0207649_10109678 | 3300025920 | Bacteria | 1842 |
| 476 | Ga0207649_10167420 | 3300025920 | Bacteria | 1528 |
| 477 | Ga0207649_10516412 | 3300025920 | Unclassified | 910 |
| 478 | Ga0207652_10001140 | 3300025921 | Bacteria | 23920 |
| 479 | Ga0207652_10074697 | 3300025921 | Bacteria | 2952 |
| 480 | Ga0207652_10253929 | 3300025921 | Bacteria | 1585 |
| 481 | Ga0207652_10307336 | 3300025921 | Bacteria | 1431 |
| 482 | Ga0207681_10000240 | 3300025923 | Bacteria | 42226 |
| 483 | Ga0207681_10026130 | 3300025923 | Bacteria | 3763 |
| 484 | Ga0207694_10073933 | 3300025924 | Bacteria | 2667 |
| 485 | Ga0207694_10358316 | 3300025924 | Bacteria | 1208 |
| 486 | Ga0207694_10608225 | 3300025924 | Bacteria | 919 |
| 487 | Ga0207650_10001431 | 3300025925 | Bacteria | 17214 |
| 488 | Ga0207659_10000017 | 3300025926 | Bacteria | 159908 |
| 489 | Ga0207659_10083765 | 3300025926 | Bacteria | 2365 |
| 490 | Ga0207687_10000417 | 3300025927 | Bacteria | 28902 |
| 491 | Ga0207687_10004146 | 3300025927 | Bacteria | 9709 |
| 492 | Ga0207687_10114298 | 3300025927 | Bacteria | 2009 |
| 493 | Ga0207687_10464209 | 3300025927 | Bacteria | 1052 |
| 494 | Ga0207700_10001311 | 3300025928 | Bacteria | 14107 |
| 495 | Ga0207700_10035316 | 3300025928 | Bacteria | 3599 |
| 496 | Ga0207700_10111760 | 3300025928 | Bacteria | 2200 |
| 497 | Ga0207700_10224766 | 3300025928 | Bacteria | 1593 |
| 498 | Ga0207664_10154464 | 3300025929 | Bacteria | 1952 |
| 499 | Ga0207664_10289103 | 3300025929 | Bacteria | 1440 |
| 500 | Ga0207644_10001407 | 3300025931 | Bacteria | 15495 |
| 501 | Ga0207644_10001531 | 3300025931 | Bacteria | 14893 |
| 502 | Ga0207690_10000151 | 3300025932 | Bacteria | 54897 |
| 503 | Ga0207706_10000368 | 3300025933 | Bacteria | 48834 |
| 504 | Ga0207706_10002253 | 3300025933 | Bacteria | 18837 |
| 505 | Ga0207706_10015959 | 3300025933 | Bacteria | 6787 |
| 506 | Ga0207706_10053322 | 3300025933 | Bacteria | 3570 |
| 507 | Ga0207706_10080678 | 3300025933 | Bacteria | 2860 |
| 508 | Ga0207686_10021340 | 3300025934 | Bacteria | 3716 |
| 509 | Ga0207709_10000256 | 3300025935 | Bacteria | 63853 |
| 510 | Ga0207709_10022259 | 3300025935 | Bacteria | 3594 |
| 511 | Ga0207709_10384996 | 3300025935 | Bacteria | 1068 |
| 512 | Ga0207670_10000086 | 3300025936 | Bacteria | 63570 |
| 513 | Ga0207670_10005957 | 3300025936 | Bacteria | 6730 |
| 514 | Ga0207670_10043022 | 3300025936 | Bacteria | 2980 |
| 515 | Ga0207670_10068068 | 3300025936 | Bacteria | 2452 |
| 516 | Ga0207669_10000423 | 3300025937 | Bacteria | 18505 |
| 517 | Ga0207669_10058911 | 3300025937 | Bacteria | 2346 |
| 518 | Ga0207704_10000139 | 3300025938 | Bacteria | 38829 |
| 519 | Ga0207665_10000330 | 3300025939 | Bacteria | 32779 |
| 520 | Ga0207665_10122123 | 3300025939 | Bacteria | 1841 |
| 521 | Ga0207665_10177699 | 3300025939 | Bacteria | 1540 |
| 522 | Ga0207691_10000303 | 3300025940 | Bacteria | 48873 |
| 523 | Ga0207691_10043840 | 3300025940 | Bacteria | 4120 |
| 524 | Ga0207691_10064509 | 3300025940 | Bacteria | 3318 |
| 525 | Ga0207691_10067755 | 3300025940 | Bacteria | 3226 |
| 526 | Ga0207711_10005029 | 3300025941 | Bacteria | 11217 |
| 527 | Ga0207711_10044071 | 3300025941 | Bacteria | 3807 |
| 528 | Ga0207711_10557180 | 3300025941 | Unclassified | 1069 |
| 529 | Ga0207689_10000109 | 3300025942 | Bacteria | 67941 |
| 530 | Ga0207689_10019901 | 3300025942 | Bacteria | 5653 |
| 531 | Ga0207661_10000074 | 3300025944 | Bacteria | 68047 |
| 532 | Ga0207661_10234227 | 3300025944 | Bacteria | 1627 |
| 533 | Ga0207679_10000031 | 3300025945 | Bacteria | 165962 |
| 534 | Ga0207679_10021114 | 3300025945 | Bacteria | 4406 |
| 535 | Ga0207667_10013372 | 3300025949 | Bacteria | 9392 |
| 536 | Ga0207667_10042411 | 3300025949 | Bacteria | 4836 |
| 537 | Ga0207667_10239868 | 3300025949 | Bacteria | 1855 |
| 538 | Ga0207667_10880201 | 3300025949 | Bacteria | 888 |
| 539 | Ga0207651_10000044 | 3300025960 | Bacteria | 58072 |
| 540 | Ga0207651_10160231 | 3300025960 | Bacteria | 1763 |
| 541 | Ga0207651_10209166 | 3300025960 | Bacteria | 1569 |
| 542 | Ga0207651_10232182 | 3300025960 | Bacteria | 1498 |
| 543 | Ga0207712_10000279 | 3300025961 | Bacteria | 48635 |
| 544 | Ga0207712_10031340 | 3300025961 | Bacteria | 3580 |
| 545 | Ga0207668_10000345 | 3300025972 | Bacteria | 30182 |
| 546 | Ga0207668_10106714 | 3300025972 | Bacteria | 2093 |
| 547 | Ga0207640_10006780 | 3300025981 | Bacteria | 6301 |
| 548 | Ga0207640_10316784 | 3300025981 | Bacteria | 1240 |
| 549 | Ga0207658_10005668 | 3300025986 | Bacteria | 8542 |
| 550 | Ga0207658_10064861 | 3300025986 | Bacteria | 2741 |
| 551 | Ga0207658_10185927 | 3300025986 | Bacteria | 1723 |
| 552 | Ga0207677_10000318 | 3300026023 | Bacteria | 35197 |
| 553 | Ga0207677_10096674 | 3300026023 | Bacteria | 2162 |
| 554 | Ga0207703_10001459 | 3300026035 | Bacteria | 21570 |
| 555 | Ga0207703_10065807 | 3300026035 | Bacteria | 2980 |
| 556 | Ga0207703_10838199 | 3300026035 | Bacteria | 879 |
| 557 | Ga0207639_10000693 | 3300026041 | Bacteria | 23172 |
| 558 | Ga0207639_10056656 | 3300026041 | Bacteria | 3005 |
| 559 | Ga0207678_10000158 | 3300026067 | Bacteria | 56255 |
| 560 | Ga0207678_10012404 | 3300026067 | Bacteria | 7480 |
| 561 | Ga0207678_10018793 | 3300026067 | Bacteria | 6070 |
| 562 | Ga0207678_10078154 | 3300026067 | Bacteria | 2834 |
| 563 | Ga0207678_10458465 | 3300026067 | Bacteria | 1109 |
| 564 | Ga0207708_10000098 | 3300026075 | Bacteria | 67005 |
| 565 | Ga0207708_10001262 | 3300026075 | Bacteria | 19058 |
| 566 | Ga0207702_10000835 | 3300026078 | Bacteria | 32256 |
| 567 | Ga0207702_10201126 | 3300026078 | Bacteria | 1847 |
| 568 | Ga0207702_10762576 | 3300026078 | Bacteria | 955 |
| 569 | Ga0207641_10000408 | 3300026088 | Bacteria | 50477 |
| 570 | Ga0207641_10109301 | 3300026088 | Bacteria | 2449 |
| 571 | Ga0207641_10555422 | 3300026088 | Bacteria | 1120 |
| 572 | Ga0207641_10742855 | 3300026088 | Bacteria | 968 |
| 573 | Ga0207648_10000696 | 3300026089 | Bacteria | 37592 |
| 574 | Ga0207648_10150924 | 3300026089 | Bacteria | 2050 |
| 575 | Ga0207648_10212042 | 3300026089 | Bacteria | 1719 |
| 576 | Ga0207676_10000133 | 3300026095 | Bacteria | 65766 |
| 577 | Ga0207676_10794029 | 3300026095 | Bacteria | 923 |
| 578 | Ga0207674_10000420 | 3300026116 | Bacteria | 55287 |
| 579 | Ga0207675_100001505 | 3300026118 | Bacteria | 23351 |
| 580 | Ga0207675_100011221 | 3300026118 | Bacteria | 8390 |
| 581 | Ga0207675_100108270 | 3300026118 | Bacteria | 2621 |
| 582 | Ga0207683_10000004 | 3300026121 | Bacteria | 188086 |
| 583 | Ga0207683_10003260 | 3300026121 | Bacteria | 14152 |
| 584 | Ga0207683_10155593 | 3300026121 | Bacteria | 2064 |
| 585 | Ga0207698_10001253 | 3300026142 | Bacteria | 14832 |
| 586 | Ga0207698_10104274 | 3300026142 | Bacteria | 2359 |
| 587 | Ga0209179_1007189 | 3300027512 | Bacteria | 1830 |
| 588 | Ga0210002_1029466 | 3300027617 | Bacteria | 908 |
| 589 | Ga0209971_1010785 | 3300027682 | Unclassified | 2164 |
| 590 | Ga0209971_1030214 | 3300027682 | Bacteria | 1297 |
| 591 | Ga0209966_1000495 | 3300027695 | Bacteria | 10461 |
| 592 | Ga0209998_10003496 | 3300027717 | Bacteria | 3431 |
| 593 | Ga0209998_10006820 | 3300027717 | Bacteria | 2369 |
| 594 | Ga0209813_10015509 | 3300027866 | Bacteria | 2066 |
| 595 | Ga0209813_10027138 | 3300027866 | Bacteria | 1661 |
| 596 | Ga0209813_10036383 | 3300027866 | Bacteria | 1478 |
| 597 | Ga0209813_10053904 | 3300027866 | Bacteria | 1266 |
| 598 | Ga0209974_10001709 | 3300027876 | Bacteria | 7966 |
| 599 | Ga0209974_10041401 | 3300027876 | Bacteria | 1533 |
| 600 | Ga0209974_10082143 | 3300027876 | Unclassified | 1110 |
| 601 | Ga0207428_10000218 | 3300027907 | Bacteria | 79728 |
| 602 | Ga0207428_10000250 | 3300027907 | Bacteria | 73217 |
| 603 | Ga0268266_10126666 | 3300028379 | Unclassified | 2280 |
| 604 | Ga0268266_10168682 | 3300028379 | Bacteria | 1985 |
| 605 | Ga0268266_10497274 | 3300028379 | Unclassified | 1164 |
| 606 | Ga0268265_10000752 | 3300028380 | Bacteria | 31485 |
| 607 | Ga0268265_10038150 | 3300028380 | Bacteria | 3532 |
| 608 | Ga0268264_10003892 | 3300028381 | Bacteria | 12796 |
| 609 | Ga0268264_10088498 | 3300028381 | Bacteria | 2665 |
| 610 | Ga0268264_10124325 | 3300028381 | Bacteria | 2278 |
| 611 | Ga0265318_10025387 | 3300028577 | Bacteria | 2340 |
| 612 | Ga0265336_10073931 | 3300028666 | Bacteria | 1019 |
| 613 | Ga0265338_10135833 | 3300028800 | Bacteria | 1933 |
| 614 | Ga0265338_10212036 | 3300028800 | Bacteria | 1453 |
| 615 | Ga0265338_10342383 | 3300028800 | Bacteria | 1077 |
| 616 | Ga0265330_10041814 | 3300031235 | Bacteria | 2031 |
| 617 | Ga0265325_10000039 | 3300031241 | Bacteria | 93014 |
| 618 | Ga0265325_10002499 | 3300031241 | Bacteria | 12381 |
| 619 | Ga0265325_10003850 | 3300031241 | Bacteria | 9641 |
| 620 | Ga0265325_10018367 | 3300031241 | Bacteria | 3877 |
| 621 | Ga0265340_10118966 | 3300031247 | Bacteria | 1216 |
| 622 | Ga0265339_10005148 | 3300031249 | Bacteria | 8770 |
| 623 | Ga0265339_10095646 | 3300031249 | Bacteria | 1551 |
| 624 | Ga0265316_10063336 | 3300031344 | Bacteria | 2868 |
| 625 | Ga0265316_10096941 | 3300031344 | Bacteria | 2245 |
| 626 | Ga0265316_10138819 | 3300031344 | Bacteria | 1827 |
| 627 | Ga0265313_10002016 | 3300031595 | Bacteria | 18226 |
| 628 | Ga0265313_10021637 | 3300031595 | Bacteria | 3513 |
| 629 | Ga0265313_10070796 | 3300031595 | Bacteria | 1606 |
| 630 | Ga0265342_10011239 | 3300031712 | Bacteria | 6141 |
| 631 | Ga0265342_10021361 | 3300031712 | Bacteria | 4136 |
| 632 | Ga0265342_10029333 | 3300031712 | Bacteria | 3416 |
| 633 | Ga0373930_0000117 | 3300034816 | Bacteria | 8515 |
| 634 | Ga0373930_0025651 | 3300034816 | Bacteria | 1184 |
| 635 | Ga0373948_0000584 | 3300034817 | Bacteria | 4657 |
| 636 | Ga0373948_0006817 | 3300034817 | Unclassified | 1902 |
| 637 | Ga0373950_0000126 | 3300034818 | Bacteria | 13244 |
| 638 | Ga0373958_0002830 | 3300034819 | Bacteria | 2467 |
| 639 | Ga0373958_0005324 | 3300034819 | Bacteria | 1949 |
| 640 | Ga0373938_0000052 | 3300034957 | Bacteria | 15127 |
| 641 | Ga0373926_0010334 | 3300035083 | Bacteria | 3128 |
| 642 | Ga0373928_0000217 | 3300035084 | Bacteria | 11150 |
| 643 | Ga0373929_0000370 | 3300035085 | Bacteria | 8436 |
| 644 | Ga0373934_0019849 | 3300035086 | Bacteria | 2582 |
| 645 | Ga0373934_0179651 | 3300035086 | Unclassified | 869 |
| 646 | Ga0373940_0000132 | 3300035088 | Bacteria | 9571 |
| 647 | Ga0373940_0008405 | 3300035088 | Bacteria | 2366 |
| 648 | Ga0373944_0011156 | 3300035089 | Bacteria | 2458 |
| 649 | Ga0373949_0003535 | 3300035090 | Bacteria | 3698 |
| 650 | Ga0373951_0000378 | 3300035091 | Bacteria | 13435 |
| 651 | Ga0373951_0007297 | 3300035091 | Bacteria | 2515 |
| 652 | Ga0373952_0000048 | 3300035092 | Bacteria | 14691 |
| 653 | Ga0373952_0002317 | 3300035092 | Bacteria | 3431 |
| 654 | Ga0373952_0035487 | 3300035092 | Unclassified | 1129 |
| 655 | Ga0373952_0051761 | 3300035092 | Bacteria | 981 |
| 656 | Ga0373923_0038581 | 3300035111 | Bacteria | 1958 |
| 657 | Ga0373932_0000094 | 3300035112 | Bacteria | 23612 |
| 658 | Ga0373936_0068812 | 3300035113 | Bacteria | 1456 |
| 659 | Ga0373936_0079795 | 3300035113 | Bacteria | 1361 |
| 660 | Ga0373936_0109211 | 3300035113 | Unclassified | 1173 |
| 661 | Ga0373936_0255070 | 3300035113 | Unclassified | 784 |
| 662 | Ga0373939_0000345 | 3300035114 | Bacteria | 11857 |
| 663 | Ga0373939_0014164 | 3300035114 | Bacteria | 2064 |
| 664 | Ga0373941_0000890 | 3300035115 | Bacteria | 6157 |
| 665 | Ga0373941_0007367 | 3300035115 | Bacteria | 2690 |
| 666 | Ga0373945_0019298 | 3300035116 | Bacteria | 2327 |
| 667 | Ga0373953_0001519 | 3300035117 | Bacteria | 6738 |
| 668 | Ga0373953_0012165 | 3300035117 | Bacteria | 3041 |
| 669 | Ga0373954_0013676 | 3300035118 | Bacteria | 3616 |
| 670 | Ga0373954_0026627 | 3300035118 | Bacteria | 2651 |
| 671 | Ga0373954_0053670 | 3300035118 | Bacteria | 1895 |
| 672 | Ga0373954_0069289 | 3300035118 | Bacteria | 1674 |
| 673 | Ga0373956_0012857 | 3300035119 | Bacteria | 3477 |
| 674 | Ga0373956_0063681 | 3300035119 | Bacteria | 1673 |
| 675 | Ga0373957_0007335 | 3300035120 | Bacteria | 3526 |
| 676 | Ga0373957_0032589 | 3300035120 | Bacteria | 1920 |
| 677 | Ga0373957_0132586 | 3300035120 | Bacteria | 1015 |
| 678 | Ga0373957_0139113 | 3300035120 | Unclassified | 992 |
| 679 | Ga0373960_0000760 | 3300035121 | Bacteria | 6747 |
| 680 | Ga0373960_0002160 | 3300035121 | Bacteria | 4428 |
| 681 | Ga0373943_0012555 | 3300035170 | Bacteria | 3817 |
| 682 | Ga0373943_0053351 | 3300035170 | Bacteria | 1996 |
| 683 | Ga0373943_0059638 | 3300035170 | Bacteria | 1902 |
| 684 | Ga0373943_0193211 | 3300035170 | Unclassified | 1123 |
| 685 | Ga0373943_0195312 | 3300035170 | Bacteria | 1118 |
| 686 | Ga0373943_0237462 | 3300035170 | Bacteria | 1020 |
| 687 | Ga0373946_0012866 | 3300035171 | Bacteria | 3137 |
| 688 | Ga0373955_0000848 | 3300035172 | Bacteria | 13090 |
| 689 | Ga0373955_0002018 | 3300035172 | Bacteria | 8733 |
| 690 | Ga0373955_0002468 | 3300035172 | Bacteria | 8082 |
| 691 | Ga0373955_0022836 | 3300035172 | Bacteria | 3179 |
| 692 | Ga0373955_0037242 | 3300035172 | Bacteria | 2585 |
| 693 | Ga0373955_0348984 | 3300035172 | Bacteria | 896 |
| 694 | Ga0373942_0001114 | 3300035207 | Bacteria | 7143 |
| 695 | Ga0373942_0019511 | 3300035207 | Bacteria | 1693 |
| 696 | Ga0373942_0178472 | 3300035207 | Unclassified | 695 |
| 697 | Ga0373961_0003766 | 3300035241 | Bacteria | 3706 |
| 698 | Ga0373961_0016311 | 3300035241 | Bacteria | 1912 |
| 699 | Ga0373962_0000137 | 3300035242 | Bacteria | 15079 |
| 700 | Ga0373962_0010224 | 3300035242 | Unclassified | 2335 |
| 701 | Ga0373924_0002913 | 3300035410 | Bacteria | 5801 |
| 702 | Ga0373924_0008057 | 3300035410 | Bacteria | 3816 |
| 703 | Ga0373931_0000034 | 3300035691 | Bacteria | 86665 |
| 704 | Ga0373931_0006073 | 3300035691 | Bacteria | 5626 |
| 705 | Ga0373931_0051263 | 3300035691 | Bacteria | 2198 |
| 706 | Ga0373931_0106833 | 3300035691 | Bacteria | 1582 |
| 707 | Ga0373935_0008682 | 3300035692 | Bacteria | 6084 |
| 708 | Ga0373935_0014967 | 3300035692 | Bacteria | 4684 |
| 709 | Ga0373935_0172448 | 3300035692 | Bacteria | 1480 |
| 710 | Ga0373935_0236094 | 3300035692 | Bacteria | 1275 |
| 711 | Ga0373935_0309937 | 3300035692 | Unclassified | 1117 |
| 712 | Ga0373927_0000518 | 3300035695 | Bacteria | 29311 |
| 713 | Ga0373927_0023682 | 3300035695 | Bacteria | 4019 |
| 714 | Ga0373927_0164926 | 3300035695 | Bacteria | 1452 |
| 715 | Ga0373927_0169537 | 3300035695 | Bacteria | 1431 |
| 716 | Ga0373927_0346741 | 3300035695 | Bacteria | 978 |
| 717 | Ga0373933_0003681 | 3300035724 | Bacteria | 8483 |
| 718 | Ga0373933_0006901 | 3300035724 | Bacteria | 6187 |
| 719 | Ga0373947_0000606 | 3300035725 | Bacteria | 21112 |
| 720 | Ga0373947_0031697 | 3300035725 | Bacteria | 3112 |
| 721 | Ga0373937_0002639 | 3300036401 | Bacteria | 14942 |
| 722 | Ga0373937_0019623 | 3300036401 | Bacteria | 6051 |
| 723 | Ga0373937_0060477 | 3300036401 | Bacteria | 3481 |
| 724 | Ga0373937_0089875 | 3300036401 | Bacteria | 2844 |
| 725 | Ga0373937_0112968 | 3300036401 | Bacteria | 2527 |
| 726 | Ga0373937_0180069 | 3300036401 | Bacteria | 1984 |
| 727 | Ga0373937_0504975 | 3300036401 | Bacteria | 1149 |
| 728 | Ga0373937_0681645 | 3300036401 | Bacteria | 974 |
| 729 | Ga0373925_0019706 | 3300037068 | Bacteria | 4909 |
| 730 | Ga0373925_0044441 | 3300037068 | Bacteria | 3298 |
| 731 | Ga0373925_0165024 | 3300037068 | Bacteria | 1746 |
| 732 | Ga0373925_0204147 | 3300037068 | Bacteria | 1572 |
| 733 | Ga0373925_0426251 | 3300037068 | Bacteria | 1084 |
| 734 | Ga0395900_0013393 | 3300037418 | Bacteria | 8379 |
| 735 | Ga0395898_0294195 | 3300037466 | Unclassified | 1549 |
| 736 | Ga0395898_0316277 | 3300037466 | Bacteria | 1489 |
| 737 | Ga0395901_0059834 | 3300038443 | Bacteria | 3963 |
| 738 | Ga0242420_000894 | 3300038996 | Bacteria | 3705 |
| 739 | Ga0436365_0725518 | 3300039437 | Bacteria | 1986 |
| 740 | Ga0436365_1202710 | 3300039437 | Bacteria | 2694 |
| 741 | Ga0439453_0005812 | 3300041408 | Bacteria | 1896 |
| 742 | Ga0439463_037591 | 3300042016 | Bacteria | 1228 |
| 743 | Ga0439460_0023172 | 3300042461 | Bacteria | 1710 |
| 744 | Ga0450893_0032341 | 3300042532 | Bacteria | 936 |
| 745 | Ga0451577_0530788 | 3300042876 | Bacteria | 1069 |
| 746 | Ga0453684_0083691 | 3300044712 | Bacteria | 3970 |
| 747 | Ga0466971_0161189 | 3300044719 | Bacteria | 1050 |
| 748 | Ga0495617_060354 | 3300046452 | Bacteria | 1255 |
| 749 | Ga0495592_0006010 | 3300046454 | Bacteria | 9023 |
| 750 | Ga0495592_0044080 | 3300046454 | Bacteria | 3334 |
| 751 | Ga0495592_0051338 | 3300046454 | Bacteria | 3063 |
| 752 | Ga0495603_0056384 | 3300046455 | Bacteria | 2326 |
| 753 | Ga0495603_0067844 | 3300046455 | Bacteria | 2098 |
| 754 | Ga0495591_035974 | 3300046458 | Bacteria | 1445 |
| 755 | Ga0495629_0005522 | 3300046459 | Bacteria | 9436 |
| 756 | Ga0495629_0015898 | 3300046459 | Bacteria | 5406 |
| 757 | Ga0495629_0057586 | 3300046459 | Bacteria | 2717 |
| 758 | Ga0495629_0078241 | 3300046459 | Bacteria | 2309 |
| 759 | Ga0495629_0086732 | 3300046459 | Bacteria | 2183 |
| 760 | Ga0495629_0176118 | 3300046459 | Bacteria | 1483 |
| 761 | Ga0495641_0010400 | 3300046461 | Bacteria | 5397 |
| 762 | Ga0495641_0038589 | 3300046461 | Bacteria | 2231 |
| 763 | Ga0495651_0000953 | 3300046462 | Bacteria | 22378 |
| 764 | Ga0495651_0006662 | 3300046462 | Bacteria | 8830 |
| 765 | Ga0495651_0106700 | 3300046462 | Bacteria | 2076 |
| 766 | Ga0495651_0134921 | 3300046462 | Bacteria | 1797 |
| 767 | Ga0495653_0001996 | 3300046463 | Bacteria | 16043 |
| 768 | Ga0495653_0007423 | 3300046463 | Bacteria | 8977 |
| 769 | Ga0495653_0055817 | 3300046463 | Bacteria | 3013 |
| 770 | Ga0495653_0071132 | 3300046463 | Bacteria | 2602 |
| 771 | Ga0495580_0098533 | 3300046472 | Bacteria | 2033 |
| 772 | Ga0495580_0113272 | 3300046472 | Bacteria | 1884 |
| 773 | Ga0495580_0278454 | 3300046472 | Unclassified | 1141 |
| 774 | Ga0495582_0007172 | 3300046473 | Bacteria | 6188 |
| 775 | Ga0495582_0015476 | 3300046473 | Bacteria | 4189 |
| 776 | Ga0495582_0067342 | 3300046473 | Bacteria | 1978 |
| 777 | Ga0495582_0214357 | 3300046473 | Bacteria | 1101 |
| 778 | Ga0495639_0064239 | 3300046475 | Bacteria | 1686 |
| 779 | Ga0495639_0081179 | 3300046475 | Bacteria | 1510 |
| 780 | Ga0495662_0030423 | 3300046476 | Bacteria | 2606 |
| 781 | Ga0495662_0032044 | 3300046476 | Bacteria | 2539 |
| 782 | Ga0495664_0000976 | 3300046477 | Bacteria | 14715 |
| 783 | Ga0495664_0006476 | 3300046477 | Bacteria | 6470 |
| 784 | Ga0495664_0023101 | 3300046477 | Bacteria | 3606 |
| 785 | Ga0495664_0127974 | 3300046477 | Bacteria | 1537 |
| 786 | Ga0495664_0164433 | 3300046477 | Unclassified | 1346 |
| 787 | Ga0495584_0053537 | 3300046491 | Bacteria | 2031 |
| 788 | Ga0495585_0001710 | 3300046492 | Bacteria | 16728 |
| 789 | Ga0495594_0003748 | 3300046499 | Bacteria | 7795 |
| 790 | Ga0495594_0036053 | 3300046499 | Bacteria | 2696 |
| 791 | Ga0495594_0273832 | 3300046499 | Bacteria | 962 |
| 792 | Ga0495607_0001556 | 3300046501 | Bacteria | 20100 |
| 793 | Ga0495608_0003982 | 3300046511 | Bacteria | 10606 |
| 794 | Ga0495608_0017623 | 3300046511 | Bacteria | 4939 |
| 795 | Ga0495608_0038614 | 3300046511 | Bacteria | 3205 |
| 796 | Ga0495618_0004731 | 3300046514 | Bacteria | 8322 |
| 797 | Ga0495618_0022404 | 3300046514 | Bacteria | 3901 |
| 798 | Ga0495618_0043310 | 3300046514 | Unclassified | 2840 |
| 799 | Ga0495618_0240630 | 3300046514 | Bacteria | 1138 |
| 800 | Ga0495628_0013061 | 3300046516 | Bacteria | 6994 |
| 801 | Ga0495628_0022252 | 3300046516 | Bacteria | 5209 |
| 802 | Ga0495628_0047170 | 3300046516 | Bacteria | 3419 |
| 803 | Ga0495628_0079907 | 3300046516 | Unclassified | 2542 |
| 804 | Ga0495630_0023873 | 3300046517 | Bacteria | 4520 |
| 805 | Ga0495630_0063762 | 3300046517 | Bacteria | 2768 |
| 806 | Ga0495630_0091602 | 3300046517 | Bacteria | 2297 |
| 807 | Ga0495630_0218917 | 3300046517 | Bacteria | 1453 |
| 808 | Ga0495644_0007809 | 3300046523 | Bacteria | 4123 |
| 809 | Ga0495666_0036237 | 3300046526 | Bacteria | 2403 |
| 810 | Ga0495666_0074186 | 3300046526 | Bacteria | 1614 |
| 811 | Ga0495652_0007587 | 3300046529 | Bacteria | 9995 |
| 812 | Ga0495652_0039727 | 3300046529 | Bacteria | 4068 |
| 813 | Ga0495652_0046128 | 3300046529 | Bacteria | 3742 |
| 814 | Ga0495652_0048465 | 3300046529 | Bacteria | 3640 |
| 815 | Ga0495652_0050450 | 3300046529 | Unclassified | 3557 |
| 816 | Ga0495652_0238850 | 3300046529 | Bacteria | 1354 |
| 817 | Ga0495665_0005230 | 3300046531 | Bacteria | 6993 |
| 818 | Ga0495665_0015212 | 3300046531 | Bacteria | 4146 |
| 819 | Ga0495665_0029221 | 3300046531 | Unclassified | 2953 |
| 820 | Ga0495640_0000406 | 3300046533 | Bacteria | 31017 |
| 821 | Ga0495640_0006464 | 3300046533 | Bacteria | 9267 |
| 822 | Ga0495640_0007428 | 3300046533 | Bacteria | 8619 |
| 823 | Ga0495586_0179796 | 3300046535 | Unclassified | 1196 |
| 824 | Ga0495587_0000784 | 3300046536 | Bacteria | 21237 |
| 825 | Ga0495587_0021777 | 3300046536 | Bacteria | 3955 |
| 826 | Ga0495587_0042701 | 3300046536 | Bacteria | 2703 |
| 827 | Ga0495587_0140122 | 3300046536 | Bacteria | 1381 |
| 828 | Ga0495645_0000656 | 3300046543 | Bacteria | 23844 |
| 829 | Ga0495645_0026011 | 3300046543 | Bacteria | 4247 |
| 830 | Ga0495645_0295504 | 3300046543 | Unclassified | 1060 |
| 831 | Ga0495622_0003340 | 3300046557 | Bacteria | 7573 |
| 832 | Ga0495633_0001919 | 3300046558 | Bacteria | 15133 |
| 833 | Ga0495667_0001270 | 3300046559 | Bacteria | 16534 |
| 834 | Ga0495667_0012253 | 3300046559 | Bacteria | 5811 |
| 835 | Ga0495667_0025707 | 3300046559 | Bacteria | 3966 |
| 836 | Ga0495667_0028685 | 3300046559 | Bacteria | 3748 |
| 837 | Ga0495667_0074298 | 3300046559 | Bacteria | 2213 |
| 838 | Ga0495656_0000503 | 3300046615 | Bacteria | 12828 |
| 839 | Ga0495634_0008180 | 3300046642 | Bacteria | 7794 |
| 840 | Ga0495634_0021259 | 3300046642 | Bacteria | 4589 |
| 841 | Ga0495634_0022715 | 3300046642 | Bacteria | 4419 |
| 842 | Ga0495635_0001701 | 3300046663 | Bacteria | 14818 |
| 843 | Ga0495635_0003774 | 3300046663 | Bacteria | 10521 |
| 844 | Ga0495635_0007304 | 3300046663 | Bacteria | 7716 |
| 845 | Ga0495635_0027249 | 3300046663 | Bacteria | 3975 |
| 846 | Ga0495635_0032148 | 3300046663 | Bacteria | 3641 |
| 847 | Ga0495635_0092813 | 3300046663 | Bacteria | 2064 |
| 848 | Ga0495635_0101464 | 3300046663 | Bacteria | 1967 |
| 849 | Ga0495635_0195139 | 3300046663 | Bacteria | 1374 |
| 850 | Ga0495659_0156620 | 3300046664 | Bacteria | 917 |
| 851 | Ga0495661_0023514 | 3300046665 | Bacteria | 4000 |
| 852 | Ga0495588_0029047 | 3300046674 | Bacteria | 2771 |
| 853 | Ga0495657_0000582 | 3300046675 | Bacteria | 33505 |
| 854 | Ga0495657_0027053 | 3300046675 | Bacteria | 4053 |
| 855 | Ga0495599_0000980 | 3300046678 | Bacteria | 15973 |
| 856 | Ga0495599_0013722 | 3300046678 | Bacteria | 5010 |
| 857 | Ga0495599_0056893 | 3300046678 | Bacteria | 2447 |
| 858 | Ga0495623_0000585 | 3300046679 | Bacteria | 24290 |
| 859 | Ga0495623_0046809 | 3300046679 | Bacteria | 2745 |
| 860 | Ga0495623_0073176 | 3300046679 | Bacteria | 2130 |
| 861 | Ga0495646_0000200 | 3300046680 | Bacteria | 29769 |
| 862 | Ga0495646_0204047 | 3300046680 | Bacteria | 1075 |
| 863 | Ga0495647_0001263 | 3300046681 | Bacteria | 7804 |
| 864 | Ga0495647_0004820 | 3300046681 | Bacteria | 4405 |
| 865 | Ga0495647_0048997 | 3300046681 | Bacteria | 1635 |
| 866 | Ga0495647_0078147 | 3300046681 | Bacteria | 1337 |
| 867 | Ga0495658_0000278 | 3300046683 | Bacteria | 29065 |
| 868 | Ga0495658_0008696 | 3300046683 | Bacteria | 5041 |
| 869 | Ga0495658_0034527 | 3300046683 | Bacteria | 2776 |
| 870 | Ga0495613_0032552 | 3300046689 | Bacteria | 3874 |
| 871 | Ga0495613_0153955 | 3300046689 | Bacteria | 1638 |
| 872 | Ga0495613_0222855 | 3300046689 | Bacteria | 1323 |
| 873 | Ga0495624_0004272 | 3300046690 | Bacteria | 10497 |
| 874 | Ga0495624_0023760 | 3300046690 | Bacteria | 4039 |
| 875 | Ga0495624_0057326 | 3300046690 | Bacteria | 2449 |
| 876 | Ga0495624_0314071 | 3300046690 | Bacteria | 944 |
| 877 | Ga0495670_0002792 | 3300046691 | Bacteria | 8636 |
| 878 | Ga0495600_0016272 | 3300046809 | Bacteria | 4717 |
| 879 | Ga0495600_0020754 | 3300046809 | Bacteria | 4202 |
| 880 | Ga0495600_0051308 | 3300046809 | Bacteria | 2693 |
| 881 | Ga0495581_0004217 | 3300047315 | Bacteria | 8283 |
| 882 | Ga0495581_0059975 | 3300047315 | Bacteria | 2199 |
| 883 | Ga0495581_0068347 | 3300047315 | Bacteria | 2054 |
| 884 | Ga0495581_0082785 | 3300047315 | Bacteria | 1859 |
| 885 | Ga0495581_0093078 | 3300047315 | Bacteria | 1749 |
| 886 | Ga0495604_0005558 | 3300047317 | Bacteria | 9995 |
| 887 | Ga0495604_0020211 | 3300047317 | Bacteria | 5321 |
| 888 | Ga0495604_0041535 | 3300047317 | Bacteria | 3607 |
| 889 | Ga0495604_0065864 | 3300047317 | Bacteria | 2757 |
| 890 | Ga0495604_0220351 | 3300047317 | Unclassified | 1306 |
| 891 | Ga0495674_0001289 | 3300047319 | Bacteria | 24350 |
| 892 | Ga0495674_0003539 | 3300047319 | Bacteria | 15202 |
| 893 | Ga0495674_0018544 | 3300047319 | Bacteria | 6476 |
| 894 | Ga0495674_0026786 | 3300047319 | Bacteria | 5273 |
| 895 | Ga0495674_0095990 | 3300047319 | Bacteria | 2527 |
| 896 | Ga0495674_0254218 | 3300047319 | Bacteria | 1445 |
| 897 | Ga0495676_0058982 | 3300047321 | Bacteria | 3017 |
| 898 | Ga0495676_0080731 | 3300047321 | Bacteria | 2468 |
| 899 | Ga0495676_0098045 | 3300047321 | Bacteria | 2175 |
| 900 | Ga0495676_0101647 | 3300047321 | Bacteria | 2126 |
| 901 | Ga0495680_0001872 | 3300047322 | Bacteria | 22140 |
| 902 | Ga0495680_0003975 | 3300047322 | Bacteria | 14284 |
| 903 | Ga0495680_0005700 | 3300047322 | Bacteria | 11659 |
| 904 | Ga0495680_0006567 | 3300047322 | Bacteria | 10792 |
| 905 | Ga0495680_0022426 | 3300047322 | Bacteria | 5261 |
| 906 | Ga0495680_0190146 | 3300047322 | Bacteria | 1477 |
| 907 | Ga0495675_0003810 | 3300047444 | Bacteria | 9131 |
| 908 | Ga0495675_0050829 | 3300047444 | Bacteria | 2634 |
| 909 | Ga0495675_0399334 | 3300047444 | Unclassified | 802 |
| 910 | Ga0495684_0000713 | 3300047471 | Bacteria | 26743 |
| 911 | Ga0495684_0001047 | 3300047471 | Bacteria | 22374 |
| 912 | Ga0495684_0029275 | 3300047471 | Bacteria | 4227 |
| 913 | Ga0495684_0031351 | 3300047471 | Bacteria | 4081 |
| 914 | Ga0495684_0069210 | 3300047471 | Bacteria | 2684 |
| 915 | Ga0495684_0131646 | 3300047471 | Bacteria | 1878 |
| 916 | Ga0495593_0005474 | 3300047673 | Bacteria | 7496 |
| 917 | Ga0495593_0100935 | 3300047673 | Bacteria | 1480 |
| 918 | Ga0495593_0131849 | 3300047673 | Bacteria | 1268 |
| 919 | Ga0495602_0008181 | 3300048088 | Bacteria | 10926 |
| 920 | Ga0495602_0013918 | 3300048088 | Bacteria | 8197 |
| 921 | Ga0495602_0022737 | 3300048088 | Bacteria | 6131 |
| 922 | Ga0495602_0461589 | 3300048088 | Bacteria | 894 |
| 923 | Ga0495614_0011762 | 3300048089 | Bacteria | 3847 |
| 924 | Ga0496100_0000050 | 3300048903 | Bacteria | 75449 |
| 925 | Ga0496100_0045393 | 3300048903 | Unclassified | 2820 |
| 926 | Ga0496100_0055828 | 3300048903 | Bacteria | 2582 |
| 927 | Ga0496100_0068894 | 3300048903 | Bacteria | 2354 |
| 928 | Ga0496100_0196240 | 3300048903 | Bacteria | 1468 |
| 929 | Ga0496100_0568079 | 3300048903 | Unclassified | 879 |
| 930 | Ga0496100_0634135 | 3300048903 | Bacteria | 831 |
| 931 | Ga0496101_0000121 | 3300048904 | Bacteria | 76264 |
| 932 | Ga0496101_0016049 | 3300048904 | Bacteria | 5055 |
| 933 | Ga0496101_0058342 | 3300048904 | Bacteria | 2795 |
| 934 | Ga0496101_0106920 | 3300048904 | Bacteria | 2101 |
| 935 | Ga0496102_0042762 | 3300048905 | Bacteria | 4107 |
| 936 | Ga0496102_0359562 | 3300048905 | Bacteria | 1371 |
| 937 | Ga0496102_0393924 | 3300048905 | Bacteria | 1302 |
| 938 | Ga0496102_0443848 | 3300048905 | Bacteria | 1217 |
| 939 | Ga0496103_0004803 | 3300048906 | Bacteria | 8169 |
| 940 | Ga0496103_0051978 | 3300048906 | Bacteria | 2537 |
| 941 | Ga0496103_0309559 | 3300048906 | Bacteria | 1016 |
| 942 | Ga0496104_0001467 | 3300048907 | Bacteria | 20349 |
| 943 | Ga0496104_0015855 | 3300048907 | Bacteria | 6836 |
| 944 | Ga0496104_0060294 | 3300048907 | Bacteria | 3594 |
| 945 | Ga0496104_0072728 | 3300048907 | Bacteria | 3270 |
| 946 | Ga0496104_0281725 | 3300048907 | Bacteria | 1575 |
| 947 | Ga0496104_0642052 | 3300048907 | Bacteria | 971 |
| 948 | Ga0496104_0735788 | 3300048907 | Bacteria | 894 |
| 949 | Ga0496105_0056163 | 3300048908 | Archaea | 3250 |
| 950 | Ga0496105_0056440 | 3300048908 | Bacteria | 3241 |
| 951 | Ga0496105_0098428 | 3300048908 | Bacteria | 2415 |
| 952 | Ga0496106_0000133 | 3300048909 | Bacteria | 55926 |
| 953 | Ga0496106_0080367 | 3300048909 | Bacteria | 2504 |
| 954 | Ga0496107_0006506 | 3300048910 | Bacteria | 8033 |
| 955 | Ga0496107_0013988 | 3300048910 | Bacteria | 5615 |
| 956 | Ga0496107_0083499 | 3300048910 | Bacteria | 2329 |
| 957 | Ga0496107_0716626 | 3300048910 | Bacteria | 735 |
| 958 | Ga0496108_0013476 | 3300048911 | Bacteria | 6671 |
| 959 | Ga0496108_0068226 | 3300048911 | Bacteria | 3000 |
| 960 | Ga0496108_0228818 | 3300048911 | Archaea | 1616 |
| 961 | Ga0496109_0001741 | 3300048912 | Bacteria | 18178 |
| 962 | Ga0496109_0002099 | 3300048912 | Bacteria | 16567 |
| 963 | Ga0496109_0009353 | 3300048912 | Bacteria | 8349 |
| 964 | Ga0496109_0064809 | 3300048912 | Bacteria | 3344 |
| 965 | Ga0496109_0174145 | 3300048912 | Bacteria | 2019 |
| 966 | Ga0496109_0184564 | 3300048912 | Bacteria | 1960 |
| 967 | Ga0496109_0545768 | 3300048912 | Bacteria | 1093 |
| 968 | Ga0496110_0141017 | 3300048913 | Unclassified | 2179 |
| 969 | Ga0496110_0210718 | 3300048913 | Bacteria | 1766 |
| 970 | Ga0496110_0454615 | 3300048913 | Bacteria | 1167 |
| 971 | Ga0496110_0801623 | 3300048913 | Unclassified | 846 |
| 972 | Ga0496111_0010401 | 3300048914 | Bacteria | 6243 |
| 973 | Ga0496111_0128454 | 3300048914 | Archaea | 1874 |
| 974 | Ga0496111_0150250 | 3300048914 | Bacteria | 1727 |
| 975 | Ga0496111_0291593 | 3300048914 | Bacteria | 1210 |
| 976 | Ga0496111_0413963 | 3300048914 | Bacteria | 996 |
| 977 | Ga0496112_0044099 | 3300048915 | Bacteria | 4368 |
| 978 | Ga0496112_0065541 | 3300048915 | Bacteria | 3584 |
| 979 | Ga0496112_0124052 | 3300048915 | Bacteria | 2553 |
| 980 | Ga0496112_0147191 | 3300048915 | Bacteria | 2323 |
| 981 | Ga0496112_0203642 | 3300048915 | Bacteria | 1937 |
| 982 | Ga0496112_0328383 | 3300048915 | Bacteria | 1474 |
| 983 | Ga0496112_0468855 | 3300048915 | Unclassified | 1196 |
| 984 | Ga0496112_0594839 | 3300048915 | Bacteria | 1038 |
| 985 | Ga0496112_0635420 | 3300048915 | Bacteria | 998 |
| 986 | Ga0496113_0008981 | 3300048916 | Bacteria | 6542 |
| 987 | Ga0496113_0078278 | 3300048916 | Bacteria | 2530 |
| 988 | Ga0496113_0079275 | 3300048916 | Bacteria | 2514 |
| 989 | Ga0496113_0138203 | 3300048916 | Bacteria | 1916 |
| 990 | Ga0496113_0437016 | 3300048916 | Bacteria | 1051 |
| 991 | Ga0496114_0003778 | 3300048917 | Bacteria | 11671 |
| 992 | Ga0496114_0040751 | 3300048917 | Bacteria | 3846 |
| 993 | Ga0496114_0077920 | 3300048917 | Bacteria | 2795 |
| 994 | Ga0496114_0267030 | 3300048917 | Bacteria | 1507 |
| 995 | Ga0496114_0664054 | 3300048917 | Bacteria | 916 |
| 996 | Ga0496115_0005713 | 3300048918 | Bacteria | 9055 |
| 997 | Ga0496115_0034569 | 3300048918 | Bacteria | 3995 |
| 998 | Ga0496115_0341722 | 3300048918 | Bacteria | 1221 |
| 999 | Ga0496126_0052179 | 3300048929 | Bacteria | 3718 |
| 1000 | Ga0501070_0089954 | 3300049586 | Bacteria | 2541 |
| 1001 | Ga0501071_0105363 | 3300049587 | Bacteria | 2082 |
| 1002 | Ga0501073_0015726 | 3300049589 | Bacteria | 5484 |
| 1003 | Ga0501073_0018153 | 3300049589 | Bacteria | 5085 |
| 1004 | Ga0501073_0315151 | 3300049589 | Bacteria | 1079 |
| 1005 | Ga0501073_0361681 | 3300049589 | Bacteria | 1002 |
| 1006 | Ga0501075_0244801 | 3300049591 | Bacteria | 1367 |
| 1007 | Ga0501075_0824734 | 3300049591 | Bacteria | 706 |
| 1008 | Ga0501076_0039609 | 3300049592 | Unclassified | 3700 |
| 1009 | Ga0501076_0070354 | 3300049592 | Bacteria | 2797 |
| 1010 | Ga0501076_0267914 | 3300049592 | Bacteria | 1399 |
| 1011 | Ga0501079_0635210 | 3300049741 | Bacteria | 841 |
| 1012 | Ga0501081_0156198 | 3300049743 | Bacteria | 1642 |
| 1013 | Ga0501083_0192574 | 3300049744 | Bacteria | 1331 |
| 1014 | Ga0501083_0390590 | 3300049744 | Unclassified | 905 |
| 1015 | Ga0501035_0402446 | 3300049822 | Bacteria | 1139 |
| 1016 | Ga0501044_0401187 | 3300049823 | Bacteria | 1284 |
| 1017 | Ga0501045_0126255 | 3300049824 | Bacteria | 1901 |
| 1018 | nmdc:mga03683_112841_c1 | 3300050489 | Bacteria | 1203 |
| 1019 | nmdc:mga03683_31760_c1 | 3300050489 | Bacteria | 2121 |
| 1020 | nmdc:mga03n38_17324_c1 | 3300050490 | Bacteria | 2819 |
| 1021 | nmdc:mga03n38_282230_c1 | 3300050490 | Bacteria | 887 |
| 1022 | nmdc:mga00v17_273275_c1 | 3300050491 | Bacteria | 1097 |
| 1023 | nmdc:mga00v17_420723_c1 | 3300050491 | Bacteria | 868 |
| 1024 | nmdc:mga0yw44_18637_c1 | 3300050492 | Bacteria | 2370 |
| 1025 | nmdc:mga0yw44_271705_c1 | 3300050492 | Bacteria | 1132 |
| 1026 | nmdc:mga0yw44_500149_c1 | 3300050492 | Bacteria | 825 |
| 1027 | nmdc:mga0yw44_500294_c1 | 3300050492 | Bacteria | 825 |
| 1028 | nmdc:mga0k408_220012_c1 | 3300050493 | Bacteria | 1134 |
| 1029 | nmdc:mga06z11_115767_c1 | 3300050494 | Bacteria | 1490 |
| 1030 | nmdc:mga06z11_20423_c1 | 3300050494 | Bacteria | 3062 |
| 1031 | nmdc:mga06z11_332237_c1 | 3300050494 | Bacteria | 908 |
| 1032 | nmdc:mga06z11_399052_c1 | 3300050494 | Bacteria | 828 |
| 1033 | nmdc:mga06z11_72502_c1 | 3300050494 | Bacteria | 1826 |
| 1034 | nmdc:mga04h51_17826_c1 | 3300050495 | Bacteria | 1653 |
| 1035 | nmdc:mga04h51_26133_c1 | 3300050495 | Bacteria | 1803 |
| 1036 | nmdc:mga04h51_31780_c1 | 3300050495 | Bacteria | 1670 |
| 1037 | nmdc:mga04h51_37823_c1 | 3300050495 | Bacteria | 1560 |
| 1038 | nmdc:mga07m45_30137_c1 | 3300050496 | Bacteria | 3004 |
| 1039 | nmdc:mga05p37_106164_c1 | 3300050507 | Bacteria | 3455 |
| 1040 | nmdc:mga05p37_354_c1 | 3300050507 | Bacteria | 49188 |
| 1041 | nmdc:mga09592_4746_c1 | 3300050508 | Bacteria | 11013 |
| 1042 | nmdc:mga0qj67_935_c1 | 3300050509 | Bacteria | 20095 |
| 1043 | nmdc:mga06r32_147_c1 | 3300050510 | Bacteria | 53171 |
| 1044 | nmdc:mga08y16_26007_c1 | 3300050511 | Bacteria | 6175 |
| 1045 | nmdc:mga08y16_289_c1 | 3300050511 | Bacteria | 45654 |
| 1046 | nmdc:mga08y16_3527_c1 | 3300050511 | Bacteria | 16242 |
| 1047 | nmdc:mga08y16_707067_c1 | 3300050511 | Bacteria | 1007 |
| 1048 | nmdc:mga0n895_2125_c1 | 3300050512 | Bacteria | 15305 |
| 1049 | nmdc:mga0n895_414471_c1 | 3300050512 | Bacteria | 1362 |
| 1050 | nmdc:mga0n895_537262_c1 | 3300050512 | Bacteria | 1176 |
| 1051 | nmdc:mga0n895_545_c1 | 3300050512 | Bacteria | 25797 |
| 1052 | nmdc:mga0rr50_1020138_c1 | 3300050513 | Bacteria | 705 |
| 1053 | nmdc:mga0rr50_1502_c1 | 3300050513 | Bacteria | 12829 |
| 1054 | nmdc:mga0rr50_160947_c1 | 3300050513 | Bacteria | 1822 |
| 1055 | nmdc:mga0rr50_219355_c1 | 3300050513 | Bacteria | 1570 |
| 1056 | nmdc:mga0rr50_9459_c2 | 3300050513 | Bacteria | 1775 |
| 1057 | nmdc:mga0rr50_98743_c1 | 3300050513 | Bacteria | 2289 |
| 1058 | nmdc:mga08x19_24_c1 | 3300050514 | Bacteria | 245940 |
| 1059 | nmdc:mga08x19_378558_c1 | 3300050514 | Bacteria | 991 |
| 1060 | nmdc:mga0a205_131106_c1 | 3300050515 | Bacteria | 2092 |
| 1061 | nmdc:mga0a205_140696_c1 | 3300050515 | Bacteria | 2313 |
| 1062 | nmdc:mga0a205_270347_c1 | 3300050515 | Bacteria | 1577 |
| 1063 | nmdc:mga0a205_4915_c1 | 3300050515 | Bacteria | 12023 |
| 1064 | nmdc:mga0a205_60_c1 | 3300050515 | Bacteria | 60202 |
| 1065 | nmdc:mga0sz30_26694_c1 | 3300050516 | Bacteria | 2369 |
| 1066 | Ga0495601_0000068 | 3300053077 | Bacteria | 56524 |
| 1067 | Ga0495601_0001006 | 3300053077 | Bacteria | 15442 |
| 1068 | Ga0495601_0002256 | 3300053077 | Bacteria | 10868 |
| 1069 | Ga0495601_0003844 | 3300053077 | Bacteria | 8644 |
| 1070 | Ga0495601_0027708 | 3300053077 | Bacteria | 3504 |
| 1071 | Ga0495601_0041400 | 3300053077 | Bacteria | 2887 |
| 1072 | Ga0495612_0001267 | 3300053078 | Bacteria | 10423 |
| 1073 | Ga0495612_0003612 | 3300053078 | Bacteria | 6417 |
| 1074 | Ga0495612_0004139 | 3300053078 | Bacteria | 6006 |
| 1075 | Ga0500610_0104431 | 3300053079 | Bacteria | 1463 |
| 1076 | Ga0495595_0001160 | 3300053084 | Bacteria | 10205 |
| 1077 | Ga0495595_0002637 | 3300053084 | Bacteria | 7039 |
| 1078 | Ga0495595_0005061 | 3300053084 | Bacteria | 5324 |
| 1079 | Ga0495595_0010358 | 3300053084 | Bacteria | 3873 |
| 1080 | Ga0495595_0099662 | 3300053084 | Bacteria | 1401 |
| 1081 | Ga0495619_0000136 | 3300053085 | Bacteria | 54722 |
| 1082 | Ga0495619_0000154 | 3300053085 | Bacteria | 50900 |
| 1083 | Ga0495619_0000996 | 3300053085 | Bacteria | 18589 |
| 1084 | Ga0495619_0001694 | 3300053085 | Bacteria | 14589 |
| 1085 | Ga0495619_0002254 | 3300053085 | Bacteria | 12749 |
| 1086 | Ga0495619_0128664 | 3300053085 | Bacteria | 1739 |
| 1087 | Ga0495619_0149955 | 3300053085 | Bacteria | 1608 |
| 1088 | Ga0495619_0303114 | 3300053085 | Unclassified | 1107 |
| 1089 | Ga0500643_001473 | 3300053087 | Bacteria | 13507 |
| 1090 | Ga0500644_0000904 | 3300053088 | Bacteria | 9477 |
| 1091 | Ga0500646_0163067 | 3300053090 | Bacteria | 745 |
| 1092 | Ga0500651_0085571 | 3300053093 | Bacteria | 1948 |
| 1093 | Ga0500566_0057215 | 3300053094 | Bacteria | 2215 |
| 1094 | Ga0500641_0001418 | 3300053096 | Bacteria | 8550 |
| 1095 | Ga0500641_0005479 | 3300053096 | Bacteria | 4496 |
| 1096 | Ga0500641_0175613 | 3300053096 | Bacteria | 921 |
| 1097 | Ga0500650_0044907 | 3300053098 | Bacteria | 2046 |
| 1098 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1099 | Ga0500595_015845 | 3300053119 | Bacteria | 2820 |
| 1100 | Ga0500597_105718 | 3300053120 | Bacteria | 1223 |
| 1101 | Ga0500652_000003 | 3300053131 | Bacteria | 221528 |
| 1102 | Ga0500652_026516 | 3300053131 | Bacteria | 2232 |
| 1103 | Ga0500658_0096881 | 3300053134 | Bacteria | 1283 |
| 1104 | Ga0500588_0216757 | 3300053146 | Bacteria | 713 |
| 1105 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1106 | Ga0500636_0010026 | 3300053177 | Bacteria | 5516 |
| 1107 | Ga0500645_000086 | 3300053730 | Bacteria | 74512 |
| 1108 | Ga0501084_0174604 | 3300054114 | Bacteria | 1814 |
| 1109 | Ga0501084_0201921 | 3300054114 | Bacteria | 1677 |
| 1110 | Ga0373935_0040371 | |||
| 1111 | SwRhRL2b_contig_902337 | |||
| 1112 | 2214856321 | |||
| 1113 | ARSoilYngRDRAFT_c00224 | |||
| 1114 | ARcpr5yngRDRAFT_c000200 | |||
| 1115 | ARSoilOldRDRAFT_c000038 | |||
| 1116 | ARCol0oldRDRAFT_c00169 | |||
| 1117 | ARCol0yngRDRAFT_1000396 | |||
| 1118 | JGI24746J21847_1002569 | |||
| 1119 | JGI24740J21852_10050257 | |||
| 1120 | JGI24739J22299_10000144 | |||
| 1121 | JGI24737J22298_10001737 | |||
| 1122 | JGI24737J22298_10001829 | |||
| 1123 | JGI24750J21931_1000014 | |||
| 1124 | JGI24745J21846_1000270 | |||
| 1125 | JGI24748J21848_1002358 | |||
| 1126 | JGI24738J21930_10000574 | |||
| 1127 | JGI24749J21850_1001045 | |||
| 1128 | JGI24744J21845_10000166 | |||
| 1129 | JGI24035J26624_1008271 | |||
| 1130 | JGI24033J26618_1001410 | |||
| 1131 | JGI24034J26672_10000281 | |||
| 1132 | JGI24742J22300_10001185 | |||
| 1133 | JGI25405J52794_10053938 | |||
| 1134 | Ga0065717_1004781 | |||
| 1135 | Ga0065716_1000005 | |||
| 1136 | Ga0065704_10093949 | |||
| 1137 | Ga0065712_10068670 | |||
| 1138 | Ga0065712_10069916 | |||
| 1139 | Ga0065712_10070787 | |||
| 1140 | Ga0065715_10000266 | |||
| 1141 | Ga0065715_10001896 | |||
| 1142 | Ga0065707_10091685 | |||
| 1143 | Ga0070658_10091260 | |||
| 1144 | Ga0070658_10104180 | |||
| 1145 | Ga0070658_10254651 | |||
| 1146 | Ga0070676_10000663 | |||
| 1147 | Ga0070676_10266539 | |||
| 1148 | Ga0070683_100000152 | |||
| 1149 | Ga0070683_100203801 | |||
| 1150 | Ga0070683_100721663 | |||
| 1151 | Ga0070690_100000388 | |||
| 1152 | Ga0070690_100024975 | |||
| 1153 | Ga0070690_100194217 | |||
| 1154 | Ga0070690_100209192 | |||
| 1155 | Ga0070670_100004481 | |||
| 1156 | Ga0070670_100027603 | |||
| 1157 | Ga0070677_10000363 | |||
| 1158 | Ga0068869_100000020 | |||
| 1159 | Ga0068869_100186397 | |||
| 1160 | Ga0070666_10007376 | |||
| 1161 | Ga0070666_10025663 | |||
| 1162 | Ga0070666_10157207 | |||
| 1163 | Ga0070666_10167189 | |||
| 1164 | Ga0070680_100025550 | |||
| 1165 | Ga0070680_100029923 | |||
| 1166 | Ga0070680_100045232 | |||
| 1167 | Ga0070680_100148337 | |||
| 1168 | Ga0070680_100367123 | |||
| 1169 | Ga0070682_100000264 | |||
| 1170 | Ga0070682_100081444 | |||
| 1171 | Ga0070682_100180629 | |||
| 1172 | Ga0070682_100541510 | |||
| 1173 | Ga0068868_100035892 | |||
| 1174 | Ga0070660_100000394 | |||
| 1175 | Ga0070660_100165750 | |||
| 1176 | Ga0070689_100004384 | |||
| 1177 | Ga0070689_100008724 | |||
| 1178 | Ga0070689_100318122 | |||
| 1179 | Ga0070691_10008871 | |||
| 1180 | Ga0070691_10037541 | |||
| 1181 | Ga0070687_100000122 | |||
| 1182 | Ga0070687_100011710 | |||
| 1183 | Ga0070661_100048239 | |||
| 1184 | Ga0070661_100117365 | |||
| 1185 | Ga0070661_100146774 | |||
| 1186 | Ga0070692_10006038 | |||
| 1187 | Ga0070668_100009693 | |||
| 1188 | Ga0070668_100104819 | |||
| 1189 | Ga0070669_100001081 | |||
| 1190 | Ga0070669_100009434 | |||
| 1191 | Ga0070669_100610788 | |||
| 1192 | Ga0070675_100009824 | |||
| 1193 | Ga0070675_100084251 | |||
| 1194 | Ga0070675_100118185 | |||
| 1195 | Ga0070671_100000718 | |||
| 1196 | Ga0070671_100005908 | |||
| 1197 | Ga0070671_100017008 | |||
| 1198 | Ga0070674_100000152 | |||
| 1199 | Ga0070674_100059626 | |||
| 1200 | Ga0070674_100197344 | |||
| 1201 | Ga0070673_100000042 | |||
| 1202 | Ga0070673_100029549 | |||
| 1203 | Ga0070673_100053237 | |||
| 1204 | Ga0070673_100147229 | |||
| 1205 | Ga0070688_100009484 | |||
| 1206 | Ga0070688_100021617 | |||
| 1207 | Ga0070688_100024369 | |||
| 1208 | Ga0070659_100000348 | |||
| 1209 | Ga0070659_100043222 | |||
| 1210 | Ga0070667_100000775 | |||
| 1211 | Ga0070667_100009286 | |||
| 1212 | Ga0070667_100036295 | |||
| 1213 | Ga0070667_100213919 | |||
| 1214 | Ga0070703_10000842 | |||
| 1215 | Ga0070709_10001300 | |||
| 1216 | Ga0070709_10218353 | |||
| 1217 | Ga0070709_10618141 | |||
| 1218 | Ga0070714_100503063 | |||
| 1219 | Ga0070713_100008767 | |||
| 1220 | Ga0070713_100134124 | |||
| 1221 | Ga0070713_100309654 | |||
| 1222 | Ga0070713_100725904 | |||
| 1223 | Ga0070710_10107906 | |||
| 1224 | Ga0070710_10271487 | |||
| 1225 | Ga0070710_10365314 | |||
| 1226 | Ga0070701_10000042 | |||
| 1227 | Ga0070701_10012698 | |||
| 1228 | Ga0070701_10375582 | |||
| 1229 | Ga0070711_100060988 | |||
| 1230 | Ga0070711_100206865 | |||
| 1231 | Ga0070705_100004068 | |||
| 1232 | Ga0070705_100035155 | |||
| 1233 | Ga0070705_100171146 | |||
| 1234 | Ga0070705_100402711 | |||
| 1235 | Ga0070700_100001033 | |||
| 1236 | Ga0070700_100014365 | |||
| 1237 | Ga0070694_100010969 | |||
| 1238 | Ga0070694_100040785 | |||
| 1239 | Ga0070708_100277788 | |||
| 1240 | Ga0070663_100000301 | |||
| 1241 | Ga0070663_100004327 | |||
| 1242 | Ga0070678_100003715 | |||
| 1243 | Ga0070678_100008818 | |||
| 1244 | Ga0070678_100224918 | |||
| 1245 | Ga0070662_100008262 | |||
| 1246 | Ga0070662_100142225 | |||
| 1247 | Ga0070662_100152940 | |||
| 1248 | Ga0070662_100308806 | |||
| 1249 | Ga0070681_10017746 | |||
| 1250 | Ga0070681_10060503 | |||
| 1251 | Ga0070681_10303919 | |||
| 1252 | Ga0070681_10397229 | |||
| 1253 | Ga0070681_10412927 | |||
| 1254 | Ga0068867_100013330 | |||
| 1255 | Ga0068867_100195914 | |||
| 1256 | Ga0068867_100539515 | |||
| 1257 | Ga0070685_10009477 | |||
| 1258 | Ga0070685_10109392 | |||
| 1259 | Ga0070706_100713122 | |||
| 1260 | Ga0070707_100167400 | |||
| 1261 | Ga0074259_11284140 | |||
| 1262 | Ga0070679_100080878 | |||
| 1263 | Ga0070679_100103023 | |||
| 1264 | Ga0070679_100222059 | |||
| 1265 | Ga0070679_100637315 | |||
| 1266 | Ga0070679_100695431 | |||
| 1267 | Ga0070684_100003011 | |||
| 1268 | Ga0070684_100059646 | |||
| 1269 | Ga0070684_100338020 | |||
| 1270 | Ga0070697_100000842 | |||
| 1271 | Ga0070697_100043536 | |||
| 1272 | Ga0070697_100383813 | |||
| 1273 | Ga0068853_100001269 | |||
| 1274 | Ga0068853_100057813 | |||
| 1275 | Ga0068853_100437203 | |||
| 1276 | Ga0070672_100000011 | |||
| 1277 | Ga0070672_100077533 | |||
| 1278 | Ga0070686_100000889 | |||
| 1279 | Ga0070686_100049720 | |||
| 1280 | Ga0070686_100072996 | |||
| 1281 | Ga0070686_100370083 | |||
| 1282 | Ga0070686_100489992 | |||
| 1283 | Ga0070695_100000088 | |||
| 1284 | Ga0070695_100019733 | |||
| 1285 | Ga0070695_100051983 | |||
| 1286 | Ga0070695_100350010 | |||
| 1287 | Ga0070696_100003446 | |||
| 1288 | Ga0070696_100036825 | |||
| 1289 | Ga0070696_100040114 | |||
| 1290 | Ga0070696_100137583 | |||
| 1291 | Ga0070693_100000273 | |||
| 1292 | Ga0070693_100175206 | |||
| 1293 | Ga0070665_100849634 | |||
| 1294 | Ga0070704_100000809 | |||
| 1295 | Ga0068855_100003933 | |||
| 1296 | Ga0068855_100019728 | |||
| 1297 | Ga0068855_100044053 | |||
| 1298 | Ga0068855_100490984 | |||
| 1299 | Ga0070664_100000263 | |||
| 1300 | Ga0068857_100002138 | |||
| 1301 | Ga0068854_100001243 | |||
| 1302 | Ga0068854_100068458 | |||
| 1303 | Ga0068854_100189162 | |||
| 1304 | Ga0068854_100261846 | |||
| 1305 | Ga0068856_100000803 | |||
| 1306 | Ga0068856_100091579 | |||
| 1307 | Ga0068856_100601258 | |||
| 1308 | Ga0068856_100655819 | |||
| 1309 | Ga0070702_100000131 | |||
| 1310 | Ga0070702_100326021 | |||
| 1311 | Ga0068852_100001912 | |||
| 1312 | Ga0068852_100067472 | |||
| 1313 | Ga0068852_100113124 | |||
| 1314 | Ga0068852_101028762 | |||
| 1315 | Ga0068859_100004279 | |||
| 1316 | Ga0068859_100011885 | |||
| 1317 | Ga0068864_100000112 | |||
| 1318 | Ga0068864_100077589 | |||
| 1319 | Ga0068864_100591741 | |||
| 1320 | Ga0068864_100774973 | |||
| 1321 | Ga0068866_10000300 | |||
| 1322 | Ga0068866_10132080 | |||
| 1323 | Ga0068866_10216397 | |||
| 1324 | Ga0068866_10352975 | |||
| 1325 | Ga0068861_100004433 | |||
| 1326 | Ga0068861_100034013 | |||
| 1327 | Ga0068861_100134220 | |||
| 1328 | Ga0068870_10000021 | |||
| 1329 | Ga0068863_100000491 | |||
| 1330 | Ga0068858_100000419 | |||
| 1331 | Ga0068858_100032586 | |||
| 1332 | Ga0068858_100055067 | |||
| 1333 | Ga0068860_100001036 | |||
| 1334 | Ga0068860_100080488 | |||
| 1335 | Ga0068860_100173883 | |||
| 1336 | Ga0068862_100002612 | |||
| 1337 | Ga0068862_100008885 | |||
| 1338 | Ga0081455_10000153 | |||
| 1339 | Ga0081540_1008782 | |||
| 1340 | Ga0070717_10000489 | |||
| 1341 | Ga0070717_10082514 | |||
| 1342 | Ga0070717_10173587 | |||
| 1343 | Ga0070717_10528913 | |||
| 1344 | Ga0075365_10084008 | |||
| 1345 | Ga0075365_10198539 | |||
| 1346 | Ga0075365_10483059 | |||
| 1347 | Ga0075368_10009150 | |||
| 1348 | Ga0075368_10035823 | |||
| 1349 | Ga0075368_10092399 | |||
| 1350 | Ga0075363_100020442 | |||
| 1351 | Ga0075363_100062795 | |||
| 1352 | Ga0075363_100248258 | |||
| 1353 | Ga0075364_10044114 | |||
| 1354 | Ga0075364_10079403 | |||
| 1355 | Ga0075364_10467518 | |||
| 1356 | Ga0070715_10210005 | |||
| 1357 | Ga0070716_100005054 | |||
| 1358 | Ga0070716_100114189 | |||
| 1359 | Ga0070716_100484676 | |||
| 1360 | Ga0070712_100007472 | |||
| 1361 | Ga0070712_100031589 | |||
| 1362 | Ga0070712_100105746 | |||
| 1363 | Ga0070712_100251324 | |||
| 1364 | Ga0075362_10007566 | |||
| 1365 | Ga0075362_10038049 | |||
| 1366 | Ga0075367_10016120 | |||
| 1367 | Ga0075367_10084258 | |||
| 1368 | Ga0075367_10094496 | |||
| 1369 | Ga0075367_10101366 | |||
| 1370 | Ga0075367_10176802 | |||
| 1371 | Ga0075427_10001653 | |||
| 1372 | Ga0075366_10122066 | |||
| 1373 | Ga0097621_100000115 | |||
| 1374 | Ga0097621_100036012 | |||
| 1375 | Ga0097621_100126539 | |||
| 1376 | Ga0097621_101219761 | |||
| 1377 | Ga0075370_10067781 | |||
| 1378 | Ga0075370_10099123 | |||
| 1379 | Ga0075370_10305564 | |||
| 1380 | Ga0068871_100000498 | |||
| 1381 | Ga0068871_100002187 | |||
| 1382 | Ga0068871_100020585 | |||
| 1383 | Ga0068871_101069032 | |||
| 1384 | Ga0075428_100000363 | |||
| 1385 | Ga0075430_100000717 | |||
| 1386 | Ga0075431_100000990 | |||
| 1387 | Ga0075433_10000187 | |||
| 1388 | Ga0075433_10004386 | |||
| 1389 | Ga0075433_10085234 | |||
| 1390 | Ga0075433_10198210 | |||
| 1391 | Ga0075434_100002790 | |||
| 1392 | Ga0075434_100026793 | |||
| 1393 | Ga0075434_100473895 | |||
| 1394 | Ga0075429_100000846 | |||
| 1395 | Ga0068865_100000978 | |||
| 1396 | Ga0068865_100014929 | |||
| 1397 | Ga0068865_100251174 | |||
| 1398 | Ga0075436_100007352 | |||
| 1399 | Ga0075436_100359877 | |||
| 1400 | Ga0097620_100004280 | |||
| 1401 | Ga0097620_100011886 | |||
| 1402 | Ga0075435_100005765 | |||
| 1403 | Ga0075435_100045776 | |||
| 1404 | Ga0075435_100064842 | |||
| 1405 | Ga0075435_100121929 | |||
| 1406 | Ga0075435_100233276 | |||
| 1407 | Ga0075435_100730676 | |||
| 1408 | Ga0099795_10064277 | |||
| 1409 | Ga0105251_10016489 | |||
| 1410 | Ga0105251_10041976 | |||
| 1411 | Ga0105244_10082458 | |||
| 1412 | Ga0105250_10014064 | |||
| 1413 | Ga0105240_10134473 | |||
| 1414 | Ga0105240_10179296 | |||
| 1415 | Ga0105240_10733264 | |||
| 1416 | Ga0111539_10000196 | |||
| 1417 | Ga0111539_10000376 | |||
| 1418 | Ga0111539_10003800 | |||
| 1419 | Ga0111539_10143834 | |||
| 1420 | Ga0111539_10472322 | |||
| 1421 | Ga0105245_10001838 | |||
| 1422 | Ga0105245_10006498 | |||
| 1423 | Ga0105245_10016640 | |||
| 1424 | Ga0105245_10079716 | |||
| 1425 | Ga0105245_11140041 | |||
| 1426 | Ga0105247_10000844 | |||
| 1427 | Ga0105247_10002518 | |||
| 1428 | Ga0105247_10093881 | |||
| 1429 | Ga0105247_10097375 | |||
| 1430 | Ga0114129_10002010 | |||
| 1431 | Ga0114129_10241321 | |||
| 1432 | Ga0114129_10480924 | |||
| 1433 | Ga0105243_10006208 | |||
| 1434 | Ga0105243_10009505 | |||
| 1435 | Ga0105243_10014565 | |||
| 1436 | Ga0105243_10057964 | |||
| 1437 | Ga0105241_10002564 | |||
| 1438 | Ga0105241_10025770 | |||
| 1439 | Ga0105242_10002293 | |||
| 1440 | Ga0105242_10022560 | |||
| 1441 | Ga0105242_10038425 | |||
| 1442 | Ga0105248_10000500 | |||
| 1443 | Ga0105248_10004770 | |||
| 1444 | Ga0105248_10042372 | |||
| 1445 | Ga0105248_10085829 | |||
| 1446 | Ga0105248_10200414 | |||
| 1447 | Ga0105237_10008730 | |||
| 1448 | Ga0105237_10048166 | |||
| 1449 | Ga0105237_10069141 | |||
| 1450 | Ga0105237_10141717 | |||
| 1451 | Ga0105238_10033617 | |||
| 1452 | Ga0105238_10044749 | |||
| 1453 | Ga0105238_10044976 | |||
| 1454 | Ga0105238_10059560 | |||
| 1455 | Ga0105238_10164644 | |||
| 1456 | Ga0105238_10427704 | |||
| 1457 | Ga0105249_10001469 | |||
| 1458 | Ga0105249_10030586 | |||
| 1459 | Ga0105249_10106073 | |||
| 1460 | Ga0105239_10042105 | |||
| 1461 | Ga0105239_10086621 | |||
| 1462 | Ga0105239_10197881 | |||
| 1463 | Ga0105239_10613774 | |||
| 1464 | Ga0105239_10701616 | |||
| 1465 | Ga0105239_11679067 | |||
| 1466 | Ga0105246_10000033 | |||
| 1467 | Ga0105246_10021948 | |||
| 1468 | Ga0105246_10064937 | |||
| 1469 | Ga0105246_10603112 | |||
| 1470 | Ga0157343_1002860 | |||
| 1471 | Ga0157341_1006572 | |||
| 1472 | Ga0157342_1002420 | |||
| 1473 | Ga0157326_1003431 | |||
| 1474 | Ga0157338_1002670 | |||
| 1475 | Ga0157338_1005608 | |||
| 1476 | Ga0157373_10135546 | |||
| 1477 | Ga0157371_10032991 | |||
| 1478 | Ga0157371_10091631 | |||
| 1479 | Ga0157371_10186041 | |||
| 1480 | Ga0157371_10550999 | |||
| 1481 | Ga0157370_10074523 | |||
| 1482 | Ga0157370_10261911 | |||
| 1483 | Ga0157369_10320562 | |||
| 1484 | Ga0157369_11079085 | |||
| 1485 | Ga0157369_11198389 | |||
| 1486 | Ga0157374_10000092 | |||
| 1487 | Ga0157378_10055006 | |||
| 1488 | Ga0157378_10965564 | |||
| 1489 | Ga0163162_10004452 | |||
| 1490 | Ga0163162_10014395 | |||
| 1491 | Ga0163162_10072042 | |||
| 1492 | Ga0157372_10005853 | |||
| 1493 | Ga0157372_10168116 | |||
| 1494 | Ga0157372_11087296 | |||
| 1495 | Ga0157375_10000124 | |||
| 1496 | Ga0157375_10058863 | |||
| 1497 | Ga0157375_10990574 | |||
| 1498 | Ga0163163_10012287 | |||
| 1499 | Ga0163163_10264303 | |||
| 1500 | Ga0163163_10892036 | |||
| 1501 | Ga0157380_10005052 | |||
| 1502 | Ga0157377_10000117 | |||
| 1503 | Ga0157379_10001950 | |||
| 1504 | Ga0157379_10015688 | |||
| 1505 | Ga0157379_10129455 | |||
| 1506 | Ga0157376_10000034 | |||
| 1507 | Ga0163161_10000448 | |||
| 1508 | Ga0163161_10159459 | |||
| 1509 | Ga0206356_11418804 | |||
| 1510 | Ga0206353_11397207 | |||
| 1511 | Ga0228598_1000969 | |||
| 1512 | Ga0207666_1000017 | |||
| 1513 | Ga0207666_1005711 | |||
| 1514 | Ga0207673_1000126 | |||
| 1515 | Ga0207697_10000009 | |||
| 1516 | Ga0207697_10004737 | |||
| 1517 | Ga0207653_10004111 | |||
| 1518 | Ga0207653_10031345 | |||
| 1519 | Ga0207682_10000016 | |||
| 1520 | Ga0207692_10000310 | |||
| 1521 | Ga0207692_10153055 | |||
| 1522 | Ga0207692_10221782 | |||
| 1523 | Ga0207642_10000097 | |||
| 1524 | Ga0207642_10160538 | |||
| 1525 | Ga0207710_10001326 | |||
| 1526 | Ga0207710_10076117 | |||
| 1527 | Ga0207688_10000012 | |||
| 1528 | Ga0207688_10011852 | |||
| 1529 | Ga0207688_10087395 | |||
| 1530 | Ga0207680_10014461 | |||
| 1531 | Ga0207680_10136129 | |||
| 1532 | Ga0207680_10550498 | |||
| 1533 | Ga0207647_10000675 | |||
| 1534 | Ga0207647_10037972 | |||
| 1535 | Ga0207647_10272082 | |||
| 1536 | Ga0207699_10000471 | |||
| 1537 | Ga0207699_10203018 | |||
| 1538 | Ga0207645_10000124 | |||
| 1539 | Ga0207645_10017212 | |||
| 1540 | Ga0207643_10000075 | |||
| 1541 | Ga0207705_10054831 | |||
| 1542 | Ga0207705_10110648 | |||
| 1543 | Ga0207654_10001202 | |||
| 1544 | Ga0207654_10007738 | |||
| 1545 | Ga0207654_10063142 | |||
| 1546 | Ga0207654_10219197 | |||
| 1547 | Ga0207707_10017942 | |||
| 1548 | Ga0207707_10152349 | |||
| 1549 | Ga0207707_10384701 | |||
| 1550 | Ga0207707_10518322 | |||
| 1551 | Ga0207707_10574292 | |||
| 1552 | Ga0207695_10048617 | |||
| 1553 | Ga0207695_10123825 | |||
| 1554 | Ga0207671_10008594 | |||
| 1555 | Ga0207671_10035231 | |||
| 1556 | Ga0207671_10204142 | |||
| 1557 | Ga0207693_10003324 | |||
| 1558 | Ga0207693_10004737 | |||
| 1559 | Ga0207693_10010263 | |||
| 1560 | Ga0207693_10021842 | |||
| 1561 | Ga0207693_10040963 | |||
| 1562 | Ga0207693_10124954 | |||
| 1563 | Ga0207693_10278041 | |||
| 1564 | Ga0207663_10066051 | |||
| 1565 | Ga0207663_10077737 | |||
| 1566 | Ga0207663_10179644 | |||
| 1567 | Ga0207663_10198854 | |||
| 1568 | Ga0207660_10000489 | |||
| 1569 | Ga0207660_10035183 | |||
| 1570 | Ga0207660_10073606 | |||
| 1571 | Ga0207660_10140859 | |||
| 1572 | Ga0207660_10762473 | |||
| 1573 | Ga0207662_10001610 | |||
| 1574 | Ga0207662_10006081 | |||
| 1575 | Ga0207662_10057105 | |||
| 1576 | Ga0207662_10579180 | |||
| 1577 | Ga0207657_10000162 | |||
| 1578 | Ga0207657_10017061 | |||
| 1579 | Ga0207657_10020743 | |||
| 1580 | Ga0207657_10125457 | |||
| 1581 | Ga0207657_10141255 | |||
| 1582 | Ga0207649_10000411 | |||
| 1583 | Ga0207649_10030727 | |||
| 1584 | Ga0207649_10109678 | |||
| 1585 | Ga0207649_10167420 | |||
| 1586 | Ga0207649_10516412 | |||
| 1587 | Ga0207652_10001140 | |||
| 1588 | Ga0207652_10074697 | |||
| 1589 | Ga0207652_10253929 | |||
| 1590 | Ga0207652_10307336 | |||
| 1591 | Ga0207681_10000240 | |||
| 1592 | Ga0207681_10026130 | |||
| 1593 | Ga0207694_10073933 | |||
| 1594 | Ga0207694_10358316 | |||
| 1595 | Ga0207694_10608225 | |||
| 1596 | Ga0207650_10001431 | |||
| 1597 | Ga0207659_10000017 | |||
| 1598 | Ga0207659_10083765 | |||
| 1599 | Ga0207687_10000417 | |||
| 1600 | Ga0207687_10004146 | |||
| 1601 | Ga0207687_10114298 | |||
| 1602 | Ga0207687_10464209 | |||
| 1603 | Ga0207700_10001311 | |||
| 1604 | Ga0207700_10035316 | |||
| 1605 | Ga0207700_10111760 | |||
| 1606 | Ga0207700_10224766 | |||
| 1607 | Ga0207664_10154464 | |||
| 1608 | Ga0207664_10289103 | |||
| 1609 | Ga0207644_10001407 | |||
| 1610 | Ga0207644_10001531 | |||
| 1611 | Ga0207690_10000151 | |||
| 1612 | Ga0207706_10000368 | |||
| 1613 | Ga0207706_10002253 | |||
| 1614 | Ga0207706_10015959 | |||
| 1615 | Ga0207706_10053322 | |||
| 1616 | Ga0207706_10080678 | |||
| 1617 | Ga0207686_10021340 | |||
| 1618 | Ga0207709_10000256 | |||
| 1619 | Ga0207709_10022259 | |||
| 1620 | Ga0207709_10384996 | |||
| 1621 | Ga0207670_10000086 | |||
| 1622 | Ga0207670_10005957 | |||
| 1623 | Ga0207670_10043022 | |||
| 1624 | Ga0207670_10068068 | |||
| 1625 | Ga0207669_10000423 | |||
| 1626 | Ga0207669_10058911 | |||
| 1627 | Ga0207704_10000139 | |||
| 1628 | Ga0207665_10000330 | |||
| 1629 | Ga0207665_10122123 | |||
| 1630 | Ga0207665_10177699 | |||
| 1631 | Ga0207691_10000303 | |||
| 1632 | Ga0207691_10043840 | |||
| 1633 | Ga0207691_10064509 | |||
| 1634 | Ga0207691_10067755 | |||
| 1635 | Ga0207711_10005029 | |||
| 1636 | Ga0207711_10044071 | |||
| 1637 | Ga0207711_10557180 | |||
| 1638 | Ga0207689_10000109 | |||
| 1639 | Ga0207689_10019901 | |||
| 1640 | Ga0207661_10000074 | |||
| 1641 | Ga0207661_10234227 | |||
| 1642 | Ga0207679_10000031 | |||
| 1643 | Ga0207679_10021114 | |||
| 1644 | Ga0207667_10013372 | |||
| 1645 | Ga0207667_10042411 | |||
| 1646 | Ga0207667_10239868 | |||
| 1647 | Ga0207667_10880201 | |||
| 1648 | Ga0207651_10000044 | |||
| 1649 | Ga0207651_10160231 | |||
| 1650 | Ga0207651_10209166 | |||
| 1651 | Ga0207651_10232182 | |||
| 1652 | Ga0207712_10000279 | |||
| 1653 | Ga0207712_10031340 | |||
| 1654 | Ga0207668_10000345 | |||
| 1655 | Ga0207668_10106714 | |||
| 1656 | Ga0207640_10006780 | |||
| 1657 | Ga0207640_10316784 | |||
| 1658 | Ga0207658_10005668 | |||
| 1659 | Ga0207658_10064861 | |||
| 1660 | Ga0207658_10185927 | |||
| 1661 | Ga0207677_10000318 | |||
| 1662 | Ga0207677_10096674 | |||
| 1663 | Ga0207703_10001459 | |||
| 1664 | Ga0207703_10065807 | |||
| 1665 | Ga0207703_10838199 | |||
| 1666 | Ga0207639_10000693 | |||
| 1667 | Ga0207639_10056656 | |||
| 1668 | Ga0207678_10000158 | |||
| 1669 | Ga0207678_10012404 | |||
| 1670 | Ga0207678_10018793 | |||
| 1671 | Ga0207678_10078154 | |||
| 1672 | Ga0207678_10458465 | |||
| 1673 | Ga0207708_10000098 | |||
| 1674 | Ga0207708_10001262 | |||
| 1675 | Ga0207702_10000835 | |||
| 1676 | Ga0207702_10201126 | |||
| 1677 | Ga0207702_10762576 | |||
| 1678 | Ga0207641_10000408 | |||
| 1679 | Ga0207641_10109301 | |||
| 1680 | Ga0207641_10555422 | |||
| 1681 | Ga0207641_10742855 | |||
| 1682 | Ga0207648_10000696 | |||
| 1683 | Ga0207648_10150924 | |||
| 1684 | Ga0207648_10212042 | |||
| 1685 | Ga0207676_10000133 | |||
| 1686 | Ga0207676_10794029 | |||
| 1687 | Ga0207674_10000420 | |||
| 1688 | Ga0207675_100001505 | |||
| 1689 | Ga0207675_100011221 | |||
| 1690 | Ga0207675_100108270 | |||
| 1691 | Ga0207683_10000004 | |||
| 1692 | Ga0207683_10003260 | |||
| 1693 | Ga0207683_10155593 | |||
| 1694 | Ga0207698_10001253 | |||
| 1695 | Ga0207698_10104274 | |||
| 1696 | Ga0209179_1007189 | |||
| 1697 | Ga0210002_1029466 | |||
| 1698 | Ga0209971_1010785 | |||
| 1699 | Ga0209971_1030214 | |||
| 1700 | Ga0209966_1000495 | |||
| 1701 | Ga0209998_10003496 | |||
| 1702 | Ga0209998_10006820 | |||
| 1703 | Ga0209813_10015509 | |||
| 1704 | Ga0209813_10027138 | |||
| 1705 | Ga0209813_10036383 | |||
| 1706 | Ga0209813_10053904 | |||
| 1707 | Ga0209974_10001709 | |||
| 1708 | Ga0209974_10041401 | |||
| 1709 | Ga0209974_10082143 | |||
| 1710 | Ga0207428_10000218 | |||
| 1711 | Ga0207428_10000250 | |||
| 1712 | Ga0268266_10126666 | |||
| 1713 | Ga0268266_10168682 | |||
| 1714 | Ga0268266_10497274 | |||
| 1715 | Ga0268265_10000752 | |||
| 1716 | Ga0268265_10038150 | |||
| 1717 | Ga0268264_10003892 | |||
| 1718 | Ga0268264_10088498 | |||
| 1719 | Ga0268264_10124325 | |||
| 1720 | Ga0265318_10025387 | |||
| 1721 | Ga0265336_10073931 | |||
| 1722 | Ga0265338_10135833 | |||
| 1723 | Ga0265338_10212036 | |||
| 1724 | Ga0265338_10342383 | |||
| 1725 | Ga0265330_10041814 | |||
| 1726 | Ga0265325_10000039 | |||
| 1727 | Ga0265325_10002499 | |||
| 1728 | Ga0265325_10003850 | |||
| 1729 | Ga0265325_10018367 | |||
| 1730 | Ga0265340_10118966 | |||
| 1731 | Ga0265339_10005148 | |||
| 1732 | Ga0265339_10095646 | |||
| 1733 | Ga0265316_10063336 | |||
| 1734 | Ga0265316_10096941 | |||
| 1735 | Ga0265316_10138819 | |||
| 1736 | Ga0265313_10002016 | |||
| 1737 | Ga0265313_10021637 | |||
| 1738 | Ga0265313_10070796 | |||
| 1739 | Ga0265342_10011239 | |||
| 1740 | Ga0265342_10021361 | |||
| 1741 | Ga0265342_10029333 | |||
| 1742 | Ga0373930_0000117 | |||
| 1743 | Ga0373930_0025651 | |||
| 1744 | Ga0373948_0000584 | |||
| 1745 | Ga0373948_0006817 | |||
| 1746 | Ga0373950_0000126 | |||
| 1747 | Ga0373958_0002830 | |||
| 1748 | Ga0373958_0005324 | |||
| 1749 | Ga0373938_0000052 | |||
| 1750 | Ga0373926_0010334 | |||
| 1751 | Ga0373928_0000217 | |||
| 1752 | Ga0373929_0000370 | |||
| 1753 | Ga0373934_0019849 | |||
| 1754 | Ga0373934_0179651 | |||
| 1755 | Ga0373940_0000132 | |||
| 1756 | Ga0373940_0008405 | |||
| 1757 | Ga0373944_0011156 | |||
| 1758 | Ga0373949_0003535 | |||
| 1759 | Ga0373951_0000378 | |||
| 1760 | Ga0373951_0007297 | |||
| 1761 | Ga0373952_0000048 | |||
| 1762 | Ga0373952_0002317 | |||
| 1763 | Ga0373952_0035487 | |||
| 1764 | Ga0373952_0051761 | |||
| 1765 | Ga0373923_0038581 | |||
| 1766 | Ga0373932_0000094 | |||
| 1767 | Ga0373936_0068812 | |||
| 1768 | Ga0373936_0079795 | |||
| 1769 | Ga0373936_0109211 | |||
| 1770 | Ga0373936_0255070 | |||
| 1771 | Ga0373939_0000345 | |||
| 1772 | Ga0373939_0014164 | |||
| 1773 | Ga0373941_0000890 | |||
| 1774 | Ga0373941_0007367 | |||
| 1775 | Ga0373945_0019298 | |||
| 1776 | Ga0373953_0001519 | |||
| 1777 | Ga0373953_0012165 | |||
| 1778 | Ga0373954_0013676 | |||
| 1779 | Ga0373954_0026627 | |||
| 1780 | Ga0373954_0053670 | |||
| 1781 | Ga0373954_0069289 | |||
| 1782 | Ga0373956_0012857 | |||
| 1783 | Ga0373956_0063681 | |||
| 1784 | Ga0373957_0007335 | |||
| 1785 | Ga0373957_0032589 | |||
| 1786 | Ga0373957_0132586 | |||
| 1787 | Ga0373957_0139113 | |||
| 1788 | Ga0373960_0000760 | |||
| 1789 | Ga0373960_0002160 | |||
| 1790 | Ga0373943_0012555 | |||
| 1791 | Ga0373943_0053351 | |||
| 1792 | Ga0373943_0059638 | |||
| 1793 | Ga0373943_0193211 | |||
| 1794 | Ga0373943_0195312 | |||
| 1795 | Ga0373943_0237462 | |||
| 1796 | Ga0373946_0012866 | |||
| 1797 | Ga0373955_0000848 | |||
| 1798 | Ga0373955_0002018 | |||
| 1799 | Ga0373955_0002468 | |||
| 1800 | Ga0373955_0022836 | |||
| 1801 | Ga0373955_0037242 | |||
| 1802 | Ga0373955_0348984 | |||
| 1803 | Ga0373942_0001114 | |||
| 1804 | Ga0373942_0019511 | |||
| 1805 | Ga0373942_0178472 | |||
| 1806 | Ga0373961_0003766 | |||
| 1807 | Ga0373961_0016311 | |||
| 1808 | Ga0373962_0000137 | |||
| 1809 | Ga0373962_0010224 | |||
| 1810 | Ga0373924_0002913 | |||
| 1811 | Ga0373924_0008057 | |||
| 1812 | Ga0373931_0000034 | |||
| 1813 | Ga0373931_0006073 | |||
| 1814 | Ga0373931_0051263 | |||
| 1815 | Ga0373931_0106833 | |||
| 1816 | Ga0373935_0008682 | |||
| 1817 | Ga0373935_0014967 | |||
| 1818 | Ga0373935_0172448 | |||
| 1819 | Ga0373935_0236094 | |||
| 1820 | Ga0373935_0309937 | |||
| 1821 | Ga0373927_0000518 | |||
| 1822 | Ga0373927_0023682 | |||
| 1823 | Ga0373927_0164926 | |||
| 1824 | Ga0373927_0169537 | |||
| 1825 | Ga0373927_0346741 | |||
| 1826 | Ga0373933_0003681 | |||
| 1827 | Ga0373933_0006901 | |||
| 1828 | Ga0373947_0000606 | |||
| 1829 | Ga0373947_0031697 | |||
| 1830 | Ga0373937_0002639 | |||
| 1831 | Ga0373937_0019623 | |||
| 1832 | Ga0373937_0060477 | |||
| 1833 | Ga0373937_0089875 | |||
| 1834 | Ga0373937_0112968 | |||
| 1835 | Ga0373937_0180069 | |||
| 1836 | Ga0373937_0504975 | |||
| 1837 | Ga0373937_0681645 | |||
| 1838 | Ga0373925_0019706 | |||
| 1839 | Ga0373925_0044441 | |||
| 1840 | Ga0373925_0165024 | |||
| 1841 | Ga0373925_0204147 | |||
| 1842 | Ga0373925_0426251 | |||
| 1843 | Ga0395900_0013393 | |||
| 1844 | Ga0395898_0294195 | |||
| 1845 | Ga0395898_0316277 | |||
| 1846 | Ga0395901_0059834 | |||
| 1847 | Ga0242420_000894 | |||
| 1848 | Ga0436365_0725518 | |||
| 1849 | Ga0436365_1202710 | |||
| 1850 | Ga0439453_0005812 | |||
| 1851 | Ga0439463_037591 | |||
| 1852 | Ga0439460_0023172 | |||
| 1853 | Ga0450893_0032341 | |||
| 1854 | Ga0451577_0530788 | |||
| 1855 | Ga0453684_0083691 | |||
| 1856 | Ga0466971_0161189 | |||
| 1857 | Ga0495617_060354 | |||
| 1858 | Ga0495592_0006010 | |||
| 1859 | Ga0495592_0044080 | |||
| 1860 | Ga0495592_0051338 | |||
| 1861 | Ga0495603_0056384 | |||
| 1862 | Ga0495603_0067844 | |||
| 1863 | Ga0495591_035974 | |||
| 1864 | Ga0495629_0005522 | |||
| 1865 | Ga0495629_0015898 | |||
| 1866 | Ga0495629_0057586 | |||
| 1867 | Ga0495629_0078241 | |||
| 1868 | Ga0495629_0086732 | |||
| 1869 | Ga0495629_0176118 | |||
| 1870 | Ga0495641_0010400 | |||
| 1871 | Ga0495641_0038589 | |||
| 1872 | Ga0495651_0000953 | |||
| 1873 | Ga0495651_0006662 | |||
| 1874 | Ga0495651_0106700 | |||
| 1875 | Ga0495651_0134921 | |||
| 1876 | Ga0495653_0001996 | |||
| 1877 | Ga0495653_0007423 | |||
| 1878 | Ga0495653_0055817 | |||
| 1879 | Ga0495653_0071132 | |||
| 1880 | Ga0495580_0098533 | |||
| 1881 | Ga0495580_0113272 | |||
| 1882 | Ga0495580_0278454 | |||
| 1883 | Ga0495582_0007172 | |||
| 1884 | Ga0495582_0015476 | |||
| 1885 | Ga0495582_0067342 | |||
| 1886 | Ga0495582_0214357 | |||
| 1887 | Ga0495639_0064239 | |||
| 1888 | Ga0495639_0081179 | |||
| 1889 | Ga0495662_0030423 | |||
| 1890 | Ga0495662_0032044 | |||
| 1891 | Ga0495664_0000976 | |||
| 1892 | Ga0495664_0006476 | |||
| 1893 | Ga0495664_0023101 | |||
| 1894 | Ga0495664_0127974 | |||
| 1895 | Ga0495664_0164433 | |||
| 1896 | Ga0495584_0053537 | |||
| 1897 | Ga0495585_0001710 | |||
| 1898 | Ga0495594_0003748 | |||
| 1899 | Ga0495594_0036053 | |||
| 1900 | Ga0495594_0273832 | |||
| 1901 | Ga0495607_0001556 | |||
| 1902 | Ga0495608_0003982 | |||
| 1903 | Ga0495608_0017623 | |||
| 1904 | Ga0495608_0038614 | |||
| 1905 | Ga0495618_0004731 | |||
| 1906 | Ga0495618_0022404 | |||
| 1907 | Ga0495618_0043310 | |||
| 1908 | Ga0495618_0240630 | |||
| 1909 | Ga0495628_0013061 | |||
| 1910 | Ga0495628_0022252 | |||
| 1911 | Ga0495628_0047170 | |||
| 1912 | Ga0495628_0079907 | |||
| 1913 | Ga0495630_0023873 | |||
| 1914 | Ga0495630_0063762 | |||
| 1915 | Ga0495630_0091602 | |||
| 1916 | Ga0495630_0218917 | |||
| 1917 | Ga0495644_0007809 | |||
| 1918 | Ga0495666_0036237 | |||
| 1919 | Ga0495666_0074186 | |||
| 1920 | Ga0495652_0007587 | |||
| 1921 | Ga0495652_0039727 | |||
| 1922 | Ga0495652_0046128 | |||
| 1923 | Ga0495652_0048465 | |||
| 1924 | Ga0495652_0050450 | |||
| 1925 | Ga0495652_0238850 | |||
| 1926 | Ga0495665_0005230 | |||
| 1927 | Ga0495665_0015212 | |||
| 1928 | Ga0495665_0029221 | |||
| 1929 | Ga0495640_0000406 | |||
| 1930 | Ga0495640_0006464 | |||
| 1931 | Ga0495640_0007428 | |||
| 1932 | Ga0495586_0179796 | |||
| 1933 | Ga0495587_0000784 | |||
| 1934 | Ga0495587_0021777 | |||
| 1935 | Ga0495587_0042701 | |||
| 1936 | Ga0495587_0140122 | |||
| 1937 | Ga0495645_0000656 | |||
| 1938 | Ga0495645_0026011 | |||
| 1939 | Ga0495645_0295504 | |||
| 1940 | Ga0495622_0003340 | |||
| 1941 | Ga0495633_0001919 | |||
| 1942 | Ga0495667_0001270 | |||
| 1943 | Ga0495667_0012253 | |||
| 1944 | Ga0495667_0025707 | |||
| 1945 | Ga0495667_0028685 | |||
| 1946 | Ga0495667_0074298 | |||
| 1947 | Ga0495656_0000503 | |||
| 1948 | Ga0495634_0008180 | |||
| 1949 | Ga0495634_0021259 | |||
| 1950 | Ga0495634_0022715 | |||
| 1951 | Ga0495635_0001701 | |||
| 1952 | Ga0495635_0003774 | |||
| 1953 | Ga0495635_0007304 | |||
| 1954 | Ga0495635_0027249 | |||
| 1955 | Ga0495635_0032148 | |||
| 1956 | Ga0495635_0092813 | |||
| 1957 | Ga0495635_0101464 | |||
| 1958 | Ga0495635_0195139 | |||
| 1959 | Ga0495659_0156620 | |||
| 1960 | Ga0495661_0023514 | |||
| 1961 | Ga0495588_0029047 | |||
| 1962 | Ga0495657_0000582 | |||
| 1963 | Ga0495657_0027053 | |||
| 1964 | Ga0495599_0000980 | |||
| 1965 | Ga0495599_0013722 | |||
| 1966 | Ga0495599_0056893 | |||
| 1967 | Ga0495623_0000585 | |||
| 1968 | Ga0495623_0046809 | |||
| 1969 | Ga0495623_0073176 | |||
| 1970 | Ga0495646_0000200 | |||
| 1971 | Ga0495646_0204047 | |||
| 1972 | Ga0495647_0001263 | |||
| 1973 | Ga0495647_0004820 | |||
| 1974 | Ga0495647_0048997 | |||
| 1975 | Ga0495647_0078147 | |||
| 1976 | Ga0495658_0000278 | |||
| 1977 | Ga0495658_0008696 | |||
| 1978 | Ga0495658_0034527 | |||
| 1979 | Ga0495613_0032552 | |||
| 1980 | Ga0495613_0153955 | |||
| 1981 | Ga0495613_0222855 | |||
| 1982 | Ga0495624_0004272 | |||
| 1983 | Ga0495624_0023760 | |||
| 1984 | Ga0495624_0057326 | |||
| 1985 | Ga0495624_0314071 | |||
| 1986 | Ga0495670_0002792 | |||
| 1987 | Ga0495600_0016272 | |||
| 1988 | Ga0495600_0020754 | |||
| 1989 | Ga0495600_0051308 | |||
| 1990 | Ga0495581_0004217 | |||
| 1991 | Ga0495581_0059975 | |||
| 1992 | Ga0495581_0068347 | |||
| 1993 | Ga0495581_0082785 | |||
| 1994 | Ga0495581_0093078 | |||
| 1995 | Ga0495604_0005558 | |||
| 1996 | Ga0495604_0020211 | |||
| 1997 | Ga0495604_0041535 | |||
| 1998 | Ga0495604_0065864 | |||
| 1999 | Ga0495604_0220351 | |||
| 2000 | Ga0495674_0001289 | |||
| 2001 | Ga0495674_0003539 | |||
| 2002 | Ga0495674_0018544 | |||
| 2003 | Ga0495674_0026786 | |||
| 2004 | Ga0495674_0095990 | |||
| 2005 | Ga0495674_0254218 | |||
| 2006 | Ga0495676_0058982 | |||
| 2007 | Ga0495676_0080731 | |||
| 2008 | Ga0495676_0098045 | |||
| 2009 | Ga0495676_0101647 | |||
| 2010 | Ga0495680_0001872 | |||
| 2011 | Ga0495680_0003975 | |||
| 2012 | Ga0495680_0005700 | |||
| 2013 | Ga0495680_0006567 | |||
| 2014 | Ga0495680_0022426 | |||
| 2015 | Ga0495680_0190146 | |||
| 2016 | Ga0495675_0003810 | |||
| 2017 | Ga0495675_0050829 | |||
| 2018 | Ga0495675_0399334 | |||
| 2019 | Ga0495684_0000713 | |||
| 2020 | Ga0495684_0001047 | |||
| 2021 | Ga0495684_0029275 | |||
| 2022 | Ga0495684_0031351 | |||
| 2023 | Ga0495684_0069210 | |||
| 2024 | Ga0495684_0131646 | |||
| 2025 | Ga0495593_0005474 | |||
| 2026 | Ga0495593_0100935 | |||
| 2027 | Ga0495593_0131849 | |||
| 2028 | Ga0495602_0008181 | |||
| 2029 | Ga0495602_0013918 | |||
| 2030 | Ga0495602_0022737 | |||
| 2031 | Ga0495602_0461589 | |||
| 2032 | Ga0495614_0011762 | |||
| 2033 | Ga0496100_0000050 | |||
| 2034 | Ga0496100_0045393 | |||
| 2035 | Ga0496100_0055828 | |||
| 2036 | Ga0496100_0068894 | |||
| 2037 | Ga0496100_0196240 | |||
| 2038 | Ga0496100_0568079 | |||
| 2039 | Ga0496100_0634135 | |||
| 2040 | Ga0496101_0000121 | |||
| 2041 | Ga0496101_0016049 | |||
| 2042 | Ga0496101_0058342 | |||
| 2043 | Ga0496101_0106920 | |||
| 2044 | Ga0496102_0042762 | |||
| 2045 | Ga0496102_0359562 | |||
| 2046 | Ga0496102_0393924 | |||
| 2047 | Ga0496102_0443848 | |||
| 2048 | Ga0496103_0004803 | |||
| 2049 | Ga0496103_0051978 | |||
| 2050 | Ga0496103_0309559 | |||
| 2051 | Ga0496104_0001467 | |||
| 2052 | Ga0496104_0015855 | |||
| 2053 | Ga0496104_0060294 | |||
| 2054 | Ga0496104_0072728 | |||
| 2055 | Ga0496104_0281725 | |||
| 2056 | Ga0496104_0642052 | |||
| 2057 | Ga0496104_0735788 | |||
| 2058 | Ga0496105_0056163 | |||
| 2059 | Ga0496105_0056440 | |||
| 2060 | Ga0496105_0098428 | |||
| 2061 | Ga0496106_0000133 | |||
| 2062 | Ga0496106_0080367 | |||
| 2063 | Ga0496107_0006506 | |||
| 2064 | Ga0496107_0013988 | |||
| 2065 | Ga0496107_0083499 | |||
| 2066 | Ga0496107_0716626 | |||
| 2067 | Ga0496108_0013476 | |||
| 2068 | Ga0496108_0068226 | |||
| 2069 | Ga0496108_0228818 | |||
| 2070 | Ga0496109_0001741 | |||
| 2071 | Ga0496109_0002099 | |||
| 2072 | Ga0496109_0009353 | |||
| 2073 | Ga0496109_0064809 | |||
| 2074 | Ga0496109_0174145 | |||
| 2075 | Ga0496109_0184564 | |||
| 2076 | Ga0496109_0545768 | |||
| 2077 | Ga0496110_0141017 | |||
| 2078 | Ga0496110_0210718 | |||
| 2079 | Ga0496110_0454615 | |||
| 2080 | Ga0496110_0801623 | |||
| 2081 | Ga0496111_0010401 | |||
| 2082 | Ga0496111_0128454 | |||
| 2083 | Ga0496111_0150250 | |||
| 2084 | Ga0496111_0291593 | |||
| 2085 | Ga0496111_0413963 | |||
| 2086 | Ga0496112_0044099 | |||
| 2087 | Ga0496112_0065541 | |||
| 2088 | Ga0496112_0124052 | |||
| 2089 | Ga0496112_0147191 | |||
| 2090 | Ga0496112_0203642 | |||
| 2091 | Ga0496112_0328383 | |||
| 2092 | Ga0496112_0468855 | |||
| 2093 | Ga0496112_0594839 | |||
| 2094 | Ga0496112_0635420 | |||
| 2095 | Ga0496113_0008981 | |||
| 2096 | Ga0496113_0078278 | |||
| 2097 | Ga0496113_0079275 | |||
| 2098 | Ga0496113_0138203 | |||
| 2099 | Ga0496113_0437016 | |||
| 2100 | Ga0496114_0003778 | |||
| 2101 | Ga0496114_0040751 | |||
| 2102 | Ga0496114_0077920 | |||
| 2103 | Ga0496114_0267030 | |||
| 2104 | Ga0496114_0664054 | |||
| 2105 | Ga0496115_0005713 | |||
| 2106 | Ga0496115_0034569 | |||
| 2107 | Ga0496115_0341722 | |||
| 2108 | Ga0496126_0052179 | |||
| 2109 | Ga0501070_0089954 | |||
| 2110 | Ga0501071_0105363 | |||
| 2111 | Ga0501073_0015726 | |||
| 2112 | Ga0501073_0018153 | |||
| 2113 | Ga0501073_0315151 | |||
| 2114 | Ga0501073_0361681 | |||
| 2115 | Ga0501075_0244801 | |||
| 2116 | Ga0501075_0824734 | |||
| 2117 | Ga0501076_0039609 | |||
| 2118 | Ga0501076_0070354 | |||
| 2119 | Ga0501076_0267914 | |||
| 2120 | Ga0501079_0635210 | |||
| 2121 | Ga0501081_0156198 | |||
| 2122 | Ga0501083_0192574 | |||
| 2123 | Ga0501083_0390590 | |||
| 2124 | Ga0501035_0402446 | |||
| 2125 | Ga0501044_0401187 | |||
| 2126 | Ga0501045_0126255 | |||
| 2127 | nmdc:mga03683_112841_c1 | |||
| 2128 | nmdc:mga03683_31760_c1 | |||
| 2129 | nmdc:mga03n38_17324_c1 | |||
| 2130 | nmdc:mga03n38_282230_c1 | |||
| 2131 | nmdc:mga00v17_273275_c1 | |||
| 2132 | nmdc:mga00v17_420723_c1 | |||
| 2133 | nmdc:mga0yw44_18637_c1 | |||
| 2134 | nmdc:mga0yw44_271705_c1 | |||
| 2135 | nmdc:mga0yw44_500149_c1 | |||
| 2136 | nmdc:mga0yw44_500294_c1 | |||
| 2137 | nmdc:mga0k408_220012_c1 | |||
| 2138 | nmdc:mga06z11_115767_c1 | |||
| 2139 | nmdc:mga06z11_20423_c1 | |||
| 2140 | nmdc:mga06z11_332237_c1 | |||
| 2141 | nmdc:mga06z11_399052_c1 | |||
| 2142 | nmdc:mga06z11_72502_c1 | |||
| 2143 | nmdc:mga04h51_17826_c1 | |||
| 2144 | nmdc:mga04h51_26133_c1 | |||
| 2145 | nmdc:mga04h51_31780_c1 | |||
| 2146 | nmdc:mga04h51_37823_c1 | |||
| 2147 | nmdc:mga07m45_30137_c1 | |||
| 2148 | nmdc:mga05p37_106164_c1 | |||
| 2149 | nmdc:mga05p37_354_c1 | |||
| 2150 | nmdc:mga09592_4746_c1 | |||
| 2151 | nmdc:mga0qj67_935_c1 | |||
| 2152 | nmdc:mga06r32_147_c1 | |||
| 2153 | nmdc:mga08y16_26007_c1 | |||
| 2154 | nmdc:mga08y16_289_c1 | |||
| 2155 | nmdc:mga08y16_3527_c1 | |||
| 2156 | nmdc:mga08y16_707067_c1 | |||
| 2157 | nmdc:mga0n895_2125_c1 | |||
| 2158 | nmdc:mga0n895_414471_c1 | |||
| 2159 | nmdc:mga0n895_537262_c1 | |||
| 2160 | nmdc:mga0n895_545_c1 | |||
| 2161 | nmdc:mga0rr50_1020138_c1 | |||
| 2162 | nmdc:mga0rr50_1502_c1 | |||
| 2163 | nmdc:mga0rr50_160947_c1 | |||
| 2164 | nmdc:mga0rr50_219355_c1 | |||
| 2165 | nmdc:mga0rr50_9459_c2 | |||
| 2166 | nmdc:mga0rr50_98743_c1 | |||
| 2167 | nmdc:mga08x19_24_c1 | |||
| 2168 | nmdc:mga08x19_378558_c1 | |||
| 2169 | nmdc:mga0a205_131106_c1 | |||
| 2170 | nmdc:mga0a205_140696_c1 | |||
| 2171 | nmdc:mga0a205_270347_c1 | |||
| 2172 | nmdc:mga0a205_4915_c1 | |||
| 2173 | nmdc:mga0a205_60_c1 | |||
| 2174 | nmdc:mga0sz30_26694_c1 | |||
| 2175 | Ga0495601_0000068 | |||
| 2176 | Ga0495601_0001006 | |||
| 2177 | Ga0495601_0002256 | |||
| 2178 | Ga0495601_0003844 | |||
| 2179 | Ga0495601_0027708 | |||
| 2180 | Ga0495601_0041400 | |||
| 2181 | Ga0495612_0001267 | |||
| 2182 | Ga0495612_0003612 | |||
| 2183 | Ga0495612_0004139 | |||
| 2184 | Ga0500610_0104431 | |||
| 2185 | Ga0495595_0001160 | |||
| 2186 | Ga0495595_0002637 | |||
| 2187 | Ga0495595_0005061 | |||
| 2188 | Ga0495595_0010358 | |||
| 2189 | Ga0495595_0099662 | |||
| 2190 | Ga0495619_0000136 | |||
| 2191 | Ga0495619_0000154 | |||
| 2192 | Ga0495619_0000996 | |||
| 2193 | Ga0495619_0001694 | |||
| 2194 | Ga0495619_0002254 | |||
| 2195 | Ga0495619_0128664 | |||
| 2196 | Ga0495619_0149955 | |||
| 2197 | Ga0495619_0303114 | |||
| 2198 | Ga0500643_001473 | |||
| 2199 | Ga0500644_0000904 | |||
| 2200 | Ga0500646_0163067 | |||
| 2201 | Ga0500651_0085571 | |||
| 2202 | Ga0500566_0057215 | |||
| 2203 | Ga0500641_0001418 | |||
| 2204 | Ga0500641_0005479 | |||
| 2205 | Ga0500641_0175613 | |||
| 2206 | Ga0500650_0044907 | |||
| 2207 | Ga0500595_000002 | |||
| 2208 | Ga0500595_015845 | |||
| 2209 | Ga0500597_105718 | |||
| 2210 | Ga0500652_000003 | |||
| 2211 | Ga0500652_026516 | |||
| 2212 | Ga0500658_0096881 | |||
| 2213 | Ga0500588_0216757 | |||
| 2214 | Ga0500616_0000002 | |||
| 2215 | Ga0500636_0010026 | |||
| 2216 | Ga0500645_000086 | |||
| 2217 | Ga0501084_0174604 | |||
| 2218 | Ga0501084_0201921 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3m3m-assembly1.cif.gz_A | crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] | 0.916 | 2 | 204 |
| 4hz2-assembly1.cif.gz_A | crystal structure of glutathione s-transferase xaut_3756 (target efi-507152) from xanthobacter autotrophicus py2 | 0.9138 | 4 | 201 |
| 3m8n-assembly1.cif.gz_A | crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris | 0.9106 | 2 | 203 |
| 3m3m-assembly1.cif.gz_A | crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] | 0.9074 | 2 | 204 |
| 3m8n-assembly1.cif.gz_B | crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris | 0.9051 | 2 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9C6C8_6_89_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9692 | 5 | 82 | 3.40.30.10 |
| 5zfgB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9469 | 4 | 81 | 3.40.30.10 |
| 4yh2C01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9466 | 4 | 81 | 3.40.30.10 |
| af_Q9SRY6_37_122_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9397 | 3 | 81 | 3.40.30.10 |
| 4ke3D01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9368 | 4 | 82 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A512NPG9-F1-model_v4 | Glutathione S-transferase | 0.982 | 1 | 207 |
GO:0016740
|
| AF-A0A7T7Y4T2-F1-model_v4 | deleted | 0.981 | 1 | 208 |
|
| AF-A0A537C7K6-F1-model_v4 | Glutathione S-transferase family protein | 0.9804 | 1 | 212 |
GO:0016740
|
| AF-A0A6J4P5P9-F1-model_v4 | Maleylacetoacetate isomerase / Glutathione S-transferase (EC 5.2.1.2) | 0.9798 | 67 | 209 |
GO:0016034
GO:0016740 |
| AF-A0A4V1VAY0-F1-model_v4 | deleted | 0.9781 | 2 | 209 |
|