F489679

General Info

Members Datasets Scaffolds Average Seq Length
1081 485 1011 484

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10136773|Ga0207678_101367731
Length 552
Sequence MKPAHTDASAAAKVFEGPTTLLPQPCQLVIFGGPGDLSWRKLLPAVYNLDVDGVLPSHFTVVAFGVPAEGASDADPDEYIRARAKSGIARFSRQAIDEATWANFARGLFFVQGSFNDMRAYEQLKARLDSLDQQFGIPGSRVYYLAVSPGLVGQCVEHLQAAGMIRDPADTTAFTRVIIEKPIGRDLESARAVNRVVGAAFAESQTYRIDHYLGKETVQNLLVLRFANSIFEPLWNSKSIDHVQITVAEDEGLAQYDPITGELIATRAGYYEGIGALRDMVQNHMLQVLCVMAMEPPWSLAPEVVRDAKVGVLNCLRPLSKADVDKQVVRGQYIEGDVHGQRVPGYRKEVRASFEAMGRTLPRSSVNSTTETFVALRLFIDNWRWAGVPFYLRTGKRLPKRVSEVAIQFKDVPQILFNANPEFQLEPTVLSVRVQPEEGLSMRIASKLPGPKIRIYPVKMEFNYASSFGGSSPEAYERLILDAMRGDHTLFNTAEGIERLWEVSTPLLEAPPPVRLYAPGSWGPNAIHQLIAPRAWRLPFERVWRDPNKAGA

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
4 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
5 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
6 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
7 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
8 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
9 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
10 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
11 2519899620 Rhizobium sp. Pop5 Isolate Nodule
12 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
13 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
14 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
15 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
16 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
17 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
18 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
19 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
20 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
21 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
22 2643221561 Nocardioides sp. Root151 Isolate Unclassified
23 2643221576 Nocardioides sp. Root614 Isolate Unclassified
24 2643221590 Nocardioides sp. Root682 Isolate Unclassified
25 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
26 2643221604 Nocardioides sp. Root190 Isolate Unclassified
27 2643221615 Nocardioides sp. Root224 Isolate Unclassified
28 2643221617 Nocardioides sp. Root79 Isolate Unclassified
29 2643221620 Nocardioides sp. Root240 Isolate Unclassified
30 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
31 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
32 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
33 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
34 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
35 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
36 2643221696 Nocardioides sp. Root140 Isolate Unclassified
37 2643221718 Rhizobium sp. Root268 Isolate Unclassified
38 2738541277 Variovorax sp. GV051 Isolate Unclassified
39 2738541305 Nocardioides sp. CF167 Isolate Unclassified
40 2738541307 Variovorax sp. GV008 Isolate Unclassified
41 2738543019 Variovorax sp. GV040 Isolate Unclassified
42 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
43 2739367898 Nocardioides sp. CF479 Isolate Unclassified
44 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
45 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
46 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
47 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
48 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
49 2791355260 Rhizobium sp. L9 Isolate Nodule
50 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
51 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
52 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
53 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
54 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
55 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
56 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
57 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
58 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
59 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
60 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
61 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
62 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
63 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
64 2909042592 Labrys sp. LIt4 Isolate Nodule
65 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
66 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
67 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
68 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
69 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
70 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
71 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
72 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
73 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
74 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
75 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
76 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
77 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
78 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
79 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
80 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
81 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
82 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
83 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
84 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
85 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
86 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
87 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
88 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
89 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
90 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
91 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
92 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
93 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
94 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
95 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
96 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
97 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
98 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
99 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
100 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
101 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
102 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
103 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
104 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
105 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
106 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
107 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
108 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
109 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
110 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
111 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
112 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
113 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
114 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
115 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
116 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
117 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
120 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
121 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
122 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
123 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
124 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
125 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
126 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
127 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
128 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
129 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
130 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
131 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
132 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
133 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
134 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
135 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
136 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
137 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
138 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
139 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
140 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
141 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
142 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
143 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
144 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
145 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
146 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
147 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
148 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
149 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
150 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
151 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
152 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
153 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
154 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
155 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
156 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
157 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
158 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
159 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
160 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
161 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
162 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
163 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
164 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
165 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
166 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
167 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
168 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
169 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
170 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
171 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
172 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
173 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
174 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
175 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
176 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
177 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
178 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
179 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
180 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
181 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
182 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
183 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
184 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
185 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
186 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
187 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
188 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
189 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
190 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
191 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
192 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
193 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
194 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
195 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
197 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
198 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
200 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
262 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
263 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
267 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
268 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
269 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
270 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
271 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
272 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
273 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
274 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
275 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
277 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
278 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
279 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
280 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
281 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
282 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
283 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
284 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
285 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
286 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
287 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
288 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
289 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
290 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
291 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
292 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
293 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
294 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
295 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
296 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
297 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
298 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
299 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
300 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
301 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
302 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
303 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
304 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
305 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
306 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
307 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
308 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
309 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
310 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
311 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
312 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
313 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
314 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
315 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
316 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
317 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
318 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
319 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
320 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
321 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
322 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
323 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
324 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
325 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
326 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
327 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
328 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
329 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
330 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
331 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
332 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
333 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
334 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
335 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
336 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
337 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
338 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
339 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
340 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
341 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
342 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
343 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
344 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
345 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
346 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
347 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
348 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
349 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
350 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
351 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
352 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
353 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
354 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
355 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
356 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
357 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
358 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
359 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
360 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
361 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
362 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
363 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
364 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
365 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
366 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
367 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
368 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
369 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
370 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
371 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
372 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
373 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
374 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
375 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
376 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
377 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
378 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
379 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
380 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
381 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
382 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
383 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
384 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
385 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
386 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
387 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
388 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
389 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
390 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
391 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
392 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
393 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
394 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
395 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
396 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
397 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
398 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
399 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
400 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
401 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
402 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
403 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
404 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
405 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
406 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
407 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
408 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
409 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
423 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
424 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
425 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
426 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
427 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
428 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
429 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
430 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
431 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
432 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
433 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
434 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
435 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
436 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
439 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
440 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
441 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
442 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
443 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
444 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
445 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
446 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
447 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
448 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
449 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
450 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
451 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
452 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
453 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
454 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
455 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
456 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
457 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
458 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
459 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
460 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
461 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
462 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
463 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
464 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
465 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
466 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
467 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
468 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
469 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
470 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
471 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
472 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
473 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
474 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
475 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
476 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
477 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
478 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
479 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
480 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
481 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
482 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
483 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
484 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
485 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.34
Metatranscriptomes 0.09
Isolates 6.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.04
Nodule 2.31
Rhizoplane 6.48
Rhizosphere 66.6
Stem 0
Stem Tuber 0
Unclassified 11.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10004395 3300002077 Bacteria 2913
2 JGI25158J39367_1000043 3300002739 Bacteria 28682
3 JGI25152J39213_1001831 3300002773 Bacteria 8576
4 JGI25152J39213_1007690 3300002773 Bacteria 2765
5 JGI25153J46596_10003067 3300003215 Bacteria 9436
6 rootH1_10008151 3300003316 Bacteria 4564
7 rootH1_10008151 3300003323 Bacteria 6827
8 rootH1_10117972 3300003323 Bacteria 2674
9 JGI25160J50197_1009936 3300003354 Bacteria 3484
10 JGI25161J50226_1000027 3300003374 Bacteria 145847
11 Ga0055526_1001863 3300003771 Bacteria 14611
12 Ga0055526_1013303 3300003771 Bacteria 3493
13 Ga0055528_1015656 3300003790 Bacteria 2727
14 Ga0055540_1004588 3300003792 Bacteria 6138
15 Ga0055543_1000100 3300004625 Bacteria 74795
16 Ga0065165_1001841 3300005262 Bacteria 20687
17 Ga0065707_10085008 3300005295 Bacteria 6545
18 Ga0070676_10006514 3300005328 Bacteria 6238
19 Ga0070683_100008299 3300005329 Bacteria 8828
20 Ga0070683_100009231 3300005329 Bacteria 8424
21 Ga0070683_100061774 3300005329 Bacteria 3483
22 Ga0070683_100167254 3300005329 Bacteria 2087
23 Ga0070690_100041805 3300005330 Bacteria 2903
24 Ga0070670_100064046 3300005331 Bacteria 3155
25 Ga0070677_10000706 3300005333 Bacteria 11224
26 Ga0070677_10007124 3300005333 Bacteria 3726
27 Ga0068869_100033427 3300005334 Bacteria 3630
28 Ga0070666_10012082 3300005335 Bacteria 5438
29 Ga0070666_10066872 3300005335 Bacteria 2440
30 Ga0070680_100002950 3300005336 Bacteria 12645
31 Ga0070682_100000061 3300005337 Bacteria 105134
32 Ga0070682_100003688 3300005337 Bacteria 8507
33 Ga0070682_100064723 3300005337 Bacteria 2321
34 Ga0068868_100020471 3300005338 Bacteria 4972
35 Ga0068868_100069539 3300005338 Bacteria 2806
36 Ga0068868_100095259 3300005338 Bacteria 2403
37 Ga0068868_100223581 3300005338 Bacteria 1577
38 Ga0070660_100022184 3300005339 Bacteria 4692
39 Ga0070689_100001851 3300005340 Bacteria 13625
40 Ga0070689_100083681 3300005340 Bacteria 2507
41 Ga0070692_10007517 3300005345 Bacteria 4803
42 Ga0070675_100022065 3300005354 Bacteria 5087
43 Ga0070675_100025410 3300005354 Bacteria 4749
44 Ga0070671_100020733 3300005355 Bacteria 5361
45 Ga0070673_100024552 3300005364 Bacteria 4422
46 Ga0070688_100011943 3300005365 Bacteria 4850
47 Ga0070688_100062643 3300005365 Bacteria 2355
48 Ga0070667_100000967 3300005367 Bacteria 26443
49 Ga0070667_100002581 3300005367 Bacteria 15733
50 Ga0070667_100034441 3300005367 Bacteria 4236
51 Ga0070667_100178439 3300005367 Bacteria 1878
52 Ga0070709_10025237 3300005434 Bacteria 3509
53 Ga0070714_100059436 3300005435 Bacteria 3278
54 Ga0070713_100141208 3300005436 Bacteria 2134
55 Ga0070701_10038650 3300005438 Bacteria 2417
56 Ga0070701_10050854 3300005438 Bacteria 2148
57 Ga0070711_100008954 3300005439 Bacteria 6143
58 Ga0070705_100052090 3300005440 Bacteria 2390
59 Ga0070700_100092156 3300005441 Bacteria 1980
60 Ga0070708_100058413 3300005445 Bacteria 3437
61 Ga0070681_10002000 3300005458 Bacteria 18452
62 Ga0070681_10027724 3300005458 Bacteria 5695
63 Ga0068867_100001469 3300005459 Bacteria 16336
64 Ga0068867_100047796 3300005459 Bacteria 3146
65 Ga0070706_100004269 3300005467 Bacteria 13866
66 Ga0070706_100114382 3300005467 Bacteria 2513
67 Ga0070706_100194924 3300005467 Bacteria 1893
68 Ga0070698_100001386 3300005471 Bacteria 26868
69 Ga0070698_100046507 3300005471 Bacteria 4437
70 Ga0070699_100046067 3300005518 Bacteria 3774
71 Ga0070699_100151915 3300005518 Bacteria 2048
72 Ga0070679_100013436 3300005530 Bacteria 7840
73 Ga0070679_100027028 3300005530 Bacteria 5642
74 Ga0070679_100073717 3300005530 Bacteria 3404
75 Ga0070684_100004622 3300005535 Bacteria 10498
76 Ga0070697_100023957 3300005536 Bacteria 4857
77 Ga0070672_100000005 3300005543 Bacteria 121014
78 Ga0070672_100001159 3300005543 Bacteria 16111
79 Ga0070672_100005485 3300005543 Bacteria 8411
80 Ga0070672_100040468 3300005543 Bacteria 3576
81 Ga0070672_100054676 3300005543 Bacteria 3126
82 Ga0070672_100067276 3300005543 Bacteria 2838
83 Ga0070672_100122881 3300005543 Bacteria 2127
84 Ga0070686_100004637 3300005544 Bacteria 7580
85 Ga0070686_100021257 3300005544 Bacteria 3854
86 Ga0070665_100000566 3300005548 Bacteria 51646
87 Ga0070665_100001336 3300005548 Bacteria 29314
88 Ga0070665_100002579 3300005548 Bacteria 19853
89 Ga0070665_100008692 3300005548 Bacteria 10277
90 Ga0070665_100012031 3300005548 Bacteria 8730
91 Ga0070665_100034625 3300005548 Bacteria 5079
92 Ga0070665_100041042 3300005548 Bacteria 4650
93 Ga0070665_100055601 3300005548 Bacteria 3969
94 Ga0068855_100000327 3300005563 Bacteria 59054
95 Ga0068855_100000479 3300005563 Bacteria 49224
96 Ga0068855_100004779 3300005563 Bacteria 16536
97 Ga0068855_100048599 3300005563 Bacteria 5006
98 Ga0068855_100134114 3300005563 Bacteria 2826
99 Ga0068855_100136947 3300005563 Bacteria 2793
100 Ga0070664_100019671 3300005564 Bacteria 5556
101 Ga0070664_100054357 3300005564 Bacteria 3397
102 Ga0068856_100005787 3300005614 Bacteria 12182
103 Ga0068856_100104020 3300005614 Bacteria 2832
104 Ga0068856_100132386 3300005614 Bacteria 2499
105 Ga0068856_100192913 3300005614 Bacteria 2051
106 Ga0070702_100019013 3300005615 Bacteria 3573
107 Ga0070702_100031825 3300005615 Bacteria 2889
108 Ga0070702_100116255 3300005615 Bacteria 1667
109 Ga0068852_100004825 3300005616 Bacteria 9580
110 Ga0068852_100035444 3300005616 Bacteria 4163
111 Ga0068852_100080734 3300005616 Bacteria 2885
112 Ga0068852_100175914 3300005616 Bacteria 2010
113 Ga0068859_100006016 3300005617 Bacteria 12327
114 Ga0068859_100018500 3300005617 Bacteria 7001
115 Ga0068859_100068400 3300005617 Bacteria 3586
116 Ga0068859_100141878 3300005617 Bacteria 2476
117 Ga0068859_100176913 3300005617 Bacteria 2215
118 Ga0068864_100008855 3300005618 Bacteria 8296
119 Ga0068864_100014290 3300005618 Bacteria 6594
120 Ga0068864_100031966 3300005618 Bacteria 4468
121 Ga0068864_100094347 3300005618 Bacteria 2645
122 Ga0068866_10008363 3300005718 Bacteria 4357
123 Ga0068866_10016882 3300005718 Bacteria 3272
124 Ga0068861_100001686 3300005719 Bacteria 14171
125 Ga0068861_100004568 3300005719 Bacteria 9295
126 Ga0068861_100005967 3300005719 Bacteria 8273
127 Ga0068861_100034539 3300005719 Bacteria 3740
128 Ga0068861_100050147 3300005719 Bacteria 3164
129 Ga0068861_100065417 3300005719 Bacteria 2801
130 Ga0068861_100082644 3300005719 Bacteria 2518
131 Ga0068870_10016817 3300005840 Bacteria 3505
132 Ga0068870_10088242 3300005840 Bacteria 1728
133 Ga0068863_100011481 3300005841 Bacteria 8565
134 Ga0068863_100078590 3300005841 Bacteria 3124
135 Ga0068863_100127377 3300005841 Bacteria 2430
136 Ga0068863_100155869 3300005841 Bacteria 2187
137 Ga0068858_100002321 3300005842 Bacteria 19227
138 Ga0068858_100004646 3300005842 Bacteria 13454
139 Ga0068858_100007963 3300005842 Bacteria 10211
140 Ga0068858_100040576 3300005842 Bacteria 4317
141 Ga0068860_100000470 3300005843 Bacteria 50165
142 Ga0068860_100082225 3300005843 Bacteria 3063
143 Ga0068860_100094501 3300005843 Bacteria 2850
144 Ga0068862_100036157 3300005844 Bacteria 4185
145 Ga0081455_10002149 3300005937 Bacteria 23509
146 Ga0081455_10002595 3300005937 Bacteria 21431
147 Ga0081455_10012181 3300005937 Bacteria 8588
148 Ga0081455_10020543 3300005937 Bacteria 6214
149 Ga0081455_10033753 3300005937 Bacteria 4594
150 Ga0081455_10050302 3300005937 Bacteria 3585
151 Ga0081538_10000022 3300005981 Bacteria 131167
152 Ga0081540_1005379 3300005983 Bacteria 9573
153 Ga0081540_1012367 3300005983 Bacteria 5630
154 Ga0081539_10000159 3300005985 Bacteria 157561
155 Ga0081539_10003942 3300005985 Bacteria 17196
156 Ga0081539_10009579 3300005985 Bacteria 8058
157 Ga0070717_10016752 3300006028 Bacteria 5688
158 Ga0075365_10001309 3300006038 Bacteria 11113
159 Ga0075365_10003178 3300006038 Bacteria 8388
160 Ga0075365_10005649 3300006038 Bacteria 6773
161 Ga0075365_10016962 3300006038 Bacteria 4446
162 Ga0075365_10019010 3300006038 Bacteria 4232
163 Ga0075365_10046261 3300006038 Bacteria 2857
164 Ga0075365_10053282 3300006038 Bacteria 2679
165 Ga0075368_10001032 3300006042 Bacteria 8718
166 Ga0075368_10001687 3300006042 Bacteria 7093
167 Ga0075368_10009161 3300006042 Bacteria 3557
168 Ga0075368_10014667 3300006042 Bacteria 2899
169 Ga0075363_100004619 3300006048 Bacteria 6049
170 Ga0075363_100008063 3300006048 Bacteria 4885
171 Ga0075363_100014602 3300006048 Bacteria 3843
172 Ga0075363_100056895 3300006048 Bacteria 2097
173 Ga0075364_10000624 3300006051 Bacteria 18225
174 Ga0075364_10003803 3300006051 Bacteria 8635
175 Ga0075364_10003820 3300006051 Bacteria 8623
176 Ga0075364_10017125 3300006051 Bacteria 4522
177 Ga0075364_10020301 3300006051 Bacteria 4178
178 Ga0075364_10032639 3300006051 Bacteria 3348
179 Ga0075364_10068764 3300006051 Bacteria 2329
180 Ga0070715_10006280 3300006163 Bacteria 4027
181 Ga0070712_100044730 3300006175 Bacteria 3054
182 Ga0070712_100059186 3300006175 Bacteria 2697
183 Ga0075367_10004567 3300006178 Bacteria 6775
184 Ga0075367_10005175 3300006178 Bacteria 6446
185 Ga0075369_10000119 3300006186 Bacteria 21759
186 Ga0075369_10018822 3300006186 Bacteria 2815
187 Ga0075366_10006300 3300006195 Bacteria 6491
188 Ga0075366_10007947 3300006195 Bacteria 5871
189 Ga0075366_10010334 3300006195 Bacteria 5239
190 Ga0075366_10010484 3300006195 Bacteria 5203
191 Ga0075366_10063026 3300006195 Bacteria 2203
192 Ga0097621_100003890 3300006237 Bacteria 10352
193 Ga0097621_100009897 3300006237 Bacteria 6946
194 Ga0075370_10000383 3300006353 Bacteria 16303
195 Ga0075370_10002885 3300006353 Bacteria 8061
196 Ga0075370_10007701 3300006353 Bacteria 5499
197 Ga0075370_10008408 3300006353 Bacteria 5312
198 Ga0075370_10030970 3300006353 Bacteria 2985
199 Ga0075370_10038957 3300006353 Bacteria 2677
200 Ga0075370_10085917 3300006353 Bacteria 1812
201 Ga0068871_100007165 3300006358 Bacteria 7957
202 Ga0075428_100001401 3300006844 Bacteria 25642
203 Ga0075428_100027074 3300006844 Bacteria 6348
204 Ga0075428_100073956 3300006844 Bacteria 3722
205 Ga0075430_100004725 3300006846 Bacteria 11455
206 Ga0075431_100004352 3300006847 Bacteria 13890
207 Ga0075431_100019791 3300006847 Bacteria 6871
208 Ga0075431_100133566 3300006847 Bacteria 2559
209 Ga0075434_100082889 3300006871 Bacteria 3204
210 Ga0075434_100132129 3300006871 Bacteria 2516
211 Ga0075429_100001477 3300006880 Bacteria 19337
212 Ga0068865_100010323 3300006881 Bacteria 5809
213 Ga0097620_100006016 3300006931 Bacteria 12327
214 Ga0097620_100018500 3300006931 Bacteria 7001
215 Ga0097620_100068400 3300006931 Bacteria 3586
216 Ga0097620_100141867 3300006931 Bacteria 2476
217 Ga0097620_100176918 3300006931 Bacteria 2215
218 Ga0099794_10001837 3300007265 Bacteria 7592
219 Ga0099794_10006637 3300007265 Bacteria 4700
220 Ga0099794_10066949 3300007265 Bacteria 1753
221 Ga0099795_10000213 3300007788 Bacteria 10001
222 Ga0105250_10000005 3300009092 Bacteria 422580
223 Ga0105240_10000215 3300009093 Bacteria 115967
224 Ga0105240_10000587 3300009093 Bacteria 67507
225 Ga0105240_10002394 3300009093 Bacteria 30190
226 Ga0105240_10011765 3300009093 Bacteria 12157
227 Ga0105240_10011928 3300009093 Bacteria 12050
228 Ga0105240_10025141 3300009093 Bacteria 7831
229 Ga0105240_10049046 3300009093 Bacteria 5333
230 Ga0105240_10127737 3300009093 Bacteria 3053
231 Ga0105240_10157215 3300009093 Bacteria 2702
232 Ga0105240_10223337 3300009093 Bacteria 2193
233 Ga0105240_10226453 3300009093 Bacteria 2175
234 Ga0111539_10049954 3300009094 Bacteria 4984
235 Ga0111539_10212266 3300009094 Bacteria 2255
236 Ga0105245_10003386 3300009098 Bacteria 14283
237 Ga0105245_10005468 3300009098 Bacteria 11159
238 Ga0105245_10068852 3300009098 Bacteria 3208
239 Ga0105247_10002551 3300009101 Bacteria 12355
240 Ga0105247_10014662 3300009101 Bacteria 4699
241 Ga0105247_10019262 3300009101 Bacteria 4095
242 Ga0105247_10025217 3300009101 Bacteria 3587
243 Ga0114129_10001245 3300009147 Bacteria 33926
244 Ga0105243_10007737 3300009148 Bacteria 8262
245 Ga0105243_10038713 3300009148 Bacteria 3714
246 Ga0105243_10126363 3300009148 Bacteria 2164
247 Ga0105243_10160217 3300009148 Bacteria 1939
248 Ga0105241_10080097 3300009174 Bacteria 2555
249 Ga0105242_10021791 3300009176 Bacteria 5035
250 Ga0105242_10113114 3300009176 Bacteria 2318
251 Ga0105248_10206868 3300009177 Bacteria 2211
252 Ga0105237_10000560 3300009545 Bacteria 52008
253 Ga0105237_10004790 3300009545 Bacteria 15552
254 Ga0105237_10044948 3300009545 Bacteria 4447
255 Ga0105237_10187773 3300009545 Bacteria 2067
256 Ga0105237_10223109 3300009545 Bacteria 1885
257 Ga0105238_10000607 3300009551 Bacteria 37628
258 Ga0105238_10010367 3300009551 Bacteria 9353
259 Ga0105249_10020374 3300009553 Bacteria 5929
260 Ga0105249_10034441 3300009553 Bacteria 4590
261 Ga0123341_1000008 3300009765 Bacteria 134834
262 Ga0123342_1005465 3300009766 Bacteria 18393
263 Ga0105239_10000025 3300010375 Bacteria 254049
264 Ga0105239_10000269 3300010375 Bacteria 76932
265 Ga0105239_10019971 3300010375 Bacteria 7395
266 Ga0105239_10022212 3300010375 Bacteria 6993
267 Ga0105239_10153090 3300010375 Bacteria 2574
268 Ga0105246_10003455 3300011119 Bacteria 9577
269 Ga0105246_10015747 3300011119 Bacteria 4780
270 Ga0157371_10129035 3300013102 Bacteria 1798
271 Ga0157370_10050953 3300013104 Bacteria 3955
272 Ga0157374_10007450 3300013296 Bacteria 9334
273 Ga0157378_10276432 3300013297 Bacteria 1617
274 Ga0163162_10014396 3300013306 Bacteria 7729
275 Ga0163162_10047916 3300013306 Bacteria 4282
276 Ga0163162_10250446 3300013306 Bacteria 1903
277 Ga0157372_10006775 3300013307 Bacteria 12184
278 Ga0157375_10004470 3300013308 Bacteria 12146
279 Ga0157375_10008041 3300013308 Bacteria 9234
280 Ga0157375_10009166 3300013308 Bacteria 8673
281 Ga0157375_10030639 3300013308 Bacteria 5075
282 Ga0157375_10038969 3300013308 Bacteria 4568
283 Ga0157375_10260599 3300013308 Bacteria 1895
284 Ga0163163_10000044 3300014325 Bacteria 135713
285 Ga0163163_10000876 3300014325 Bacteria 25650
286 Ga0163163_10016691 3300014325 Bacteria 6829
287 Ga0163163_10037049 3300014325 Bacteria 4743
288 Ga0163163_10192228 3300014325 Bacteria 2089
289 Ga0157380_10066780 3300014326 Bacteria 2894
290 Ga0157380_10131909 3300014326 Bacteria 2133
291 Ga0182008_10035582 3300014497 Bacteria 2493
292 Ga0157377_10036186 3300014745 Bacteria 2714
293 Ga0157377_10045571 3300014745 Bacteria 2450
294 Ga0157379_10000038 3300014968 Bacteria 81063
295 Ga0157379_10007099 3300014968 Bacteria 9686
296 Ga0157379_10008491 3300014968 Bacteria 8935
297 Ga0157379_10012604 3300014968 Bacteria 7384
298 Ga0157379_10022185 3300014968 Bacteria 5626
299 Ga0157379_10031631 3300014968 Bacteria 4715
300 Ga0157379_10037973 3300014968 Bacteria 4296
301 Ga0157379_10142457 3300014968 Bacteria 2161
302 Ga0157376_10013434 3300014969 Bacteria 6109
303 Ga0157376_10018397 3300014969 Bacteria 5356
304 Ga0157376_10165202 3300014969 Bacteria 2010
305 Ga0182006_1030966 3300015261 Bacteria 2159
306 Ga0182007_10001637 3300015262 Bacteria 11859
307 Ga0163161_10055223 3300017792 Bacteria 2883
308 Ga0213875_10020700 3300021388 Bacteria 3156
309 Ga0209436_100009 3300025208 Bacteria 143684
310 Ga0207425_1004443 3300025245 Bacteria 4202
311 Ga0209129_1000041 3300025258 Bacteria 307590
312 Ga0209129_1000333 3300025258 Bacteria 40851
313 Ga0209673_1000013 3300025273 Bacteria 571633
314 Ga0209673_1007377 3300025273 Bacteria 5087
315 Ga0209130_1000022 3300025284 Bacteria 361244
316 Ga0209025_1019064 3300025294 Bacteria 3838
317 Ga0209564_1000029 3300025295 Bacteria 505995
318 Ga0209564_1000264 3300025295 Bacteria 111404
319 Ga0209564_1001353 3300025295 Bacteria 25873
320 Ga0209564_1002363 3300025295 Bacteria 15182
321 Ga0209758_1000043 3300025297 Bacteria 402310
322 Ga0209758_1000057 3300025297 Bacteria 333111
323 Ga0209758_1007042 3300025297 Bacteria 7806
324 Ga0209050_1000149 3300025298 Bacteria 163252
325 Ga0209256_1005145 3300025299 Bacteria 7728
326 Ga0209256_1006523 3300025299 Bacteria 6131
327 Ga0209256_1008410 3300025299 Bacteria 4793
328 Ga0209256_1018531 3300025299 Bacteria 2256
329 Ga0207426_1000042 3300025302 Bacteria 433289
330 Ga0207426_1000537 3300025302 Bacteria 54262
331 Ga0209051_1000489 3300025303 Bacteria 51077
332 Ga0209051_1007353 3300025303 Bacteria 6039
333 Ga0207656_10000244 3300025321 Bacteria 18974
334 Ga0207696_1000276 3300025711 Bacteria 60824
335 Ga0207692_10015057 3300025898 Bacteria 3394
336 Ga0207642_10013793 3300025899 Bacteria 2960
337 Ga0207642_10030691 3300025899 Bacteria 2242
338 Ga0207710_10000593 3300025900 Bacteria 21302
339 Ga0207710_10011463 3300025900 Bacteria 3732
340 Ga0207688_10001626 3300025901 Bacteria 11858
341 Ga0207688_10006136 3300025901 Bacteria 6541
342 Ga0207680_10005598 3300025903 Bacteria 6009
343 Ga0207647_10058303 3300025904 Bacteria 2365
344 Ga0207685_10001766 3300025905 Bacteria 4704
345 Ga0207645_10003682 3300025907 Bacteria 11561
346 Ga0207645_10014754 3300025907 Bacteria 5218
347 Ga0207645_10040690 3300025907 Bacteria 2976
348 Ga0207643_10001184 3300025908 Bacteria 15445
349 Ga0207643_10024032 3300025908 Bacteria 3363
350 Ga0207705_10024663 3300025909 Bacteria 4291
351 Ga0207684_10005060 3300025910 Bacteria 12285
352 Ga0207684_10061918 3300025910 Bacteria 3177
353 Ga0207684_10138169 3300025910 Bacteria 2093
354 Ga0207707_10001863 3300025912 Bacteria 19260
355 Ga0207707_10141546 3300025912 Bacteria 2103
356 Ga0207695_10000347 3300025913 Bacteria 107013
357 Ga0207695_10004517 3300025913 Bacteria 18930
358 Ga0207695_10016693 3300025913 Bacteria 8579
359 Ga0207695_10018105 3300025913 Bacteria 8153
360 Ga0207695_10020509 3300025913 Bacteria 7568
361 Ga0207695_10039933 3300025913 Bacteria 5039
362 Ga0207695_10061366 3300025913 Bacteria 3885
363 Ga0207695_10158749 3300025913 Bacteria 2194
364 Ga0207671_10000952 3300025914 Bacteria 35982
365 Ga0207671_10024013 3300025914 Bacteria 4589
366 Ga0207671_10138007 3300025914 Bacteria 1876
367 Ga0207693_10052265 3300025915 Bacteria 3205
368 Ga0207663_10017023 3300025916 Bacteria 4042
369 Ga0207660_10025425 3300025917 Bacteria 4018
370 Ga0207660_10025885 3300025917 Bacteria 3988
371 Ga0207657_10002307 3300025919 Bacteria 20684
372 Ga0207657_10058970 3300025919 Bacteria 3301
373 Ga0207652_10019486 3300025921 Bacteria 5580
374 Ga0207652_10055163 3300025921 Bacteria 3417
375 Ga0207652_10063785 3300025921 Bacteria 3187
376 Ga0207681_10024501 3300025923 Bacteria 3874
377 Ga0207694_10000606 3300025924 Bacteria 32510
378 Ga0207694_10021736 3300025924 Bacteria 4862
379 Ga0207694_10040384 3300025924 Bacteria 3591
380 Ga0207650_10135964 3300025925 Bacteria 1928
381 Ga0207659_10116440 3300025926 Bacteria 2040
382 Ga0207687_10005646 3300025927 Bacteria 8276
383 Ga0207687_10011372 3300025927 Bacteria 5817
384 Ga0207700_10039730 3300025928 Bacteria 3427
385 Ga0207700_10146165 3300025928 Bacteria 1949
386 Ga0207664_10061884 3300025929 Bacteria 2988
387 Ga0207644_10002169 3300025931 Bacteria 12734
388 Ga0207644_10078058 3300025931 Bacteria 2440
389 Ga0207706_10003325 3300025933 Bacteria 15389
390 Ga0207686_10082739 3300025934 Bacteria 2099
391 Ga0207709_10003330 3300025935 Bacteria 9625
392 Ga0207709_10009011 3300025935 Bacteria 5501
393 Ga0207709_10032358 3300025935 Bacteria 3062
394 Ga0207709_10076289 3300025935 Bacteria 2145
395 Ga0207670_10035363 3300025936 Bacteria 3238
396 Ga0207669_10021936 3300025937 Bacteria 3382
397 Ga0207669_10082467 3300025937 Bacteria 2064
398 Ga0207704_10022274 3300025938 Bacteria 3391
399 Ga0207704_10057054 3300025938 Bacteria 2396
400 Ga0207691_10000028 3300025940 Bacteria 121090
401 Ga0207691_10002487 3300025940 Bacteria 18018
402 Ga0207691_10008483 3300025940 Bacteria 9869
403 Ga0207691_10010326 3300025940 Bacteria 8956
404 Ga0207691_10034149 3300025940 Bacteria 4732
405 Ga0207691_10102659 3300025940 Bacteria 2550
406 Ga0207691_10158855 3300025940 Bacteria 1984
407 Ga0207711_10031272 3300025941 Bacteria 4493
408 Ga0207711_10087780 3300025941 Bacteria 2729
409 Ga0207711_10110637 3300025941 Bacteria 2443
410 Ga0207689_10014440 3300025942 Bacteria 6718
411 Ga0207689_10028770 3300025942 Bacteria 4647
412 Ga0207689_10033405 3300025942 Bacteria 4276
413 Ga0207661_10039718 3300025944 Bacteria 3695
414 Ga0207661_10228557 3300025944 Bacteria 1647
415 Ga0207667_10000175 3300025949 Bacteria 93793
416 Ga0207667_10003104 3300025949 Bacteria 20565
417 Ga0207667_10008252 3300025949 Bacteria 12395
418 Ga0207667_10034111 3300025949 Bacteria 5468
419 Ga0207667_10034807 3300025949 Bacteria 5406
420 Ga0207651_10218098 3300025960 Bacteria 1540
421 Ga0207712_10108531 3300025961 Bacteria 2077
422 Ga0207712_10137628 3300025961 Bacteria 1870
423 Ga0207640_10000077 3300025981 Bacteria 76155
424 Ga0207640_10165641 3300025981 Bacteria 1641
425 Ga0207658_10000800 3300025986 Bacteria 26430
426 Ga0207658_10117507 3300025986 Bacteria 2114
427 Ga0207677_10000929 3300026023 Bacteria 16369
428 Ga0207703_10000957 3300026035 Bacteria 27938
429 Ga0207703_10001166 3300026035 Bacteria 24812
430 Ga0207703_10004717 3300026035 Bacteria 11123
431 Ga0207703_10033934 3300026035 Bacteria 4047
432 Ga0207703_10064578 3300026035 Bacteria 3005
433 Ga0207639_10018300 3300026041 Bacteria 4978
434 Ga0207678_10024110 3300026067 Bacteria 5316
435 Ga0207678_10136773 3300026067 Bacteria 2090
436 Ga0207708_10002529 3300026075 Bacteria 13451
437 Ga0207708_10049932 3300026075 Bacteria 3185
438 Ga0207708_10126415 3300026075 Bacteria 1996
439 Ga0207702_10010110 3300026078 Bacteria 7906
440 Ga0207702_10048313 3300026078 Bacteria 3588
441 Ga0207702_10278556 3300026078 Bacteria 1580
442 Ga0207641_10001175 3300026088 Bacteria 26305
443 Ga0207641_10007318 3300026088 Bacteria 9195
444 Ga0207641_10013250 3300026088 Bacteria 6761
445 Ga0207641_10072629 3300026088 Bacteria 2963
446 Ga0207641_10122262 3300026088 Bacteria 2325
447 Ga0207641_10125292 3300026088 Bacteria 2299
448 Ga0207648_10000550 3300026089 Bacteria 42009
449 Ga0207648_10028619 3300026089 Bacteria 4939
450 Ga0207648_10052060 3300026089 Bacteria 3579
451 Ga0207648_10061086 3300026089 Bacteria 3286
452 Ga0207648_10078057 3300026089 Bacteria 2888
453 Ga0207676_10004867 3300026095 Bacteria 9508
454 Ga0207676_10031838 3300026095 Bacteria 3968
455 Ga0207676_10086857 3300026095 Bacteria 2556
456 Ga0207674_10018743 3300026116 Bacteria 7512
457 Ga0207674_10032831 3300026116 Bacteria 5441
458 Ga0207674_10115649 3300026116 Bacteria 2654
459 Ga0207675_100006048 3300026118 Bacteria 11514
460 Ga0207675_100007010 3300026118 Bacteria 10656
461 Ga0207675_100012751 3300026118 Bacteria 7853
462 Ga0207675_100017246 3300026118 Bacteria 6742
463 Ga0207675_100030556 3300026118 Bacteria 5019
464 Ga0207675_100209559 3300026118 Bacteria 1874
465 Ga0207675_100262402 3300026118 Bacteria 1674
466 Ga0207683_10169056 3300026121 Bacteria 1979
467 Ga0207698_10019128 3300026142 Bacteria 4681
468 Ga0207698_10023374 3300026142 Bacteria 4317
469 Ga0207698_10080992 3300026142 Bacteria 2618
470 Ga0207698_10153374 3300026142 Bacteria 2003
471 Ga0209813_10000255 3300027866 Bacteria 15495
472 Ga0209813_10004191 3300027866 Bacteria 3427
473 Ga0207428_10097293 3300027907 Bacteria 2278
474 Ga0268266_10000596 3300028379 Bacteria 49462
475 Ga0268266_10001984 3300028379 Bacteria 22953
476 Ga0268266_10003195 3300028379 Bacteria 16585
477 Ga0268266_10003489 3300028379 Bacteria 15655
478 Ga0268266_10009083 3300028379 Bacteria 8777
479 Ga0268266_10024997 3300028379 Bacteria 5084
480 Ga0268266_10025515 3300028379 Bacteria 5027
481 Ga0268266_10073745 3300028379 Bacteria 2962
482 Ga0268265_10048388 3300028380 Bacteria 3192
483 Ga0268264_10000287 3300028381 Bacteria 85050
484 Ga0268264_10000420 3300028381 Bacteria 59901
485 Ga0268264_10028551 3300028381 Bacteria 4564
486 Ga0268264_10064052 3300028381 Bacteria 3093
487 Ga0268264_10144640 3300028381 Bacteria 2124
488 Ga0265337_1006149 3300028556 Bacteria 4668
489 Ga0265326_10010375 3300028558 Bacteria 2762
490 Ga0265334_10000014 3300028573 Bacteria 154345
491 Ga0307517_10004912 3300028786 Bacteria 20370
492 Ga0307517_10065457 3300028786 Bacteria 3362
493 Ga0307517_10093494 3300028786 Bacteria 2437
494 Ga0307515_10000011 3300028794 Bacteria 633903
495 Ga0307515_10000186 3300028794 Bacteria 153531
496 Ga0307515_10050257 3300028794 Bacteria 6250
497 Ga0307515_10058448 3300028794 Bacteria 5553
498 Ga0307515_10065339 3300028794 Bacteria 5066
499 Ga0307515_10097341 3300028794 Bacteria 3597
500 Ga0307515_10111006 3300028794 Bacteria 3204
501 Ga0307515_10176786 3300028794 Bacteria 2102
502 Ga0265338_10000377 3300028800 Bacteria 79902
503 Ga0265338_10004531 3300028800 Bacteria 18718
504 Ga0265338_10006711 3300028800 Bacteria 14542
505 Ga0265338_10047374 3300028800 Bacteria 3926
506 Ga0307511_10000037 3300030521 Bacteria 103008
507 Ga0307511_10054297 3300030521 Bacteria 3161
508 Ga0307512_10061925 3300030522 Bacteria 2876
509 Ga0316182_1299158 3300030745 Bacteria 7088
510 Ga0265760_10016520 3300031090 Bacteria 2118
511 Ga0265328_10038116 3300031239 Bacteria 1774
512 Ga0265320_10006123 3300031240 Bacteria 7620
513 Ga0265325_10000155 3300031241 Bacteria 48142
514 Ga0265340_10000121 3300031247 Bacteria 38466
515 Ga0265339_10048068 3300031249 Bacteria 2340
516 Ga0265331_10004523 3300031250 Bacteria 8675
517 Ga0265331_10004710 3300031250 Bacteria 8443
518 Ga0265327_10000487 3300031251 Bacteria 69944
519 Ga0265316_10004680 3300031344 Bacteria 13553
520 Ga0307513_10002991 3300031456 Bacteria 23045
521 Ga0307513_10015253 3300031456 Bacteria 9325
522 Ga0307513_10016687 3300031456 Bacteria 8841
523 Ga0307513_10053100 3300031456 Bacteria 4359
524 Ga0307513_10083111 3300031456 Bacteria 3294
525 Ga0307513_10092686 3300031456 Bacteria 3074
526 Ga0307513_10234044 3300031456 Bacteria 1647
527 Ga0307509_10000001 3300031507 Bacteria 629324
528 Ga0307509_10000044 3300031507 Bacteria 176718
529 Ga0307509_10003432 3300031507 Bacteria 24057
530 Ga0307509_10004147 3300031507 Bacteria 21173
531 Ga0307509_10004183 3300031507 Bacteria 21075
532 Ga0307509_10021431 3300031507 Bacteria 7305
533 Ga0307509_10061981 3300031507 Bacteria 3945
534 Ga0307509_10095132 3300031507 Bacteria 3035
535 Ga0307408_100000006 3300031548 Bacteria 472824
536 Ga0265313_10001336 3300031595 Bacteria 23225
537 Ga0307508_10005121 3300031616 Bacteria 12567
538 Ga0307508_10011794 3300031616 Bacteria 7987
539 Ga0307508_10012983 3300031616 Bacteria 7616
540 Ga0307508_10031568 3300031616 Bacteria 4788
541 Ga0307514_10020475 3300031649 Bacteria 5398
542 Ga0307514_10040937 3300031649 Bacteria 3650
543 Ga0265314_10012680 3300031711 Bacteria 6858
544 Ga0265314_10025791 3300031711 Bacteria 4427
545 Ga0265342_10016314 3300031712 Bacteria 4859
546 Ga0265342_10018466 3300031712 Bacteria 4517
547 Ga0316576_10006578 3300031727 Bacteria 7252
548 Ga0307516_10005815 3300031730 Bacteria 14613
549 Ga0307516_10016202 3300031730 Bacteria 7808
550 Ga0307516_10017271 3300031730 Bacteria 7528
551 Ga0307516_10018714 3300031730 Bacteria 7193
552 Ga0307516_10095107 3300031730 Bacteria 2803
553 Ga0307516_10157445 3300031730 Bacteria 2025
554 Ga0307413_10003854 3300031824 Bacteria 6405
555 Ga0307409_100016212 3300031995 Bacteria 4922
556 Ga0307409_100028358 3300031995 Bacteria 3987
557 Ga0307409_100097567 3300031995 Bacteria 2428
558 Ga0307416_100013529 3300032002 Bacteria 5551
559 Ga0307510_10000016 3300033180 Bacteria 206932
560 Ga0307510_10005766 3300033180 Bacteria 14762
561 Ga0307510_10006502 3300033180 Bacteria 13936
562 Ga0307510_10008022 3300033180 Bacteria 12565
563 Ga0307510_10067143 3300033180 Bacteria 3613
564 Ga0373936_0005394 3300035113 Bacteria 4818
565 Ga0373936_0034391 3300035113 Bacteria 2013
566 Ga0373945_0013158 3300035116 Bacteria 2758
567 Ga0373946_0021708 3300035171 Bacteria 2492
568 Ga0373931_0007299 3300035691 Bacteria 5200
569 Ga0373931_0010537 3300035691 Bacteria 4444
570 Ga0373927_0063530 3300035695 Bacteria 2388
571 Ga0373933_0069196 3300035724 Bacteria 2145
572 Ga0373937_0033714 3300036401 Bacteria 4652
573 Ga0373937_0068466 3300036401 Bacteria 3273
574 Ga0373937_0148784 3300036401 Bacteria 2193
575 Ga0395899_0047305 3300037312 Bacteria 3203
576 Ga0395899_0058632 3300037312 Bacteria 2839
577 Ga0395900_0006806 3300037418 Bacteria 11855
578 Ga0395900_0014634 3300037418 Bacteria 8002
579 Ga0395900_0151595 3300037418 Bacteria 2368
580 Ga0395898_0004666 3300037466 Bacteria 14932
581 Ga0395898_0024464 3300037466 Bacteria 6091
582 Ga0395898_0150511 3300037466 Bacteria 2227
583 Ga0395905_0102329 3300037471 Bacteria 2689
584 Ga0436364_0457524 3300037853 Bacteria 2139
585 Ga0436364_0748817 3300037853 Bacteria 3432
586 Ga0395901_0020172 3300038443 Bacteria 6822
587 Ga0395901_0032881 3300038443 Bacteria 5351
588 Ga0395901_0245307 3300038443 Bacteria 1867
589 Ga0436365_0002580 3300039437 Bacteria 4922
590 Ga0436365_0327786 3300039437 Bacteria 9722
591 Ga0436365_0592429 3300039437 Bacteria 2289
592 Ga0436365_0898810 3300039437 Bacteria 2969
593 Ga0436365_1619143 3300039437 Bacteria 6286
594 Ga0436360_0112640 3300039438 Bacteria 1912
595 Ga0436360_0738491 3300039438 Bacteria 5353
596 Ga0436360_1026710 3300039438 Bacteria 2090
597 Ga0436360_1129771 3300039438 Bacteria 5578
598 Ga0436361_0395058 3300039447 Bacteria 1519
599 Ga0436361_0611431 3300039447 Bacteria 2208
600 Ga0436361_0899139 3300039447 Bacteria 2367
601 Ga0436363_0481565 3300039450 Bacteria 3760
602 Ga0436363_1106384 3300039450 Bacteria 3922
603 Ga0436362_0757178 3300039453 Bacteria 1888
604 Ga0436362_1106345 3300039453 Bacteria 2044
605 Ga0451791_0356334 3300041451 Bacteria 2488
606 Ga0451798_0226398 3300041458 Bacteria 3712
607 Ga0451800_0869303 3300041459 Bacteria 3532
608 Ga0451839_0104998 3300041496 Bacteria 2277
609 Ga0451847_0654707 3300041503 Bacteria 5399
610 Ga0451851_0138487 3300041507 Bacteria 1843
611 Ga0451855_0184220 3300041511 Bacteria 3498
612 Ga0439462_0017763 3300042015 Bacteria 1843
613 Ga0451577_0133997 3300042876 Bacteria 2224
614 Ga0466969_0002439 3300044656 Bacteria 9913
615 Ga0466965_0021990 3300044683 Bacteria 3074
616 Ga0466965_0026025 3300044683 Bacteria 2835
617 Ga0466965_0037781 3300044683 Bacteria 2371
618 Ga0466966_0006687 3300044684 Bacteria 7637
619 Ga0466966_0029066 3300044684 Bacteria 3598
620 Ga0466961_0021280 3300044693 Bacteria 4176
621 Ga0466963_0115462 3300044694 Bacteria 1845
622 Ga0466971_0073324 3300044719 Bacteria 1556
623 Ga0466970_0018274 3300044765 Bacteria 3627
624 Ga0466970_0046920 3300044765 Bacteria 2301
625 Ga0466970_0052692 3300044765 Bacteria 2172
626 Ga0466957_0019120 3300044842 Bacteria 4028
627 Ga0466960_0014516 3300044901 Bacteria 3374
628 Ga0466960_0023325 3300044901 Bacteria 2777
629 Ga0466960_0056478 3300044901 Bacteria 1911
630 Ga0466959_0061889 3300045049 Bacteria 2721
631 Ga0451576_0020730 3300045051 Bacteria 7155
632 Ga0466958_0014007 3300045836 Bacteria 4574
633 Ga0466967_0023032 3300045976 Bacteria 5096
634 Ga0466967_0043364 3300045976 Bacteria 3894
635 Ga0466967_0062820 3300045976 Bacteria 3298
636 Ga0466967_0073790 3300045976 Bacteria 3062
637 Ga0495627_008967 3300046453 Bacteria 3699
638 Ga0495592_0000203 3300046454 Bacteria 50733
639 Ga0495592_0073735 3300046454 Bacteria 2481
640 Ga0495603_0051288 3300046455 Bacteria 2452
641 Ga0495603_0098352 3300046455 Bacteria 1709
642 Ga0495590_0031669 3300046457 Bacteria 1851
643 Ga0495638_0004766 3300046460 Bacteria 10231
644 Ga0495638_0029580 3300046460 Bacteria 3532
645 Ga0495638_0036493 3300046460 Bacteria 3132
646 Ga0495653_0004980 3300046463 Bacteria 10780
647 Ga0495650_0010731 3300046471 Bacteria 5090
648 Ga0495650_0012066 3300046471 Bacteria 4674
649 Ga0495650_0025838 3300046471 Bacteria 2743
650 Ga0495582_0038368 3300046473 Bacteria 2636
651 Ga0495605_0015688 3300046474 Bacteria 4117
652 Ga0495639_0001912 3300046475 Bacteria 9238
653 Ga0495662_0051399 3300046476 Bacteria 1989
654 Ga0495664_0105373 3300046477 Bacteria 1700
655 Ga0495584_0005419 3300046491 Bacteria 6757
656 Ga0495585_0088494 3300046492 Bacteria 1670
657 Ga0495607_0072375 3300046501 Bacteria 1919
658 Ga0495583_0004172 3300046506 Bacteria 10531
659 Ga0495583_0069357 3300046506 Bacteria 1553
660 Ga0495606_0000253 3300046507 Bacteria 94485
661 Ga0495606_0000895 3300046507 Bacteria 44393
662 Ga0495606_0006342 3300046507 Bacteria 10942
663 Ga0495608_0000013 3300046511 Bacteria 228481
664 Ga0495608_0145297 3300046511 Bacteria 1513
665 Ga0495616_0001686 3300046513 Bacteria 15063
666 Ga0495616_0014165 3300046513 Bacteria 4474
667 Ga0495620_0054441 3300046515 Bacteria 1690
668 Ga0495630_0072872 3300046517 Bacteria 2586
669 Ga0495630_0107710 3300046517 Bacteria 2111
670 Ga0495632_0002177 3300046519 Bacteria 15118
671 Ga0495632_0002541 3300046519 Bacteria 13831
672 Ga0495632_0026675 3300046519 Bacteria 3038
673 Ga0495643_0016469 3300046522 Bacteria 4341
674 Ga0495643_0033054 3300046522 Bacteria 2865
675 Ga0495648_0033094 3300046524 Bacteria 3382
676 Ga0495665_0056714 3300046531 Bacteria 2068
677 Ga0495597_0014009 3300046542 Bacteria 3829
678 Ga0495622_0000566 3300046557 Bacteria 22206
679 Ga0495622_0017920 3300046557 Bacteria 3298
680 Ga0495633_0009942 3300046558 Bacteria 5223
681 Ga0495633_0054782 3300046558 Bacteria 1876
682 Ga0495656_0000232 3300046615 Bacteria 19679
683 Ga0495656_0045982 3300046615 Bacteria 1845
684 Ga0495668_0042200 3300046616 Bacteria 2540
685 Ga0495625_0005672 3300046660 Bacteria 11308
686 Ga0495625_0015246 3300046660 Bacteria 6095
687 Ga0495625_0015952 3300046660 Bacteria 5926
688 Ga0495625_0030593 3300046660 Bacteria 4015
689 Ga0495625_0109271 3300046660 Bacteria 1892
690 Ga0495635_0119992 3300046663 Bacteria 1794
691 Ga0495588_0001503 3300046674 Bacteria 9988
692 Ga0495657_0000003 3300046675 Bacteria 279680
693 Ga0495671_0019063 3300046692 Bacteria 3632
694 Ga0495649_0009300 3300046694 Bacteria 5849
695 Ga0495649_0032383 3300046694 Bacteria 2879
696 Ga0495649_0070413 3300046694 Bacteria 1875
697 Ga0495649_0106081 3300046694 Bacteria 1491
698 Ga0495660_0019406 3300046810 Bacteria 3903
699 Ga0495674_0011969 3300047319 Bacteria 8182
700 Ga0495672_0001753 3300047320 Bacteria 20929
701 Ga0495676_0089584 3300047321 Bacteria 2305
702 Ga0495680_0143410 3300047322 Bacteria 1746
703 Ga0495680_0152583 3300047322 Bacteria 1683
704 Ga0495683_0045896 3300047323 Bacteria 2194
705 Ga0495687_001076 3300047443 Bacteria 26881
706 Ga0495687_006562 3300047443 Bacteria 7098
707 Ga0495687_024614 3300047443 Bacteria 2858
708 Ga0495675_0000094 3300047444 Bacteria 63338
709 Ga0495684_0056481 3300047471 Bacteria 2993
710 Ga0495686_0000923 3300047472 Bacteria 36619
711 Ga0496100_0001473 3300048903 Bacteria 11524
712 Ga0496101_0002555 3300048904 Bacteria 11168
713 Ga0496101_0012522 3300048904 Bacteria 5661
714 Ga0496101_0018822 3300048904 Bacteria 4703
715 Ga0496101_0024641 3300048904 Bacteria 4166
716 Ga0496101_0060520 3300048904 Bacteria 2748
717 Ga0496102_0002386 3300048905 Bacteria 16031
718 Ga0496102_0005870 3300048905 Bacteria 10453
719 Ga0496102_0040624 3300048905 Bacteria 4208
720 Ga0496102_0042726 3300048905 Bacteria 4109
721 Ga0496102_0044793 3300048905 Bacteria 4016
722 Ga0496102_0104688 3300048905 Bacteria 2632
723 Ga0496104_0010103 3300048907 Bacteria 8428
724 Ga0496104_0016340 3300048907 Bacteria 6740
725 Ga0496104_0039296 3300048907 Bacteria 4430
726 Ga0496104_0048594 3300048907 Bacteria 3999
727 Ga0496104_0052297 3300048907 Bacteria 3857
728 Ga0496104_0098459 3300048907 Bacteria 2799
729 Ga0496104_0202856 3300048907 Bacteria 1895
730 Ga0496105_0000649 3300048908 Bacteria 23327
731 Ga0496105_0011401 3300048908 Bacteria 7021
732 Ga0496105_0011580 3300048908 Bacteria 6975
733 Ga0496105_0018169 3300048908 Bacteria 5646
734 Ga0496105_0020997 3300048908 Bacteria 5281
735 Ga0496105_0057220 3300048908 Bacteria 3220
736 Ga0496105_0082879 3300048908 Bacteria 2649
737 Ga0496105_0100044 3300048908 Bacteria 2394
738 Ga0496107_0002401 3300048910 Bacteria 12126
739 Ga0496107_0034810 3300048910 Bacteria 3609
740 Ga0496107_0042839 3300048910 Bacteria 3252
741 Ga0496107_0106667 3300048910 Bacteria 2058
742 Ga0496108_0003961 3300048911 Bacteria 11896
743 Ga0496108_0006730 3300048911 Bacteria 9308
744 Ga0496108_0047157 3300048911 Bacteria 3602
745 Ga0496108_0051740 3300048911 Bacteria 3441
746 Ga0496108_0072384 3300048911 Bacteria 2909
747 Ga0496109_0000011 3300048912 Bacteria 234908
748 Ga0496109_0008248 3300048912 Bacteria 8846
749 Ga0496109_0042602 3300048912 Bacteria 4112
750 Ga0496109_0062929 3300048912 Bacteria 3393
751 Ga0496109_0141433 3300048912 Bacteria 2250
752 Ga0496110_0003748 3300048913 Bacteria 11706
753 Ga0496110_0032013 3300048913 Bacteria 4539
754 Ga0496110_0040232 3300048913 Bacteria 4074
755 Ga0496110_0044209 3300048913 Bacteria 3890
756 Ga0496110_0062681 3300048913 Bacteria 3284
757 Ga0496110_0075894 3300048913 Bacteria 2987
758 Ga0496110_0220366 3300048913 Bacteria 1725
759 Ga0496110_0221404 3300048913 Bacteria 1721
760 Ga0496111_0004320 3300048914 Bacteria 8962
761 Ga0496111_0031555 3300048914 Bacteria 3775
762 Ga0496111_0048660 3300048914 Bacteria 3054
763 Ga0496111_0055314 3300048914 Bacteria 2870
764 Ga0496112_0061691 3300048915 Bacteria 3697
765 Ga0496113_0009214 3300048916 Bacteria 6474
766 Ga0496113_0043947 3300048916 Bacteria 3308
767 Ga0496114_0000691 3300048917 Bacteria 25121
768 Ga0496114_0004625 3300048917 Bacteria 10691
769 Ga0496114_0014043 3300048917 Bacteria 6423
770 Ga0496114_0021689 3300048917 Bacteria 5226
771 Ga0496114_0055385 3300048917 Bacteria 3307
772 Ga0496114_0087299 3300048917 Bacteria 2645
773 Ga0496115_0004033 3300048918 Bacteria 10603
774 Ga0496115_0005460 3300048918 Bacteria 9247
775 Ga0496115_0128209 3300048918 Bacteria 2090
776 Ga0496115_0143409 3300048918 Bacteria 1970
777 Ga0496116_0006937 3300048919 Bacteria 10158
778 Ga0496116_0009097 3300048919 Bacteria 8515
779 Ga0496117_0000211 3300048920 Bacteria 112609
780 Ga0496117_0002066 3300048920 Bacteria 26549
781 Ga0496117_0059146 3300048920 Bacteria 2650
782 Ga0496118_0000005 3300048921 Bacteria 697350
783 Ga0496118_0001422 3300048921 Bacteria 36121
784 Ga0496118_0008974 3300048921 Bacteria 10198
785 Ga0496118_0093165 3300048921 Bacteria 2065
786 Ga0496119_0001007 3300048922 Bacteria 36111
787 Ga0496119_0020348 3300048922 Bacteria 4845
788 Ga0496120_0000242 3300048923 Bacteria 93148
789 Ga0496121_0000245 3300048924 Bacteria 116316
790 Ga0496121_0001299 3300048924 Bacteria 42922
791 Ga0496121_0001771 3300048924 Bacteria 35100
792 Ga0496121_0006402 3300048924 Bacteria 14641
793 Ga0496121_0016052 3300048924 Bacteria 7761
794 Ga0496121_0016227 3300048924 Bacteria 7707
795 Ga0496122_0043664 3300048925 Bacteria 3509
796 Ga0496123_0026983 3300048926 Bacteria 4288
797 Ga0496125_0000220 3300048928 Bacteria 116658
798 Ga0496125_0002613 3300048928 Bacteria 23120
799 Ga0496125_0017234 3300048928 Bacteria 6901
800 Ga0496125_0056000 3300048928 Bacteria 3206
801 Ga0496126_0000082 3300048929 Bacteria 218571
802 Ga0496126_0007294 3300048929 Bacteria 12146
803 Ga0496126_0012911 3300048929 Bacteria 8531
804 Ga0496126_0030405 3300048929 Bacteria 5117
805 Ga0496126_0070007 3300048929 Bacteria 3127
806 Ga0496126_0100817 3300048929 Bacteria 2526
807 Ga0496126_0228916 3300048929 Bacteria 1558
808 Ga0495678_046199 3300049459 Bacteria 1713
809 Ga0501031_0009449 3300049568 Bacteria 6339
810 Ga0501031_0017540 3300049568 Bacteria 4654
811 Ga0501032_0001352 3300049569 Bacteria 19486
812 Ga0501032_0016245 3300049569 Bacteria 5236
813 Ga0501032_0093024 3300049569 Bacteria 2000
814 Ga0501033_0002715 3300049570 Bacteria 14846
815 Ga0501033_0009073 3300049570 Bacteria 7672
816 Ga0501033_0014485 3300049570 Bacteria 5986
817 Ga0501033_0031456 3300049570 Bacteria 3988
818 Ga0501033_0044138 3300049570 Bacteria 3318
819 Ga0501033_0058023 3300049570 Bacteria 2860
820 Ga0501034_0006801 3300049571 Bacteria 12232
821 Ga0501034_0015328 3300049571 Bacteria 7879
822 Ga0501034_0043680 3300049571 Bacteria 4534
823 Ga0501034_0096216 3300049571 Bacteria 2957
824 Ga0501034_0096509 3300049571 Bacteria 2952
825 Ga0501034_0148802 3300049571 Bacteria 2318
826 Ga0501034_0273039 3300049571 Bacteria 1631
827 Ga0501036_0010613 3300049572 Bacteria 7609
828 Ga0501036_0015326 3300049572 Bacteria 6402
829 Ga0501036_0062996 3300049572 Bacteria 3140
830 Ga0501037_0002323 3300049573 Bacteria 13743
831 Ga0501037_0008734 3300049573 Bacteria 7425
832 Ga0501037_0030998 3300049573 Bacteria 3948
833 Ga0501038_0012761 3300049574 Bacteria 7675
834 Ga0501038_0019872 3300049574 Bacteria 6045
835 Ga0501038_0045082 3300049574 Bacteria 3828
836 Ga0501038_0058778 3300049574 Bacteria 3295
837 Ga0501038_0080373 3300049574 Bacteria 2748
838 Ga0501038_0081980 3300049574 Bacteria 2717
839 Ga0501039_0040228 3300049575 Bacteria 3609
840 Ga0501039_0056362 3300049575 Bacteria 3044
841 Ga0501042_0011333 3300049578 Bacteria 6013
842 Ga0501042_0054774 3300049578 Bacteria 2845
843 Ga0501042_0074421 3300049578 Bacteria 2431
844 Ga0501042_0100653 3300049578 Bacteria 2078
845 Ga0501042_0109130 3300049578 Bacteria 1992
846 Ga0501043_0022731 3300049579 Bacteria 4918
847 Ga0501043_0038345 3300049579 Bacteria 3767
848 Ga0501043_0038622 3300049579 Bacteria 3753
849 Ga0501043_0102213 3300049579 Bacteria 2253
850 Ga0501046_0000440 3300049580 Bacteria 41802
851 Ga0501046_0013547 3300049580 Bacteria 6898
852 Ga0501047_0017363 3300049581 Bacteria 6891
853 Ga0501047_0041195 3300049581 Bacteria 4463
854 Ga0501047_0075066 3300049581 Bacteria 3253
855 Ga0501047_0091725 3300049581 Bacteria 2916
856 Ga0501047_0124366 3300049581 Bacteria 2460
857 Ga0501047_0138227 3300049581 Bacteria 2315
858 Ga0501047_0204700 3300049581 Bacteria 1833
859 Ga0501047_0212777 3300049581 Bacteria 1791
860 Ga0501048_0003540 3300049582 Bacteria 11876
861 Ga0501048_0009975 3300049582 Bacteria 7111
862 Ga0501048_0054097 3300049582 Bacteria 2852
863 Ga0501067_0005392 3300049583 Bacteria 7102
864 Ga0501067_0023499 3300049583 Bacteria 3417
865 Ga0501067_0065926 3300049583 Bacteria 2005
866 Ga0501068_0013764 3300049584 Bacteria 4609
867 Ga0501068_0018284 3300049584 Bacteria 4060
868 Ga0501068_0026499 3300049584 Bacteria 3416
869 Ga0501069_0001873 3300049585 Bacteria 10513
870 Ga0501069_0097792 3300049585 Bacteria 1664
871 Ga0501070_0005021 3300049586 Bacteria 11287
872 Ga0501070_0020638 3300049586 Bacteria 5526
873 Ga0501070_0042508 3300049586 Bacteria 3785
874 Ga0501070_0044489 3300049586 Bacteria 3694
875 Ga0501070_0049291 3300049586 Bacteria 3497
876 Ga0501070_0050550 3300049586 Bacteria 3451
877 Ga0501071_0000964 3300049587 Bacteria 15695
878 Ga0501071_0052107 3300049587 Bacteria 2951
879 Ga0501071_0081063 3300049587 Bacteria 2374
880 Ga0501071_0167675 3300049587 Bacteria 1644
881 Ga0501072_0007154 3300049588 Bacteria 8462
882 Ga0501072_0037835 3300049588 Bacteria 3784
883 Ga0501072_0085303 3300049588 Bacteria 2505
884 Ga0501073_0004452 3300049589 Bacteria 10527
885 Ga0501073_0028934 3300049589 Bacteria 3958
886 Ga0501073_0034168 3300049589 Bacteria 3619
887 Ga0501073_0049326 3300049589 Bacteria 2952
888 Ga0501073_0103994 3300049589 Bacteria 1971
889 Ga0501073_0111102 3300049589 Bacteria 1901
890 Ga0501074_0000164 3300049590 Bacteria 35412
891 Ga0501074_0002061 3300049590 Bacteria 13892
892 Ga0501074_0017736 3300049590 Bacteria 5170
893 Ga0501074_0027835 3300049590 Bacteria 4097
894 Ga0501074_0097952 3300049590 Bacteria 2099
895 Ga0501074_0106853 3300049590 Bacteria 2004
896 Ga0501076_0003060 3300049592 Bacteria 11640
897 Ga0501077_0001810 3300049593 Bacteria 12912
898 Ga0501079_0000806 3300049741 Bacteria 21347
899 Ga0501079_0006265 3300049741 Bacteria 8924
900 Ga0501079_0018566 3300049741 Bacteria 5313
901 Ga0501080_0004388 3300049742 Bacteria 12531
902 Ga0501080_0021347 3300049742 Bacteria 5994
903 Ga0501080_0047414 3300049742 Bacteria 3999
904 Ga0501080_0068905 3300049742 Bacteria 3291
905 Ga0501080_0127202 3300049742 Bacteria 2359
906 Ga0501080_0131057 3300049742 Bacteria 2321
907 Ga0501080_0205331 3300049742 Bacteria 1807
908 Ga0501081_0047429 3300049743 Bacteria 2956
909 Ga0501081_0129275 3300049743 Bacteria 1804
910 Ga0501083_0002676 3300049744 Bacteria 12266
911 Ga0501083_0007870 3300049744 Bacteria 7551
912 Ga0501083_0017374 3300049744 Bacteria 5015
913 Ga0501035_0000595 3300049822 Bacteria 39851
914 Ga0501035_0004343 3300049822 Bacteria 13453
915 Ga0501035_0032187 3300049822 Bacteria 4772
916 Ga0501035_0034734 3300049822 Bacteria 4580
917 Ga0501044_0001080 3300049823 Bacteria 32578
918 Ga0501044_0001470 3300049823 Bacteria 27679
919 Ga0501044_0003782 3300049823 Bacteria 16994
920 Ga0501044_0009792 3300049823 Bacteria 10421
921 Ga0501044_0013472 3300049823 Bacteria 8843
922 Ga0501044_0037938 3300049823 Bacteria 5035
923 Ga0501044_0059359 3300049823 Bacteria 3919
924 Ga0501045_0017641 3300049824 Bacteria 5068
925 nmdc:mga03683_26791_c1 3300050489 Bacteria 2277
926 nmdc:mga03683_8566_c1 3300050489 Bacteria 3600
927 nmdc:mga03n38_11631_c1 3300050490 Bacteria 3287
928 nmdc:mga03n38_23432_c1 3300050490 Bacteria 2511
929 nmdc:mga03n38_557_c1 3300050490 Bacteria 9452
930 nmdc:mga00v17_104215_c1 3300050491 Bacteria 1793
931 nmdc:mga00v17_1591_c1 3300050491 Bacteria 11859
932 nmdc:mga00v17_6139_c1 3300050491 Bacteria 6011
933 nmdc:mga00v17_64745_c1 3300050491 Bacteria 2253
934 nmdc:mga00v17_6677_c1 3300050491 Bacteria 6130
935 nmdc:mga00v17_8643_c1 3300050491 Bacteria 5485
936 nmdc:mga0yw44_112001_c1 3300050492 Bacteria 1750
937 nmdc:mga0yw44_13053_c1 3300050492 Bacteria 4357
938 nmdc:mga0yw44_17806_c2 3300050492 Bacteria 2787
939 nmdc:mga0yw44_27806_c1 3300050492 Bacteria 3244
940 nmdc:mga0yw44_29570_c1 3300050492 Bacteria 3164
941 nmdc:mga0yw44_33599_c1 3300050492 Bacteria 2998
942 nmdc:mga0yw44_58716_c1 3300050492 Bacteria 2351
943 nmdc:mga0yw44_6559_c1 3300050492 Bacteria 5635
944 nmdc:mga0k408_23318_c1 3300050493 Bacteria 3489
945 nmdc:mga06z11_3678_c1 3300050494 Bacteria 5955
946 nmdc:mga06z11_60060_c1 3300050494 Bacteria 1978
947 nmdc:mga04h51_4676_c1 3300050495 Bacteria 3427
948 nmdc:mga04h51_6017_c1 3300050495 Bacteria 3124
949 nmdc:mga07m45_136846_c1 3300050496 Bacteria 1418
950 nmdc:mga07m45_1431_c1 3300050496 Bacteria 10940
951 nmdc:mga07m45_14526_c1 3300050496 Bacteria 4197
952 nmdc:mga07m45_15022_c1 3300050496 Bacteria 4135
953 nmdc:mga07m45_1612_c1 3300050496 Bacteria 10389
954 nmdc:mga07m45_22035_c1 3300050496 Bacteria 3476
955 nmdc:mga07m45_37676_c1 3300050496 Bacteria 2697
956 nmdc:mga05p37_411199_c1 3300050507 Bacteria 1577
957 nmdc:mga05p37_4665_c1 3300050507 Bacteria 16015
958 nmdc:mga09592_9512_c1 3300050508 Bacteria 7900
959 nmdc:mga0qj67_142782_c1 3300050509 Bacteria 1941
960 nmdc:mga0qj67_3934_c1 3300050509 Bacteria 10749
961 nmdc:mga06r32_3907_c1 3300050510 Bacteria 13362
962 nmdc:mga08y16_55772_c1 3300050511 Bacteria 4129
963 nmdc:mga0sz30_4483_c1 3300050516 Bacteria 4410
964 Ga0495601_0010824 3300053077 Bacteria 5442
965 Ga0495601_0062416 3300053077 Bacteria 2367
966 Ga0495655_0001453 3300053083 Bacteria 3626
967 Ga0495595_0000007 3300053084 Bacteria 228504
968 Ga0495595_0018898 3300053084 Bacteria 2984
969 Ga0495595_0050785 3300053084 Bacteria 1921
970 Ga0495619_0000067 3300053085 Bacteria 83418
971 Ga0495619_0020724 3300053085 Bacteria 4192
972 Ga0500578_0000011 3300053086 Bacteria 217243
973 Ga0500643_000008 3300053087 Bacteria 457931
974 Ga0500644_0000204 3300053088 Bacteria 35880
975 Ga0500583_0034679 3300053092 Bacteria 2245
976 Ga0500651_0002949 3300053093 Bacteria 9158
977 Ga0500566_0000162 3300053094 Bacteria 34256
978 Ga0500566_0008386 3300053094 Bacteria 6111
979 Ga0500556_0000317 3300053104 Bacteria 36403
980 Ga0500556_0001079 3300053104 Bacteria 13767
981 Ga0500593_002351 3300053117 Bacteria 6931
982 Ga0500593_010832 3300053117 Bacteria 3836
983 Ga0500595_003028 3300053119 Bacteria 7984
984 Ga0500607_038321 3300053121 Bacteria 2609
985 Ga0500617_023549 3300053124 Bacteria 2723
986 Ga0500628_000798 3300053129 Bacteria 5590
987 Ga0500652_000189 3300053131 Bacteria 23838
988 Ga0500658_0008263 3300053134 Bacteria 3846
989 Ga0500559_0000097 3300053136 Bacteria 70124
990 Ga0500559_0012325 3300053136 Bacteria 3636
991 Ga0500568_0004967 3300053139 Bacteria 6989
992 Ga0500588_0000286 3300053146 Bacteria 7441
993 Ga0500590_000044 3300053148 Bacteria 29977
994 Ga0500590_025761 3300053148 Bacteria 3054
995 Ga0500616_0000491 3300053153 Bacteria 51066
996 Ga0500616_0018420 3300053153 Bacteria 3948
997 Ga0500622_0000097 3300053156 Bacteria 89802
998 Ga0500622_0000434 3300053156 Bacteria 39656
999 Ga0500622_0000978 3300053156 Bacteria 24237
1000 Ga0500622_0001119 3300053156 Bacteria 22384
1001 Ga0500622_0007159 3300053156 Bacteria 6361
1002 Ga0500633_0000920 3300053160 Bacteria 5140
1003 Ga0500645_001558 3300053730 Bacteria 11410
1004 Ga0500587_001071 3300053739 Bacteria 3744
1005 Ga0501084_0001034 3300054114 Bacteria 21610
1006 Ga0501084_0005366 3300054114 Bacteria 10507
1007 Ga0501084_0024439 3300054114 Bacteria 5040
1008 Ga0501082_0001324 3300060353 Bacteria 21681
1009 Ga0501082_0002035 3300060353 Bacteria 17775
1010 Ga0501082_0004992 3300060353 Bacteria 11584
1011 Ga0501082_0067845 3300060353 Bacteria 3072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006186 Ga0075369_10018822 Ga0075369_100188222 447
2 3300050516 nmdc:mga0sz30_4483_c1 nmdc:mga0sz30_4483_c1_2223_3665 447
3 3300050496 nmdc:mga07m45_136846_c1 nmdc:mga07m45_136846_c1_29_1393 454
4 3300030745 Ga0316182_1299158 Ga0316182_12991582 456
5 3300006051 Ga0075364_10068764 Ga0075364_100687642 460
6 3300050491 nmdc:mga00v17_8643_c1 nmdc:mga00v17_8643_c1_3543_4979 460
7 3300009101 Ga0105247_10014662 Ga0105247_100146625 463
8 3300044719 Ga0466971_0073324 Ga0466971_0073324_153_1544 463
9 3300048928 Ga0496125_0000220 Ga0496125_0000220_98893_100284 463
10 3300048929 Ga0496126_0030405 Ga0496126_0030405_3344_4735 463
11 iso_pu_bacteria 2738543034 2739362073 463
12 3300005329 Ga0070683_100008299 Ga0070683_1000082994 464
13 3300005337 Ga0070682_100003688 Ga0070682_1000036888 464
14 3300005535 Ga0070684_100004622 Ga0070684_1000046227 464
15 3300005614 Ga0068856_100132386 Ga0068856_1001323863 464
16 3300006881 Ga0068865_100010323 Ga0068865_1000103233 464
17 3300025899 Ga0207642_10013793 Ga0207642_100137932 464
18 3300025909 Ga0207705_10024663 Ga0207705_100246635 464
19 3300025927 Ga0207687_10005646 Ga0207687_100056469 464
20 3300025938 Ga0207704_10057054 Ga0207704_100570543 464
21 3300025944 Ga0207661_10039718 Ga0207661_100397183 464
22 3300026078 Ga0207702_10278556 Ga0207702_102785561 464
23 3300028381 Ga0268264_10144640 Ga0268264_101446402 464
24 3300048924 Ga0496121_0001299 Ga0496121_0001299_17003_18421 464
25 3300006038 Ga0075365_10053282 Ga0075365_100532821 465
26 3300009098 Ga0105245_10068852 Ga0105245_100688523 466
27 3300009553 Ga0105249_10034441 Ga0105249_100344414 466
28 3300010375 Ga0105239_10019971 Ga0105239_100199713 466
29 3300011119 Ga0105246_10003455 Ga0105246_100034556 466
30 3300013307 Ga0157372_10006775 Ga0157372_100067755 466
31 3300013308 Ga0157375_10008041 Ga0157375_100080416 466
32 3300014497 Ga0182008_10035582 Ga0182008_100355822 466
33 3300014968 Ga0157379_10007099 Ga0157379_1000709911 466
34 3300026121 Ga0207683_10169056 Ga0207683_101690562 466
35 3300044684 Ga0466966_0006687 Ga0466966_0006687_3090_4490 466
36 3300044693 Ga0466961_0021280 Ga0466961_0021280_607_2007 466
37 3300044694 Ga0466963_0115462 Ga0466963_0115462_366_1766 466
38 3300044765 Ga0466970_0052692 Ga0466970_0052692_446_1846 466
39 3300045836 Ga0466958_0014007 Ga0466958_0014007_710_2110 466
40 3300048911 Ga0496108_0047157 Ga0496108_0047157_1880_3319 466
41 3300048913 Ga0496110_0062681 Ga0496110_0062681_1758_3197 466
42 3300053153 Ga0500616_0000491 Ga0500616_0000491_38328_39764 466
43 3300006844 Ga0075428_100073956 Ga0075428_1000739562 467
44 3300049586 Ga0501070_0050550 Ga0501070_0050550_1264_2697 467
45 3300049587 Ga0501071_0167675 Ga0501071_0167675_46_1563 467
46 3300050507 nmdc:mga05p37_411199_c1 nmdc:mga05p37_411199_c1_76_1506 467
47 3300050509 nmdc:mga0qj67_142782_c1 nmdc:mga0qj67_142782_c1_206_1705 467
48 3300037466 Ga0395898_0024464 Ga0395898_0024464_2658_4064 468
49 3300046517 Ga0495630_0107710 Ga0495630_0107710_676_2082 468
50 3300005340 Ga0070689_100083681 Ga0070689_1000836813 469
51 3300005354 Ga0070675_100025410 Ga0070675_1000254103 469
52 3300005543 Ga0070672_100040468 Ga0070672_1000404681 469
53 3300005614 Ga0068856_100192913 Ga0068856_1001929132 469
54 3300005615 Ga0070702_100116255 Ga0070702_1001162551 469
55 3300005718 Ga0068866_10016882 Ga0068866_100168823 469
56 3300005937 Ga0081455_10033753 Ga0081455_100337535 469
57 3300005983 Ga0081540_1005379 Ga0081540_10053794 469
58 3300007788 Ga0099795_10000213 Ga0099795_100002136 469
59 3300009148 Ga0105243_10038713 Ga0105243_100387134 469
60 3300009176 Ga0105242_10021791 Ga0105242_100217914 469
61 3300013308 Ga0157375_10038969 Ga0157375_100389691 469
62 3300014325 Ga0163163_10192228 Ga0163163_101922281 469
63 3300017792 Ga0163161_10055223 Ga0163161_100552231 469
64 3300025900 Ga0207710_10011463 Ga0207710_100114633 469
65 3300025901 Ga0207688_10001626 Ga0207688_100016264 469
66 3300025915 Ga0207693_10052265 Ga0207693_100522652 469
67 3300025942 Ga0207689_10033405 Ga0207689_100334054 469
68 3300026035 Ga0207703_10064578 Ga0207703_100645781 469
69 3300026075 Ga0207708_10002529 Ga0207708_1000252910 469
70 3300026089 Ga0207648_10078057 Ga0207648_100780571 469
71 3300026095 Ga0207676_10031838 Ga0207676_100318382 469
72 3300026142 Ga0207698_10153374 Ga0207698_101533741 469
73 3300028794 Ga0307515_10176786 Ga0307515_101767861 469
74 3300035116 Ga0373945_0013158 Ga0373945_0013158_452_1861 469
75 3300035171 Ga0373946_0021708 Ga0373946_0021708_698_2107 469
76 3300039450 Ga0436363_0481565 Ga0436363_0481565_1081_2490 469
77 3300044901 Ga0466960_0023325 Ga0466960_0023325_397_1851 469
78 3300046473 Ga0495582_0038368 Ga0495582_0038368_880_2289 469
79 3300046522 Ga0495643_0033054 Ga0495643_0033054_206_1618 469
80 3300046531 Ga0495665_0056714 Ga0495665_0056714_637_2046 469
81 3300046694 Ga0495649_0106081 Ga0495649_0106081_13_1425 469
82 3300048905 Ga0496102_0040624 Ga0496102_0040624_1524_2933 469
83 3300048907 Ga0496104_0052297 Ga0496104_0052297_154_1563 469
84 3300048908 Ga0496105_0011580 Ga0496105_0011580_5520_6929 469
85 3300048910 Ga0496107_0002401 Ga0496107_0002401_3953_5362 469
86 3300048911 Ga0496108_0006730 Ga0496108_0006730_7700_9109 469
87 3300048913 Ga0496110_0003748 Ga0496110_0003748_7755_9164 469
88 3300048914 Ga0496111_0004320 Ga0496111_0004320_4257_5666 469
89 3300048916 Ga0496113_0009214 Ga0496113_0009214_522_1931 469
90 3300048917 Ga0496114_0087299 Ga0496114_0087299_270_1679 469
91 3300048918 Ga0496115_0128209 Ga0496115_0128209_508_1917 469
92 3300050492 nmdc:mga0yw44_13053_c1 nmdc:mga0yw44_13053_c1_2110_3519 469
93 3300050492 nmdc:mga0yw44_27806_c1 nmdc:mga0yw44_27806_c1_654_2063 469
94 3300050511 nmdc:mga08y16_55772_c1 nmdc:mga08y16_55772_c1_1636_3045 469
95 3300053084 Ga0495595_0018898 Ga0495595_0018898_89_1498 469
96 3300053084 Ga0495595_0050785 Ga0495595_0050785_115_1524 469
97 3300007265 Ga0099794_10066949 Ga0099794_100669492 470
98 3300031995 Ga0307409_100028358 Ga0307409_1000283582 470
99 3300037312 Ga0395899_0047305 Ga0395899_0047305_1502_2914 470
100 3300049569 Ga0501032_0001352 Ga0501032_0001352_2077_3498 470
101 3300049571 Ga0501034_0096509 Ga0501034_0096509_1382_2821 470
102 3300049573 Ga0501037_0030998 Ga0501037_0030998_1583_3004 470
103 3300049574 Ga0501038_0058778 Ga0501038_0058778_1648_3069 470
104 3300049579 Ga0501043_0022731 Ga0501043_0022731_241_1662 470
105 3300049581 Ga0501047_0124366 Ga0501047_0124366_535_1974 470
106 3300049582 Ga0501048_0054097 Ga0501048_0054097_423_1847 470
107 3300049586 Ga0501070_0005021 Ga0501070_0005021_3049_4470 470
108 3300049587 Ga0501071_0081063 Ga0501071_0081063_441_1880 470
109 3300049589 Ga0501073_0028934 Ga0501073_0028934_638_2077 470
110 3300049590 Ga0501074_0017736 Ga0501074_0017736_739_2160 470
111 3300049742 Ga0501080_0021347 Ga0501080_0021347_1019_2458 470
112 3300049742 Ga0501080_0131057 Ga0501080_0131057_833_2254 470
113 3300049822 Ga0501035_0034734 Ga0501035_0034734_387_1808 470
114 3300049823 Ga0501044_0001080 Ga0501044_0001080_29658_31079 470
115 3300050491 nmdc:mga00v17_64745_c1 nmdc:mga00v17_64745_c1_535_2007 470
116 3300054114 Ga0501084_0024439 Ga0501084_0024439_112_1551 470
117 iso_pu_bacteria 2643221561 2643825025 470
118 iso_pu_bacteria 2643221696 2644534668 470
119 iso_pu_bacteria 2818991318 2819425480 470
120 iso_pu_bacteria 2818991458 2819667850 470
121 iso_pu_bacteria 2818991462 2819690248 470
122 iso_pu_bacteria 2818991469 2819726204 470
123 3300009093 Ga0105240_10011928 Ga0105240_100119288 471
124 3300009101 Ga0105247_10002551 Ga0105247_1000255110 471
125 3300009545 Ga0105237_10187773 Ga0105237_101877732 471
126 3300009551 Ga0105238_10010367 Ga0105238_100103675 471
127 3300013306 Ga0163162_10250446 Ga0163162_102504462 471
128 3300014325 Ga0163163_10016691 Ga0163163_100166913 471
129 3300014968 Ga0157379_10008491 Ga0157379_100084917 471
130 3300025933 Ga0207706_10003325 Ga0207706_100033257 471
131 3300026035 Ga0207703_10001166 Ga0207703_100011668 471
132 3300026088 Ga0207641_10001175 Ga0207641_100011756 471
133 3300028786 Ga0307517_10065457 Ga0307517_100654572 471
134 3300031456 Ga0307513_10015253 Ga0307513_100152532 471
135 3300031507 Ga0307509_10021431 Ga0307509_100214313 471
136 3300037466 Ga0395898_0004666 Ga0395898_0004666_2850_4265 471
137 3300041451 Ga0451791_0356334 Ga0451791_0356334_901_2331 471
138 3300045049 Ga0466959_0061889 Ga0466959_0061889_1044_2459 471
139 3300046660 Ga0495625_0030593 Ga0495625_0030593_661_2076 471
140 3300046694 Ga0495649_0070413 Ga0495649_0070413_95_1510 471
141 3300048905 Ga0496102_0042726 Ga0496102_0042726_203_1618 471
142 3300048915 Ga0496112_0061691 Ga0496112_0061691_806_2221 471
143 3300048922 Ga0496119_0001007 Ga0496119_0001007_14408_15823 471
144 3300048923 Ga0496120_0000242 Ga0496120_0000242_31929_33344 471
145 3300048924 Ga0496121_0001771 Ga0496121_0001771_28362_29777 471
146 3300048928 Ga0496125_0002613 Ga0496125_0002613_9441_10856 471
147 3300053139 Ga0500568_0004967 Ga0500568_0004967_5441_6856 471
148 3300053153 Ga0500616_0018420 Ga0500616_0018420_205_1620 471
149 iso_pu_bacteria 2857481737 2857485428 471
150 3300005471 Ga0070698_100001386 Ga0070698_10000138613 472
151 3300007265 Ga0099794_10001837 Ga0099794_100018377 472
152 3300007265 Ga0099794_10006637 Ga0099794_100066372 472
153 3300009093 Ga0105240_10000587 Ga0105240_1000058728 472
154 3300009093 Ga0105240_10002394 Ga0105240_1000239414 472
155 3300009093 Ga0105240_10223337 Ga0105240_102233372 472
156 3300013308 Ga0157375_10030639 Ga0157375_100306393 472
157 3300021388 Ga0213875_10020700 Ga0213875_100207002 472
158 3300037853 Ga0436364_0748817 Ga0436364_0748817_722_2140 472
159 3300042015 Ga0439462_0017763 Ga0439462_0017763_257_1687 472
160 3300046455 Ga0495603_0098352 Ga0495603_0098352_86_1504 472
161 3300046506 Ga0495583_0069357 Ga0495583_0069357_23_1441 472
162 3300046660 Ga0495625_0109271 Ga0495625_0109271_67_1485 472
163 3300047321 Ga0495676_0089584 Ga0495676_0089584_321_1739 472
164 3300048919 Ga0496116_0009097 Ga0496116_0009097_2710_4128 472
165 3300048920 Ga0496117_0000211 Ga0496117_0000211_19697_21115 472
166 3300048921 Ga0496118_0000005 Ga0496118_0000005_564254_565672 472
167 3300048922 Ga0496119_0020348 Ga0496119_0020348_3379_4797 472
168 3300048928 Ga0496125_0017234 Ga0496125_0017234_342_1760 472
169 3300053104 Ga0500556_0001079 Ga0500556_0001079_5543_6979 472
170 iso_pu_bacteria 2739367898 2740167923 472
171 3300006051 Ga0075364_10020301 Ga0075364_100203013 473
172 3300006844 Ga0075428_100001401 Ga0075428_1000014015 473
173 3300006846 Ga0075430_100004725 Ga0075430_1000047252 473
174 3300006847 Ga0075431_100004352 Ga0075431_1000043524 473
175 3300006880 Ga0075429_100001477 Ga0075429_10000147711 473
176 3300009147 Ga0114129_10001245 Ga0114129_100012455 473
177 3300014968 Ga0157379_10037973 Ga0157379_100379732 473
178 3300046557 Ga0495622_0000566 Ga0495622_0000566_9765_11186 473
179 3300047320 Ga0495672_0001753 Ga0495672_0001753_10779_12260 473
180 3300047322 Ga0495680_0152583 Ga0495680_0152583_245_1669 473
181 3300048926 Ga0496123_0026983 Ga0496123_0026983_2838_4259 473
182 3300049571 Ga0501034_0096216 Ga0501034_0096216_251_1672 473
183 3300049584 Ga0501068_0013764 Ga0501068_0013764_3126_4547 473
184 3300049585 Ga0501069_0097792 Ga0501069_0097792_186_1607 473
185 3300049586 Ga0501070_0020638 Ga0501070_0020638_1971_3392 473
186 3300049587 Ga0501071_0000964 Ga0501071_0000964_10642_12063 473
187 3300049588 Ga0501072_0037835 Ga0501072_0037835_2203_3624 473
188 3300049589 Ga0501073_0004452 Ga0501073_0004452_2862_4283 473
189 3300049590 Ga0501074_0002061 Ga0501074_0002061_2965_4386 473
190 3300049592 Ga0501076_0003060 Ga0501076_0003060_2245_3666 473
191 3300049741 Ga0501079_0000806 Ga0501079_0000806_6348_7769 473
192 3300049742 Ga0501080_0004388 Ga0501080_0004388_6213_7634 473
193 3300049742 Ga0501080_0127202 Ga0501080_0127202_353_1774 473
194 3300049744 Ga0501083_0007870 Ga0501083_0007870_5867_7288 473
195 3300050491 nmdc:mga00v17_1591_c1 nmdc:mga00v17_1591_c1_7808_9262 473
196 3300050507 nmdc:mga05p37_4665_c1 nmdc:mga05p37_4665_c1_7312_8742 473
197 3300050508 nmdc:mga09592_9512_c1 nmdc:mga09592_9512_c1_4869_6299 473
198 3300050509 nmdc:mga0qj67_3934_c1 nmdc:mga0qj67_3934_c1_6843_8273 473
199 3300050510 nmdc:mga06r32_3907_c1 nmdc:mga06r32_3907_c1_4661_6091 473
200 3300054114 Ga0501084_0005366 Ga0501084_0005366_1497_2918 473
201 3300060353 Ga0501082_0004992 Ga0501082_0004992_1415_2836 473
202 iso_pu_bacteria 2643221615 2644092719 473
203 iso_pu_bacteria 2643221657 2644322332 473
204 3300005329 Ga0070683_100061774 Ga0070683_1000617742 474
205 3300005338 Ga0068868_100223581 Ga0068868_1002235811 474
206 3300005345 Ga0070692_10007517 Ga0070692_100075176 474
207 3300005438 Ga0070701_10038650 Ga0070701_100386502 474
208 3300005459 Ga0068867_100001469 Ga0068867_1000014699 474
209 3300005543 Ga0070672_100001159 Ga0070672_10000115910 474
210 3300005544 Ga0070686_100021257 Ga0070686_1000212572 474
211 3300005563 Ga0068855_100136947 Ga0068855_1001369472 474
212 3300005615 Ga0070702_100019013 Ga0070702_1000190132 474
213 3300005616 Ga0068852_100004825 Ga0068852_1000048254 474
214 3300005719 Ga0068861_100004568 Ga0068861_1000045687 474
215 3300005840 Ga0068870_10016817 Ga0068870_100168171 474
216 3300009098 Ga0105245_10003386 Ga0105245_100033861 474
217 3300010375 Ga0105239_10153090 Ga0105239_101530902 474
218 3300025901 Ga0207688_10006136 Ga0207688_100061367 474
219 3300025908 Ga0207643_10024032 Ga0207643_100240322 474
220 3300025914 Ga0207671_10138007 Ga0207671_101380072 474
221 3300025935 Ga0207709_10003330 Ga0207709_100033303 474
222 3300025938 Ga0207704_10022274 Ga0207704_100222742 474
223 3300025940 Ga0207691_10002487 Ga0207691_100024873 474
224 3300025960 Ga0207651_10218098 Ga0207651_102180981 474
225 3300026075 Ga0207708_10049932 Ga0207708_100499322 474
226 3300026089 Ga0207648_10000550 Ga0207648_100005509 474
227 3300026118 Ga0207675_100017246 Ga0207675_1000172464 474
228 3300026142 Ga0207698_10019128 Ga0207698_100191282 474
229 3300027907 Ga0207428_10097293 Ga0207428_100972932 474
230 3300045976 Ga0466967_0043364 Ga0466967_0043364_1197_2630 474
231 3300048911 Ga0496108_0072384 Ga0496108_0072384_62_1498 474
232 3300049571 Ga0501034_0006801 Ga0501034_0006801_1662_3137 474
233 3300049571 Ga0501034_0148802 Ga0501034_0148802_285_1712 474
234 3300053094 Ga0500566_0008386 Ga0500566_0008386_3261_4694 474
235 3300006038 Ga0075365_10016962 Ga0075365_100169623 475
236 3300006042 Ga0075368_10014667 Ga0075368_100146673 475
237 3300006048 Ga0075363_100004619 Ga0075363_1000046195 475
238 3300006051 Ga0075364_10003803 Ga0075364_100038037 475
239 3300009148 Ga0105243_10160217 Ga0105243_101602172 475
240 3300014326 Ga0157380_10131909 Ga0157380_101319092 475
241 3300025935 Ga0207709_10009011 Ga0207709_100090117 475
242 3300044765 Ga0466970_0046920 Ga0466970_0046920_532_1968 475
243 3300048907 Ga0496104_0202856 Ga0496104_0202856_12_1448 475
244 3300048908 Ga0496105_0018169 Ga0496105_0018169_2055_3491 475
245 3300048910 Ga0496107_0106667 Ga0496107_0106667_113_1549 475
246 3300048917 Ga0496114_0004625 Ga0496114_0004625_3429_4865 475
247 3300050490 nmdc:mga03n38_23432_c1 nmdc:mga03n38_23432_c1_526_1956 475
248 3300050492 nmdc:mga0yw44_112001_c1 nmdc:mga0yw44_112001_c1_150_1592 475
249 3300053094 Ga0500566_0000162 Ga0500566_0000162_939_2369 475
250 iso_pu_bacteria 2643221576 2643893200 475
251 iso_pu_bacteria 2643221590 2643961741 475
252 iso_pu_bacteria 2643221637 2644207894 475
253 iso_pu_bacteria 2643221718 2644651169 475
254 3300005548 Ga0070665_100000566 Ga0070665_10000056630 476
255 3300005563 Ga0068855_100048599 Ga0068855_1000485997 476
256 3300005616 Ga0068852_100080734 Ga0068852_1000807342 476
257 3300006038 Ga0075365_10019010 Ga0075365_100190104 476
258 3300014745 Ga0157377_10045571 Ga0157377_100455712 476
259 3300025949 Ga0207667_10034807 Ga0207667_100348073 476
260 3300028379 Ga0268266_10000596 Ga0268266_100005969 476
261 3300038443 Ga0395901_0245307 Ga0395901_0245307_284_1735 476
262 3300044683 Ga0466965_0021990 Ga0466965_0021990_1254_2702 476
263 3300044683 Ga0466965_0037781 Ga0466965_0037781_114_1556 476
264 3300044901 Ga0466960_0056478 Ga0466960_0056478_207_1649 476
265 3300045976 Ga0466967_0023032 Ga0466967_0023032_1019_2458 476
266 3300046455 Ga0495603_0051288 Ga0495603_0051288_378_1817 476
267 3300046477 Ga0495664_0105373 Ga0495664_0105373_168_1613 476
268 3300048907 Ga0496104_0048594 Ga0496104_0048594_1699_3138 476
269 3300048908 Ga0496105_0011401 Ga0496105_0011401_2216_3655 476
270 3300048908 Ga0496105_0082879 Ga0496105_0082879_581_2011 476
271 3300048912 Ga0496109_0042602 Ga0496109_0042602_455_1894 476
272 3300048912 Ga0496109_0062929 Ga0496109_0062929_911_2350 476
273 3300048913 Ga0496110_0220366 Ga0496110_0220366_178_1617 476
274 3300048917 Ga0496114_0021689 Ga0496114_0021689_1536_2975 476
275 3300048918 Ga0496115_0005460 Ga0496115_0005460_2140_3579 476
276 3300049570 Ga0501033_0009073 Ga0501033_0009073_1050_2483 476
277 3300049571 Ga0501034_0015328 Ga0501034_0015328_3122_4561 476
278 3300049574 Ga0501038_0080373 Ga0501038_0080373_1221_2660 476
279 3300049588 Ga0501072_0007154 Ga0501072_0007154_4465_5904 476
280 3300049589 Ga0501073_0049326 Ga0501073_0049326_726_2165 476
281 3300049590 Ga0501074_0000164 Ga0501074_0000164_13963_15402 476
282 3300049593 Ga0501077_0001810 Ga0501077_0001810_2740_4179 476
283 3300049741 Ga0501079_0006265 Ga0501079_0006265_647_2086 476
284 3300049744 Ga0501083_0002676 Ga0501083_0002676_8764_10203 476
285 3300049823 Ga0501044_0003782 Ga0501044_0003782_13103_14536 476
286 3300050490 nmdc:mga03n38_11631_c1 nmdc:mga03n38_11631_c1_638_2080 476
287 3300050492 nmdc:mga0yw44_17806_c2 nmdc:mga0yw44_17806_c2_1179_2621 476
288 3300050492 nmdc:mga0yw44_58716_c1 nmdc:mga0yw44_58716_c1_644_2086 476
289 3300050492 nmdc:mga0yw44_6559_c1 nmdc:mga0yw44_6559_c1_932_2374 476
290 3300050495 nmdc:mga04h51_4676_c1 nmdc:mga04h51_4676_c1_1412_2854 476
291 3300053077 Ga0495601_0010824 Ga0495601_0010824_561_2006 476
292 3300060353 Ga0501082_0001324 Ga0501082_0001324_17006_18445 476
293 3300005329 Ga0070683_100167254 Ga0070683_1001672542 477
294 3300005337 Ga0070682_100000061 Ga0070682_10000006149 477
295 3300010375 Ga0105239_10022212 Ga0105239_100222123 477
296 3300014745 Ga0157377_10036186 Ga0157377_100361863 477
297 3300025981 Ga0207640_10000077 Ga0207640_100000772 477
298 3300031727 Ga0316576_10006578 Ga0316576_100065785 477
299 3300031995 Ga0307409_100097567 Ga0307409_1000975672 477
300 3300046457 Ga0495590_0031669 Ga0495590_0031669_73_1536 477
301 3300046463 Ga0495653_0004980 Ga0495653_0004980_756_2204 477
302 3300046511 Ga0495608_0145297 Ga0495608_0145297_30_1466 477
303 3300049568 Ga0501031_0017540 Ga0501031_0017540_1456_2901 477
304 3300049570 Ga0501033_0002715 Ga0501033_0002715_4653_6104 477
305 3300049586 Ga0501070_0044489 Ga0501070_0044489_1966_3411 477
306 3300049587 Ga0501071_0052107 Ga0501071_0052107_211_1656 477
307 3300049743 Ga0501081_0129275 Ga0501081_0129275_151_1596 477
308 3300049824 Ga0501045_0017641 Ga0501045_0017641_298_1743 477
309 3300050492 nmdc:mga0yw44_29570_c1 nmdc:mga0yw44_29570_c1_788_2233 477
310 3300053085 Ga0495619_0000067 Ga0495619_0000067_14983_16458 477
311 3300053104 Ga0500556_0000317 Ga0500556_0000317_20166_21611 477
312 3300053117 Ga0500593_010832 Ga0500593_010832_900_2345 477
313 iso_pu_bacteria 2643221604 2644034069 477
314 3300005543 Ga0070672_100000005 Ga0070672_10000000556 478
315 3300025916 Ga0207663_10017023 Ga0207663_100170234 478
316 3300025940 Ga0207691_10000028 Ga0207691_1000002874 478
317 3300026023 Ga0207677_10000929 Ga0207677_100009298 478
318 3300037418 Ga0395900_0014634 Ga0395900_0014634_473_1921 478
319 3300037471 Ga0395905_0102329 Ga0395905_0102329_889_2334 478
320 3300045976 Ga0466967_0062820 Ga0466967_0062820_1711_3201 478
321 3300046507 Ga0495606_0000895 Ga0495606_0000895_9386_10855 478
322 3300046511 Ga0495608_0000013 Ga0495608_0000013_191496_192980 478
323 3300046675 Ga0495657_0000003 Ga0495657_0000003_242695_244179 478
324 3300047444 Ga0495675_0000094 Ga0495675_0000094_35502_36986 478
325 3300048911 Ga0496108_0003961 Ga0496108_0003961_4169_5638 478
326 3300048912 Ga0496109_0000011 Ga0496109_0000011_61590_63059 478
327 3300053083 Ga0495655_0001453 Ga0495655_0001453_645_2126 478
328 3300053084 Ga0495595_0000007 Ga0495595_0000007_191519_193003 478
329 iso_pu_bacteria 2643221617 2644099492 478
330 iso_pu_bacteria 2643221620 2644116315 478
331 iso_pu_bacteria 2738541305 2738871271 478
332 iso_pu_bacteria 2811994874 2812333868 478
333 3300025928 Ga0207700_10039730 Ga0207700_100397302 479
334 3300031548 Ga0307408_100000006 Ga0307408_100000006207 479
335 3300037418 Ga0395900_0151595 Ga0395900_0151595_747_2195 479
336 3300037466 Ga0395898_0150511 Ga0395898_0150511_757_2205 479
337 3300044765 Ga0466970_0018274 Ga0466970_0018274_995_2467 479
338 3300044901 Ga0466960_0014516 Ga0466960_0014516_124_1575 479
339 3300049581 Ga0501047_0091725 Ga0501047_0091725_824_2293 479
340 3300049822 Ga0501035_0000595 Ga0501035_0000595_24926_26395 479
341 3300049823 Ga0501044_0001470 Ga0501044_0001470_12664_14133 479
342 3300014325 Ga0163163_10037049 Ga0163163_100370492 480
343 3300046454 Ga0495592_0000203 Ga0495592_0000203_26698_28140 480
344 3300046471 Ga0495650_0012066 Ga0495650_0012066_1975_3438 480
345 3300047471 Ga0495684_0056481 Ga0495684_0056481_67_1554 480
346 3300050491 nmdc:mga00v17_104215_c1 nmdc:mga00v17_104215_c1_58_1698 480
347 3300050492 nmdc:mga0yw44_33599_c1 nmdc:mga0yw44_33599_c1_140_1582 480
348 3300053085 Ga0495619_0020724 Ga0495619_0020724_136_1623 480
349 3300053136 Ga0500559_0012325 Ga0500559_0012325_2043_3527 480
350 3300053148 Ga0500590_025761 Ga0500590_025761_201_1643 480
351 3300053730 Ga0500645_001558 Ga0500645_001558_2965_4485 480
352 3300053739 Ga0500587_001071 Ga0500587_001071_1425_2867 480
353 iso_pu_bacteria 2617270742 2617386532 480
354 iso_pu_bacteria 2894652903 2894657232 480
355 3300028794 Ga0307515_10065339 Ga0307515_100653393 481
356 3300037312 Ga0395899_0058632 Ga0395899_0058632_289_1767 481
357 3300037418 Ga0395900_0006806 Ga0395900_0006806_5160_6638 481
358 3300038443 Ga0395901_0020172 Ga0395901_0020172_372_1850 481
359 3300044683 Ga0466965_0026025 Ga0466965_0026025_208_1662 481
360 3300044842 Ga0466957_0019120 Ga0466957_0019120_499_1953 481
361 3300045976 Ga0466967_0073790 Ga0466967_0073790_317_1771 481
362 3300049743 Ga0501081_0047429 Ga0501081_0047429_1282_2760 481
363 3300060353 Ga0501082_0067845 Ga0501082_0067845_998_2476 481
364 iso_pu_bacteria 2519899620 2520375415 481
365 iso_pu_bacteria 2582581294 2585205188 481
366 iso_pu_bacteria 2751185725 2753036132 481
367 iso_pu_bacteria 2751185792 2753324004 481
368 iso_pu_bacteria 2842363717 2842365603 481
369 iso_pu_bacteria 2909042592 2909048386 481
370 3300005365 Ga0070688_100062643 Ga0070688_1000626432 482
371 3300005842 Ga0068858_100040576 Ga0068858_1000405762 482
372 3300005843 Ga0068860_100000470 Ga0068860_10000047031 482
373 3300005937 Ga0081455_10050302 Ga0081455_100503023 482
374 3300005981 Ga0081538_10000022 Ga0081538_1000002223 482
375 3300006038 Ga0075365_10001309 Ga0075365_100013096 482
376 3300006038 Ga0075365_10046261 Ga0075365_100462612 482
377 3300006042 Ga0075368_10001032 Ga0075368_100010326 482
378 3300006042 Ga0075368_10009161 Ga0075368_100091612 482
379 3300006048 Ga0075363_100008063 Ga0075363_1000080632 482
380 3300006048 Ga0075363_100014602 Ga0075363_1000146023 482
381 3300006051 Ga0075364_10017125 Ga0075364_100171252 482
382 3300006051 Ga0075364_10032639 Ga0075364_100326391 482
383 3300006175 Ga0070712_100044730 Ga0070712_1000447302 482
384 3300006175 Ga0070712_100059186 Ga0070712_1000591863 482
385 3300006178 Ga0075367_10004567 Ga0075367_100045674 482
386 3300006178 Ga0075367_10005175 Ga0075367_100051752 482
387 3300006353 Ga0075370_10002885 Ga0075370_100028854 482
388 3300006353 Ga0075370_10007701 Ga0075370_100077014 482
389 3300006847 Ga0075431_100133566 Ga0075431_1001335662 482
390 3300009094 Ga0111539_10212266 Ga0111539_102122662 482
391 3300014968 Ga0157379_10022185 Ga0157379_100221854 482
392 3300014969 Ga0157376_10013434 Ga0157376_100134342 482
393 3300026035 Ga0207703_10033934 Ga0207703_100339341 482
394 3300027866 Ga0209813_10000255 Ga0209813_1000025512 482
395 3300027866 Ga0209813_10004191 Ga0209813_100041912 482
396 3300028381 Ga0268264_10000420 Ga0268264_1000042018 482
397 3300035691 Ga0373931_0010537 Ga0373931_0010537_1665_3140 482
398 3300039437 Ga0436365_1619143 Ga0436365_1619143_819_2285 482
399 3300048904 Ga0496101_0002555 Ga0496101_0002555_6126_7601 482
400 3300048904 Ga0496101_0060520 Ga0496101_0060520_1073_2524 482
401 3300048905 Ga0496102_0044793 Ga0496102_0044793_1527_2993 482
402 3300048905 Ga0496102_0104688 Ga0496102_0104688_648_2099 482
403 3300048907 Ga0496104_0098459 Ga0496104_0098459_1270_2745 482
404 3300048908 Ga0496105_0057220 Ga0496105_0057220_620_2086 482
405 3300048912 Ga0496109_0141433 Ga0496109_0141433_429_1895 482
406 3300048913 Ga0496110_0040232 Ga0496110_0040232_2132_3598 482
407 3300048913 Ga0496110_0044209 Ga0496110_0044209_956_2419 482
408 3300048914 Ga0496111_0031555 Ga0496111_0031555_1776_3239 482
409 3300048914 Ga0496111_0055314 Ga0496111_0055314_777_2243 482
410 3300048916 Ga0496113_0043947 Ga0496113_0043947_1144_2607 482
411 3300048917 Ga0496114_0014043 Ga0496114_0014043_4727_6178 482
412 3300048918 Ga0496115_0004033 Ga0496115_0004033_3753_5228 482
413 3300048919 Ga0496116_0006937 Ga0496116_0006937_553_2004 482
414 3300048929 Ga0496126_0012911 Ga0496126_0012911_1073_2524 482
415 3300049583 Ga0501067_0023499 Ga0501067_0023499_1941_3407 482
416 3300049590 Ga0501074_0106853 Ga0501074_0106853_308_1774 482
417 3300049742 Ga0501080_0068905 Ga0501080_0068905_990_2456 482
418 3300050489 nmdc:mga03683_8566_c1 nmdc:mga03683_8566_c1_1796_3256 482
419 3300050490 nmdc:mga03n38_557_c1 nmdc:mga03n38_557_c1_6602_8062 482
420 3300050491 nmdc:mga00v17_6677_c1 nmdc:mga00v17_6677_c1_2276_3736 482
421 3300050495 nmdc:mga04h51_6017_c1 nmdc:mga04h51_6017_c1_95_1555 482
422 3300053077 Ga0495601_0062416 Ga0495601_0062416_861_2336 482
423 3300053088 Ga0500644_0000204 Ga0500644_0000204_31983_33443 482
424 iso_pu_bacteria 2928115317 2928120481 482
425 3300003792 Ga0055540_1004588 Ga0055540_10045889 483
426 3300005330 Ga0070690_100041805 Ga0070690_1000418053 483
427 3300005459 Ga0068867_100047796 Ga0068867_1000477962 483
428 3300005544 Ga0070686_100004637 Ga0070686_1000046373 483
429 3300005718 Ga0068866_10008363 Ga0068866_100083633 483
430 3300005843 Ga0068860_100082225 Ga0068860_1000822252 483
431 3300006038 Ga0075365_10005649 Ga0075365_100056493 483
432 3300006048 Ga0075363_100056895 Ga0075363_1000568952 483
433 3300006051 Ga0075364_10000624 Ga0075364_100006245 483
434 3300009148 Ga0105243_10007737 Ga0105243_100077374 483
435 3300009177 Ga0105248_10206868 Ga0105248_102068682 483
436 3300009545 Ga0105237_10223109 Ga0105237_102231092 483
437 3300013308 Ga0157375_10260599 Ga0157375_102605992 483
438 3300025303 Ga0209051_1000489 Ga0209051_10004897 483
439 3300025899 Ga0207642_10030691 Ga0207642_100306912 483
440 3300025934 Ga0207686_10082739 Ga0207686_100827392 483
441 3300025935 Ga0207709_10032358 Ga0207709_100323583 483
442 3300025941 Ga0207711_10110637 Ga0207711_101106372 483
443 3300025986 Ga0207658_10117507 Ga0207658_101175072 483
444 3300026067 Ga0207678_10136773 Ga0207678_101367731 483
445 3300026089 Ga0207648_10061086 Ga0207648_100610863 483
446 3300028381 Ga0268264_10064052 Ga0268264_100640522 483
447 3300028800 Ga0265338_10000377 Ga0265338_1000037742 483
448 3300031241 Ga0265325_10000155 Ga0265325_1000015513 483
449 3300031249 Ga0265339_10048068 Ga0265339_100480682 483
450 3300039453 Ga0436362_1106345 Ga0436362_1106345_338_1789 483
451 3300048904 Ga0496101_0018822 Ga0496101_0018822_360_1844 483
452 3300048907 Ga0496104_0010103 Ga0496104_0010103_992_2476 483
453 3300048910 Ga0496107_0034810 Ga0496107_0034810_746_2230 483
454 3300049568 Ga0501031_0009449 Ga0501031_0009449_625_2094 483
455 3300049569 Ga0501032_0016245 Ga0501032_0016245_371_1825 483
456 3300049569 Ga0501032_0093024 Ga0501032_0093024_535_1989 483
457 3300049570 Ga0501033_0014485 Ga0501033_0014485_287_1741 483
458 3300049571 Ga0501034_0043680 Ga0501034_0043680_2099_3553 483
459 3300049572 Ga0501036_0010613 Ga0501036_0010613_5858_7327 483
460 3300049572 Ga0501036_0015326 Ga0501036_0015326_3489_4952 483
461 3300049572 Ga0501036_0062996 Ga0501036_0062996_352_1806 483
462 3300049573 Ga0501037_0002323 Ga0501037_0002323_10634_12103 483
463 3300049573 Ga0501037_0008734 Ga0501037_0008734_3551_5005 483
464 3300049574 Ga0501038_0012761 Ga0501038_0012761_5729_7198 483
465 3300049574 Ga0501038_0019872 Ga0501038_0019872_4388_5851 483
466 3300049574 Ga0501038_0045082 Ga0501038_0045082_2004_3458 483
467 3300049574 Ga0501038_0081980 Ga0501038_0081980_153_1607 483
468 3300049575 Ga0501039_0040228 Ga0501039_0040228_163_1617 483
469 3300049575 Ga0501039_0056362 Ga0501039_0056362_706_2175 483
470 3300049578 Ga0501042_0011333 Ga0501042_0011333_3121_4584 483
471 3300049578 Ga0501042_0054774 Ga0501042_0054774_1144_2598 483
472 3300049578 Ga0501042_0100653 Ga0501042_0100653_603_2066 483
473 3300049578 Ga0501042_0109130 Ga0501042_0109130_168_1637 483
474 3300049579 Ga0501043_0038345 Ga0501043_0038345_625_2079 483
475 3300049579 Ga0501043_0038622 Ga0501043_0038622_2167_3636 483
476 3300049580 Ga0501046_0000440 Ga0501046_0000440_28509_29978 483
477 3300049580 Ga0501046_0013547 Ga0501046_0013547_4456_5910 483
478 3300049581 Ga0501047_0017363 Ga0501047_0017363_4984_6453 483
479 3300049581 Ga0501047_0075066 Ga0501047_0075066_1497_2960 483
480 3300049582 Ga0501048_0003540 Ga0501048_0003540_7011_8465 483
481 3300049582 Ga0501048_0009975 Ga0501048_0009975_1045_2514 483
482 3300049583 Ga0501067_0005392 Ga0501067_0005392_1121_2575 483
483 3300049583 Ga0501067_0065926 Ga0501067_0065926_478_1947 483
484 3300049585 Ga0501069_0001873 Ga0501069_0001873_5861_7315 483
485 3300049586 Ga0501070_0042508 Ga0501070_0042508_1200_2654 483
486 3300049588 Ga0501072_0085303 Ga0501072_0085303_364_1818 483
487 3300049589 Ga0501073_0034168 Ga0501073_0034168_2007_3461 483
488 3300049589 Ga0501073_0111102 Ga0501073_0111102_407_1870 483
489 3300049590 Ga0501074_0027835 Ga0501074_0027835_1206_2660 483
490 3300049741 Ga0501079_0018566 Ga0501079_0018566_2858_4312 483
491 3300049742 Ga0501080_0047414 Ga0501080_0047414_35_1489 483
492 3300049744 Ga0501083_0017374 Ga0501083_0017374_3154_4608 483
493 3300049822 Ga0501035_0032187 Ga0501035_0032187_1566_3020 483
494 3300049823 Ga0501044_0009792 Ga0501044_0009792_1282_2745 483
495 3300049823 Ga0501044_0013472 Ga0501044_0013472_5190_6659 483
496 3300049823 Ga0501044_0059359 Ga0501044_0059359_715_2169 483
497 3300050489 nmdc:mga03683_26791_c1 nmdc:mga03683_26791_c1_366_1838 483
498 3300050494 nmdc:mga06z11_60060_c1 nmdc:mga06z11_60060_c1_239_1711 483
499 3300050496 nmdc:mga07m45_22035_c1 nmdc:mga07m45_22035_c1_210_1682 483
500 3300054114 Ga0501084_0001034 Ga0501084_0001034_708_2162 483
501 3300060353 Ga0501082_0002035 Ga0501082_0002035_3863_5317 483
502 iso_pu_bacteria 2510461076 2510892209 483
503 iso_pu_bacteria 2513237103 2513713614 483
504 iso_pu_bacteria 2513237162 2514023313 483
505 iso_pu_bacteria 2515154113 2515632134 483
506 iso_pu_bacteria 2515154114 2515644564 483
507 iso_pu_bacteria 2515154116 2515660011 483
508 iso_pu_bacteria 2517287029 2517409976 483
509 iso_pu_bacteria 2585428057 2587730368 483
510 iso_pu_bacteria 2585428058 2587736862 483
511 iso_pu_bacteria 2588253510 2588291765 483
512 iso_pu_bacteria 2599185354 2600201911 483
513 iso_pu_bacteria 2643221592 2643972410 483
514 iso_pu_bacteria 2643221625 2644138582 483
515 iso_pu_bacteria 2643221648 2644272918 483
516 iso_pu_bacteria 2643221654 2644305233 483
517 iso_pu_bacteria 2738541277 2738723276 483
518 iso_pu_bacteria 2738541307 2738885599 483
519 iso_pu_bacteria 2738543019 2739284007 483
520 iso_pu_bacteria 2751185897 2753766660 483
521 iso_pu_bacteria 2765235942 2766066970 483
522 iso_pu_bacteria 2842110456 2842111837 483
523 iso_pu_bacteria 2842217011 2842219608 483
524 iso_pu_bacteria 2904578770 2904579755 483
525 iso_pu_bacteria 2919119836 2919120577 483
526 iso_pu_bacteria 2933586486 2933588113 483
527 iso_pu_bacteria 639633055 639645320 483
528 iso_pu_bacteria 8024486573 8024487374 483
529 3300002773 JGI25152J39213_1001831 JGI25152J39213_10018312 484
530 3300003354 JGI25160J50197_1009936 JGI25160J50197_10099362 484
531 3300006847 Ga0075431_100019791 Ga0075431_1000197913 484
532 3300025258 Ga0209129_1000333 Ga0209129_100033325 484
533 3300025294 Ga0209025_1019064 Ga0209025_10190642 484
534 3300025295 Ga0209564_1002363 Ga0209564_10023639 484
535 3300025299 Ga0209256_1005145 Ga0209256_10051452 484
536 3300025302 Ga0207426_1000537 Ga0207426_100053739 484
537 3300041496 Ga0451839_0104998 Ga0451839_0104998_385_1851 484
538 3300041503 Ga0451847_0654707 Ga0451847_0654707_1286_2752 484
539 3300041507 Ga0451851_0138487 Ga0451851_0138487_32_1498 484
540 3300041511 Ga0451855_0184220 Ga0451855_0184220_1503_2969 484
541 3300046454 Ga0495592_0073735 Ga0495592_0073735_753_2219 484
542 3300046474 Ga0495605_0015688 Ga0495605_0015688_35_1492 484
543 3300046476 Ga0495662_0051399 Ga0495662_0051399_10_1476 484
544 3300046491 Ga0495584_0005419 Ga0495584_0005419_1054_2511 484
545 3300046492 Ga0495585_0088494 Ga0495585_0088494_168_1625 484
546 3300046501 Ga0495607_0072375 Ga0495607_0072375_186_1652 484
547 3300046506 Ga0495583_0004172 Ga0495583_0004172_7618_9075 484
548 3300046507 Ga0495606_0000253 Ga0495606_0000253_61819_63285 484
549 3300046513 Ga0495616_0014165 Ga0495616_0014165_1463_2920 484
550 3300046522 Ga0495643_0016469 Ga0495643_0016469_1067_2524 484
551 3300046524 Ga0495648_0033094 Ga0495648_0033094_1264_2730 484
552 3300046542 Ga0495597_0014009 Ga0495597_0014009_1515_2972 484
553 3300046557 Ga0495622_0017920 Ga0495622_0017920_210_1676 484
554 3300046558 Ga0495633_0009942 Ga0495633_0009942_1866_3332 484
555 3300046615 Ga0495656_0045982 Ga0495656_0045982_236_1732 484
556 3300046616 Ga0495668_0042200 Ga0495668_0042200_99_1556 484
557 3300046660 Ga0495625_0015246 Ga0495625_0015246_1043_2500 484
558 3300046663 Ga0495635_0119992 Ga0495635_0119992_106_1572 484
559 3300046694 Ga0495649_0032383 Ga0495649_0032383_328_1785 484
560 3300046810 Ga0495660_0019406 Ga0495660_0019406_1458_2915 484
561 3300047443 Ga0495687_024614 Ga0495687_024614_492_1949 484
562 3300048907 Ga0496104_0039296 Ga0496104_0039296_1303_2811 484
563 3300048908 Ga0496105_0020997 Ga0496105_0020997_3053_4561 484
564 3300048924 Ga0496121_0016227 Ga0496121_0016227_146_1612 484
565 3300048928 Ga0496125_0056000 Ga0496125_0056000_406_1914 484
566 3300053148 Ga0500590_000044 Ga0500590_000044_4358_5824 484
567 iso_pu_bacteria 2509276021 2509391201 484
568 iso_pu_bacteria 2510917030 2511194983 484
569 iso_pu_bacteria 2513237088 2513599358 484
570 iso_pu_bacteria 2534681796 2535520758 484
571 iso_pu_bacteria 2582581298 2585226332 484
572 iso_pu_bacteria 2582581867 2585404916 484
573 iso_pu_bacteria 2585427529 2585548748 484
574 iso_pu_bacteria 2643221634 2644193921 484
575 iso_pu_bacteria 2791355260 2793319950 484
576 iso_pu_bacteria 2841864319 2841868673 484
577 iso_pu_bacteria 2842341865 2842342621 484
578 iso_pu_bacteria 8005542996 8005548531 484
579 3300002739 JGI25158J39367_1000043 JGI25158J39367_100004315 485
580 3300003374 JGI25161J50226_1000027 JGI25161J50226_100002770 485
581 3300003771 Ga0055526_1013303 Ga0055526_10133031 485
582 3300003790 Ga0055528_1015656 Ga0055528_10156562 485
583 3300004625 Ga0055543_1000100 Ga0055543_100010017 485
584 3300006353 Ga0075370_10085917 Ga0075370_100859172 485
585 3300009765 Ga0123341_1000008 Ga0123341_100000812 485
586 3300009766 Ga0123342_1005465 Ga0123342_100546511 485
587 3300025208 Ga0209436_100009 Ga0209436_100009103 485
588 3300025273 Ga0209673_1000013 Ga0209673_1000013214 485
589 3300025273 Ga0209673_1007377 Ga0209673_10073775 485
590 3300025284 Ga0209130_1000022 Ga0209130_1000022350 485
591 3300025295 Ga0209564_1000264 Ga0209564_1000264105 485
592 3300025295 Ga0209564_1001353 Ga0209564_100135313 485
593 3300025297 Ga0209758_1007042 Ga0209758_10070425 485
594 3300025299 Ga0209256_1006523 Ga0209256_10065234 485
595 3300025299 Ga0209256_1008410 Ga0209256_10084103 485
596 3300025302 Ga0207426_1000042 Ga0207426_1000042103 485
597 3300025321 Ga0207656_10000244 Ga0207656_1000024418 485
598 3300025927 Ga0207687_10011372 Ga0207687_100113723 485
599 3300031616 Ga0307508_10031568 Ga0307508_100315684 485
600 3300039437 Ga0436365_0592429 Ga0436365_0592429_296_1753 485
601 3300039438 Ga0436360_0738491 Ga0436360_0738491_1720_3192 485
602 3300048920 Ga0496117_0059146 Ga0496117_0059146_294_1763 485
603 3300048921 Ga0496118_0001422 Ga0496118_0001422_5790_7259 485
604 3300048924 Ga0496121_0006402 Ga0496121_0006402_7273_8742 485
605 3300049459 Ga0495678_046199 Ga0495678_046199_134_1594 485
606 3300049584 Ga0501068_0018284 Ga0501068_0018284_1520_3001 485
607 3300053156 Ga0500622_0000434 Ga0500622_0000434_14923_16392 485
608 3300053160 Ga0500633_0000920 Ga0500633_0000920_910_2379 485
609 iso_pu_bacteria 2791355259 2793316665 485
610 iso_pu_bacteria 8046767195 8046772967 485
611 3300005435 Ga0070714_100059436 Ga0070714_1000594362 486
612 3300005438 Ga0070701_10050854 Ga0070701_100508542 486
613 3300005441 Ga0070700_100092156 Ga0070700_1000921561 486
614 3300005458 Ga0070681_10027724 Ga0070681_100277243 486
615 3300005530 Ga0070679_100013436 Ga0070679_1000134369 486
616 3300005543 Ga0070672_100122881 Ga0070672_1001228812 486
617 3300005563 Ga0068855_100134114 Ga0068855_1001341143 486
618 3300005719 Ga0068861_100082644 Ga0068861_1000826442 486
619 3300005841 Ga0068863_100127377 Ga0068863_1001273772 486
620 3300009094 Ga0111539_10049954 Ga0111539_100499542 486
621 3300013104 Ga0157370_10050953 Ga0157370_100509532 486
622 3300013308 Ga0157375_10009166 Ga0157375_100091662 486
623 3300025912 Ga0207707_10141546 Ga0207707_101415461 486
624 3300025913 Ga0207695_10061366 Ga0207695_100613661 486
625 3300025917 Ga0207660_10025425 Ga0207660_100254254 486
626 3300025921 Ga0207652_10055163 Ga0207652_100551635 486
627 3300025929 Ga0207664_10061884 Ga0207664_100618843 486
628 3300025940 Ga0207691_10102659 Ga0207691_101026592 486
629 3300026075 Ga0207708_10126415 Ga0207708_101264152 486
630 3300026088 Ga0207641_10125292 Ga0207641_101252922 486
631 3300026116 Ga0207674_10115649 Ga0207674_101156492 486
632 3300026118 Ga0207675_100030556 Ga0207675_1000305562 486
633 3300026118 Ga0207675_100209559 Ga0207675_1002095591 486
634 3300031090 Ga0265760_10016520 Ga0265760_100165201 486
635 3300031649 Ga0307514_10040937 Ga0307514_100409373 486
636 3300038443 Ga0395901_0032881 Ga0395901_0032881_900_2363 486
637 3300048913 Ga0496110_0221404 Ga0496110_0221404_151_1611 486
638 3300049570 Ga0501033_0031456 Ga0501033_0031456_61_1524 486
639 3300049570 Ga0501033_0044138 Ga0501033_0044138_937_2412 486
640 3300049570 Ga0501033_0058023 Ga0501033_0058023_790_2262 486
641 3300049571 Ga0501034_0273039 Ga0501034_0273039_73_1548 486
642 3300049579 Ga0501043_0102213 Ga0501043_0102213_74_1576 486
643 3300049581 Ga0501047_0041195 Ga0501047_0041195_2723_4195 486
644 3300049581 Ga0501047_0138227 Ga0501047_0138227_86_1561 486
645 3300049581 Ga0501047_0204700 Ga0501047_0204700_328_1791 486
646 3300049581 Ga0501047_0212777 Ga0501047_0212777_28_1503 486
647 3300049586 Ga0501070_0049291 Ga0501070_0049291_592_2067 486
648 3300049589 Ga0501073_0103994 Ga0501073_0103994_132_1607 486
649 3300049822 Ga0501035_0004343 Ga0501035_0004343_9551_11023 486
650 3300049823 Ga0501044_0037938 Ga0501044_0037938_2661_4133 486
651 iso_pu_bacteria 2861691609 2861695604 486
652 3300002077 JGI24744J21845_10004395 JGI24744J21845_100043952 487
653 3300002773 JGI25152J39213_1007690 JGI25152J39213_10076902 487
654 3300003215 JGI25153J46596_10003067 JGI25153J46596_100030675 487
655 3300003323 rootH1_10008151 rootH1_100081513 487
656 3300003323 rootH1_10117972 rootH1_101179722 487
657 3300003771 Ga0055526_1001863 Ga0055526_100186313 487
658 3300005262 Ga0065165_1001841 Ga0065165_100184112 487
659 3300005295 Ga0065707_10085008 Ga0065707_100850085 487
660 3300005328 Ga0070676_10006514 Ga0070676_100065143 487
661 3300005329 Ga0070683_100009231 Ga0070683_1000092315 487
662 3300005331 Ga0070670_100064046 Ga0070670_1000640463 487
663 3300005333 Ga0070677_10000706 Ga0070677_100007064 487
664 3300005333 Ga0070677_10007124 Ga0070677_100071242 487
665 3300005334 Ga0068869_100033427 Ga0068869_1000334272 487
666 3300005335 Ga0070666_10012082 Ga0070666_100120821 487
667 3300005335 Ga0070666_10066872 Ga0070666_100668722 487
668 3300005336 Ga0070680_100002950 Ga0070680_1000029507 487
669 3300005337 Ga0070682_100064723 Ga0070682_1000647231 487
670 3300005338 Ga0068868_100020471 Ga0068868_1000204714 487
671 3300005338 Ga0068868_100069539 Ga0068868_1000695392 487
672 3300005338 Ga0068868_100095259 Ga0068868_1000952592 487
673 3300005339 Ga0070660_100022184 Ga0070660_1000221843 487
674 3300005340 Ga0070689_100001851 Ga0070689_1000018512 487
675 3300005354 Ga0070675_100022065 Ga0070675_1000220652 487
676 3300005355 Ga0070671_100020733 Ga0070671_1000207336 487
677 3300005364 Ga0070673_100024552 Ga0070673_1000245522 487
678 3300005365 Ga0070688_100011943 Ga0070688_1000119431 487
679 3300005367 Ga0070667_100000967 Ga0070667_10000096729 487
680 3300005367 Ga0070667_100002581 Ga0070667_1000025815 487
681 3300005367 Ga0070667_100034441 Ga0070667_1000344415 487
682 3300005367 Ga0070667_100178439 Ga0070667_1001784392 487
683 3300005434 Ga0070709_10025237 Ga0070709_100252373 487
684 3300005436 Ga0070713_100141208 Ga0070713_1001412082 487
685 3300005439 Ga0070711_100008954 Ga0070711_1000089542 487
686 3300005440 Ga0070705_100052090 Ga0070705_1000520902 487
687 3300005445 Ga0070708_100058413 Ga0070708_1000584132 487
688 3300005458 Ga0070681_10002000 Ga0070681_1000200013 487
689 3300005467 Ga0070706_100004269 Ga0070706_1000042692 487
690 3300005467 Ga0070706_100114382 Ga0070706_1001143821 487
691 3300005467 Ga0070706_100194924 Ga0070706_1001949241 487
692 3300005471 Ga0070698_100046507 Ga0070698_1000465075 487
693 3300005518 Ga0070699_100046067 Ga0070699_1000460671 487
694 3300005518 Ga0070699_100151915 Ga0070699_1001519152 487
695 3300005530 Ga0070679_100027028 Ga0070679_1000270283 487
696 3300005530 Ga0070679_100073717 Ga0070679_1000737173 487
697 3300005536 Ga0070697_100023957 Ga0070697_1000239573 487
698 3300005543 Ga0070672_100005485 Ga0070672_1000054854 487
699 3300005543 Ga0070672_100054676 Ga0070672_1000546763 487
700 3300005543 Ga0070672_100067276 Ga0070672_1000672764 487
701 3300005548 Ga0070665_100001336 Ga0070665_10000133618 487
702 3300005548 Ga0070665_100002579 Ga0070665_1000025798 487
703 3300005548 Ga0070665_100008692 Ga0070665_1000086925 487
704 3300005548 Ga0070665_100012031 Ga0070665_1000120318 487
705 3300005548 Ga0070665_100034625 Ga0070665_1000346253 487
706 3300005548 Ga0070665_100041042 Ga0070665_1000410423 487
707 3300005548 Ga0070665_100055601 Ga0070665_1000556012 487
708 3300005563 Ga0068855_100000327 Ga0068855_10000032743 487
709 3300005563 Ga0068855_100000479 Ga0068855_10000047936 487
710 3300005563 Ga0068855_100004779 Ga0068855_10000477912 487
711 3300005564 Ga0070664_100019671 Ga0070664_1000196712 487
712 3300005564 Ga0070664_100054357 Ga0070664_1000543574 487
713 3300005614 Ga0068856_100005787 Ga0068856_1000057876 487
714 3300005614 Ga0068856_100104020 Ga0068856_1001040204 487
715 3300005615 Ga0070702_100031825 Ga0070702_1000318252 487
716 3300005616 Ga0068852_100035444 Ga0068852_1000354442 487
717 3300005616 Ga0068852_100175914 Ga0068852_1001759141 487
718 3300005617 Ga0068859_100006016 Ga0068859_1000060169 487
719 3300005617 Ga0068859_100018500 Ga0068859_1000185002 487
720 3300005617 Ga0068859_100068400 Ga0068859_1000684003 487
721 3300005617 Ga0068859_100141878 Ga0068859_1001418782 487
722 3300005617 Ga0068859_100176913 Ga0068859_1001769131 487
723 3300005618 Ga0068864_100008855 Ga0068864_1000088556 487
724 3300005618 Ga0068864_100014290 Ga0068864_1000142905 487
725 3300005618 Ga0068864_100031966 Ga0068864_1000319662 487
726 3300005618 Ga0068864_100094347 Ga0068864_1000943473 487
727 3300005719 Ga0068861_100001686 Ga0068861_1000016863 487
728 3300005719 Ga0068861_100005967 Ga0068861_1000059675 487
729 3300005719 Ga0068861_100034539 Ga0068861_1000345392 487
730 3300005719 Ga0068861_100050147 Ga0068861_1000501474 487
731 3300005719 Ga0068861_100065417 Ga0068861_1000654173 487
732 3300005840 Ga0068870_10088242 Ga0068870_100882422 487
733 3300005841 Ga0068863_100011481 Ga0068863_1000114812 487
734 3300005841 Ga0068863_100078590 Ga0068863_1000785903 487
735 3300005841 Ga0068863_100155869 Ga0068863_1001558692 487
736 3300005842 Ga0068858_100002321 Ga0068858_1000023212 487
737 3300005842 Ga0068858_100004646 Ga0068858_1000046462 487
738 3300005842 Ga0068858_100007963 Ga0068858_1000079633 487
739 3300005843 Ga0068860_100094501 Ga0068860_1000945012 487
740 3300005844 Ga0068862_100036157 Ga0068862_1000361572 487
741 3300005937 Ga0081455_10002149 Ga0081455_100021492 487
742 3300005937 Ga0081455_10002595 Ga0081455_1000259519 487
743 3300005937 Ga0081455_10012181 Ga0081455_100121812 487
744 3300005937 Ga0081455_10020543 Ga0081455_100205432 487
745 3300005983 Ga0081540_1012367 Ga0081540_10123673 487
746 3300005985 Ga0081539_10000159 Ga0081539_1000015990 487
747 3300005985 Ga0081539_10003942 Ga0081539_100039428 487
748 3300005985 Ga0081539_10009579 Ga0081539_100095798 487
749 3300006028 Ga0070717_10016752 Ga0070717_100167524 487
750 3300006038 Ga0075365_10003178 Ga0075365_100031782 487
751 3300006042 Ga0075368_10001687 Ga0075368_100016872 487
752 3300006051 Ga0075364_10003820 Ga0075364_100038209 487
753 3300006163 Ga0070715_10006280 Ga0070715_100062802 487
754 3300006186 Ga0075369_10000119 Ga0075369_1000011915 487
755 3300006195 Ga0075366_10006300 Ga0075366_100063004 487
756 3300006195 Ga0075366_10007947 Ga0075366_100079475 487
757 3300006195 Ga0075366_10010334 Ga0075366_100103344 487
758 3300006195 Ga0075366_10010484 Ga0075366_100104844 487
759 3300006195 Ga0075366_10063026 Ga0075366_100630262 487
760 3300006237 Ga0097621_100003890 Ga0097621_1000038906 487
761 3300006237 Ga0097621_100009897 Ga0097621_1000098974 487
762 3300006353 Ga0075370_10000383 Ga0075370_100003839 487
763 3300006353 Ga0075370_10008408 Ga0075370_100084084 487
764 3300006353 Ga0075370_10030970 Ga0075370_100309702 487
765 3300006353 Ga0075370_10038957 Ga0075370_100389572 487
766 3300006358 Ga0068871_100007165 Ga0068871_1000071653 487
767 3300006844 Ga0075428_100027074 Ga0075428_1000270741 487
768 3300006871 Ga0075434_100082889 Ga0075434_1000828892 487
769 3300006871 Ga0075434_100132129 Ga0075434_1001321292 487
770 3300006931 Ga0097620_100006016 Ga0097620_1000060168 487
771 3300006931 Ga0097620_100018500 Ga0097620_1000185002 487
772 3300006931 Ga0097620_100068400 Ga0097620_1000684003 487
773 3300006931 Ga0097620_100141867 Ga0097620_1001418672 487
774 3300006931 Ga0097620_100176918 Ga0097620_1001769182 487
775 3300009092 Ga0105250_10000005 Ga0105250_10000005298 487
776 3300009093 Ga0105240_10000215 Ga0105240_1000021557 487
777 3300009093 Ga0105240_10011765 Ga0105240_100117658 487
778 3300009093 Ga0105240_10025141 Ga0105240_100251413 487
779 3300009093 Ga0105240_10049046 Ga0105240_100490463 487
780 3300009093 Ga0105240_10127737 Ga0105240_101277372 487
781 3300009093 Ga0105240_10157215 Ga0105240_101572152 487
782 3300009093 Ga0105240_10226453 Ga0105240_102264532 487
783 3300009098 Ga0105245_10005468 Ga0105245_100054684 487
784 3300009101 Ga0105247_10019262 Ga0105247_100192622 487
785 3300009101 Ga0105247_10025217 Ga0105247_100252172 487
786 3300009148 Ga0105243_10126363 Ga0105243_101263632 487
787 3300009174 Ga0105241_10080097 Ga0105241_100800971 487
788 3300009176 Ga0105242_10113114 Ga0105242_101131142 487
789 3300009545 Ga0105237_10000560 Ga0105237_1000056019 487
790 3300009545 Ga0105237_10004790 Ga0105237_100047902 487
791 3300009545 Ga0105237_10044948 Ga0105237_100449483 487
792 3300009551 Ga0105238_10000607 Ga0105238_1000060727 487
793 3300009553 Ga0105249_10020374 Ga0105249_100203743 487
794 3300010375 Ga0105239_10000025 Ga0105239_10000025155 487
795 3300010375 Ga0105239_10000269 Ga0105239_1000026954 487
796 3300011119 Ga0105246_10015747 Ga0105246_100157471 487
797 3300013102 Ga0157371_10129035 Ga0157371_101290351 487
798 3300013296 Ga0157374_10007450 Ga0157374_100074507 487
799 3300013297 Ga0157378_10276432 Ga0157378_102764321 487
800 3300013306 Ga0163162_10014396 Ga0163162_100143963 487
801 3300013306 Ga0163162_10047916 Ga0163162_100479162 487
802 3300013308 Ga0157375_10004470 Ga0157375_1000447011 487
803 3300014325 Ga0163163_10000044 Ga0163163_1000004469 487
804 3300014325 Ga0163163_10000876 Ga0163163_100008761 487
805 3300014326 Ga0157380_10066780 Ga0157380_100667803 487
806 3300014968 Ga0157379_10000038 Ga0157379_1000003856 487
807 3300014968 Ga0157379_10012604 Ga0157379_100126047 487
808 3300014968 Ga0157379_10031631 Ga0157379_100316314 487
809 3300014968 Ga0157379_10142457 Ga0157379_101424572 487
810 3300014969 Ga0157376_10018397 Ga0157376_100183972 487
811 3300014969 Ga0157376_10165202 Ga0157376_101652021 487
812 3300015261 Ga0182006_1030966 Ga0182006_10309661 487
813 3300015262 Ga0182007_10001637 Ga0182007_1000163712 487
814 3300025245 Ga0207425_1004443 Ga0207425_10044432 487
815 3300025258 Ga0209129_1000041 Ga0209129_1000041127 487
816 3300025295 Ga0209564_1000029 Ga0209564_1000029273 487
817 3300025297 Ga0209758_1000043 Ga0209758_1000043167 487
818 3300025297 Ga0209758_1000057 Ga0209758_1000057137 487
819 3300025298 Ga0209050_1000149 Ga0209050_1000149136 487
820 3300025299 Ga0209256_1018531 Ga0209256_10185313 487
821 3300025303 Ga0209051_1007353 Ga0209051_10073533 487
822 3300025711 Ga0207696_1000276 Ga0207696_100027649 487
823 3300025898 Ga0207692_10015057 Ga0207692_100150573 487
824 3300025900 Ga0207710_10000593 Ga0207710_100005939 487
825 3300025903 Ga0207680_10005598 Ga0207680_100055985 487
826 3300025904 Ga0207647_10058303 Ga0207647_100583032 487
827 3300025905 Ga0207685_10001766 Ga0207685_100017661 487
828 3300025907 Ga0207645_10003682 Ga0207645_100036823 487
829 3300025907 Ga0207645_10014754 Ga0207645_100147545 487
830 3300025907 Ga0207645_10040690 Ga0207645_100406903 487
831 3300025908 Ga0207643_10001184 Ga0207643_1000118410 487
832 3300025910 Ga0207684_10005060 Ga0207684_100050602 487
833 3300025910 Ga0207684_10061918 Ga0207684_100619182 487
834 3300025910 Ga0207684_10138169 Ga0207684_101381691 487
835 3300025912 Ga0207707_10001863 Ga0207707_100018631 487
836 3300025913 Ga0207695_10000347 Ga0207695_1000034757 487
837 3300025913 Ga0207695_10004517 Ga0207695_100045173 487
838 3300025913 Ga0207695_10016693 Ga0207695_100166932 487
839 3300025913 Ga0207695_10018105 Ga0207695_100181053 487
840 3300025913 Ga0207695_10020509 Ga0207695_100205094 487
841 3300025913 Ga0207695_10039933 Ga0207695_100399334 487
842 3300025913 Ga0207695_10158749 Ga0207695_101587492 487
843 3300025914 Ga0207671_10000952 Ga0207671_1000095214 487
844 3300025914 Ga0207671_10024013 Ga0207671_100240132 487
845 3300025917 Ga0207660_10025885 Ga0207660_100258853 487
846 3300025919 Ga0207657_10002307 Ga0207657_100023073 487
847 3300025919 Ga0207657_10058970 Ga0207657_100589703 487
848 3300025921 Ga0207652_10019486 Ga0207652_100194862 487
849 3300025921 Ga0207652_10063785 Ga0207652_100637852 487
850 3300025923 Ga0207681_10024501 Ga0207681_100245015 487
851 3300025924 Ga0207694_10000606 Ga0207694_1000060631 487
852 3300025924 Ga0207694_10021736 Ga0207694_100217362 487
853 3300025924 Ga0207694_10040384 Ga0207694_100403842 487
854 3300025925 Ga0207650_10135964 Ga0207650_101359642 487
855 3300025926 Ga0207659_10116440 Ga0207659_101164402 487
856 3300025928 Ga0207700_10146165 Ga0207700_101461652 487
857 3300025931 Ga0207644_10002169 Ga0207644_1000216910 487
858 3300025931 Ga0207644_10078058 Ga0207644_100780582 487
859 3300025935 Ga0207709_10076289 Ga0207709_100762891 487
860 3300025936 Ga0207670_10035363 Ga0207670_100353632 487
861 3300025937 Ga0207669_10021936 Ga0207669_100219362 487
862 3300025937 Ga0207669_10082467 Ga0207669_100824672 487
863 3300025940 Ga0207691_10008483 Ga0207691_100084832 487
864 3300025940 Ga0207691_10010326 Ga0207691_100103264 487
865 3300025940 Ga0207691_10034149 Ga0207691_100341492 487
866 3300025940 Ga0207691_10158855 Ga0207691_101588552 487
867 3300025941 Ga0207711_10031272 Ga0207711_100312722 487
868 3300025941 Ga0207711_10087780 Ga0207711_100877801 487
869 3300025942 Ga0207689_10014440 Ga0207689_100144406 487
870 3300025942 Ga0207689_10028770 Ga0207689_100287703 487
871 3300025944 Ga0207661_10228557 Ga0207661_102285572 487
872 3300025949 Ga0207667_10000175 Ga0207667_1000017551 487
873 3300025949 Ga0207667_10003104 Ga0207667_1000310411 487
874 3300025949 Ga0207667_10008252 Ga0207667_100082522 487
875 3300025949 Ga0207667_10034111 Ga0207667_100341113 487
876 3300025961 Ga0207712_10108531 Ga0207712_101085312 487
877 3300025961 Ga0207712_10137628 Ga0207712_101376282 487
878 3300025981 Ga0207640_10165641 Ga0207640_101656411 487
879 3300025986 Ga0207658_10000800 Ga0207658_100008008 487
880 3300026035 Ga0207703_10000957 Ga0207703_100009576 487
881 3300026035 Ga0207703_10004717 Ga0207703_100047175 487
882 3300026041 Ga0207639_10018300 Ga0207639_100183004 487
883 3300026067 Ga0207678_10024110 Ga0207678_100241105 487
884 3300026078 Ga0207702_10010110 Ga0207702_100101106 487
885 3300026078 Ga0207702_10048313 Ga0207702_100483132 487
886 3300026088 Ga0207641_10007318 Ga0207641_1000731810 487
887 3300026088 Ga0207641_10013250 Ga0207641_100132507 487
888 3300026088 Ga0207641_10072629 Ga0207641_100726292 487
889 3300026088 Ga0207641_10122262 Ga0207641_101222621 487
890 3300026089 Ga0207648_10028619 Ga0207648_100286194 487
891 3300026089 Ga0207648_10052060 Ga0207648_100520601 487
892 3300026095 Ga0207676_10004867 Ga0207676_100048673 487
893 3300026095 Ga0207676_10086857 Ga0207676_100868572 487
894 3300026116 Ga0207674_10018743 Ga0207674_100187438 487
895 3300026116 Ga0207674_10032831 Ga0207674_100328314 487
896 3300026118 Ga0207675_100006048 Ga0207675_1000060485 487
897 3300026118 Ga0207675_100007010 Ga0207675_1000070107 487
898 3300026118 Ga0207675_100012751 Ga0207675_1000127514 487
899 3300026118 Ga0207675_100262402 Ga0207675_1002624021 487
900 3300026142 Ga0207698_10023374 Ga0207698_100233742 487
901 3300026142 Ga0207698_10080992 Ga0207698_100809921 487
902 3300028379 Ga0268266_10001984 Ga0268266_1000198412 487
903 3300028379 Ga0268266_10003195 Ga0268266_1000319517 487
904 3300028379 Ga0268266_10003489 Ga0268266_100034899 487
905 3300028379 Ga0268266_10009083 Ga0268266_100090838 487
906 3300028379 Ga0268266_10024997 Ga0268266_100249973 487
907 3300028379 Ga0268266_10025515 Ga0268266_100255154 487
908 3300028379 Ga0268266_10073745 Ga0268266_100737453 487
909 3300028380 Ga0268265_10048388 Ga0268265_100483882 487
910 3300028381 Ga0268264_10000287 Ga0268264_1000028735 487
911 3300028381 Ga0268264_10028551 Ga0268264_100285512 487
912 3300028556 Ga0265337_1006149 Ga0265337_10061493 487
913 3300028558 Ga0265326_10010375 Ga0265326_100103752 487
914 3300028573 Ga0265334_10000014 Ga0265334_100000148 487
915 3300028786 Ga0307517_10004912 Ga0307517_100049127 487
916 3300028786 Ga0307517_10093494 Ga0307517_100934942 487
917 3300028794 Ga0307515_10000011 Ga0307515_10000011337 487
918 3300028794 Ga0307515_10000186 Ga0307515_1000018621 487
919 3300028794 Ga0307515_10050257 Ga0307515_100502574 487
920 3300028794 Ga0307515_10058448 Ga0307515_100584483 487
921 3300028794 Ga0307515_10097341 Ga0307515_100973412 487
922 3300028794 Ga0307515_10111006 Ga0307515_101110063 487
923 3300028800 Ga0265338_10004531 Ga0265338_1000453119 487
924 3300028800 Ga0265338_10006711 Ga0265338_100067117 487
925 3300028800 Ga0265338_10047374 Ga0265338_100473744 487
926 3300030521 Ga0307511_10000037 Ga0307511_1000003792 487
927 3300030521 Ga0307511_10054297 Ga0307511_100542975 487
928 3300030522 Ga0307512_10061925 Ga0307512_100619253 487
929 3300031239 Ga0265328_10038116 Ga0265328_100381161 487
930 3300031240 Ga0265320_10006123 Ga0265320_100061236 487
931 3300031247 Ga0265340_10000121 Ga0265340_1000012124 487
932 3300031250 Ga0265331_10004523 Ga0265331_100045235 487
933 3300031250 Ga0265331_10004710 Ga0265331_100047106 487
934 3300031251 Ga0265327_10000487 Ga0265327_1000048750 487
935 3300031344 Ga0265316_10004680 Ga0265316_100046805 487
936 3300031456 Ga0307513_10002991 Ga0307513_1000299113 487
937 3300031456 Ga0307513_10016687 Ga0307513_100166873 487
938 3300031456 Ga0307513_10053100 Ga0307513_100531003 487
939 3300031456 Ga0307513_10083111 Ga0307513_100831112 487
940 3300031456 Ga0307513_10092686 Ga0307513_100926862 487
941 3300031456 Ga0307513_10234044 Ga0307513_102340441 487
942 3300031507 Ga0307509_10000001 Ga0307509_10000001354 487
943 3300031507 Ga0307509_10000044 Ga0307509_10000044117 487
944 3300031507 Ga0307509_10003432 Ga0307509_100034328 487
945 3300031507 Ga0307509_10004147 Ga0307509_1000414719 487
946 3300031507 Ga0307509_10004183 Ga0307509_100041837 487
947 3300031507 Ga0307509_10061981 Ga0307509_100619811 487
948 3300031507 Ga0307509_10095132 Ga0307509_100951321 487
949 3300031595 Ga0265313_10001336 Ga0265313_100013369 487
950 3300031616 Ga0307508_10005121 Ga0307508_1000512110 487
951 3300031616 Ga0307508_10011794 Ga0307508_100117942 487
952 3300031616 Ga0307508_10012983 Ga0307508_100129835 487
953 3300031649 Ga0307514_10020475 Ga0307514_100204756 487
954 3300031711 Ga0265314_10012680 Ga0265314_100126802 487
955 3300031711 Ga0265314_10025791 Ga0265314_100257911 487
956 3300031712 Ga0265342_10016314 Ga0265342_100163142 487
957 3300031712 Ga0265342_10018466 Ga0265342_100184663 487
958 3300031730 Ga0307516_10005815 Ga0307516_1000581511 487
959 3300031730 Ga0307516_10016202 Ga0307516_100162023 487
960 3300031730 Ga0307516_10017271 Ga0307516_100172716 487
961 3300031730 Ga0307516_10018714 Ga0307516_100187145 487
962 3300031730 Ga0307516_10095107 Ga0307516_100951072 487
963 3300031730 Ga0307516_10157445 Ga0307516_101574451 487
964 3300031824 Ga0307413_10003854 Ga0307413_100038544 487
965 3300031995 Ga0307409_100016212 Ga0307409_1000162122 487
966 3300032002 Ga0307416_100013529 Ga0307416_1000135292 487
967 3300033180 Ga0307510_10000016 Ga0307510_1000001641 487
968 3300033180 Ga0307510_10005766 Ga0307510_100057663 487
969 3300033180 Ga0307510_10006502 Ga0307510_1000650213 487
970 3300033180 Ga0307510_10008022 Ga0307510_1000802214 487
971 3300033180 Ga0307510_10067143 Ga0307510_100671433 487
972 3300035113 Ga0373936_0005394 Ga0373936_0005394_2395_3858 487
973 3300035113 Ga0373936_0034391 Ga0373936_0034391_226_1692 487
974 3300035691 Ga0373931_0007299 Ga0373931_0007299_2504_3967 487
975 3300035695 Ga0373927_0063530 Ga0373927_0063530_297_1763 487
976 3300035724 Ga0373933_0069196 Ga0373933_0069196_160_1623 487
977 3300036401 Ga0373937_0033714 Ga0373937_0033714_1512_2975 487
978 3300036401 Ga0373937_0068466 Ga0373937_0068466_850_2313 487
979 3300036401 Ga0373937_0148784 Ga0373937_0148784_544_2007 487
980 3300037853 Ga0436364_0457524 Ga0436364_0457524_14_1477 487
981 3300039437 Ga0436365_0002580 Ga0436365_0002580_1579_3048 487
982 3300039437 Ga0436365_0327786 Ga0436365_0327786_4514_5977 487
983 3300039437 Ga0436365_0898810 Ga0436365_0898810_353_1822 487
984 3300039438 Ga0436360_0112640 Ga0436360_0112640_193_1668 487
985 3300039438 Ga0436360_1026710 Ga0436360_1026710_180_1643 487
986 3300039438 Ga0436360_1129771 Ga0436360_1129771_3472_4935 487
987 3300039447 Ga0436361_0395058 Ga0436361_0395058_42_1505 487
988 3300039447 Ga0436361_0611431 Ga0436361_0611431_342_1868 487
989 3300039447 Ga0436361_0899139 Ga0436361_0899139_48_1514 487
990 3300039450 Ga0436363_1106384 Ga0436363_1106384_247_1713 487
991 3300039453 Ga0436362_0757178 Ga0436362_0757178_13_1476 487
992 3300041458 Ga0451798_0226398 Ga0451798_0226398_61_1524 487
993 3300041459 Ga0451800_0869303 Ga0451800_0869303_2044_3507 487
994 3300042876 Ga0451577_0133997 Ga0451577_0133997_749_2212 487
995 3300044656 Ga0466969_0002439 Ga0466969_0002439_7839_9302 487
996 3300044684 Ga0466966_0029066 Ga0466966_0029066_1376_2839 487
997 3300045051 Ga0451576_0020730 Ga0451576_0020730_788_2287 487
998 3300046453 Ga0495627_008967 Ga0495627_008967_1698_3161 487
999 3300046460 Ga0495638_0004766 Ga0495638_0004766_7769_9232 487
1000 3300046460 Ga0495638_0029580 Ga0495638_0029580_1896_3359 487
1001 3300046460 Ga0495638_0036493 Ga0495638_0036493_1460_2923 487
1002 3300046471 Ga0495650_0010731 Ga0495650_0010731_2948_4411 487
1003 3300046471 Ga0495650_0025838 Ga0495650_0025838_798_2273 487
1004 3300046475 Ga0495639_0001912 Ga0495639_0001912_2203_3669 487
1005 3300046507 Ga0495606_0006342 Ga0495606_0006342_8507_9970 487
1006 3300046513 Ga0495616_0001686 Ga0495616_0001686_1066_2529 487
1007 3300046515 Ga0495620_0054441 Ga0495620_0054441_211_1674 487
1008 3300046517 Ga0495630_0072872 Ga0495630_0072872_578_2170 487
1009 3300046519 Ga0495632_0002177 Ga0495632_0002177_8136_9599 487
1010 3300046519 Ga0495632_0002541 Ga0495632_0002541_329_1792 487
1011 3300046519 Ga0495632_0026675 Ga0495632_0026675_1000_2463 487
1012 3300046558 Ga0495633_0054782 Ga0495633_0054782_150_1616 487
1013 3300046615 Ga0495656_0000232 Ga0495656_0000232_10352_11818 487
1014 3300046660 Ga0495625_0005672 Ga0495625_0005672_8258_9721 487
1015 3300046660 Ga0495625_0015952 Ga0495625_0015952_4139_5602 487
1016 3300046674 Ga0495588_0001503 Ga0495588_0001503_3076_4542 487
1017 3300046692 Ga0495671_0019063 Ga0495671_0019063_381_1844 487
1018 3300046694 Ga0495649_0009300 Ga0495649_0009300_1619_3082 487
1019 3300047319 Ga0495674_0011969 Ga0495674_0011969_2003_3466 487
1020 3300047322 Ga0495680_0143410 Ga0495680_0143410_121_1596 487
1021 3300047323 Ga0495683_0045896 Ga0495683_0045896_247_1710 487
1022 3300047443 Ga0495687_001076 Ga0495687_001076_1148_2611 487
1023 3300047443 Ga0495687_006562 Ga0495687_006562_5199_6662 487
1024 3300047472 Ga0495686_0000923 Ga0495686_0000923_16898_18406 487
1025 3300048903 Ga0496100_0001473 Ga0496100_0001473_3476_4942 487
1026 3300048904 Ga0496101_0012522 Ga0496101_0012522_3669_5132 487
1027 3300048904 Ga0496101_0024641 Ga0496101_0024641_322_1788 487
1028 3300048905 Ga0496102_0002386 Ga0496102_0002386_3686_5152 487
1029 3300048905 Ga0496102_0005870 Ga0496102_0005870_3270_4733 487
1030 3300048907 Ga0496104_0016340 Ga0496104_0016340_2125_3591 487
1031 3300048908 Ga0496105_0000649 Ga0496105_0000649_2125_3591 487
1032 3300048908 Ga0496105_0100044 Ga0496105_0100044_226_1692 487
1033 3300048910 Ga0496107_0042839 Ga0496107_0042839_830_2296 487
1034 3300048911 Ga0496108_0051740 Ga0496108_0051740_1217_2683 487
1035 3300048912 Ga0496109_0008248 Ga0496109_0008248_7330_8793 487
1036 3300048913 Ga0496110_0032013 Ga0496110_0032013_1592_3058 487
1037 3300048913 Ga0496110_0075894 Ga0496110_0075894_1216_2682 487
1038 3300048914 Ga0496111_0048660 Ga0496111_0048660_100_1566 487
1039 3300048917 Ga0496114_0000691 Ga0496114_0000691_11442_12905 487
1040 3300048917 Ga0496114_0055385 Ga0496114_0055385_479_1945 487
1041 3300048918 Ga0496115_0143409 Ga0496115_0143409_138_1604 487
1042 3300048920 Ga0496117_0002066 Ga0496117_0002066_17331_18794 487
1043 3300048921 Ga0496118_0008974 Ga0496118_0008974_8174_9637 487
1044 3300048921 Ga0496118_0093165 Ga0496118_0093165_262_1725 487
1045 3300048924 Ga0496121_0000245 Ga0496121_0000245_80700_82205 487
1046 3300048924 Ga0496121_0016052 Ga0496121_0016052_4065_5528 487
1047 3300048925 Ga0496122_0043664 Ga0496122_0043664_73_1536 487
1048 3300048929 Ga0496126_0000082 Ga0496126_0000082_11560_13023 487
1049 3300048929 Ga0496126_0007294 Ga0496126_0007294_5834_7339 487
1050 3300048929 Ga0496126_0070007 Ga0496126_0070007_1300_2811 487
1051 3300048929 Ga0496126_0100817 Ga0496126_0100817_521_1984 487
1052 3300048929 Ga0496126_0228916 Ga0496126_0228916_44_1516 487
1053 3300049578 Ga0501042_0074421 Ga0501042_0074421_593_2056 487
1054 3300049584 Ga0501068_0026499 Ga0501068_0026499_824_2293 487
1055 3300049590 Ga0501074_0097952 Ga0501074_0097952_228_1715 487
1056 3300049742 Ga0501080_0205331 Ga0501080_0205331_237_1700 487
1057 3300050491 nmdc:mga00v17_6139_c1 nmdc:mga00v17_6139_c1_2367_3830 487
1058 3300050493 nmdc:mga0k408_23318_c1 nmdc:mga0k408_23318_c1_841_2304 487
1059 3300050494 nmdc:mga06z11_3678_c1 nmdc:mga06z11_3678_c1_566_2029 487
1060 3300050496 nmdc:mga07m45_1431_c1 nmdc:mga07m45_1431_c1_6840_8303 487
1061 3300050496 nmdc:mga07m45_14526_c1 nmdc:mga07m45_14526_c1_2575_4038 487
1062 3300050496 nmdc:mga07m45_15022_c1 nmdc:mga07m45_15022_c1_1967_3430 487
1063 3300050496 nmdc:mga07m45_1612_c1 nmdc:mga07m45_1612_c1_5132_6613 487
1064 3300050496 nmdc:mga07m45_37676_c1 nmdc:mga07m45_37676_c1_706_2169 487
1065 3300053086 Ga0500578_0000011 Ga0500578_0000011_117200_118672 487
1066 3300053087 Ga0500643_000008 Ga0500643_000008_2606_4069 487
1067 3300053092 Ga0500583_0034679 Ga0500583_0034679_698_2161 487
1068 3300053093 Ga0500651_0002949 Ga0500651_0002949_1110_2579 487
1069 3300053117 Ga0500593_002351 Ga0500593_002351_3216_4679 487
1070 3300053119 Ga0500595_003028 Ga0500595_003028_2402_3865 487
1071 3300053121 Ga0500607_038321 Ga0500607_038321_117_1580 487
1072 3300053124 Ga0500617_023549 Ga0500617_023549_133_1719 487
1073 3300053129 Ga0500628_000798 Ga0500628_000798_2387_3850 487
1074 3300053131 Ga0500652_000189 Ga0500652_000189_19488_20951 487
1075 3300053134 Ga0500658_0008263 Ga0500658_0008263_206_1927 487
1076 3300053136 Ga0500559_0000097 Ga0500559_0000097_11433_12902 487
1077 3300053146 Ga0500588_0000286 Ga0500588_0000286_5735_7198 487
1078 3300053156 Ga0500622_0000097 Ga0500622_0000097_83180_84643 487
1079 3300053156 Ga0500622_0000978 Ga0500622_0000978_17951_19420 487
1080 3300053156 Ga0500622_0001119 Ga0500622_0001119_3722_5185 487
1081 3300053156 Ga0500622_0007159 Ga0500622_0007159_4834_6300 487

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02781

G6PD_C

Glucose-6-phosphate dehydrogenase, C-terminal domain

222

544

0.91

PF00479

G6PD_N

Glucose-6-phosphate dehydrogenase, NAD binding domain

29

220

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lgv-assembly1.cif.gz_D x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8899 13 474
4lgv-assembly1.cif.gz_B x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8817 9 474
4lgv-assembly1.cif.gz_D x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8804 13 474
5ukw-assembly1.cif.gz_A crystal structure of human glucose 6-phosphate dehydrogenase mutant (a277c) complexed with g6p 0.8761 12 473
4lgv-assembly1.cif.gz_A x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8753 12 474
ID Description Score Start End Superfamily
af_P9WN73_32_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9249 18 181 3.40.50.720
1e7mA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9087 13 178 3.40.50.720
af_O14137_1_171_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9037 14 178 3.40.50.720
af_Q557D2_7_178_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8813 12 178 3.40.50.720
4lgvD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8804 13 178 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6P0DV66-F1-model_v4 Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) 0.9853 28 164 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A534WCE8-F1-model_v4 Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) 0.9802 1 171 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A6P0DV66-F1-model_v4 Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) 0.9782 28 164 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A534WCE8-F1-model_v4 Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) 0.9746 1 171 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A6N9V909-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9699 219 333 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661

Feature Viewer

pLDDT pTM Quality
84.82 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map