F489643

General Info

Members Datasets Scaffolds Average Seq Length
1079 435 2158 190

Family's Representative Sequence

Representative Sequence 3300031238|Ga0265332_10212302|Ga0265332_102123021
Length 214
Sequence VRERPWLKGNGAPKAWIDRVAPYPYIARMAVRDILIIPDKRLRLKSEPVKAVDKSLRALVDDMFETMYAAPGIGLAAIQIGMAQRVVTMDLAKKDDPPAPQVFINPEVTWKSDEKSTYEEGCLSIPEYYEEVERPASVRVKYLGFDGTPHEIEATGLLATCLQHEIDHTNGILFIDYISKLKRSMVMKKFKKVAKKTEGATPLADDKEPSHHIG

Samples

Sample ID Description Type Environment
1 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
10 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
17 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
63 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
136 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
137 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
231 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
232 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
233 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
234 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
235 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
236 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
237 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
240 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
241 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
245 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
246 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
247 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
248 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
249 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
250 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
251 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
252 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
253 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
254 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
255 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
256 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
257 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
259 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
261 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
262 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
263 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
264 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
265 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
266 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
267 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
268 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
269 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
270 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
271 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
272 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
273 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
274 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
275 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
276 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
277 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
278 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
279 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
280 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
282 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
283 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
284 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
285 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
286 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
287 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
288 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
289 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
290 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
291 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
292 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
293 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
296 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
297 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
298 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
299 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
300 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
301 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
302 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
303 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
304 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
305 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
306 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
309 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
310 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
311 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
312 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
313 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
314 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
315 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
316 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
317 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
318 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
319 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
320 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
321 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
322 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
323 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
324 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
325 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
326 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
327 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
328 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
329 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
330 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
331 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
332 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
333 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
334 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
335 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
336 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
337 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
338 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
339 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
340 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
341 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
342 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
343 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
344 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
347 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
348 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
349 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
354 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
355 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
356 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
357 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
358 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
359 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
360 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
361 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
362 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
363 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
364 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
365 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
366 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
367 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
368 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
369 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
370 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
371 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
372 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
373 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
374 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
375 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
388 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
389 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
390 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
391 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
392 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
393 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
394 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
395 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
396 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
397 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
398 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
401 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
402 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
403 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
404 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
405 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
406 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
407 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
408 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
409 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
410 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
411 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
412 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
413 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
414 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
415 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
416 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
417 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
418 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
419 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
420 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
421 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
422 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
423 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
424 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
425 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
426 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
427 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
428 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
429 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
430 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
431 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
432 2738543024 Aminobacter sp. AP02 Isolate Unclassified
433 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
434 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
435 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0.19
Rhizoplane 7.88
Rhizosphere 88.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265332_10212302 3300031238 Bacteria 803
2 2214544925 2209111006 Bacteria 18798
3 ARcpr5oldR_c000010 3300000041 Bacteria 39074
4 ARSoilYngRDRAFT_c00060 3300000042 Bacteria 17969
5 ARcpr5yngRDRAFT_c000016 3300000043 Bacteria 29226
6 ARSoilOldRDRAFT_c000011 3300000044 Bacteria 42914
7 ARCol0oldRDRAFT_c00012 3300000045 Bacteria 14081
8 ARCol0yngRDRAFT_1000018 3300000652 Bacteria 30924
9 JGI24032J14994_100108 3300001430 Bacteria 3758
10 JGI24741J21665_1013514 3300001915 Bacteria 1384
11 JGI24746J21847_1001357 3300001977 Bacteria 3906
12 JGI24747J21853_1000086 3300001978 Bacteria 4031
13 JGI24740J21852_10025886 3300001979 Bacteria 1971
14 JGI24739J22299_10000724 3300001989 Bacteria 11949
15 JGI24737J22298_10001113 3300001990 Bacteria 9446
16 JGI24750J21931_1000096 3300002070 Bacteria 13445
17 JGI24748J21848_1001964 3300002074 Bacteria 2286
18 JGI24738J21930_10000997 3300002075 Bacteria 8121
19 JGI24749J21850_1024770 3300002076 Bacteria 855
20 JGI24744J21845_10000153 3300002077 Bacteria 10102
21 JGI24035J26624_1000660 3300002126 Bacteria 3188
22 JGI24034J26672_10000231 3300002239 Bacteria 7381
23 JGI24742J22300_10000137 3300002244 Bacteria 10780
24 JGI24751J29686_10013941 3300002459 Bacteria 1659
25 JGI25405J52794_10011519 3300003911 Bacteria 1693
26 Ga0065717_1002132 3300005276 Bacteria 2802
27 Ga0065704_10127429 3300005289 Bacteria 1676
28 Ga0065712_10011139 3300005290 Bacteria 4292
29 Ga0065712_10071510 3300005290 Bacteria 5223
30 Ga0065712_10082223 3300005290 Bacteria 2935
31 Ga0065715_10001079 3300005293 Bacteria 7146
32 Ga0065715_10008006 3300005293 Bacteria 3840
33 Ga0065707_10091944 3300005295 Bacteria 3855
34 Ga0070676_10000506 3300005328 Bacteria 18658
35 Ga0070683_100009453 3300005329 Bacteria 8336
36 Ga0070683_100120932 3300005329 Bacteria 2474
37 Ga0070690_100002629 3300005330 Bacteria 9678
38 Ga0070690_100005686 3300005330 Bacteria 7019
39 Ga0070670_100004573 3300005331 Bacteria 11607
40 Ga0070677_10000227 3300005333 Bacteria 19393
41 Ga0070677_10489552 3300005333 Bacteria 665
42 Ga0068869_100001832 3300005334 Bacteria 12767
43 Ga0068869_100347149 3300005334 Bacteria 1209
44 Ga0070666_10025905 3300005335 Bacteria 3826
45 Ga0070666_10027715 3300005335 Bacteria 3713
46 Ga0070666_10161884 3300005335 Bacteria 1564
47 Ga0070666_10273376 3300005335 Bacteria 1200
48 Ga0070680_100003424 3300005336 Bacteria 11842
49 Ga0070680_100025759 3300005336 Bacteria 4702
50 Ga0070682_100001699 3300005337 Bacteria 12232
51 Ga0070682_100032433 3300005337 Bacteria 3168
52 Ga0070682_100207755 3300005337 Bacteria 1386
53 Ga0070682_100529188 3300005337 Bacteria 918
54 Ga0068868_100007757 3300005338 Bacteria 7659
55 Ga0070660_100008125 3300005339 Bacteria 7333
56 Ga0070660_100145897 3300005339 Bacteria 1901
57 Ga0070660_100169729 3300005339 Bacteria 1761
58 Ga0070689_100000668 3300005340 Bacteria 20748
59 Ga0070689_100001841 3300005340 Bacteria 13666
60 Ga0070689_100297102 3300005340 Bacteria 1344
61 Ga0070689_100344038 3300005340 Bacteria 1249
62 Ga0070691_10014066 3300005341 Bacteria 3670
63 Ga0070691_10161599 3300005341 Bacteria 1155
64 Ga0070691_10293750 3300005341 Bacteria 885
65 Ga0070687_100000527 3300005343 Bacteria 12848
66 Ga0070661_100003238 3300005344 Bacteria 11222
67 Ga0070661_100344664 3300005344 Bacteria 1168
68 Ga0070661_100373633 3300005344 Bacteria 1122
69 Ga0070692_10001083 3300005345 Bacteria 9454
70 Ga0070668_100003117 3300005347 Bacteria 12247
71 Ga0070668_100130887 3300005347 Bacteria 2014
72 Ga0070669_100001315 3300005353 Bacteria 17944
73 Ga0070675_100002954 3300005354 Bacteria 12826
74 Ga0070675_100015172 3300005354 Bacteria 6084
75 Ga0070675_100369657 3300005354 Bacteria 1275
76 Ga0070675_100720913 3300005354 Bacteria 909
77 Ga0070671_100033121 3300005355 Bacteria 4272
78 Ga0070671_100035414 3300005355 Bacteria 4136
79 Ga0070674_100002968 3300005356 Bacteria 9419
80 Ga0070674_100720369 3300005356 Bacteria 854
81 Ga0070673_100001477 3300005364 Bacteria 13763
82 Ga0070673_100101479 3300005364 Bacteria 2370
83 Ga0070688_100001239 3300005365 Bacteria 12735
84 Ga0070688_100006198 3300005365 Bacteria 6369
85 Ga0070688_100033995 3300005365 Bacteria 3084
86 Ga0070688_100162605 3300005365 Bacteria 1535
87 Ga0070659_100002622 3300005366 Bacteria 12786
88 Ga0070659_100015463 3300005366 Bacteria 5717
89 Ga0070659_100172634 3300005366 Bacteria 1772
90 Ga0070667_100005188 3300005367 Bacteria 10886
91 Ga0070667_100089585 3300005367 Bacteria 2643
92 Ga0070703_10006319 3300005406 Bacteria 3319
93 Ga0070703_10010223 3300005406 Bacteria 2645
94 Ga0070709_10108172 3300005434 Bacteria 1864
95 Ga0070709_10109350 3300005434 Bacteria 1855
96 Ga0070709_10532718 3300005434 Bacteria 896
97 Ga0070714_100074400 3300005435 Bacteria 2945
98 Ga0070714_100132937 3300005435 Bacteria 2225
99 Ga0070714_100330733 3300005435 Bacteria 1427
100 Ga0070713_100248163 3300005436 Bacteria 1623
101 Ga0070713_100268476 3300005436 Bacteria 1561
102 Ga0070710_10018331 3300005437 Bacteria 3600
103 Ga0070710_10059094 3300005437 Bacteria 2176
104 Ga0070710_10091163 3300005437 Bacteria 1798
105 Ga0070701_10002283 3300005438 Bacteria 7348
106 Ga0070701_10008389 3300005438 Bacteria 4467
107 Ga0070711_100130116 3300005439 Bacteria 1873
108 Ga0070711_100206562 3300005439 Bacteria 1518
109 Ga0070705_100001458 3300005440 Bacteria 12507
110 Ga0070705_100018737 3300005440 Bacteria 3632
111 Ga0070705_100020503 3300005440 Bacteria 3501
112 Ga0070700_100001211 3300005441 Bacteria 12787
113 Ga0070700_100019152 3300005441 Bacteria 3946
114 Ga0070694_100001764 3300005444 Bacteria 12786
115 Ga0070694_100070014 3300005444 Bacteria 2414
116 Ga0070708_100023985 3300005445 Bacteria 5194
117 Ga0070708_100124631 3300005445 Bacteria 2380
118 Ga0070663_100000761 3300005455 Bacteria 17492
119 Ga0070663_100038492 3300005455 Bacteria 3336
120 Ga0070663_100107071 3300005455 Bacteria 2095
121 Ga0070663_100230715 3300005455 Bacteria 1457
122 Ga0070663_100620418 3300005455 Bacteria 911
123 Ga0070678_100000525 3300005456 Bacteria 18583
124 Ga0070678_100125575 3300005456 Bacteria 2030
125 Ga0070678_100375734 3300005456 Bacteria 1228
126 Ga0070662_100002968 3300005457 Bacteria 10539
127 Ga0070662_100050510 3300005457 Bacteria 3000
128 Ga0070662_100072657 3300005457 Bacteria 2540
129 Ga0070681_10004977 3300005458 Bacteria 12786
130 Ga0070681_10220689 3300005458 Bacteria 1811
131 Ga0070681_10221180 3300005458 Bacteria 1808
132 Ga0070681_10410226 3300005458 Bacteria 1266
133 Ga0070681_10805059 3300005458 Bacteria 857
134 Ga0070681_10905305 3300005458 Bacteria 801
135 Ga0068867_100002950 3300005459 Bacteria 11984
136 Ga0068867_100092156 3300005459 Bacteria 2301
137 Ga0070685_10004716 3300005466 Bacteria 6899
138 Ga0070685_10025023 3300005466 Bacteria 3285
139 Ga0070685_10027875 3300005466 Bacteria 3125
140 Ga0070707_100517710 3300005468 Bacteria 1155
141 Ga0070698_100584318 3300005471 Bacteria 1057
142 Ga0070679_100015045 3300005530 Bacteria 7434
143 Ga0070679_100315891 3300005530 Bacteria 1512
144 Ga0070684_100005941 3300005535 Bacteria 9401
145 Ga0070684_100019299 3300005535 Bacteria 5637
146 Ga0070684_100034783 3300005535 Bacteria 4309
147 Ga0070697_100467633 3300005536 Bacteria 1100
148 Ga0068853_100003070 3300005539 Bacteria 12759
149 Ga0068853_100050832 3300005539 Bacteria 3566
150 Ga0068853_100594036 3300005539 Bacteria 1051
151 Ga0070672_100002960 3300005543 Bacteria 10932
152 Ga0070672_100339281 3300005543 Bacteria 1279
153 Ga0070686_100001573 3300005544 Bacteria 12811
154 Ga0070686_100008797 3300005544 Bacteria 5658
155 Ga0070686_100065168 3300005544 Bacteria 2365
156 Ga0070686_100222585 3300005544 Bacteria 1364
157 Ga0070695_100002369 3300005545 Bacteria 10826
158 Ga0070695_100014478 3300005545 Bacteria 4755
159 Ga0070696_100016306 3300005546 Bacteria 5000
160 Ga0070696_100021005 3300005546 Bacteria 4425
161 Ga0070696_100029021 3300005546 Bacteria 3777
162 Ga0070693_100000880 3300005547 Bacteria 13363
163 Ga0070704_100001917 3300005549 Bacteria 11493
164 Ga0070704_100031811 3300005549 Bacteria 3552
165 Ga0068855_100009051 3300005563 Bacteria 12031
166 Ga0070664_100002934 3300005564 Bacteria 13792
167 Ga0070664_100020499 3300005564 Bacteria 5444
168 Ga0070664_100660809 3300005564 Bacteria 972
169 Ga0068857_100000358 3300005577 Bacteria 31869
170 Ga0068857_100086207 3300005577 Bacteria 2807
171 Ga0068854_100007075 3300005578 Bacteria 7161
172 Ga0068856_100045885 3300005614 Bacteria 4303
173 Ga0068856_100161948 3300005614 Bacteria 2248
174 Ga0070702_100000526 3300005615 Bacteria 13792
175 Ga0070702_100308500 3300005615 Bacteria 1098
176 Ga0068852_100009893 3300005616 Bacteria 7097
177 Ga0068859_100005591 3300005617 Bacteria 12805
178 Ga0068859_100038332 3300005617 Bacteria 4809
179 Ga0068859_100065369 3300005617 Bacteria 3671
180 Ga0068859_101334038 3300005617 Bacteria 791
181 Ga0068864_100001988 3300005618 Bacteria 16835
182 Ga0068864_100783779 3300005618 Bacteria 936
183 Ga0068866_10000916 3300005718 Bacteria 12945
184 Ga0068866_10161547 3300005718 Bacteria 1307
185 Ga0068866_10197133 3300005718 Bacteria 1201
186 Ga0068861_100001805 3300005719 Bacteria 13785
187 Ga0068861_100011624 3300005719 Bacteria 6125
188 Ga0068861_101009703 3300005719 Bacteria 795
189 Ga0068870_10000025 3300005840 Bacteria 46848
190 Ga0068870_10135764 3300005840 Bacteria 1434
191 Ga0068863_100002964 3300005841 Bacteria 16783
192 Ga0068863_100185951 3300005841 Bacteria 1995
193 Ga0068863_100460690 3300005841 Bacteria 1248
194 Ga0068858_100003227 3300005842 Bacteria 16273
195 Ga0068858_100099681 3300005842 Bacteria 2709
196 Ga0068858_100343073 3300005842 Bacteria 1430
197 Ga0068860_100007120 3300005843 Bacteria 11192
198 Ga0068860_100060928 3300005843 Bacteria 3586
199 Ga0068860_100180869 3300005843 Bacteria 2038
200 Ga0068862_100011988 3300005844 Bacteria 7161
201 Ga0068862_100032289 3300005844 Bacteria 4423
202 Ga0081455_10002463 3300005937 Bacteria 22024
203 Ga0081455_10012779 3300005937 Bacteria 8347
204 Ga0081455_10020122 3300005937 Bacteria 6297
205 Ga0081455_10188085 3300005937 Bacteria 1558
206 Ga0070717_10074409 3300006028 Bacteria 2839
207 Ga0070717_10236183 3300006028 Bacteria 1611
208 Ga0070717_11465233 3300006028 Bacteria 619
209 Ga0075432_10004844 3300006058 Bacteria 4581
210 Ga0075432_10011268 3300006058 Bacteria 3039
211 Ga0070715_10030799 3300006163 Bacteria 2172
212 Ga0070716_100127591 3300006173 Bacteria 1603
213 Ga0070716_100255281 3300006173 Bacteria 1197
214 Ga0070712_100022909 3300006175 Bacteria 4119
215 Ga0070712_100082682 3300006175 Bacteria 2329
216 Ga0070712_100396740 3300006175 Bacteria 1139
217 Ga0075367_10081426 3300006178 Bacteria 1959
218 Ga0075427_10000109 3300006194 Bacteria 7088
219 Ga0097621_100000456 3300006237 Bacteria 28666
220 Ga0097621_100010034 3300006237 Bacteria 6905
221 Ga0097621_100150100 3300006237 Bacteria 1998
222 Ga0068871_100000269 3300006358 Bacteria 35773
223 Ga0068871_100290885 3300006358 Bacteria 1431
224 Ga0068871_100883976 3300006358 Bacteria 827
225 Ga0075430_100000094 3300006846 Bacteria 52204
226 Ga0075431_100002169 3300006847 Bacteria 18764
227 Ga0075433_10001242 3300006852 Bacteria 18605
228 Ga0075433_10021666 3300006852 Bacteria 5391
229 Ga0075433_10037552 3300006852 Bacteria 4180
230 Ga0075433_10324029 3300006852 Bacteria 1363
231 Ga0075434_100000299 3300006871 Bacteria 35320
232 Ga0075434_100011399 3300006871 Bacteria 8385
233 Ga0075434_100022390 3300006871 Bacteria 6154
234 Ga0075434_100211482 3300006871 Bacteria 1959
235 Ga0075434_100351544 3300006871 Bacteria 1495
236 Ga0075429_100002930 3300006880 Bacteria 14473
237 Ga0068865_100001731 3300006881 Bacteria 12818
238 Ga0068865_100054063 3300006881 Bacteria 2788
239 Ga0068865_100055301 3300006881 Bacteria 2761
240 Ga0075436_100390243 3300006914 Bacteria 1007
241 Ga0097620_100005590 3300006931 Bacteria 12805
242 Ga0097620_100038332 3300006931 Bacteria 4809
243 Ga0097620_100065370 3300006931 Bacteria 3671
244 Ga0097620_101333829 3300006931 Bacteria 791
245 Ga0075435_100023116 3300007076 Bacteria 4802
246 Ga0075435_100047923 3300007076 Bacteria 3431
247 Ga0075435_100276152 3300007076 Bacteria 1434
248 Ga0075435_100289239 3300007076 Bacteria 1400
249 Ga0075435_100593923 3300007076 Bacteria 960
250 Ga0105244_10023092 3300009036 Bacteria 3417
251 Ga0105240_10024320 3300009093 Bacteria 7989
252 Ga0105240_10582449 3300009093 Bacteria 1234
253 Ga0105240_11282096 3300009093 Bacteria 773
254 Ga0111539_10003217 3300009094 Bacteria 21607
255 Ga0111539_10003331 3300009094 Bacteria 21223
256 Ga0111539_10007321 3300009094 Bacteria 14133
257 Ga0111539_10076769 3300009094 Bacteria 3933
258 Ga0105245_10000183 3300009098 Bacteria 59105
259 Ga0105245_10088559 3300009098 Bacteria 2844
260 Ga0105245_10882646 3300009098 Bacteria 935
261 Ga0105247_10210490 3300009101 Bacteria 1311
262 Ga0105247_10225672 3300009101 Bacteria 1270
263 Ga0114129_10001218 3300009147 Bacteria 34180
264 Ga0114129_10002246 3300009147 Bacteria 26676
265 Ga0114129_10866549 3300009147 Bacteria 1147
266 Ga0105243_10001561 3300009148 Bacteria 20018
267 Ga0105243_10100210 3300009148 Bacteria 2403
268 Ga0105243_10171621 3300009148 Bacteria 1879
269 Ga0105241_10003567 3300009174 Bacteria 11569
270 Ga0105241_10063456 3300009174 Bacteria 2850
271 Ga0105241_10203232 3300009174 Bacteria 1656
272 Ga0105241_10338921 3300009174 Bacteria 1302
273 Ga0105242_10000701 3300009176 Bacteria 26184
274 Ga0105242_10006507 3300009176 Bacteria 8997
275 Ga0105242_10033043 3300009176 Bacteria 4140
276 Ga0105248_10006263 3300009177 Bacteria 13046
277 Ga0105248_10010394 3300009177 Bacteria 10250
278 Ga0105248_10040556 3300009177 Bacteria 5219
279 Ga0105248_10153094 3300009177 Bacteria 2602
280 Ga0105248_10424133 3300009177 Bacteria 1498
281 Ga0105248_10719629 3300009177 Bacteria 1126
282 Ga0105237_10010897 3300009545 Bacteria 9647
283 Ga0105237_10125419 3300009545 Bacteria 2562
284 Ga0105237_10150914 3300009545 Bacteria 2320
285 Ga0105237_10650127 3300009545 Bacteria 1061
286 Ga0105237_10822676 3300009545 Bacteria 936
287 Ga0105238_11051622 3300009551 Bacteria 836
288 Ga0105249_10009795 3300009553 Bacteria 8397
289 Ga0105249_10124718 3300009553 Bacteria 2451
290 Ga0105249_10190361 3300009553 Bacteria 2002
291 Ga0105239_10007315 3300010375 Bacteria 12675
292 Ga0105239_10054653 3300010375 Bacteria 4380
293 Ga0105239_10169366 3300010375 Bacteria 2442
294 Ga0105246_10002447 3300011119 Bacteria 11209
295 Ga0105246_10049961 3300011119 Bacteria 2867
296 Ga0105246_10528029 3300011119 Bacteria 1007
297 Ga0105246_10555642 3300011119 Bacteria 985
298 Ga0157321_1002428 3300012487 Bacteria 1039
299 Ga0157335_1000784 3300012492 Bacteria 1567
300 Ga0157342_1002072 3300012507 Bacteria 1581
301 Ga0157373_10017762 3300013100 Bacteria 5179
302 Ga0157373_10237996 3300013100 Bacteria 1287
303 Ga0157371_10018807 3300013102 Bacteria 5103
304 Ga0157370_10175628 3300013104 Bacteria 1991
305 Ga0157370_10292424 3300013104 Bacteria 1505
306 Ga0157370_10739344 3300013104 Bacteria 897
307 Ga0157369_10449243 3300013105 Bacteria 1335
308 Ga0157374_10000463 3300013296 Bacteria 36848
309 Ga0157374_10145086 3300013296 Bacteria 2305
310 Ga0157378_10000613 3300013297 Bacteria 33512
311 Ga0157378_10139508 3300013297 Bacteria 2250
312 Ga0157378_10407146 3300013297 Bacteria 1342
313 Ga0163162_10005908 3300013306 Bacteria 11842
314 Ga0163162_10020966 3300013306 Bacteria 6429
315 Ga0163162_10210444 3300013306 Bacteria 2074
316 Ga0163162_10492272 3300013306 Bacteria 1357
317 Ga0163162_11082860 3300013306 Bacteria 908
318 Ga0163162_11834567 3300013306 Bacteria 693
319 Ga0157372_10010921 3300013307 Bacteria 9665
320 Ga0157372_10219504 3300013307 Bacteria 2204
321 Ga0157372_10843730 3300013307 Bacteria 1064
322 Ga0157375_10004786 3300013308 Bacteria 11768
323 Ga0157375_10250000 3300013308 Bacteria 1934
324 Ga0157375_10791497 3300013308 Bacteria 1097
325 Ga0157375_11065711 3300013308 Bacteria 945
326 Ga0163163_10001239 3300014325 Bacteria 21547
327 Ga0163163_10035378 3300014325 Bacteria 4844
328 Ga0163163_10548246 3300014325 Bacteria 1219
329 Ga0157380_10004641 3300014326 Bacteria 9554
330 Ga0182008_10065920 3300014497 Bacteria 1781
331 Ga0157377_10000358 3300014745 Bacteria 20360
332 Ga0157377_10160273 3300014745 Bacteria 1398
333 Ga0157377_10731243 3300014745 Bacteria 722
334 Ga0157379_10003902 3300014968 Bacteria 12714
335 Ga0157379_10073473 3300014968 Bacteria 3061
336 Ga0157379_10111692 3300014968 Bacteria 2455
337 Ga0157376_10003730 3300014969 Bacteria 10526
338 Ga0157376_10117525 3300014969 Bacteria 2351
339 Ga0157376_10309774 3300014969 Bacteria 1498
340 Ga0157376_10628833 3300014969 Bacteria 1071
341 Ga0163161_10001492 3300017792 Bacteria 17279
342 Ga0207666_1000140 3300025271 Bacteria 11329
343 Ga0207666_1000838 3300025271 Bacteria 3692
344 Ga0207673_1000039 3300025290 Bacteria 10384
345 Ga0207697_10000763 3300025315 Bacteria 18220
346 Ga0207697_10015702 3300025315 Bacteria 3126
347 Ga0207653_10001778 3300025885 Bacteria 6892
348 Ga0207653_10004542 3300025885 Bacteria 4350
349 Ga0207682_10000062 3300025893 Bacteria 46841
350 Ga0207692_10009135 3300025898 Bacteria 4129
351 Ga0207692_10027325 3300025898 Bacteria 2687
352 Ga0207692_10063538 3300025898 Bacteria 1919
353 Ga0207642_10002089 3300025899 Bacteria 6175
354 Ga0207642_10037083 3300025899 Bacteria 2098
355 Ga0207642_10291787 3300025899 Bacteria 942
356 Ga0207710_10010626 3300025900 Bacteria 3877
357 Ga0207710_10016965 3300025900 Bacteria 3085
358 Ga0207688_10001992 3300025901 Bacteria 10954
359 Ga0207688_10023221 3300025901 Bacteria 3395
360 Ga0207680_10000740 3300025903 Bacteria 15389
361 Ga0207680_10028054 3300025903 Bacteria 3144
362 Ga0207680_10057899 3300025903 Bacteria 2347
363 Ga0207647_10003504 3300025904 Bacteria 11767
364 Ga0207647_10008790 3300025904 Bacteria 7210
365 Ga0207699_10052537 3300025906 Bacteria 2412
366 Ga0207699_10074353 3300025906 Bacteria 2087
367 Ga0207699_10076009 3300025906 Bacteria 2067
368 Ga0207645_10000248 3300025907 Bacteria 44949
369 Ga0207643_10000064 3300025908 Bacteria 70490
370 Ga0207643_10200940 3300025908 Bacteria 1214
371 Ga0207654_10001623 3300025911 Bacteria 11742
372 Ga0207654_10055710 3300025911 Bacteria 2290
373 Ga0207654_10109549 3300025911 Bacteria 1716
374 Ga0207707_10002084 3300025912 Bacteria 18100
375 Ga0207707_10276060 3300025912 Bacteria 1456
376 Ga0207695_10387313 3300025913 Bacteria 1283
377 Ga0207695_10424328 3300025913 Bacteria 1214
378 Ga0207671_10007347 3300025914 Bacteria 9567
379 Ga0207671_10016982 3300025914 Bacteria 5633
380 Ga0207693_10015019 3300025915 Bacteria 6216
381 Ga0207693_10016146 3300025915 Bacteria 5972
382 Ga0207693_10031012 3300025915 Bacteria 4223
383 Ga0207693_10050174 3300025915 Bacteria 3277
384 Ga0207663_10033406 3300025916 Bacteria 3064
385 Ga0207660_10000194 3300025917 Bacteria 38742
386 Ga0207660_10020931 3300025917 Bacteria 4394
387 Ga0207660_10387402 3300025917 Bacteria 1124
388 Ga0207662_10001637 3300025918 Bacteria 10959
389 Ga0207662_10012055 3300025918 Bacteria 4809
390 Ga0207657_10006919 3300025919 Bacteria 11695
391 Ga0207657_10103323 3300025919 Bacteria 2362
392 Ga0207657_10126273 3300025919 Bacteria 2101
393 Ga0207657_10146132 3300025919 Bacteria 1928
394 Ga0207649_10000234 3300025920 Bacteria 45397
395 Ga0207649_10195825 3300025920 Bacteria 1424
396 Ga0207649_10259803 3300025920 Bacteria 1254
397 Ga0207652_10001613 3300025921 Bacteria 19823
398 Ga0207652_10002210 3300025921 Bacteria 16600
399 Ga0207652_10033371 3300025921 Bacteria 4334
400 Ga0207652_10108802 3300025921 Bacteria 2456
401 Ga0207652_10248611 3300025921 Bacteria 1604
402 Ga0207646_10161302 3300025922 Bacteria 2023
403 Ga0207681_10000794 3300025923 Bacteria 20828
404 Ga0207650_10010580 3300025925 Bacteria 6336
405 Ga0207650_10174661 3300025925 Bacteria 1709
406 Ga0207659_10000172 3300025926 Bacteria 38725
407 Ga0207659_10130264 3300025926 Bacteria 1940
408 Ga0207659_10611563 3300025926 Bacteria 930
409 Ga0207687_10008699 3300025927 Bacteria 6631
410 Ga0207687_10018894 3300025927 Bacteria 4558
411 Ga0207687_10158696 3300025927 Bacteria 1733
412 Ga0207700_10339698 3300025928 Bacteria 1305
413 Ga0207700_10459064 3300025928 Bacteria 1123
414 Ga0207700_11199531 3300025928 Bacteria 677
415 Ga0207664_10011995 3300025929 Bacteria 6186
416 Ga0207664_10259341 3300025929 Bacteria 1520
417 Ga0207664_10260833 3300025929 Bacteria 1515
418 Ga0207644_10000439 3300025931 Bacteria 26923
419 Ga0207644_10041647 3300025931 Bacteria 3250
420 Ga0207644_10050000 3300025931 Bacteria 2995
421 Ga0207690_10000796 3300025932 Bacteria 20342
422 Ga0207690_10013199 3300025932 Bacteria 4958
423 Ga0207690_10260751 3300025932 Bacteria 1343
424 Ga0207706_10005059 3300025933 Bacteria 12314
425 Ga0207706_10031628 3300025933 Bacteria 4713
426 Ga0207706_10032340 3300025933 Bacteria 4660
427 Ga0207706_10230288 3300025933 Bacteria 1621
428 Ga0207686_10001093 3300025934 Bacteria 15891
429 Ga0207686_10028444 3300025934 Bacteria 3286
430 Ga0207686_10058609 3300025934 Bacteria 2428
431 Ga0207686_10227163 3300025934 Bacteria 1351
432 Ga0207709_10001438 3300025935 Bacteria 16619
433 Ga0207709_10012223 3300025935 Bacteria 4730
434 Ga0207709_10038752 3300025935 Bacteria 2842
435 Ga0207670_10000608 3300025936 Bacteria 19358
436 Ga0207670_10000807 3300025936 Bacteria 16336
437 Ga0207670_10104914 3300025936 Bacteria 2025
438 Ga0207670_10412987 3300025936 Bacteria 1081
439 Ga0207669_10000141 3300025937 Bacteria 34618
440 Ga0207669_10211782 3300025937 Bacteria 1415
441 Ga0207704_10000755 3300025938 Bacteria 14264
442 Ga0207704_10019206 3300025938 Bacteria 3585
443 Ga0207704_10022632 3300025938 Bacteria 3372
444 Ga0207704_10286088 3300025938 Bacteria 1255
445 Ga0207665_10003066 3300025939 Bacteria 11213
446 Ga0207665_10034796 3300025939 Bacteria 3342
447 Ga0207665_10372956 3300025939 Bacteria 1081
448 Ga0207665_10495413 3300025939 Bacteria 943
449 Ga0207691_10006997 3300025940 Bacteria 10884
450 Ga0207691_10221408 3300025940 Bacteria 1641
451 Ga0207691_10371733 3300025940 Bacteria 1221
452 Ga0207711_10003636 3300025941 Bacteria 13333
453 Ga0207711_10004836 3300025941 Bacteria 11448
454 Ga0207711_10006747 3300025941 Bacteria 9652
455 Ga0207711_10089790 3300025941 Bacteria 2700
456 Ga0207711_10241018 3300025941 Bacteria 1658
457 Ga0207689_10004430 3300025942 Bacteria 12738
458 Ga0207689_10122069 3300025942 Bacteria 2142
459 Ga0207689_10239138 3300025942 Bacteria 1501
460 Ga0207689_11094343 3300025942 Bacteria 672
461 Ga0207661_10000098 3300025944 Bacteria 55518
462 Ga0207661_10096962 3300025944 Bacteria 2468
463 Ga0207679_10000174 3300025945 Bacteria 53051
464 Ga0207679_10021341 3300025945 Bacteria 4390
465 Ga0207679_10620957 3300025945 Bacteria 976
466 Ga0207679_10925973 3300025945 Bacteria 798
467 Ga0207679_11052426 3300025945 Bacteria 746
468 Ga0207667_10004743 3300025949 Bacteria 16630
469 Ga0207651_10000782 3300025960 Bacteria 13684
470 Ga0207651_10002999 3300025960 Bacteria 8177
471 Ga0207651_10233029 3300025960 Bacteria 1496
472 Ga0207712_10000659 3300025961 Bacteria 26800
473 Ga0207712_10039876 3300025961 Bacteria 3220
474 Ga0207712_10332225 3300025961 Bacteria 1258
475 Ga0207668_10001107 3300025972 Bacteria 16030
476 Ga0207668_10012828 3300025972 Bacteria 5142
477 Ga0207640_10000846 3300025981 Bacteria 17376
478 Ga0207658_10001843 3300025986 Bacteria 15875
479 Ga0207658_10123524 3300025986 Bacteria 2068
480 Ga0207658_10154750 3300025986 Bacteria 1872
481 Ga0207658_10191697 3300025986 Bacteria 1699
482 Ga0207677_10101282 3300026023 Bacteria 2120
483 Ga0207677_10348421 3300026023 Bacteria 1240
484 Ga0207703_10002433 3300026035 Bacteria 16135
485 Ga0207703_10006706 3300026035 Bacteria 9188
486 Ga0207703_10043948 3300026035 Bacteria 3588
487 Ga0207703_10306701 3300026035 Bacteria 1450
488 Ga0207703_10398746 3300026035 Bacteria 1276
489 Ga0207703_11506208 3300026035 Bacteria 647
490 Ga0207639_10001774 3300026041 Bacteria 14522
491 Ga0207639_10388798 3300026041 Bacteria 1254
492 Ga0207678_10001059 3300026067 Bacteria 25176
493 Ga0207678_10006214 3300026067 Bacteria 10613
494 Ga0207678_10030636 3300026067 Bacteria 4696
495 Ga0207678_10082021 3300026067 Bacteria 2760
496 Ga0207678_10406356 3300026067 Bacteria 1179
497 Ga0207708_10002793 3300026075 Bacteria 12833
498 Ga0207708_10020046 3300026075 Bacteria 5042
499 Ga0207702_10014464 3300026078 Bacteria 6553
500 Ga0207702_10041934 3300026078 Bacteria 3838
501 Ga0207702_10169832 3300026078 Bacteria 1999
502 Ga0207641_10000622 3300026088 Bacteria 38657
503 Ga0207641_10640641 3300026088 Bacteria 1043
504 Ga0207648_10009300 3300026089 Bacteria 9423
505 Ga0207648_10062170 3300026089 Bacteria 3256
506 Ga0207648_10735065 3300026089 Bacteria 916
507 Ga0207676_10002696 3300026095 Bacteria 12630
508 Ga0207676_10231674 3300026095 Bacteria 1651
509 Ga0207676_10347863 3300026095 Bacteria 1370
510 Ga0207674_10001342 3300026116 Bacteria 31848
511 Ga0207674_10036947 3300026116 Bacteria 5083
512 Ga0207675_100006706 3300026118 Bacteria 10886
513 Ga0207675_100011711 3300026118 Bacteria 8203
514 Ga0207683_10001193 3300026121 Bacteria 23509
515 Ga0207683_10024887 3300026121 Bacteria 5159
516 Ga0207683_10027481 3300026121 Bacteria 4916
517 Ga0207683_10054787 3300026121 Bacteria 3497
518 Ga0207698_10007867 3300026142 Bacteria 6709
519 Ga0209996_1014069 3300027395 Bacteria 1086
520 Ga0209970_1008074 3300027614 Bacteria 1728
521 Ga0210002_1000401 3300027617 Bacteria 5920
522 Ga0209983_1007094 3300027665 Bacteria 2300
523 Ga0209971_1007630 3300027682 Bacteria 2567
524 Ga0209966_1001072 3300027695 Bacteria 4995
525 Ga0209998_10001333 3300027717 Bacteria 5996
526 Ga0209998_10001362 3300027717 Bacteria 5937
527 Ga0209974_10115781 3300027876 Bacteria 946
528 Ga0207428_10000513 3300027907 Bacteria 46311
529 Ga0207428_10000626 3300027907 Bacteria 41522
530 Ga0207428_10001020 3300027907 Bacteria 31018
531 Ga0268265_10002370 3300028380 Bacteria 14256
532 Ga0268265_10014719 3300028380 Bacteria 5337
533 Ga0268264_10004444 3300028381 Bacteria 11961
534 Ga0268264_10188687 3300028381 Bacteria 1877
535 Ga0265337_1009173 3300028556 Bacteria 3550
536 Ga0307515_10339874 3300028794 Bacteria 1154
537 Ga0265338_10462939 3300028800 Bacteria 897
538 Ga0265325_10007153 3300031241 Bacteria 6708
539 Ga0265325_10012441 3300031241 Bacteria 4864
540 Ga0265325_10017987 3300031241 Bacteria 3923
541 Ga0265325_10029347 3300031241 Bacteria 2957
542 Ga0265339_10032503 3300031249 Bacteria 2942
543 Ga0265331_10086462 3300031250 Bacteria 1452
544 Ga0265316_10386059 3300031344 Bacteria 1010
545 Ga0307513_10645055 3300031456 Bacteria 766
546 Ga0307408_100964926 3300031548 Bacteria 784
547 Ga0265313_10000525 3300031595 Bacteria 40049
548 Ga0265313_10008290 3300031595 Bacteria 6926
549 Ga0265313_10016157 3300031595 Bacteria 4304
550 Ga0265313_10107984 3300031595 Bacteria 1227
551 Ga0265313_10164418 3300031595 Bacteria 941
552 Ga0316579_10068836 3300031691 Bacteria 1674
553 Ga0265314_10006316 3300031711 Bacteria 10511
554 Ga0307409_101365069 3300031995 Bacteria 735
555 Ga0307415_100958170 3300032126 Bacteria 793
556 Ga0373948_0000049 3300034817 Bacteria 12986
557 Ga0373948_0014293 3300034817 Bacteria 1444
558 Ga0373948_0056125 3300034817 Bacteria 856
559 Ga0373950_0000665 3300034818 Bacteria 4258
560 Ga0373950_0001094 3300034818 Bacteria 3462
561 Ga0373958_0000026 3300034819 Bacteria 16079
562 Ga0373958_0000135 3300034819 Bacteria 8219
563 Ga0373958_0004984 3300034819 Bacteria 1993
564 Ga0373958_0028965 3300034819 Bacteria 1075
565 Ga0373958_0085299 3300034819 Bacteria 721
566 Ga0373959_0001171 3300034820 Bacteria 4235
567 Ga0373938_0000133 3300034957 Bacteria 10609
568 Ga0373938_0000538 3300034957 Bacteria 6129
569 Ga0373938_0003284 3300034957 Bacteria 2639
570 Ga0373928_0001408 3300035084 Bacteria 4691
571 Ga0373929_0000110 3300035085 Bacteria 13537
572 Ga0373934_0030387 3300035086 Bacteria 2113
573 Ga0373940_0001333 3300035088 Bacteria 4407
574 Ga0373940_0002247 3300035088 Bacteria 3714
575 Ga0373944_0110061 3300035089 Bacteria 939
576 Ga0373944_0153535 3300035089 Bacteria 813
577 Ga0373949_0000771 3300035090 Bacteria 10307
578 Ga0373949_0001010 3300035090 Bacteria 8668
579 Ga0373949_0009925 3300035090 Bacteria 2082
580 Ga0373949_0110874 3300035090 Bacteria 761
581 Ga0373949_0163103 3300035090 Bacteria 651
582 Ga0373951_0001038 3300035091 Bacteria 7468
583 Ga0373951_0002914 3300035091 Bacteria 4253
584 Ga0373951_0003615 3300035091 Bacteria 3728
585 Ga0373951_0033003 3300035091 Bacteria 1226
586 Ga0373952_0000200 3300035092 Bacteria 9497
587 Ga0373952_0000271 3300035092 Bacteria 8517
588 Ga0373952_0002332 3300035092 Bacteria 3422
589 Ga0373923_0059044 3300035111 Bacteria 1625
590 Ga0373923_0098540 3300035111 Bacteria 1286
591 Ga0373923_0278883 3300035111 Bacteria 787
592 Ga0373932_0000822 3300035112 Bacteria 9175
593 Ga0373932_0001180 3300035112 Bacteria 7469
594 Ga0373932_0008434 3300035112 Bacteria 2464
595 Ga0373932_0011585 3300035112 Bacteria 2158
596 Ga0373936_0002908 3300035113 Bacteria 6397
597 Ga0373939_0003897 3300035114 Bacteria 3509
598 Ga0373939_0004068 3300035114 Bacteria 3443
599 Ga0373939_0005157 3300035114 Bacteria 3107
600 Ga0373941_0000259 3300035115 Bacteria 10177
601 Ga0373941_0000952 3300035115 Bacteria 5977
602 Ga0373941_0006275 3300035115 Bacteria 2854
603 Ga0373945_0002980 3300035116 Bacteria 5317
604 Ga0373945_0017410 3300035116 Bacteria 2433
605 Ga0373953_0026413 3300035117 Bacteria 2224
606 Ga0373953_0078767 3300035117 Bacteria 1367
607 Ga0373954_0001844 3300035118 Bacteria 8749
608 Ga0373954_0004126 3300035118 Bacteria 6225
609 Ga0373956_0001114 3300035119 Bacteria 11079
610 Ga0373956_0013063 3300035119 Bacteria 3451
611 Ga0373956_0040689 3300035119 Bacteria 2062
612 Ga0373957_0001424 3300035120 Bacteria 6472
613 Ga0373957_0010241 3300035120 Bacteria 3092
614 Ga0373957_0017200 3300035120 Bacteria 2514
615 Ga0373960_0000277 3300035121 Bacteria 9832
616 Ga0373960_0001175 3300035121 Bacteria 5700
617 Ga0373943_0000267 3300035170 Bacteria 21498
618 Ga0373943_0005699 3300035170 Bacteria 5588
619 Ga0373943_0007845 3300035170 Bacteria 4793
620 Ga0373943_0453324 3300035170 Bacteria 745
621 Ga0373943_0464868 3300035170 Bacteria 736
622 Ga0373946_0006942 3300035171 Bacteria 4123
623 Ga0373946_0010659 3300035171 Bacteria 3408
624 Ga0373946_0302123 3300035171 Bacteria 791
625 Ga0373955_0005446 3300035172 Bacteria 5720
626 Ga0373955_0027080 3300035172 Bacteria 2959
627 Ga0373955_0092033 3300035172 Bacteria 1729
628 Ga0373942_0000533 3300035207 Bacteria 10673
629 Ga0373942_0007137 3300035207 Bacteria 2586
630 Ga0373942_0040070 3300035207 Bacteria 1276
631 Ga0373942_0152320 3300035207 Bacteria 743
632 Ga0373961_0001383 3300035241 Bacteria 7253
633 Ga0373961_0001598 3300035241 Bacteria 6444
634 Ga0373961_0046126 3300035241 Bacteria 1276
635 Ga0373962_0000275 3300035242 Bacteria 11095
636 Ga0373962_0001638 3300035242 Bacteria 5319
637 Ga0373962_0018817 3300035242 Bacteria 1801
638 Ga0373962_0039498 3300035242 Bacteria 1324
639 Ga0373931_0002417 3300035691 Bacteria 8259
640 Ga0373931_0004020 3300035691 Bacteria 6662
641 Ga0373931_0007842 3300035691 Bacteria 5046
642 Ga0373931_0100883 3300035691 Bacteria 1623
643 Ga0373931_0515845 3300035691 Bacteria 773
644 Ga0373935_0001440 3300035692 Bacteria 13192
645 Ga0373935_0001725 3300035692 Bacteria 12243
646 Ga0373927_0002318 3300035695 Bacteria 13902
647 Ga0373927_0008373 3300035695 Bacteria 6962
648 Ga0373927_0016357 3300035695 Bacteria 4894
649 Ga0373927_0053503 3300035695 Bacteria 2612
650 Ga0373927_0209104 3300035695 Bacteria 1281
651 Ga0373933_0003523 3300035724 Bacteria 8715
652 Ga0373933_0022799 3300035724 Bacteria 3570
653 Ga0373933_0041923 3300035724 Bacteria 2704
654 Ga0373933_0143952 3300035724 Bacteria 1506
655 Ga0373933_0607407 3300035724 Bacteria 718
656 Ga0373947_0001425 3300035725 Bacteria 14710
657 Ga0373947_0138212 3300035725 Bacteria 1560
658 Ga0373947_0143833 3300035725 Bacteria 1532
659 Ga0373947_0303149 3300035725 Bacteria 1065
660 Ga0373937_0004926 3300036401 Bacteria 11347
661 Ga0373937_0012806 3300036401 Bacteria 7386
662 Ga0373937_0021169 3300036401 Bacteria 5836
663 Ga0373937_0055967 3300036401 Bacteria 3621
664 Ga0373937_0096606 3300036401 Bacteria 2740
665 Ga0373937_0144215 3300036401 Bacteria 2228
666 Ga0373937_0293079 3300036401 Bacteria 1537
667 Ga0373937_0630658 3300036401 Bacteria 1017
668 Ga0373937_1008473 3300036401 Bacteria 781
669 Ga0373937_1685113 3300036401 Bacteria 581
670 Ga0373925_0001642 3300037068 Bacteria 18838
671 Ga0373925_0015058 3300037068 Bacteria 5590
672 Ga0373925_0116048 3300037068 Bacteria 2073
673 Ga0373925_0149194 3300037068 Bacteria 1835
674 Ga0395900_0001475 3300037418 Bacteria 28056
675 Ga0395900_0071587 3300037418 Bacteria 3564
676 Ga0395900_0391293 3300037418 Bacteria 1356
677 Ga0395898_0057650 3300037466 Bacteria 3784
678 Ga0395898_0074306 3300037466 Bacteria 3283
679 Ga0395898_1295201 3300037466 Bacteria 658
680 Ga0395901_0023603 3300038443 Bacteria 6306
681 Ga0395901_0098684 3300038443 Bacteria 3062
682 Ga0436365_1111585 3300039437 Bacteria 1112
683 Ga0439465_0119165 3300041413 Bacteria 924
684 Ga0451839_1007098 3300041496 Bacteria 1293
685 Ga0451843_1140181 3300041509 Bacteria 1141
686 Ga0439459_0040327 3300042438 Bacteria 990
687 Ga0450893_0059057 3300042532 Bacteria 730
688 Ga0451577_0074007 3300042876 Bacteria 3039
689 Ga0466963_0415975 3300044694 Bacteria 948
690 Ga0466964_0233612 3300044706 Bacteria 899
691 Ga0453684_0077244 3300044712 Bacteria 4176
692 Ga0466957_0282360 3300044842 Bacteria 1111
693 Ga0466959_0090698 3300045049 Bacteria 2195
694 Ga0451576_0013587 3300045051 Bacteria 9101
695 Ga0466967_0804417 3300045976 Bacteria 933
696 Ga0495617_006700 3300046452 Bacteria 4027
697 Ga0495592_0001131 3300046454 Bacteria 18562
698 Ga0495592_0007618 3300046454 Bacteria 8111
699 Ga0495592_0012894 3300046454 Bacteria 6353
700 Ga0495592_0114193 3300046454 Bacteria 1908
701 Ga0495603_0034243 3300046455 Bacteria 3054
702 Ga0495629_0000748 3300046459 Bacteria 26249
703 Ga0495629_0386423 3300046459 Bacteria 952
704 Ga0495638_0021650 3300046460 Bacteria 4231
705 Ga0495641_0023167 3300046461 Bacteria 3091
706 Ga0495641_0025462 3300046461 Bacteria 2904
707 Ga0495651_0131592 3300046462 Bacteria 1826
708 Ga0495651_0148077 3300046462 Bacteria 1695
709 Ga0495651_0165626 3300046462 Bacteria 1579
710 Ga0495653_0006076 3300046463 Bacteria 9893
711 Ga0495653_0151260 3300046463 Bacteria 1621
712 Ga0495653_0178772 3300046463 Bacteria 1458
713 Ga0495653_0318976 3300046463 Bacteria 1008
714 Ga0495580_0027411 3300046472 Bacteria 4145
715 Ga0495580_0132890 3300046472 Bacteria 1725
716 Ga0495582_0020868 3300046473 Bacteria 3587
717 Ga0495582_0061501 3300046473 Bacteria 2073
718 Ga0495639_0005351 3300046475 Bacteria 5527
719 Ga0495639_0012936 3300046475 Bacteria 3601
720 Ga0495662_0159630 3300046476 Bacteria 1111
721 Ga0495662_0328264 3300046476 Bacteria 752
722 Ga0495664_0038492 3300046477 Bacteria 2822
723 Ga0495664_0130634 3300046477 Bacteria 1520
724 Ga0495664_0195979 3300046477 Bacteria 1224
725 Ga0495584_0035359 3300046491 Bacteria 2526
726 Ga0495585_0000546 3300046492 Bacteria 35582
727 Ga0495594_0012140 3300046499 Bacteria 4485
728 Ga0495594_0034883 3300046499 Bacteria 2738
729 Ga0495594_0132898 3300046499 Bacteria 1409
730 Ga0495607_0002967 3300046501 Bacteria 13310
731 Ga0495608_0000557 3300046511 Bacteria 25706
732 Ga0495608_0009270 3300046511 Bacteria 6884
733 Ga0495608_0140150 3300046511 Bacteria 1544
734 Ga0495608_0311387 3300046511 Bacteria 974
735 Ga0495618_0014639 3300046514 Bacteria 4782
736 Ga0495618_0017294 3300046514 Bacteria 4419
737 Ga0495618_0036560 3300046514 Bacteria 3081
738 Ga0495618_0092002 3300046514 Bacteria 1939
739 Ga0495628_0061817 3300046516 Bacteria 2936
740 Ga0495628_0148926 3300046516 Bacteria 1783
741 Ga0495630_0007320 3300046517 Bacteria 7880
742 Ga0495630_0114341 3300046517 Bacteria 2045
743 Ga0495630_0307506 3300046517 Bacteria 1211
744 Ga0495631_0018545 3300046518 Bacteria 3274
745 Ga0495644_0014751 3300046523 Bacteria 2992
746 Ga0495666_0012431 3300046526 Bacteria 4244
747 Ga0495666_0024785 3300046526 Bacteria 2963
748 Ga0495666_0027064 3300046526 Bacteria 2823
749 Ga0495652_0019278 3300046529 Bacteria 6077
750 Ga0495652_0229583 3300046529 Bacteria 1389
751 Ga0495665_0026242 3300046531 Bacteria 3129
752 Ga0495665_0196386 3300046531 Bacteria 1047
753 Ga0495640_0006625 3300046533 Bacteria 9136
754 Ga0495640_0283421 3300046533 Bacteria 1031
755 Ga0495640_0311360 3300046533 Bacteria 976
756 Ga0495586_0004986 3300046535 Bacteria 7101
757 Ga0495586_0053932 3300046535 Bacteria 2178
758 Ga0495587_0004155 3300046536 Bacteria 9581
759 Ga0495587_0014061 3300046536 Bacteria 5026
760 Ga0495587_0027416 3300046536 Bacteria 3469
761 Ga0495598_0022225 3300046537 Bacteria 1695
762 Ga0495621_0056148 3300046539 Bacteria 1419
763 Ga0495645_0007749 3300046543 Bacteria 7469
764 Ga0495645_0062950 3300046543 Bacteria 2686
765 Ga0495645_0084739 3300046543 Bacteria 2269
766 Ga0495622_0008152 3300046557 Bacteria 4854
767 Ga0495633_0008413 3300046558 Bacteria 5816
768 Ga0495667_0001194 3300046559 Bacteria 16949
769 Ga0495667_0002899 3300046559 Bacteria 11503
770 Ga0495667_0009830 3300046559 Bacteria 6479
771 Ga0495667_0030978 3300046559 Bacteria 3592
772 Ga0495656_0282358 3300046615 Bacteria 846
773 Ga0495634_0022647 3300046642 Bacteria 4425
774 Ga0495634_0084280 3300046642 Bacteria 2072
775 Ga0495634_0129488 3300046642 Bacteria 1610
776 Ga0495635_0019672 3300046663 Bacteria 4701
777 Ga0495635_0091251 3300046663 Bacteria 2083
778 Ga0495635_0141048 3300046663 Bacteria 1641
779 Ga0495635_0314070 3300046663 Bacteria 1049
780 Ga0495659_0000633 3300046664 Bacteria 12802
781 Ga0495588_0144505 3300046674 Bacteria 1257
782 Ga0495657_0040922 3300046675 Bacteria 3175
783 Ga0495657_0041424 3300046675 Bacteria 3151
784 Ga0495599_0001663 3300046678 Bacteria 12840
785 Ga0495599_0017327 3300046678 Bacteria 4479
786 Ga0495623_0001616 3300046679 Bacteria 15135
787 Ga0495623_0007933 3300046679 Bacteria 6902
788 Ga0495646_0003032 3300046680 Bacteria 10400
789 Ga0495646_0005955 3300046680 Bacteria 7729
790 Ga0495646_0116695 3300046680 Bacteria 1514
791 Ga0495647_0000453 3300046681 Bacteria 11831
792 Ga0495647_0004002 3300046681 Bacteria 4756
793 Ga0495647_0008665 3300046681 Bacteria 3423
794 Ga0495647_0091397 3300046681 Bacteria 1248
795 Ga0495658_0001515 3300046683 Bacteria 12183
796 Ga0495658_0003288 3300046683 Bacteria 8032
797 Ga0495669_0077930 3300046684 Bacteria 1518
798 Ga0495613_0063175 3300046689 Bacteria 2709
799 Ga0495613_0169781 3300046689 Bacteria 1548
800 Ga0495613_0287942 3300046689 Bacteria 1139
801 Ga0495624_0002572 3300046690 Bacteria 13714
802 Ga0495624_0010998 3300046690 Bacteria 6232
803 Ga0495624_0139800 3300046690 Bacteria 1484
804 Ga0495600_0002049 3300046809 Bacteria 11360
805 Ga0495600_0011556 3300046809 Bacteria 5506
806 Ga0495581_0055265 3300047315 Bacteria 2291
807 Ga0495581_0063230 3300047315 Bacteria 2138
808 Ga0495604_0001274 3300047317 Bacteria 20598
809 Ga0495604_0003734 3300047317 Bacteria 12126
810 Ga0495604_0018396 3300047317 Bacteria 5595
811 Ga0495674_0016969 3300047319 Bacteria 6786
812 Ga0495674_0079579 3300047319 Bacteria 2814
813 Ga0495674_0125471 3300047319 Bacteria 2166
814 Ga0495674_0171607 3300047319 Bacteria 1809
815 Ga0495676_0027741 3300047321 Bacteria 4851
816 Ga0495676_0065631 3300047321 Bacteria 2816
817 Ga0495676_0148043 3300047321 Bacteria 1674
818 Ga0495676_0372758 3300047321 Bacteria 951
819 Ga0495680_0006572 3300047322 Bacteria 10788
820 Ga0495680_0008513 3300047322 Bacteria 9321
821 Ga0495680_0012421 3300047322 Bacteria 7495
822 Ga0495680_0036047 3300047322 Bacteria 3976
823 Ga0495680_0039455 3300047322 Bacteria 3767
824 Ga0495680_0061841 3300047322 Bacteria 2879
825 Ga0495675_0000740 3300047444 Bacteria 20363
826 Ga0495675_0005699 3300047444 Bacteria 7613
827 Ga0495675_0010997 3300047444 Bacteria 5672
828 Ga0495684_0004959 3300047471 Bacteria 10397
829 Ga0495684_0034085 3300047471 Bacteria 3906
830 Ga0495684_0169551 3300047471 Bacteria 1624
831 Ga0495684_0199773 3300047471 Bacteria 1474
832 Ga0495684_0234651 3300047471 Bacteria 1340
833 Ga0495593_0006602 3300047673 Bacteria 6788
834 Ga0495593_0021323 3300047673 Bacteria 3621
835 Ga0495593_0048086 3300047673 Bacteria 2267
836 Ga0495602_0002218 3300048088 Bacteria 19614
837 Ga0495602_0051357 3300048088 Bacteria 3672
838 Ga0495602_0054723 3300048088 Bacteria 3520
839 Ga0495602_0076279 3300048088 Bacteria 2841
840 Ga0495614_0180128 3300048089 Bacteria 950
841 Ga0495614_0425799 3300048089 Bacteria 626
842 Ga0496100_0000447 3300048903 Bacteria 19924
843 Ga0496100_0000501 3300048903 Bacteria 18814
844 Ga0496100_0018638 3300048903 Bacteria 4121
845 Ga0496100_0080583 3300048903 Bacteria 2197
846 Ga0496100_0749709 3300048903 Bacteria 764
847 Ga0496101_0001349 3300048904 Bacteria 14712
848 Ga0496101_0005470 3300048904 Bacteria 8098
849 Ga0496101_0039625 3300048904 Bacteria 3352
850 Ga0496102_0002354 3300048905 Bacteria 16125
851 Ga0496102_0083393 3300048905 Bacteria 2949
852 Ga0496102_0096599 3300048905 Bacteria 2739
853 Ga0496102_0346195 3300048905 Bacteria 1399
854 Ga0496102_0430748 3300048905 Bacteria 1238
855 Ga0496103_0000837 3300048906 Bacteria 22480
856 Ga0496103_0023448 3300048906 Bacteria 3721
857 Ga0496103_0036345 3300048906 Bacteria 3016
858 Ga0496103_0102731 3300048906 Bacteria 1810
859 Ga0496104_0000126 3300048907 Bacteria 70488
860 Ga0496104_0004960 3300048907 Bacteria 11617
861 Ga0496104_0027230 3300048907 Bacteria 5290
862 Ga0496104_0074672 3300048907 Bacteria 3227
863 Ga0496104_0131627 3300048907 Bacteria 2403
864 Ga0496104_0904560 3300048907 Bacteria 787
865 Ga0496105_0000117 3300048908 Bacteria 54274
866 Ga0496105_0002637 3300048908 Bacteria 13054
867 Ga0496105_0020680 3300048908 Bacteria 5320
868 Ga0496105_0024254 3300048908 Bacteria 4929
869 Ga0496106_0001351 3300048909 Bacteria 18370
870 Ga0496106_0011805 3300048909 Bacteria 6448
871 Ga0496106_0012975 3300048909 Bacteria 6148
872 Ga0496106_0037295 3300048909 Bacteria 3636
873 Ga0496106_0122012 3300048909 Bacteria 2037
874 Ga0496106_0318858 3300048909 Bacteria 1247
875 Ga0496107_0001211 3300048910 Bacteria 15713
876 Ga0496107_0016353 3300048910 Bacteria 5207
877 Ga0496107_0017254 3300048910 Bacteria 5076
878 Ga0496107_0056195 3300048910 Bacteria 2843
879 Ga0496107_0127761 3300048910 Bacteria 1875
880 Ga0496107_0129895 3300048910 Bacteria 1859
881 Ga0496108_0006065 3300048911 Bacteria 9774
882 Ga0496108_0015761 3300048911 Bacteria 6161
883 Ga0496108_0016812 3300048911 Bacteria 5977
884 Ga0496108_0397554 3300048911 Bacteria 1203
885 Ga0496109_0000188 3300048912 Bacteria 61633
886 Ga0496109_0002868 3300048912 Bacteria 14419
887 Ga0496109_0005044 3300048912 Bacteria 11034
888 Ga0496109_0056119 3300048912 Bacteria 3594
889 Ga0496109_0057110 3300048912 Bacteria 3561
890 Ga0496109_0066995 3300048912 Bacteria 3288
891 Ga0496109_0361875 3300048912 Bacteria 1370
892 Ga0496109_0409615 3300048912 Bacteria 1281
893 Ga0496109_0684842 3300048912 Bacteria 962
894 Ga0496110_0006025 3300048913 Bacteria 9550
895 Ga0496110_0006085 3300048913 Bacteria 9508
896 Ga0496110_0030903 3300048913 Bacteria 4619
897 Ga0496110_0068915 3300048913 Bacteria 3132
898 Ga0496110_0203676 3300048913 Bacteria 1798
899 Ga0496110_0368821 3300048913 Bacteria 1308
900 Ga0496111_0008703 3300048914 Bacteria 6735
901 Ga0496111_0040142 3300048914 Bacteria 3356
902 Ga0496111_0045141 3300048914 Bacteria 3170
903 Ga0496111_0188898 3300048914 Bacteria 1532
904 Ga0496112_0004798 3300048915 Bacteria 11537
905 Ga0496112_0026058 3300048915 Bacteria 5621
906 Ga0496112_0099248 3300048915 Bacteria 2881
907 Ga0496112_0142749 3300048915 Bacteria 2363
908 Ga0496113_0004222 3300048916 Bacteria 8788
909 Ga0496113_0066091 3300048916 Bacteria 2738
910 Ga0496113_0098160 3300048916 Bacteria 2267
911 Ga0496113_0106322 3300048916 Bacteria 2180
912 Ga0496113_0114080 3300048916 Bacteria 2106
913 Ga0496113_0254442 3300048916 Bacteria 1402
914 Ga0496114_0001734 3300048917 Bacteria 16551
915 Ga0496114_0008857 3300048917 Bacteria 7976
916 Ga0496114_0022764 3300048917 Bacteria 5107
917 Ga0496114_0207371 3300048917 Bacteria 1718
918 Ga0496114_0208722 3300048917 Bacteria 1712
919 Ga0496115_0000592 3300048918 Bacteria 27769
920 Ga0496115_0027143 3300048918 Bacteria 4475
921 Ga0496115_0062645 3300048918 Bacteria 3001
922 Ga0496115_0070401 3300048918 Bacteria 2835
923 Ga0496115_0083249 3300048918 Bacteria 2608
924 Ga0496115_0140201 3300048918 Bacteria 1994
925 Ga0496115_0255662 3300048918 Bacteria 1441
926 Ga0496115_0272788 3300048918 Bacteria 1389
927 Ga0496123_0227291 3300048926 Bacteria 937
928 Ga0501032_0030974 3300049569 Bacteria 3669
929 Ga0501032_0195940 3300049569 Bacteria 1319
930 Ga0501033_0017120 3300049570 Bacteria 5479
931 Ga0501033_0092352 3300049570 Bacteria 2213
932 Ga0501033_0365779 3300049570 Bacteria 1009
933 Ga0501034_0008567 3300049571 Bacteria 10794
934 Ga0501034_0040118 3300049571 Bacteria 4740
935 Ga0501034_0041240 3300049571 Bacteria 4670
936 Ga0501034_0092690 3300049571 Bacteria 3017
937 Ga0501034_0163904 3300049571 Bacteria 2192
938 Ga0501034_0288833 3300049571 Bacteria 1578
939 Ga0501034_0904130 3300049571 Bacteria 770
940 Ga0501036_0000281 3300049572 Bacteria 35045
941 Ga0501036_0134137 3300049572 Bacteria 2089
942 Ga0501036_0284551 3300049572 Bacteria 1383
943 Ga0501036_0527761 3300049572 Bacteria 981
944 Ga0501036_0628177 3300049572 Bacteria 890
945 Ga0501037_0014910 3300049573 Bacteria 5718
946 Ga0501037_0039382 3300049573 Bacteria 3479
947 Ga0501037_0109601 3300049573 Bacteria 1989
948 Ga0501037_0124625 3300049573 Bacteria 1850
949 Ga0501038_0039412 3300049574 Bacteria 4132
950 Ga0501038_0039534 3300049574 Bacteria 4125
951 Ga0501038_0282093 3300049574 Bacteria 1307
952 Ga0501038_0490513 3300049574 Bacteria 940
953 Ga0501039_0112844 3300049575 Bacteria 2125
954 Ga0501039_0330335 3300049575 Bacteria 1198
955 Ga0501040_0317409 3300049576 Bacteria 1114
956 Ga0501043_0005571 3300049579 Bacteria 10146
957 Ga0501043_0102011 3300049579 Bacteria 2255
958 Ga0501043_0139445 3300049579 Bacteria 1899
959 Ga0501043_0735154 3300049579 Bacteria 718
960 Ga0501046_0398364 3300049580 Bacteria 995
961 Ga0501047_0000316 3300049581 Bacteria 55680
962 Ga0501047_0109688 3300049581 Bacteria 2642
963 Ga0501047_0194915 3300049581 Bacteria 1888
964 Ga0501047_0205130 3300049581 Bacteria 1831
965 Ga0501048_0000150 3300049582 Bacteria 42721
966 Ga0501048_0093929 3300049582 Bacteria 2116
967 Ga0501048_0241721 3300049582 Bacteria 1281
968 Ga0501067_0015221 3300049583 Bacteria 4259
969 Ga0501068_0046081 3300049584 Bacteria 2628
970 Ga0501068_0152941 3300049584 Bacteria 1450
971 Ga0501068_0439341 3300049584 Bacteria 843
972 Ga0501068_0643654 3300049584 Bacteria 692
973 Ga0501069_0602264 3300049585 Bacteria 659
974 Ga0501070_0015099 3300049586 Bacteria 6501
975 Ga0501070_0092398 3300049586 Bacteria 2504
976 Ga0501070_0283795 3300049586 Bacteria 1350
977 Ga0501070_0427535 3300049586 Bacteria 1069
978 Ga0501070_1111479 3300049586 Bacteria 609
979 Ga0501071_0020000 3300049587 Bacteria 4650
980 Ga0501071_0098843 3300049587 Bacteria 2150
981 Ga0501072_0205727 3300049588 Bacteria 1569
982 Ga0501073_0095755 3300049589 Bacteria 2061
983 Ga0501074_0024398 3300049590 Bacteria 4395
984 Ga0501079_0031559 3300049741 Bacteria 4072
985 Ga0501079_0541084 3300049741 Bacteria 916
986 Ga0501080_0001372 3300049742 Bacteria 20366
987 Ga0501080_0061704 3300049742 Bacteria 3489
988 Ga0501080_0077738 3300049742 Bacteria 3086
989 Ga0501080_0097720 3300049742 Bacteria 2726
990 Ga0501083_0002096 3300049744 Bacteria 13707
991 Ga0501083_0066063 3300049744 Bacteria 2409
992 Ga0501035_0089759 3300049822 Bacteria 2706
993 Ga0501035_0131817 3300049822 Bacteria 2178
994 Ga0501035_0170047 3300049822 Bacteria 1883
995 Ga0501044_0009598 3300049823 Bacteria 10531
996 Ga0501044_0069472 3300049823 Bacteria 3585
997 Ga0501044_0082385 3300049823 Bacteria 3255
998 Ga0501044_0096639 3300049823 Bacteria 2975
999 Ga0501044_0190547 3300049823 Bacteria 2013
1000 Ga0501044_0444213 3300049823 Bacteria 1204
1001 Ga0501045_0265619 3300049824 Bacteria 1278
1002 Ga0501045_0328052 3300049824 Bacteria 1139
1003 nmdc:mga03n38_100195_c1 3300050490 Bacteria 1396
1004 nmdc:mga03n38_43234_c1 3300050490 Bacteria 1974
1005 nmdc:mga03n38_8072_c1 3300050490 Bacteria 3757
1006 nmdc:mga00v17_151054_c1 3300050491 Bacteria 1493
1007 nmdc:mga00v17_551079_c1 3300050491 Bacteria 746
1008 nmdc:mga0k408_134146_c1 3300050493 Bacteria 1471
1009 nmdc:mga0k408_475333_c1 3300050493 Bacteria 741
1010 nmdc:mga06z11_321150_c1 3300050494 Bacteria 924
1011 nmdc:mga04h51_254273_c1 3300050495 Bacteria 705
1012 nmdc:mga07m45_123873_c1 3300050496 Bacteria 1494
1013 nmdc:mga07m45_144875_c1 3300050496 Bacteria 1377
1014 nmdc:mga07m45_176630_c1 3300050496 Bacteria 1242
1015 nmdc:mga07m45_31114_c1 3300050496 Bacteria 2956
1016 nmdc:mga05p37_1114_c1 3300050507 Bacteria 30870
1017 nmdc:mga05p37_79219_c1 3300050507 Bacteria 4046
1018 nmdc:mga09592_1302_c1 3300050508 Bacteria 20054
1019 nmdc:mga0qj67_276_c1 3300050509 Bacteria 35718
1020 nmdc:mga06r32_3728_c1 3300050510 Bacteria 13639
1021 nmdc:mga08y16_3668_c1 3300050511 Bacteria 15982
1022 nmdc:mga08y16_7407_c1 3300050511 Bacteria 11499
1023 nmdc:mga08y16_8959_c1 3300050511 Bacteria 10509
1024 nmdc:mga0n895_124362_c1 3300050512 Bacteria 2602
1025 nmdc:mga0n895_217077_c1 3300050512 Bacteria 1942
1026 nmdc:mga0n895_224722_c1 3300050512 Bacteria 1906
1027 nmdc:mga0n895_3698_c1 3300050512 Bacteria 12366
1028 nmdc:mga0n895_651_c1 3300050512 Bacteria 24245
1029 nmdc:mga0n895_682_c1 3300050512 Bacteria 23848
1030 nmdc:mga0rr50_2190_c1 3300050513 Bacteria 10950
1031 nmdc:mga0rr50_286227_c1 3300050513 Bacteria 1376
1032 nmdc:mga0rr50_453760_c1 3300050513 Bacteria 1087
1033 nmdc:mga0rr50_919_c1 3300050513 Bacteria 15930
1034 nmdc:mga08x19_56758_c1 3300050514 Bacteria 2528
1035 nmdc:mga08x19_87785_c1 3300050514 Bacteria 2049
1036 nmdc:mga0a205_1012_c1 3300050515 Bacteria 23345
1037 nmdc:mga0a205_1633_c1 3300050515 Bacteria 19288
1038 nmdc:mga0a205_190661_c1 3300050515 Bacteria 1942
1039 nmdc:mga0a205_21841_c1 3300050515 Bacteria 6053
1040 nmdc:mga0sz30_105616_c1 3300050516 Bacteria 1232
1041 nmdc:mga0sz30_170913_c1 3300050516 Bacteria 964
1042 Ga0495601_0000128 3300053077 Bacteria 42850
1043 Ga0495601_0011860 3300053077 Bacteria 5225
1044 Ga0495601_0020775 3300053077 Bacteria 4013
1045 Ga0495601_0070486 3300053077 Bacteria 2231
1046 Ga0495601_0071243 3300053077 Bacteria 2219
1047 Ga0495612_0002217 3300053078 Bacteria 7992
1048 Ga0495612_0009092 3300053078 Bacteria 4029
1049 Ga0495595_0000976 3300053084 Bacteria 11021
1050 Ga0495595_0003217 3300053084 Bacteria 6484
1051 Ga0495595_0004577 3300053084 Bacteria 5562
1052 Ga0495595_0011834 3300053084 Bacteria 3657
1053 Ga0495595_0099156 3300053084 Bacteria 1405
1054 Ga0495595_0102320 3300053084 Bacteria 1384
1055 Ga0495595_0215650 3300053084 Bacteria 957
1056 Ga0495619_0000016 3300053085 Bacteria 231442
1057 Ga0495619_0000231 3300053085 Bacteria 40742
1058 Ga0495619_0000252 3300053085 Bacteria 38976
1059 Ga0495619_0011260 3300053085 Bacteria 5625
1060 Ga0495619_0011414 3300053085 Bacteria 5594
1061 Ga0495619_0016668 3300053085 Bacteria 4649
1062 Ga0495619_0049308 3300053085 Bacteria 2776
1063 Ga0495619_0136775 3300053085 Bacteria 1686
1064 Ga0495619_0383660 3300053085 Bacteria 971
1065 Ga0500578_0118419 3300053086 Bacteria 1666
1066 Ga0500566_0058632 3300053094 Bacteria 2185
1067 Ga0500569_235355 3300053109 Bacteria 622
1068 Ga0500595_034410 3300053119 Bacteria 1675
1069 Ga0500608_189135 3300053122 Bacteria 863
1070 Ga0500616_0202446 3300053153 Bacteria 878
1071 Ga0500622_0026738 3300053156 Bacteria 3043
1072 Ga0500636_0002418 3300053177 Bacteria 10334
1073 Ga0501084_0089085 3300054114 Bacteria 2590
1074 Ga0501082_0216941 3300060353 Bacteria 1665
1075 2643758725 2643221547 Bacteria 4740017
1076 2739308458 2738543024 Bacteria 5603683
1077 2841915518 2841911363 Bacteria 6173697
1078 2841920720 2841917233 Bacteria 6173500
1079 2889918277 2889914905 Bacteria 5702301
1080 Ga0265332_10212302
1081 2214544925
1082 ARcpr5oldR_c000010
1083 ARSoilYngRDRAFT_c00060
1084 ARcpr5yngRDRAFT_c000016
1085 ARSoilOldRDRAFT_c000011
1086 ARCol0oldRDRAFT_c00012
1087 ARCol0yngRDRAFT_1000018
1088 JGI24032J14994_100108
1089 JGI24741J21665_1013514
1090 JGI24746J21847_1001357
1091 JGI24747J21853_1000086
1092 JGI24740J21852_10025886
1093 JGI24739J22299_10000724
1094 JGI24737J22298_10001113
1095 JGI24750J21931_1000096
1096 JGI24748J21848_1001964
1097 JGI24738J21930_10000997
1098 JGI24749J21850_1024770
1099 JGI24744J21845_10000153
1100 JGI24035J26624_1000660
1101 JGI24034J26672_10000231
1102 JGI24742J22300_10000137
1103 JGI24751J29686_10013941
1104 JGI25405J52794_10011519
1105 Ga0065717_1002132
1106 Ga0065704_10127429
1107 Ga0065712_10011139
1108 Ga0065712_10071510
1109 Ga0065712_10082223
1110 Ga0065715_10001079
1111 Ga0065715_10008006
1112 Ga0065707_10091944
1113 Ga0070676_10000506
1114 Ga0070683_100009453
1115 Ga0070683_100120932
1116 Ga0070690_100002629
1117 Ga0070690_100005686
1118 Ga0070670_100004573
1119 Ga0070677_10000227
1120 Ga0070677_10489552
1121 Ga0068869_100001832
1122 Ga0068869_100347149
1123 Ga0070666_10025905
1124 Ga0070666_10027715
1125 Ga0070666_10161884
1126 Ga0070666_10273376
1127 Ga0070680_100003424
1128 Ga0070680_100025759
1129 Ga0070682_100001699
1130 Ga0070682_100032433
1131 Ga0070682_100207755
1132 Ga0070682_100529188
1133 Ga0068868_100007757
1134 Ga0070660_100008125
1135 Ga0070660_100145897
1136 Ga0070660_100169729
1137 Ga0070689_100000668
1138 Ga0070689_100001841
1139 Ga0070689_100297102
1140 Ga0070689_100344038
1141 Ga0070691_10014066
1142 Ga0070691_10161599
1143 Ga0070691_10293750
1144 Ga0070687_100000527
1145 Ga0070661_100003238
1146 Ga0070661_100344664
1147 Ga0070661_100373633
1148 Ga0070692_10001083
1149 Ga0070668_100003117
1150 Ga0070668_100130887
1151 Ga0070669_100001315
1152 Ga0070675_100002954
1153 Ga0070675_100015172
1154 Ga0070675_100369657
1155 Ga0070675_100720913
1156 Ga0070671_100033121
1157 Ga0070671_100035414
1158 Ga0070674_100002968
1159 Ga0070674_100720369
1160 Ga0070673_100001477
1161 Ga0070673_100101479
1162 Ga0070688_100001239
1163 Ga0070688_100006198
1164 Ga0070688_100033995
1165 Ga0070688_100162605
1166 Ga0070659_100002622
1167 Ga0070659_100015463
1168 Ga0070659_100172634
1169 Ga0070667_100005188
1170 Ga0070667_100089585
1171 Ga0070703_10006319
1172 Ga0070703_10010223
1173 Ga0070709_10108172
1174 Ga0070709_10109350
1175 Ga0070709_10532718
1176 Ga0070714_100074400
1177 Ga0070714_100132937
1178 Ga0070714_100330733
1179 Ga0070713_100248163
1180 Ga0070713_100268476
1181 Ga0070710_10018331
1182 Ga0070710_10059094
1183 Ga0070710_10091163
1184 Ga0070701_10002283
1185 Ga0070701_10008389
1186 Ga0070711_100130116
1187 Ga0070711_100206562
1188 Ga0070705_100001458
1189 Ga0070705_100018737
1190 Ga0070705_100020503
1191 Ga0070700_100001211
1192 Ga0070700_100019152
1193 Ga0070694_100001764
1194 Ga0070694_100070014
1195 Ga0070708_100023985
1196 Ga0070708_100124631
1197 Ga0070663_100000761
1198 Ga0070663_100038492
1199 Ga0070663_100107071
1200 Ga0070663_100230715
1201 Ga0070663_100620418
1202 Ga0070678_100000525
1203 Ga0070678_100125575
1204 Ga0070678_100375734
1205 Ga0070662_100002968
1206 Ga0070662_100050510
1207 Ga0070662_100072657
1208 Ga0070681_10004977
1209 Ga0070681_10220689
1210 Ga0070681_10221180
1211 Ga0070681_10410226
1212 Ga0070681_10805059
1213 Ga0070681_10905305
1214 Ga0068867_100002950
1215 Ga0068867_100092156
1216 Ga0070685_10004716
1217 Ga0070685_10025023
1218 Ga0070685_10027875
1219 Ga0070707_100517710
1220 Ga0070698_100584318
1221 Ga0070679_100015045
1222 Ga0070679_100315891
1223 Ga0070684_100005941
1224 Ga0070684_100019299
1225 Ga0070684_100034783
1226 Ga0070697_100467633
1227 Ga0068853_100003070
1228 Ga0068853_100050832
1229 Ga0068853_100594036
1230 Ga0070672_100002960
1231 Ga0070672_100339281
1232 Ga0070686_100001573
1233 Ga0070686_100008797
1234 Ga0070686_100065168
1235 Ga0070686_100222585
1236 Ga0070695_100002369
1237 Ga0070695_100014478
1238 Ga0070696_100016306
1239 Ga0070696_100021005
1240 Ga0070696_100029021
1241 Ga0070693_100000880
1242 Ga0070704_100001917
1243 Ga0070704_100031811
1244 Ga0068855_100009051
1245 Ga0070664_100002934
1246 Ga0070664_100020499
1247 Ga0070664_100660809
1248 Ga0068857_100000358
1249 Ga0068857_100086207
1250 Ga0068854_100007075
1251 Ga0068856_100045885
1252 Ga0068856_100161948
1253 Ga0070702_100000526
1254 Ga0070702_100308500
1255 Ga0068852_100009893
1256 Ga0068859_100005591
1257 Ga0068859_100038332
1258 Ga0068859_100065369
1259 Ga0068859_101334038
1260 Ga0068864_100001988
1261 Ga0068864_100783779
1262 Ga0068866_10000916
1263 Ga0068866_10161547
1264 Ga0068866_10197133
1265 Ga0068861_100001805
1266 Ga0068861_100011624
1267 Ga0068861_101009703
1268 Ga0068870_10000025
1269 Ga0068870_10135764
1270 Ga0068863_100002964
1271 Ga0068863_100185951
1272 Ga0068863_100460690
1273 Ga0068858_100003227
1274 Ga0068858_100099681
1275 Ga0068858_100343073
1276 Ga0068860_100007120
1277 Ga0068860_100060928
1278 Ga0068860_100180869
1279 Ga0068862_100011988
1280 Ga0068862_100032289
1281 Ga0081455_10002463
1282 Ga0081455_10012779
1283 Ga0081455_10020122
1284 Ga0081455_10188085
1285 Ga0070717_10074409
1286 Ga0070717_10236183
1287 Ga0070717_11465233
1288 Ga0075432_10004844
1289 Ga0075432_10011268
1290 Ga0070715_10030799
1291 Ga0070716_100127591
1292 Ga0070716_100255281
1293 Ga0070712_100022909
1294 Ga0070712_100082682
1295 Ga0070712_100396740
1296 Ga0075367_10081426
1297 Ga0075427_10000109
1298 Ga0097621_100000456
1299 Ga0097621_100010034
1300 Ga0097621_100150100
1301 Ga0068871_100000269
1302 Ga0068871_100290885
1303 Ga0068871_100883976
1304 Ga0075430_100000094
1305 Ga0075431_100002169
1306 Ga0075433_10001242
1307 Ga0075433_10021666
1308 Ga0075433_10037552
1309 Ga0075433_10324029
1310 Ga0075434_100000299
1311 Ga0075434_100011399
1312 Ga0075434_100022390
1313 Ga0075434_100211482
1314 Ga0075434_100351544
1315 Ga0075429_100002930
1316 Ga0068865_100001731
1317 Ga0068865_100054063
1318 Ga0068865_100055301
1319 Ga0075436_100390243
1320 Ga0097620_100005590
1321 Ga0097620_100038332
1322 Ga0097620_100065370
1323 Ga0097620_101333829
1324 Ga0075435_100023116
1325 Ga0075435_100047923
1326 Ga0075435_100276152
1327 Ga0075435_100289239
1328 Ga0075435_100593923
1329 Ga0105244_10023092
1330 Ga0105240_10024320
1331 Ga0105240_10582449
1332 Ga0105240_11282096
1333 Ga0111539_10003217
1334 Ga0111539_10003331
1335 Ga0111539_10007321
1336 Ga0111539_10076769
1337 Ga0105245_10000183
1338 Ga0105245_10088559
1339 Ga0105245_10882646
1340 Ga0105247_10210490
1341 Ga0105247_10225672
1342 Ga0114129_10001218
1343 Ga0114129_10002246
1344 Ga0114129_10866549
1345 Ga0105243_10001561
1346 Ga0105243_10100210
1347 Ga0105243_10171621
1348 Ga0105241_10003567
1349 Ga0105241_10063456
1350 Ga0105241_10203232
1351 Ga0105241_10338921
1352 Ga0105242_10000701
1353 Ga0105242_10006507
1354 Ga0105242_10033043
1355 Ga0105248_10006263
1356 Ga0105248_10010394
1357 Ga0105248_10040556
1358 Ga0105248_10153094
1359 Ga0105248_10424133
1360 Ga0105248_10719629
1361 Ga0105237_10010897
1362 Ga0105237_10125419
1363 Ga0105237_10150914
1364 Ga0105237_10650127
1365 Ga0105237_10822676
1366 Ga0105238_11051622
1367 Ga0105249_10009795
1368 Ga0105249_10124718
1369 Ga0105249_10190361
1370 Ga0105239_10007315
1371 Ga0105239_10054653
1372 Ga0105239_10169366
1373 Ga0105246_10002447
1374 Ga0105246_10049961
1375 Ga0105246_10528029
1376 Ga0105246_10555642
1377 Ga0157321_1002428
1378 Ga0157335_1000784
1379 Ga0157342_1002072
1380 Ga0157373_10017762
1381 Ga0157373_10237996
1382 Ga0157371_10018807
1383 Ga0157370_10175628
1384 Ga0157370_10292424
1385 Ga0157370_10739344
1386 Ga0157369_10449243
1387 Ga0157374_10000463
1388 Ga0157374_10145086
1389 Ga0157378_10000613
1390 Ga0157378_10139508
1391 Ga0157378_10407146
1392 Ga0163162_10005908
1393 Ga0163162_10020966
1394 Ga0163162_10210444
1395 Ga0163162_10492272
1396 Ga0163162_11082860
1397 Ga0163162_11834567
1398 Ga0157372_10010921
1399 Ga0157372_10219504
1400 Ga0157372_10843730
1401 Ga0157375_10004786
1402 Ga0157375_10250000
1403 Ga0157375_10791497
1404 Ga0157375_11065711
1405 Ga0163163_10001239
1406 Ga0163163_10035378
1407 Ga0163163_10548246
1408 Ga0157380_10004641
1409 Ga0182008_10065920
1410 Ga0157377_10000358
1411 Ga0157377_10160273
1412 Ga0157377_10731243
1413 Ga0157379_10003902
1414 Ga0157379_10073473
1415 Ga0157379_10111692
1416 Ga0157376_10003730
1417 Ga0157376_10117525
1418 Ga0157376_10309774
1419 Ga0157376_10628833
1420 Ga0163161_10001492
1421 Ga0207666_1000140
1422 Ga0207666_1000838
1423 Ga0207673_1000039
1424 Ga0207697_10000763
1425 Ga0207697_10015702
1426 Ga0207653_10001778
1427 Ga0207653_10004542
1428 Ga0207682_10000062
1429 Ga0207692_10009135
1430 Ga0207692_10027325
1431 Ga0207692_10063538
1432 Ga0207642_10002089
1433 Ga0207642_10037083
1434 Ga0207642_10291787
1435 Ga0207710_10010626
1436 Ga0207710_10016965
1437 Ga0207688_10001992
1438 Ga0207688_10023221
1439 Ga0207680_10000740
1440 Ga0207680_10028054
1441 Ga0207680_10057899
1442 Ga0207647_10003504
1443 Ga0207647_10008790
1444 Ga0207699_10052537
1445 Ga0207699_10074353
1446 Ga0207699_10076009
1447 Ga0207645_10000248
1448 Ga0207643_10000064
1449 Ga0207643_10200940
1450 Ga0207654_10001623
1451 Ga0207654_10055710
1452 Ga0207654_10109549
1453 Ga0207707_10002084
1454 Ga0207707_10276060
1455 Ga0207695_10387313
1456 Ga0207695_10424328
1457 Ga0207671_10007347
1458 Ga0207671_10016982
1459 Ga0207693_10015019
1460 Ga0207693_10016146
1461 Ga0207693_10031012
1462 Ga0207693_10050174
1463 Ga0207663_10033406
1464 Ga0207660_10000194
1465 Ga0207660_10020931
1466 Ga0207660_10387402
1467 Ga0207662_10001637
1468 Ga0207662_10012055
1469 Ga0207657_10006919
1470 Ga0207657_10103323
1471 Ga0207657_10126273
1472 Ga0207657_10146132
1473 Ga0207649_10000234
1474 Ga0207649_10195825
1475 Ga0207649_10259803
1476 Ga0207652_10001613
1477 Ga0207652_10002210
1478 Ga0207652_10033371
1479 Ga0207652_10108802
1480 Ga0207652_10248611
1481 Ga0207646_10161302
1482 Ga0207681_10000794
1483 Ga0207650_10010580
1484 Ga0207650_10174661
1485 Ga0207659_10000172
1486 Ga0207659_10130264
1487 Ga0207659_10611563
1488 Ga0207687_10008699
1489 Ga0207687_10018894
1490 Ga0207687_10158696
1491 Ga0207700_10339698
1492 Ga0207700_10459064
1493 Ga0207700_11199531
1494 Ga0207664_10011995
1495 Ga0207664_10259341
1496 Ga0207664_10260833
1497 Ga0207644_10000439
1498 Ga0207644_10041647
1499 Ga0207644_10050000
1500 Ga0207690_10000796
1501 Ga0207690_10013199
1502 Ga0207690_10260751
1503 Ga0207706_10005059
1504 Ga0207706_10031628
1505 Ga0207706_10032340
1506 Ga0207706_10230288
1507 Ga0207686_10001093
1508 Ga0207686_10028444
1509 Ga0207686_10058609
1510 Ga0207686_10227163
1511 Ga0207709_10001438
1512 Ga0207709_10012223
1513 Ga0207709_10038752
1514 Ga0207670_10000608
1515 Ga0207670_10000807
1516 Ga0207670_10104914
1517 Ga0207670_10412987
1518 Ga0207669_10000141
1519 Ga0207669_10211782
1520 Ga0207704_10000755
1521 Ga0207704_10019206
1522 Ga0207704_10022632
1523 Ga0207704_10286088
1524 Ga0207665_10003066
1525 Ga0207665_10034796
1526 Ga0207665_10372956
1527 Ga0207665_10495413
1528 Ga0207691_10006997
1529 Ga0207691_10221408
1530 Ga0207691_10371733
1531 Ga0207711_10003636
1532 Ga0207711_10004836
1533 Ga0207711_10006747
1534 Ga0207711_10089790
1535 Ga0207711_10241018
1536 Ga0207689_10004430
1537 Ga0207689_10122069
1538 Ga0207689_10239138
1539 Ga0207689_11094343
1540 Ga0207661_10000098
1541 Ga0207661_10096962
1542 Ga0207679_10000174
1543 Ga0207679_10021341
1544 Ga0207679_10620957
1545 Ga0207679_10925973
1546 Ga0207679_11052426
1547 Ga0207667_10004743
1548 Ga0207651_10000782
1549 Ga0207651_10002999
1550 Ga0207651_10233029
1551 Ga0207712_10000659
1552 Ga0207712_10039876
1553 Ga0207712_10332225
1554 Ga0207668_10001107
1555 Ga0207668_10012828
1556 Ga0207640_10000846
1557 Ga0207658_10001843
1558 Ga0207658_10123524
1559 Ga0207658_10154750
1560 Ga0207658_10191697
1561 Ga0207677_10101282
1562 Ga0207677_10348421
1563 Ga0207703_10002433
1564 Ga0207703_10006706
1565 Ga0207703_10043948
1566 Ga0207703_10306701
1567 Ga0207703_10398746
1568 Ga0207703_11506208
1569 Ga0207639_10001774
1570 Ga0207639_10388798
1571 Ga0207678_10001059
1572 Ga0207678_10006214
1573 Ga0207678_10030636
1574 Ga0207678_10082021
1575 Ga0207678_10406356
1576 Ga0207708_10002793
1577 Ga0207708_10020046
1578 Ga0207702_10014464
1579 Ga0207702_10041934
1580 Ga0207702_10169832
1581 Ga0207641_10000622
1582 Ga0207641_10640641
1583 Ga0207648_10009300
1584 Ga0207648_10062170
1585 Ga0207648_10735065
1586 Ga0207676_10002696
1587 Ga0207676_10231674
1588 Ga0207676_10347863
1589 Ga0207674_10001342
1590 Ga0207674_10036947
1591 Ga0207675_100006706
1592 Ga0207675_100011711
1593 Ga0207683_10001193
1594 Ga0207683_10024887
1595 Ga0207683_10027481
1596 Ga0207683_10054787
1597 Ga0207698_10007867
1598 Ga0209996_1014069
1599 Ga0209970_1008074
1600 Ga0210002_1000401
1601 Ga0209983_1007094
1602 Ga0209971_1007630
1603 Ga0209966_1001072
1604 Ga0209998_10001333
1605 Ga0209998_10001362
1606 Ga0209974_10115781
1607 Ga0207428_10000513
1608 Ga0207428_10000626
1609 Ga0207428_10001020
1610 Ga0268265_10002370
1611 Ga0268265_10014719
1612 Ga0268264_10004444
1613 Ga0268264_10188687
1614 Ga0265337_1009173
1615 Ga0307515_10339874
1616 Ga0265338_10462939
1617 Ga0265325_10007153
1618 Ga0265325_10012441
1619 Ga0265325_10017987
1620 Ga0265325_10029347
1621 Ga0265339_10032503
1622 Ga0265331_10086462
1623 Ga0265316_10386059
1624 Ga0307513_10645055
1625 Ga0307408_100964926
1626 Ga0265313_10000525
1627 Ga0265313_10008290
1628 Ga0265313_10016157
1629 Ga0265313_10107984
1630 Ga0265313_10164418
1631 Ga0316579_10068836
1632 Ga0265314_10006316
1633 Ga0307409_101365069
1634 Ga0307415_100958170
1635 Ga0373948_0000049
1636 Ga0373948_0014293
1637 Ga0373948_0056125
1638 Ga0373950_0000665
1639 Ga0373950_0001094
1640 Ga0373958_0000026
1641 Ga0373958_0000135
1642 Ga0373958_0004984
1643 Ga0373958_0028965
1644 Ga0373958_0085299
1645 Ga0373959_0001171
1646 Ga0373938_0000133
1647 Ga0373938_0000538
1648 Ga0373938_0003284
1649 Ga0373928_0001408
1650 Ga0373929_0000110
1651 Ga0373934_0030387
1652 Ga0373940_0001333
1653 Ga0373940_0002247
1654 Ga0373944_0110061
1655 Ga0373944_0153535
1656 Ga0373949_0000771
1657 Ga0373949_0001010
1658 Ga0373949_0009925
1659 Ga0373949_0110874
1660 Ga0373949_0163103
1661 Ga0373951_0001038
1662 Ga0373951_0002914
1663 Ga0373951_0003615
1664 Ga0373951_0033003
1665 Ga0373952_0000200
1666 Ga0373952_0000271
1667 Ga0373952_0002332
1668 Ga0373923_0059044
1669 Ga0373923_0098540
1670 Ga0373923_0278883
1671 Ga0373932_0000822
1672 Ga0373932_0001180
1673 Ga0373932_0008434
1674 Ga0373932_0011585
1675 Ga0373936_0002908
1676 Ga0373939_0003897
1677 Ga0373939_0004068
1678 Ga0373939_0005157
1679 Ga0373941_0000259
1680 Ga0373941_0000952
1681 Ga0373941_0006275
1682 Ga0373945_0002980
1683 Ga0373945_0017410
1684 Ga0373953_0026413
1685 Ga0373953_0078767
1686 Ga0373954_0001844
1687 Ga0373954_0004126
1688 Ga0373956_0001114
1689 Ga0373956_0013063
1690 Ga0373956_0040689
1691 Ga0373957_0001424
1692 Ga0373957_0010241
1693 Ga0373957_0017200
1694 Ga0373960_0000277
1695 Ga0373960_0001175
1696 Ga0373943_0000267
1697 Ga0373943_0005699
1698 Ga0373943_0007845
1699 Ga0373943_0453324
1700 Ga0373943_0464868
1701 Ga0373946_0006942
1702 Ga0373946_0010659
1703 Ga0373946_0302123
1704 Ga0373955_0005446
1705 Ga0373955_0027080
1706 Ga0373955_0092033
1707 Ga0373942_0000533
1708 Ga0373942_0007137
1709 Ga0373942_0040070
1710 Ga0373942_0152320
1711 Ga0373961_0001383
1712 Ga0373961_0001598
1713 Ga0373961_0046126
1714 Ga0373962_0000275
1715 Ga0373962_0001638
1716 Ga0373962_0018817
1717 Ga0373962_0039498
1718 Ga0373931_0002417
1719 Ga0373931_0004020
1720 Ga0373931_0007842
1721 Ga0373931_0100883
1722 Ga0373931_0515845
1723 Ga0373935_0001440
1724 Ga0373935_0001725
1725 Ga0373927_0002318
1726 Ga0373927_0008373
1727 Ga0373927_0016357
1728 Ga0373927_0053503
1729 Ga0373927_0209104
1730 Ga0373933_0003523
1731 Ga0373933_0022799
1732 Ga0373933_0041923
1733 Ga0373933_0143952
1734 Ga0373933_0607407
1735 Ga0373947_0001425
1736 Ga0373947_0138212
1737 Ga0373947_0143833
1738 Ga0373947_0303149
1739 Ga0373937_0004926
1740 Ga0373937_0012806
1741 Ga0373937_0021169
1742 Ga0373937_0055967
1743 Ga0373937_0096606
1744 Ga0373937_0144215
1745 Ga0373937_0293079
1746 Ga0373937_0630658
1747 Ga0373937_1008473
1748 Ga0373937_1685113
1749 Ga0373925_0001642
1750 Ga0373925_0015058
1751 Ga0373925_0116048
1752 Ga0373925_0149194
1753 Ga0395900_0001475
1754 Ga0395900_0071587
1755 Ga0395900_0391293
1756 Ga0395898_0057650
1757 Ga0395898_0074306
1758 Ga0395898_1295201
1759 Ga0395901_0023603
1760 Ga0395901_0098684
1761 Ga0436365_1111585
1762 Ga0439465_0119165
1763 Ga0451839_1007098
1764 Ga0451843_1140181
1765 Ga0439459_0040327
1766 Ga0450893_0059057
1767 Ga0451577_0074007
1768 Ga0466963_0415975
1769 Ga0466964_0233612
1770 Ga0453684_0077244
1771 Ga0466957_0282360
1772 Ga0466959_0090698
1773 Ga0451576_0013587
1774 Ga0466967_0804417
1775 Ga0495617_006700
1776 Ga0495592_0001131
1777 Ga0495592_0007618
1778 Ga0495592_0012894
1779 Ga0495592_0114193
1780 Ga0495603_0034243
1781 Ga0495629_0000748
1782 Ga0495629_0386423
1783 Ga0495638_0021650
1784 Ga0495641_0023167
1785 Ga0495641_0025462
1786 Ga0495651_0131592
1787 Ga0495651_0148077
1788 Ga0495651_0165626
1789 Ga0495653_0006076
1790 Ga0495653_0151260
1791 Ga0495653_0178772
1792 Ga0495653_0318976
1793 Ga0495580_0027411
1794 Ga0495580_0132890
1795 Ga0495582_0020868
1796 Ga0495582_0061501
1797 Ga0495639_0005351
1798 Ga0495639_0012936
1799 Ga0495662_0159630
1800 Ga0495662_0328264
1801 Ga0495664_0038492
1802 Ga0495664_0130634
1803 Ga0495664_0195979
1804 Ga0495584_0035359
1805 Ga0495585_0000546
1806 Ga0495594_0012140
1807 Ga0495594_0034883
1808 Ga0495594_0132898
1809 Ga0495607_0002967
1810 Ga0495608_0000557
1811 Ga0495608_0009270
1812 Ga0495608_0140150
1813 Ga0495608_0311387
1814 Ga0495618_0014639
1815 Ga0495618_0017294
1816 Ga0495618_0036560
1817 Ga0495618_0092002
1818 Ga0495628_0061817
1819 Ga0495628_0148926
1820 Ga0495630_0007320
1821 Ga0495630_0114341
1822 Ga0495630_0307506
1823 Ga0495631_0018545
1824 Ga0495644_0014751
1825 Ga0495666_0012431
1826 Ga0495666_0024785
1827 Ga0495666_0027064
1828 Ga0495652_0019278
1829 Ga0495652_0229583
1830 Ga0495665_0026242
1831 Ga0495665_0196386
1832 Ga0495640_0006625
1833 Ga0495640_0283421
1834 Ga0495640_0311360
1835 Ga0495586_0004986
1836 Ga0495586_0053932
1837 Ga0495587_0004155
1838 Ga0495587_0014061
1839 Ga0495587_0027416
1840 Ga0495598_0022225
1841 Ga0495621_0056148
1842 Ga0495645_0007749
1843 Ga0495645_0062950
1844 Ga0495645_0084739
1845 Ga0495622_0008152
1846 Ga0495633_0008413
1847 Ga0495667_0001194
1848 Ga0495667_0002899
1849 Ga0495667_0009830
1850 Ga0495667_0030978
1851 Ga0495656_0282358
1852 Ga0495634_0022647
1853 Ga0495634_0084280
1854 Ga0495634_0129488
1855 Ga0495635_0019672
1856 Ga0495635_0091251
1857 Ga0495635_0141048
1858 Ga0495635_0314070
1859 Ga0495659_0000633
1860 Ga0495588_0144505
1861 Ga0495657_0040922
1862 Ga0495657_0041424
1863 Ga0495599_0001663
1864 Ga0495599_0017327
1865 Ga0495623_0001616
1866 Ga0495623_0007933
1867 Ga0495646_0003032
1868 Ga0495646_0005955
1869 Ga0495646_0116695
1870 Ga0495647_0000453
1871 Ga0495647_0004002
1872 Ga0495647_0008665
1873 Ga0495647_0091397
1874 Ga0495658_0001515
1875 Ga0495658_0003288
1876 Ga0495669_0077930
1877 Ga0495613_0063175
1878 Ga0495613_0169781
1879 Ga0495613_0287942
1880 Ga0495624_0002572
1881 Ga0495624_0010998
1882 Ga0495624_0139800
1883 Ga0495600_0002049
1884 Ga0495600_0011556
1885 Ga0495581_0055265
1886 Ga0495581_0063230
1887 Ga0495604_0001274
1888 Ga0495604_0003734
1889 Ga0495604_0018396
1890 Ga0495674_0016969
1891 Ga0495674_0079579
1892 Ga0495674_0125471
1893 Ga0495674_0171607
1894 Ga0495676_0027741
1895 Ga0495676_0065631
1896 Ga0495676_0148043
1897 Ga0495676_0372758
1898 Ga0495680_0006572
1899 Ga0495680_0008513
1900 Ga0495680_0012421
1901 Ga0495680_0036047
1902 Ga0495680_0039455
1903 Ga0495680_0061841
1904 Ga0495675_0000740
1905 Ga0495675_0005699
1906 Ga0495675_0010997
1907 Ga0495684_0004959
1908 Ga0495684_0034085
1909 Ga0495684_0169551
1910 Ga0495684_0199773
1911 Ga0495684_0234651
1912 Ga0495593_0006602
1913 Ga0495593_0021323
1914 Ga0495593_0048086
1915 Ga0495602_0002218
1916 Ga0495602_0051357
1917 Ga0495602_0054723
1918 Ga0495602_0076279
1919 Ga0495614_0180128
1920 Ga0495614_0425799
1921 Ga0496100_0000447
1922 Ga0496100_0000501
1923 Ga0496100_0018638
1924 Ga0496100_0080583
1925 Ga0496100_0749709
1926 Ga0496101_0001349
1927 Ga0496101_0005470
1928 Ga0496101_0039625
1929 Ga0496102_0002354
1930 Ga0496102_0083393
1931 Ga0496102_0096599
1932 Ga0496102_0346195
1933 Ga0496102_0430748
1934 Ga0496103_0000837
1935 Ga0496103_0023448
1936 Ga0496103_0036345
1937 Ga0496103_0102731
1938 Ga0496104_0000126
1939 Ga0496104_0004960
1940 Ga0496104_0027230
1941 Ga0496104_0074672
1942 Ga0496104_0131627
1943 Ga0496104_0904560
1944 Ga0496105_0000117
1945 Ga0496105_0002637
1946 Ga0496105_0020680
1947 Ga0496105_0024254
1948 Ga0496106_0001351
1949 Ga0496106_0011805
1950 Ga0496106_0012975
1951 Ga0496106_0037295
1952 Ga0496106_0122012
1953 Ga0496106_0318858
1954 Ga0496107_0001211
1955 Ga0496107_0016353
1956 Ga0496107_0017254
1957 Ga0496107_0056195
1958 Ga0496107_0127761
1959 Ga0496107_0129895
1960 Ga0496108_0006065
1961 Ga0496108_0015761
1962 Ga0496108_0016812
1963 Ga0496108_0397554
1964 Ga0496109_0000188
1965 Ga0496109_0002868
1966 Ga0496109_0005044
1967 Ga0496109_0056119
1968 Ga0496109_0057110
1969 Ga0496109_0066995
1970 Ga0496109_0361875
1971 Ga0496109_0409615
1972 Ga0496109_0684842
1973 Ga0496110_0006025
1974 Ga0496110_0006085
1975 Ga0496110_0030903
1976 Ga0496110_0068915
1977 Ga0496110_0203676
1978 Ga0496110_0368821
1979 Ga0496111_0008703
1980 Ga0496111_0040142
1981 Ga0496111_0045141
1982 Ga0496111_0188898
1983 Ga0496112_0004798
1984 Ga0496112_0026058
1985 Ga0496112_0099248
1986 Ga0496112_0142749
1987 Ga0496113_0004222
1988 Ga0496113_0066091
1989 Ga0496113_0098160
1990 Ga0496113_0106322
1991 Ga0496113_0114080
1992 Ga0496113_0254442
1993 Ga0496114_0001734
1994 Ga0496114_0008857
1995 Ga0496114_0022764
1996 Ga0496114_0207371
1997 Ga0496114_0208722
1998 Ga0496115_0000592
1999 Ga0496115_0027143
2000 Ga0496115_0062645
2001 Ga0496115_0070401
2002 Ga0496115_0083249
2003 Ga0496115_0140201
2004 Ga0496115_0255662
2005 Ga0496115_0272788
2006 Ga0496123_0227291
2007 Ga0501032_0030974
2008 Ga0501032_0195940
2009 Ga0501033_0017120
2010 Ga0501033_0092352
2011 Ga0501033_0365779
2012 Ga0501034_0008567
2013 Ga0501034_0040118
2014 Ga0501034_0041240
2015 Ga0501034_0092690
2016 Ga0501034_0163904
2017 Ga0501034_0288833
2018 Ga0501034_0904130
2019 Ga0501036_0000281
2020 Ga0501036_0134137
2021 Ga0501036_0284551
2022 Ga0501036_0527761
2023 Ga0501036_0628177
2024 Ga0501037_0014910
2025 Ga0501037_0039382
2026 Ga0501037_0109601
2027 Ga0501037_0124625
2028 Ga0501038_0039412
2029 Ga0501038_0039534
2030 Ga0501038_0282093
2031 Ga0501038_0490513
2032 Ga0501039_0112844
2033 Ga0501039_0330335
2034 Ga0501040_0317409
2035 Ga0501043_0005571
2036 Ga0501043_0102011
2037 Ga0501043_0139445
2038 Ga0501043_0735154
2039 Ga0501046_0398364
2040 Ga0501047_0000316
2041 Ga0501047_0109688
2042 Ga0501047_0194915
2043 Ga0501047_0205130
2044 Ga0501048_0000150
2045 Ga0501048_0093929
2046 Ga0501048_0241721
2047 Ga0501067_0015221
2048 Ga0501068_0046081
2049 Ga0501068_0152941
2050 Ga0501068_0439341
2051 Ga0501068_0643654
2052 Ga0501069_0602264
2053 Ga0501070_0015099
2054 Ga0501070_0092398
2055 Ga0501070_0283795
2056 Ga0501070_0427535
2057 Ga0501070_1111479
2058 Ga0501071_0020000
2059 Ga0501071_0098843
2060 Ga0501072_0205727
2061 Ga0501073_0095755
2062 Ga0501074_0024398
2063 Ga0501079_0031559
2064 Ga0501079_0541084
2065 Ga0501080_0001372
2066 Ga0501080_0061704
2067 Ga0501080_0077738
2068 Ga0501080_0097720
2069 Ga0501083_0002096
2070 Ga0501083_0066063
2071 Ga0501035_0089759
2072 Ga0501035_0131817
2073 Ga0501035_0170047
2074 Ga0501044_0009598
2075 Ga0501044_0069472
2076 Ga0501044_0082385
2077 Ga0501044_0096639
2078 Ga0501044_0190547
2079 Ga0501044_0444213
2080 Ga0501045_0265619
2081 Ga0501045_0328052
2082 nmdc:mga03n38_100195_c1
2083 nmdc:mga03n38_43234_c1
2084 nmdc:mga03n38_8072_c1
2085 nmdc:mga00v17_151054_c1
2086 nmdc:mga00v17_551079_c1
2087 nmdc:mga0k408_134146_c1
2088 nmdc:mga0k408_475333_c1
2089 nmdc:mga06z11_321150_c1
2090 nmdc:mga04h51_254273_c1
2091 nmdc:mga07m45_123873_c1
2092 nmdc:mga07m45_144875_c1
2093 nmdc:mga07m45_176630_c1
2094 nmdc:mga07m45_31114_c1
2095 nmdc:mga05p37_1114_c1
2096 nmdc:mga05p37_79219_c1
2097 nmdc:mga09592_1302_c1
2098 nmdc:mga0qj67_276_c1
2099 nmdc:mga06r32_3728_c1
2100 nmdc:mga08y16_3668_c1
2101 nmdc:mga08y16_7407_c1
2102 nmdc:mga08y16_8959_c1
2103 nmdc:mga0n895_124362_c1
2104 nmdc:mga0n895_217077_c1
2105 nmdc:mga0n895_224722_c1
2106 nmdc:mga0n895_3698_c1
2107 nmdc:mga0n895_651_c1
2108 nmdc:mga0n895_682_c1
2109 nmdc:mga0rr50_2190_c1
2110 nmdc:mga0rr50_286227_c1
2111 nmdc:mga0rr50_453760_c1
2112 nmdc:mga0rr50_919_c1
2113 nmdc:mga08x19_56758_c1
2114 nmdc:mga08x19_87785_c1
2115 nmdc:mga0a205_1012_c1
2116 nmdc:mga0a205_1633_c1
2117 nmdc:mga0a205_190661_c1
2118 nmdc:mga0a205_21841_c1
2119 nmdc:mga0sz30_105616_c1
2120 nmdc:mga0sz30_170913_c1
2121 Ga0495601_0000128
2122 Ga0495601_0011860
2123 Ga0495601_0020775
2124 Ga0495601_0070486
2125 Ga0495601_0071243
2126 Ga0495612_0002217
2127 Ga0495612_0009092
2128 Ga0495595_0000976
2129 Ga0495595_0003217
2130 Ga0495595_0004577
2131 Ga0495595_0011834
2132 Ga0495595_0099156
2133 Ga0495595_0102320
2134 Ga0495595_0215650
2135 Ga0495619_0000016
2136 Ga0495619_0000231
2137 Ga0495619_0000252
2138 Ga0495619_0011260
2139 Ga0495619_0011414
2140 Ga0495619_0016668
2141 Ga0495619_0049308
2142 Ga0495619_0136775
2143 Ga0495619_0383660
2144 Ga0500578_0118419
2145 Ga0500566_0058632
2146 Ga0500569_235355
2147 Ga0500595_034410
2148 Ga0500608_189135
2149 Ga0500616_0202446
2150 Ga0500622_0026738
2151 Ga0500636_0002418
2152 Ga0501084_0089085
2153 Ga0501082_0216941
2154 2643758725
2155 2739308458
2156 2841915518
2157 2841920720
2158 2889918277

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

31

184

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s17-assembly2.cif.gz_B identification of novel potent bicyclic peptide deformylase inhibitors 0.9748 2 166
1lry-assembly1.cif.gz_A crystal structure of p. aeruginosa peptide deformylase complexed with antibiotic actinonin 0.9717 2 166
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.9696 1 151
3k6l-assembly3.cif.gz_C the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9637 3 162
1s17-assembly2.cif.gz_B identification of novel potent bicyclic peptide deformylase inhibitors 0.9632 2 166
ID Description Score Start End Superfamily
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9694 1 151 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9574 1 151 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9564 1 151 3.90.45.10
3uwaA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9444 4 150 3.90.45.10
3u04A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.942 1 165 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A5R2MX39-F1-model_v4 Peptide deformylase-like (Polypeptide deformylase-like) 0.9924 51 151 GO:0042586
GO:0043686
AF-P63913-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9898 1 168 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A175RMI5-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9887 1 169 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-F7QG71-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9878 4 167 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A4R3XLY2-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.987 1 168 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map