F489643
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1079 | 435 | 2158 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300031238|Ga0265332_10212302|Ga0265332_102123021 |
| Length | 214 |
| Sequence | VRERPWLKGNGAPKAWIDRVAPYPYIARMAVRDILIIPDKRLRLKSEPVKAVDKSLRALVDDMFETMYAAPGIGLAAIQIGMAQRVVTMDLAKKDDPPAPQVFINPEVTWKSDEKSTYEEGCLSIPEYYEEVERPASVRVKYLGFDGTPHEIEATGLLATCLQHEIDHTNGILFIDYISKLKRSMVMKKFKKVAKKTEGATPLADDKEPSHHIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 10 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 11 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 12 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 13 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 16 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 17 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 20 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 21 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 72 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 136 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 137 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 138 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 228 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 231 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 232 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 234 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 236 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 237 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 241 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 244 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 245 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 246 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 247 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 248 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 249 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 251 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 257 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 260 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 261 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 264 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 265 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 267 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 274 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 276 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 277 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 278 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 279 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 282 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 283 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 284 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 285 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 286 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 287 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 288 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 289 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 290 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 291 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 292 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 293 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 298 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 361 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 362 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 363 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 364 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 365 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 366 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 369 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 370 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 371 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 372 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 373 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 374 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 375 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 402 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 404 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 405 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 406 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 407 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 417 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 422 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 423 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 424 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 425 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 426 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 427 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 428 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 429 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 432 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 433 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 434 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 435 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0 |
| Isolates | 0.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.22 |
| Nodule | 0.19 |
| Rhizoplane | 7.88 |
| Rhizosphere | 88.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265332_10212302 | 3300031238 | Bacteria | 803 |
| 2 | 2214544925 | 2209111006 | Bacteria | 18798 |
| 3 | ARcpr5oldR_c000010 | 3300000041 | Bacteria | 39074 |
| 4 | ARSoilYngRDRAFT_c00060 | 3300000042 | Bacteria | 17969 |
| 5 | ARcpr5yngRDRAFT_c000016 | 3300000043 | Bacteria | 29226 |
| 6 | ARSoilOldRDRAFT_c000011 | 3300000044 | Bacteria | 42914 |
| 7 | ARCol0oldRDRAFT_c00012 | 3300000045 | Bacteria | 14081 |
| 8 | ARCol0yngRDRAFT_1000018 | 3300000652 | Bacteria | 30924 |
| 9 | JGI24032J14994_100108 | 3300001430 | Bacteria | 3758 |
| 10 | JGI24741J21665_1013514 | 3300001915 | Bacteria | 1384 |
| 11 | JGI24746J21847_1001357 | 3300001977 | Bacteria | 3906 |
| 12 | JGI24747J21853_1000086 | 3300001978 | Bacteria | 4031 |
| 13 | JGI24740J21852_10025886 | 3300001979 | Bacteria | 1971 |
| 14 | JGI24739J22299_10000724 | 3300001989 | Bacteria | 11949 |
| 15 | JGI24737J22298_10001113 | 3300001990 | Bacteria | 9446 |
| 16 | JGI24750J21931_1000096 | 3300002070 | Bacteria | 13445 |
| 17 | JGI24748J21848_1001964 | 3300002074 | Bacteria | 2286 |
| 18 | JGI24738J21930_10000997 | 3300002075 | Bacteria | 8121 |
| 19 | JGI24749J21850_1024770 | 3300002076 | Bacteria | 855 |
| 20 | JGI24744J21845_10000153 | 3300002077 | Bacteria | 10102 |
| 21 | JGI24035J26624_1000660 | 3300002126 | Bacteria | 3188 |
| 22 | JGI24034J26672_10000231 | 3300002239 | Bacteria | 7381 |
| 23 | JGI24742J22300_10000137 | 3300002244 | Bacteria | 10780 |
| 24 | JGI24751J29686_10013941 | 3300002459 | Bacteria | 1659 |
| 25 | JGI25405J52794_10011519 | 3300003911 | Bacteria | 1693 |
| 26 | Ga0065717_1002132 | 3300005276 | Bacteria | 2802 |
| 27 | Ga0065704_10127429 | 3300005289 | Bacteria | 1676 |
| 28 | Ga0065712_10011139 | 3300005290 | Bacteria | 4292 |
| 29 | Ga0065712_10071510 | 3300005290 | Bacteria | 5223 |
| 30 | Ga0065712_10082223 | 3300005290 | Bacteria | 2935 |
| 31 | Ga0065715_10001079 | 3300005293 | Bacteria | 7146 |
| 32 | Ga0065715_10008006 | 3300005293 | Bacteria | 3840 |
| 33 | Ga0065707_10091944 | 3300005295 | Bacteria | 3855 |
| 34 | Ga0070676_10000506 | 3300005328 | Bacteria | 18658 |
| 35 | Ga0070683_100009453 | 3300005329 | Bacteria | 8336 |
| 36 | Ga0070683_100120932 | 3300005329 | Bacteria | 2474 |
| 37 | Ga0070690_100002629 | 3300005330 | Bacteria | 9678 |
| 38 | Ga0070690_100005686 | 3300005330 | Bacteria | 7019 |
| 39 | Ga0070670_100004573 | 3300005331 | Bacteria | 11607 |
| 40 | Ga0070677_10000227 | 3300005333 | Bacteria | 19393 |
| 41 | Ga0070677_10489552 | 3300005333 | Bacteria | 665 |
| 42 | Ga0068869_100001832 | 3300005334 | Bacteria | 12767 |
| 43 | Ga0068869_100347149 | 3300005334 | Bacteria | 1209 |
| 44 | Ga0070666_10025905 | 3300005335 | Bacteria | 3826 |
| 45 | Ga0070666_10027715 | 3300005335 | Bacteria | 3713 |
| 46 | Ga0070666_10161884 | 3300005335 | Bacteria | 1564 |
| 47 | Ga0070666_10273376 | 3300005335 | Bacteria | 1200 |
| 48 | Ga0070680_100003424 | 3300005336 | Bacteria | 11842 |
| 49 | Ga0070680_100025759 | 3300005336 | Bacteria | 4702 |
| 50 | Ga0070682_100001699 | 3300005337 | Bacteria | 12232 |
| 51 | Ga0070682_100032433 | 3300005337 | Bacteria | 3168 |
| 52 | Ga0070682_100207755 | 3300005337 | Bacteria | 1386 |
| 53 | Ga0070682_100529188 | 3300005337 | Bacteria | 918 |
| 54 | Ga0068868_100007757 | 3300005338 | Bacteria | 7659 |
| 55 | Ga0070660_100008125 | 3300005339 | Bacteria | 7333 |
| 56 | Ga0070660_100145897 | 3300005339 | Bacteria | 1901 |
| 57 | Ga0070660_100169729 | 3300005339 | Bacteria | 1761 |
| 58 | Ga0070689_100000668 | 3300005340 | Bacteria | 20748 |
| 59 | Ga0070689_100001841 | 3300005340 | Bacteria | 13666 |
| 60 | Ga0070689_100297102 | 3300005340 | Bacteria | 1344 |
| 61 | Ga0070689_100344038 | 3300005340 | Bacteria | 1249 |
| 62 | Ga0070691_10014066 | 3300005341 | Bacteria | 3670 |
| 63 | Ga0070691_10161599 | 3300005341 | Bacteria | 1155 |
| 64 | Ga0070691_10293750 | 3300005341 | Bacteria | 885 |
| 65 | Ga0070687_100000527 | 3300005343 | Bacteria | 12848 |
| 66 | Ga0070661_100003238 | 3300005344 | Bacteria | 11222 |
| 67 | Ga0070661_100344664 | 3300005344 | Bacteria | 1168 |
| 68 | Ga0070661_100373633 | 3300005344 | Bacteria | 1122 |
| 69 | Ga0070692_10001083 | 3300005345 | Bacteria | 9454 |
| 70 | Ga0070668_100003117 | 3300005347 | Bacteria | 12247 |
| 71 | Ga0070668_100130887 | 3300005347 | Bacteria | 2014 |
| 72 | Ga0070669_100001315 | 3300005353 | Bacteria | 17944 |
| 73 | Ga0070675_100002954 | 3300005354 | Bacteria | 12826 |
| 74 | Ga0070675_100015172 | 3300005354 | Bacteria | 6084 |
| 75 | Ga0070675_100369657 | 3300005354 | Bacteria | 1275 |
| 76 | Ga0070675_100720913 | 3300005354 | Bacteria | 909 |
| 77 | Ga0070671_100033121 | 3300005355 | Bacteria | 4272 |
| 78 | Ga0070671_100035414 | 3300005355 | Bacteria | 4136 |
| 79 | Ga0070674_100002968 | 3300005356 | Bacteria | 9419 |
| 80 | Ga0070674_100720369 | 3300005356 | Bacteria | 854 |
| 81 | Ga0070673_100001477 | 3300005364 | Bacteria | 13763 |
| 82 | Ga0070673_100101479 | 3300005364 | Bacteria | 2370 |
| 83 | Ga0070688_100001239 | 3300005365 | Bacteria | 12735 |
| 84 | Ga0070688_100006198 | 3300005365 | Bacteria | 6369 |
| 85 | Ga0070688_100033995 | 3300005365 | Bacteria | 3084 |
| 86 | Ga0070688_100162605 | 3300005365 | Bacteria | 1535 |
| 87 | Ga0070659_100002622 | 3300005366 | Bacteria | 12786 |
| 88 | Ga0070659_100015463 | 3300005366 | Bacteria | 5717 |
| 89 | Ga0070659_100172634 | 3300005366 | Bacteria | 1772 |
| 90 | Ga0070667_100005188 | 3300005367 | Bacteria | 10886 |
| 91 | Ga0070667_100089585 | 3300005367 | Bacteria | 2643 |
| 92 | Ga0070703_10006319 | 3300005406 | Bacteria | 3319 |
| 93 | Ga0070703_10010223 | 3300005406 | Bacteria | 2645 |
| 94 | Ga0070709_10108172 | 3300005434 | Bacteria | 1864 |
| 95 | Ga0070709_10109350 | 3300005434 | Bacteria | 1855 |
| 96 | Ga0070709_10532718 | 3300005434 | Bacteria | 896 |
| 97 | Ga0070714_100074400 | 3300005435 | Bacteria | 2945 |
| 98 | Ga0070714_100132937 | 3300005435 | Bacteria | 2225 |
| 99 | Ga0070714_100330733 | 3300005435 | Bacteria | 1427 |
| 100 | Ga0070713_100248163 | 3300005436 | Bacteria | 1623 |
| 101 | Ga0070713_100268476 | 3300005436 | Bacteria | 1561 |
| 102 | Ga0070710_10018331 | 3300005437 | Bacteria | 3600 |
| 103 | Ga0070710_10059094 | 3300005437 | Bacteria | 2176 |
| 104 | Ga0070710_10091163 | 3300005437 | Bacteria | 1798 |
| 105 | Ga0070701_10002283 | 3300005438 | Bacteria | 7348 |
| 106 | Ga0070701_10008389 | 3300005438 | Bacteria | 4467 |
| 107 | Ga0070711_100130116 | 3300005439 | Bacteria | 1873 |
| 108 | Ga0070711_100206562 | 3300005439 | Bacteria | 1518 |
| 109 | Ga0070705_100001458 | 3300005440 | Bacteria | 12507 |
| 110 | Ga0070705_100018737 | 3300005440 | Bacteria | 3632 |
| 111 | Ga0070705_100020503 | 3300005440 | Bacteria | 3501 |
| 112 | Ga0070700_100001211 | 3300005441 | Bacteria | 12787 |
| 113 | Ga0070700_100019152 | 3300005441 | Bacteria | 3946 |
| 114 | Ga0070694_100001764 | 3300005444 | Bacteria | 12786 |
| 115 | Ga0070694_100070014 | 3300005444 | Bacteria | 2414 |
| 116 | Ga0070708_100023985 | 3300005445 | Bacteria | 5194 |
| 117 | Ga0070708_100124631 | 3300005445 | Bacteria | 2380 |
| 118 | Ga0070663_100000761 | 3300005455 | Bacteria | 17492 |
| 119 | Ga0070663_100038492 | 3300005455 | Bacteria | 3336 |
| 120 | Ga0070663_100107071 | 3300005455 | Bacteria | 2095 |
| 121 | Ga0070663_100230715 | 3300005455 | Bacteria | 1457 |
| 122 | Ga0070663_100620418 | 3300005455 | Bacteria | 911 |
| 123 | Ga0070678_100000525 | 3300005456 | Bacteria | 18583 |
| 124 | Ga0070678_100125575 | 3300005456 | Bacteria | 2030 |
| 125 | Ga0070678_100375734 | 3300005456 | Bacteria | 1228 |
| 126 | Ga0070662_100002968 | 3300005457 | Bacteria | 10539 |
| 127 | Ga0070662_100050510 | 3300005457 | Bacteria | 3000 |
| 128 | Ga0070662_100072657 | 3300005457 | Bacteria | 2540 |
| 129 | Ga0070681_10004977 | 3300005458 | Bacteria | 12786 |
| 130 | Ga0070681_10220689 | 3300005458 | Bacteria | 1811 |
| 131 | Ga0070681_10221180 | 3300005458 | Bacteria | 1808 |
| 132 | Ga0070681_10410226 | 3300005458 | Bacteria | 1266 |
| 133 | Ga0070681_10805059 | 3300005458 | Bacteria | 857 |
| 134 | Ga0070681_10905305 | 3300005458 | Bacteria | 801 |
| 135 | Ga0068867_100002950 | 3300005459 | Bacteria | 11984 |
| 136 | Ga0068867_100092156 | 3300005459 | Bacteria | 2301 |
| 137 | Ga0070685_10004716 | 3300005466 | Bacteria | 6899 |
| 138 | Ga0070685_10025023 | 3300005466 | Bacteria | 3285 |
| 139 | Ga0070685_10027875 | 3300005466 | Bacteria | 3125 |
| 140 | Ga0070707_100517710 | 3300005468 | Bacteria | 1155 |
| 141 | Ga0070698_100584318 | 3300005471 | Bacteria | 1057 |
| 142 | Ga0070679_100015045 | 3300005530 | Bacteria | 7434 |
| 143 | Ga0070679_100315891 | 3300005530 | Bacteria | 1512 |
| 144 | Ga0070684_100005941 | 3300005535 | Bacteria | 9401 |
| 145 | Ga0070684_100019299 | 3300005535 | Bacteria | 5637 |
| 146 | Ga0070684_100034783 | 3300005535 | Bacteria | 4309 |
| 147 | Ga0070697_100467633 | 3300005536 | Bacteria | 1100 |
| 148 | Ga0068853_100003070 | 3300005539 | Bacteria | 12759 |
| 149 | Ga0068853_100050832 | 3300005539 | Bacteria | 3566 |
| 150 | Ga0068853_100594036 | 3300005539 | Bacteria | 1051 |
| 151 | Ga0070672_100002960 | 3300005543 | Bacteria | 10932 |
| 152 | Ga0070672_100339281 | 3300005543 | Bacteria | 1279 |
| 153 | Ga0070686_100001573 | 3300005544 | Bacteria | 12811 |
| 154 | Ga0070686_100008797 | 3300005544 | Bacteria | 5658 |
| 155 | Ga0070686_100065168 | 3300005544 | Bacteria | 2365 |
| 156 | Ga0070686_100222585 | 3300005544 | Bacteria | 1364 |
| 157 | Ga0070695_100002369 | 3300005545 | Bacteria | 10826 |
| 158 | Ga0070695_100014478 | 3300005545 | Bacteria | 4755 |
| 159 | Ga0070696_100016306 | 3300005546 | Bacteria | 5000 |
| 160 | Ga0070696_100021005 | 3300005546 | Bacteria | 4425 |
| 161 | Ga0070696_100029021 | 3300005546 | Bacteria | 3777 |
| 162 | Ga0070693_100000880 | 3300005547 | Bacteria | 13363 |
| 163 | Ga0070704_100001917 | 3300005549 | Bacteria | 11493 |
| 164 | Ga0070704_100031811 | 3300005549 | Bacteria | 3552 |
| 165 | Ga0068855_100009051 | 3300005563 | Bacteria | 12031 |
| 166 | Ga0070664_100002934 | 3300005564 | Bacteria | 13792 |
| 167 | Ga0070664_100020499 | 3300005564 | Bacteria | 5444 |
| 168 | Ga0070664_100660809 | 3300005564 | Bacteria | 972 |
| 169 | Ga0068857_100000358 | 3300005577 | Bacteria | 31869 |
| 170 | Ga0068857_100086207 | 3300005577 | Bacteria | 2807 |
| 171 | Ga0068854_100007075 | 3300005578 | Bacteria | 7161 |
| 172 | Ga0068856_100045885 | 3300005614 | Bacteria | 4303 |
| 173 | Ga0068856_100161948 | 3300005614 | Bacteria | 2248 |
| 174 | Ga0070702_100000526 | 3300005615 | Bacteria | 13792 |
| 175 | Ga0070702_100308500 | 3300005615 | Bacteria | 1098 |
| 176 | Ga0068852_100009893 | 3300005616 | Bacteria | 7097 |
| 177 | Ga0068859_100005591 | 3300005617 | Bacteria | 12805 |
| 178 | Ga0068859_100038332 | 3300005617 | Bacteria | 4809 |
| 179 | Ga0068859_100065369 | 3300005617 | Bacteria | 3671 |
| 180 | Ga0068859_101334038 | 3300005617 | Bacteria | 791 |
| 181 | Ga0068864_100001988 | 3300005618 | Bacteria | 16835 |
| 182 | Ga0068864_100783779 | 3300005618 | Bacteria | 936 |
| 183 | Ga0068866_10000916 | 3300005718 | Bacteria | 12945 |
| 184 | Ga0068866_10161547 | 3300005718 | Bacteria | 1307 |
| 185 | Ga0068866_10197133 | 3300005718 | Bacteria | 1201 |
| 186 | Ga0068861_100001805 | 3300005719 | Bacteria | 13785 |
| 187 | Ga0068861_100011624 | 3300005719 | Bacteria | 6125 |
| 188 | Ga0068861_101009703 | 3300005719 | Bacteria | 795 |
| 189 | Ga0068870_10000025 | 3300005840 | Bacteria | 46848 |
| 190 | Ga0068870_10135764 | 3300005840 | Bacteria | 1434 |
| 191 | Ga0068863_100002964 | 3300005841 | Bacteria | 16783 |
| 192 | Ga0068863_100185951 | 3300005841 | Bacteria | 1995 |
| 193 | Ga0068863_100460690 | 3300005841 | Bacteria | 1248 |
| 194 | Ga0068858_100003227 | 3300005842 | Bacteria | 16273 |
| 195 | Ga0068858_100099681 | 3300005842 | Bacteria | 2709 |
| 196 | Ga0068858_100343073 | 3300005842 | Bacteria | 1430 |
| 197 | Ga0068860_100007120 | 3300005843 | Bacteria | 11192 |
| 198 | Ga0068860_100060928 | 3300005843 | Bacteria | 3586 |
| 199 | Ga0068860_100180869 | 3300005843 | Bacteria | 2038 |
| 200 | Ga0068862_100011988 | 3300005844 | Bacteria | 7161 |
| 201 | Ga0068862_100032289 | 3300005844 | Bacteria | 4423 |
| 202 | Ga0081455_10002463 | 3300005937 | Bacteria | 22024 |
| 203 | Ga0081455_10012779 | 3300005937 | Bacteria | 8347 |
| 204 | Ga0081455_10020122 | 3300005937 | Bacteria | 6297 |
| 205 | Ga0081455_10188085 | 3300005937 | Bacteria | 1558 |
| 206 | Ga0070717_10074409 | 3300006028 | Bacteria | 2839 |
| 207 | Ga0070717_10236183 | 3300006028 | Bacteria | 1611 |
| 208 | Ga0070717_11465233 | 3300006028 | Bacteria | 619 |
| 209 | Ga0075432_10004844 | 3300006058 | Bacteria | 4581 |
| 210 | Ga0075432_10011268 | 3300006058 | Bacteria | 3039 |
| 211 | Ga0070715_10030799 | 3300006163 | Bacteria | 2172 |
| 212 | Ga0070716_100127591 | 3300006173 | Bacteria | 1603 |
| 213 | Ga0070716_100255281 | 3300006173 | Bacteria | 1197 |
| 214 | Ga0070712_100022909 | 3300006175 | Bacteria | 4119 |
| 215 | Ga0070712_100082682 | 3300006175 | Bacteria | 2329 |
| 216 | Ga0070712_100396740 | 3300006175 | Bacteria | 1139 |
| 217 | Ga0075367_10081426 | 3300006178 | Bacteria | 1959 |
| 218 | Ga0075427_10000109 | 3300006194 | Bacteria | 7088 |
| 219 | Ga0097621_100000456 | 3300006237 | Bacteria | 28666 |
| 220 | Ga0097621_100010034 | 3300006237 | Bacteria | 6905 |
| 221 | Ga0097621_100150100 | 3300006237 | Bacteria | 1998 |
| 222 | Ga0068871_100000269 | 3300006358 | Bacteria | 35773 |
| 223 | Ga0068871_100290885 | 3300006358 | Bacteria | 1431 |
| 224 | Ga0068871_100883976 | 3300006358 | Bacteria | 827 |
| 225 | Ga0075430_100000094 | 3300006846 | Bacteria | 52204 |
| 226 | Ga0075431_100002169 | 3300006847 | Bacteria | 18764 |
| 227 | Ga0075433_10001242 | 3300006852 | Bacteria | 18605 |
| 228 | Ga0075433_10021666 | 3300006852 | Bacteria | 5391 |
| 229 | Ga0075433_10037552 | 3300006852 | Bacteria | 4180 |
| 230 | Ga0075433_10324029 | 3300006852 | Bacteria | 1363 |
| 231 | Ga0075434_100000299 | 3300006871 | Bacteria | 35320 |
| 232 | Ga0075434_100011399 | 3300006871 | Bacteria | 8385 |
| 233 | Ga0075434_100022390 | 3300006871 | Bacteria | 6154 |
| 234 | Ga0075434_100211482 | 3300006871 | Bacteria | 1959 |
| 235 | Ga0075434_100351544 | 3300006871 | Bacteria | 1495 |
| 236 | Ga0075429_100002930 | 3300006880 | Bacteria | 14473 |
| 237 | Ga0068865_100001731 | 3300006881 | Bacteria | 12818 |
| 238 | Ga0068865_100054063 | 3300006881 | Bacteria | 2788 |
| 239 | Ga0068865_100055301 | 3300006881 | Bacteria | 2761 |
| 240 | Ga0075436_100390243 | 3300006914 | Bacteria | 1007 |
| 241 | Ga0097620_100005590 | 3300006931 | Bacteria | 12805 |
| 242 | Ga0097620_100038332 | 3300006931 | Bacteria | 4809 |
| 243 | Ga0097620_100065370 | 3300006931 | Bacteria | 3671 |
| 244 | Ga0097620_101333829 | 3300006931 | Bacteria | 791 |
| 245 | Ga0075435_100023116 | 3300007076 | Bacteria | 4802 |
| 246 | Ga0075435_100047923 | 3300007076 | Bacteria | 3431 |
| 247 | Ga0075435_100276152 | 3300007076 | Bacteria | 1434 |
| 248 | Ga0075435_100289239 | 3300007076 | Bacteria | 1400 |
| 249 | Ga0075435_100593923 | 3300007076 | Bacteria | 960 |
| 250 | Ga0105244_10023092 | 3300009036 | Bacteria | 3417 |
| 251 | Ga0105240_10024320 | 3300009093 | Bacteria | 7989 |
| 252 | Ga0105240_10582449 | 3300009093 | Bacteria | 1234 |
| 253 | Ga0105240_11282096 | 3300009093 | Bacteria | 773 |
| 254 | Ga0111539_10003217 | 3300009094 | Bacteria | 21607 |
| 255 | Ga0111539_10003331 | 3300009094 | Bacteria | 21223 |
| 256 | Ga0111539_10007321 | 3300009094 | Bacteria | 14133 |
| 257 | Ga0111539_10076769 | 3300009094 | Bacteria | 3933 |
| 258 | Ga0105245_10000183 | 3300009098 | Bacteria | 59105 |
| 259 | Ga0105245_10088559 | 3300009098 | Bacteria | 2844 |
| 260 | Ga0105245_10882646 | 3300009098 | Bacteria | 935 |
| 261 | Ga0105247_10210490 | 3300009101 | Bacteria | 1311 |
| 262 | Ga0105247_10225672 | 3300009101 | Bacteria | 1270 |
| 263 | Ga0114129_10001218 | 3300009147 | Bacteria | 34180 |
| 264 | Ga0114129_10002246 | 3300009147 | Bacteria | 26676 |
| 265 | Ga0114129_10866549 | 3300009147 | Bacteria | 1147 |
| 266 | Ga0105243_10001561 | 3300009148 | Bacteria | 20018 |
| 267 | Ga0105243_10100210 | 3300009148 | Bacteria | 2403 |
| 268 | Ga0105243_10171621 | 3300009148 | Bacteria | 1879 |
| 269 | Ga0105241_10003567 | 3300009174 | Bacteria | 11569 |
| 270 | Ga0105241_10063456 | 3300009174 | Bacteria | 2850 |
| 271 | Ga0105241_10203232 | 3300009174 | Bacteria | 1656 |
| 272 | Ga0105241_10338921 | 3300009174 | Bacteria | 1302 |
| 273 | Ga0105242_10000701 | 3300009176 | Bacteria | 26184 |
| 274 | Ga0105242_10006507 | 3300009176 | Bacteria | 8997 |
| 275 | Ga0105242_10033043 | 3300009176 | Bacteria | 4140 |
| 276 | Ga0105248_10006263 | 3300009177 | Bacteria | 13046 |
| 277 | Ga0105248_10010394 | 3300009177 | Bacteria | 10250 |
| 278 | Ga0105248_10040556 | 3300009177 | Bacteria | 5219 |
| 279 | Ga0105248_10153094 | 3300009177 | Bacteria | 2602 |
| 280 | Ga0105248_10424133 | 3300009177 | Bacteria | 1498 |
| 281 | Ga0105248_10719629 | 3300009177 | Bacteria | 1126 |
| 282 | Ga0105237_10010897 | 3300009545 | Bacteria | 9647 |
| 283 | Ga0105237_10125419 | 3300009545 | Bacteria | 2562 |
| 284 | Ga0105237_10150914 | 3300009545 | Bacteria | 2320 |
| 285 | Ga0105237_10650127 | 3300009545 | Bacteria | 1061 |
| 286 | Ga0105237_10822676 | 3300009545 | Bacteria | 936 |
| 287 | Ga0105238_11051622 | 3300009551 | Bacteria | 836 |
| 288 | Ga0105249_10009795 | 3300009553 | Bacteria | 8397 |
| 289 | Ga0105249_10124718 | 3300009553 | Bacteria | 2451 |
| 290 | Ga0105249_10190361 | 3300009553 | Bacteria | 2002 |
| 291 | Ga0105239_10007315 | 3300010375 | Bacteria | 12675 |
| 292 | Ga0105239_10054653 | 3300010375 | Bacteria | 4380 |
| 293 | Ga0105239_10169366 | 3300010375 | Bacteria | 2442 |
| 294 | Ga0105246_10002447 | 3300011119 | Bacteria | 11209 |
| 295 | Ga0105246_10049961 | 3300011119 | Bacteria | 2867 |
| 296 | Ga0105246_10528029 | 3300011119 | Bacteria | 1007 |
| 297 | Ga0105246_10555642 | 3300011119 | Bacteria | 985 |
| 298 | Ga0157321_1002428 | 3300012487 | Bacteria | 1039 |
| 299 | Ga0157335_1000784 | 3300012492 | Bacteria | 1567 |
| 300 | Ga0157342_1002072 | 3300012507 | Bacteria | 1581 |
| 301 | Ga0157373_10017762 | 3300013100 | Bacteria | 5179 |
| 302 | Ga0157373_10237996 | 3300013100 | Bacteria | 1287 |
| 303 | Ga0157371_10018807 | 3300013102 | Bacteria | 5103 |
| 304 | Ga0157370_10175628 | 3300013104 | Bacteria | 1991 |
| 305 | Ga0157370_10292424 | 3300013104 | Bacteria | 1505 |
| 306 | Ga0157370_10739344 | 3300013104 | Bacteria | 897 |
| 307 | Ga0157369_10449243 | 3300013105 | Bacteria | 1335 |
| 308 | Ga0157374_10000463 | 3300013296 | Bacteria | 36848 |
| 309 | Ga0157374_10145086 | 3300013296 | Bacteria | 2305 |
| 310 | Ga0157378_10000613 | 3300013297 | Bacteria | 33512 |
| 311 | Ga0157378_10139508 | 3300013297 | Bacteria | 2250 |
| 312 | Ga0157378_10407146 | 3300013297 | Bacteria | 1342 |
| 313 | Ga0163162_10005908 | 3300013306 | Bacteria | 11842 |
| 314 | Ga0163162_10020966 | 3300013306 | Bacteria | 6429 |
| 315 | Ga0163162_10210444 | 3300013306 | Bacteria | 2074 |
| 316 | Ga0163162_10492272 | 3300013306 | Bacteria | 1357 |
| 317 | Ga0163162_11082860 | 3300013306 | Bacteria | 908 |
| 318 | Ga0163162_11834567 | 3300013306 | Bacteria | 693 |
| 319 | Ga0157372_10010921 | 3300013307 | Bacteria | 9665 |
| 320 | Ga0157372_10219504 | 3300013307 | Bacteria | 2204 |
| 321 | Ga0157372_10843730 | 3300013307 | Bacteria | 1064 |
| 322 | Ga0157375_10004786 | 3300013308 | Bacteria | 11768 |
| 323 | Ga0157375_10250000 | 3300013308 | Bacteria | 1934 |
| 324 | Ga0157375_10791497 | 3300013308 | Bacteria | 1097 |
| 325 | Ga0157375_11065711 | 3300013308 | Bacteria | 945 |
| 326 | Ga0163163_10001239 | 3300014325 | Bacteria | 21547 |
| 327 | Ga0163163_10035378 | 3300014325 | Bacteria | 4844 |
| 328 | Ga0163163_10548246 | 3300014325 | Bacteria | 1219 |
| 329 | Ga0157380_10004641 | 3300014326 | Bacteria | 9554 |
| 330 | Ga0182008_10065920 | 3300014497 | Bacteria | 1781 |
| 331 | Ga0157377_10000358 | 3300014745 | Bacteria | 20360 |
| 332 | Ga0157377_10160273 | 3300014745 | Bacteria | 1398 |
| 333 | Ga0157377_10731243 | 3300014745 | Bacteria | 722 |
| 334 | Ga0157379_10003902 | 3300014968 | Bacteria | 12714 |
| 335 | Ga0157379_10073473 | 3300014968 | Bacteria | 3061 |
| 336 | Ga0157379_10111692 | 3300014968 | Bacteria | 2455 |
| 337 | Ga0157376_10003730 | 3300014969 | Bacteria | 10526 |
| 338 | Ga0157376_10117525 | 3300014969 | Bacteria | 2351 |
| 339 | Ga0157376_10309774 | 3300014969 | Bacteria | 1498 |
| 340 | Ga0157376_10628833 | 3300014969 | Bacteria | 1071 |
| 341 | Ga0163161_10001492 | 3300017792 | Bacteria | 17279 |
| 342 | Ga0207666_1000140 | 3300025271 | Bacteria | 11329 |
| 343 | Ga0207666_1000838 | 3300025271 | Bacteria | 3692 |
| 344 | Ga0207673_1000039 | 3300025290 | Bacteria | 10384 |
| 345 | Ga0207697_10000763 | 3300025315 | Bacteria | 18220 |
| 346 | Ga0207697_10015702 | 3300025315 | Bacteria | 3126 |
| 347 | Ga0207653_10001778 | 3300025885 | Bacteria | 6892 |
| 348 | Ga0207653_10004542 | 3300025885 | Bacteria | 4350 |
| 349 | Ga0207682_10000062 | 3300025893 | Bacteria | 46841 |
| 350 | Ga0207692_10009135 | 3300025898 | Bacteria | 4129 |
| 351 | Ga0207692_10027325 | 3300025898 | Bacteria | 2687 |
| 352 | Ga0207692_10063538 | 3300025898 | Bacteria | 1919 |
| 353 | Ga0207642_10002089 | 3300025899 | Bacteria | 6175 |
| 354 | Ga0207642_10037083 | 3300025899 | Bacteria | 2098 |
| 355 | Ga0207642_10291787 | 3300025899 | Bacteria | 942 |
| 356 | Ga0207710_10010626 | 3300025900 | Bacteria | 3877 |
| 357 | Ga0207710_10016965 | 3300025900 | Bacteria | 3085 |
| 358 | Ga0207688_10001992 | 3300025901 | Bacteria | 10954 |
| 359 | Ga0207688_10023221 | 3300025901 | Bacteria | 3395 |
| 360 | Ga0207680_10000740 | 3300025903 | Bacteria | 15389 |
| 361 | Ga0207680_10028054 | 3300025903 | Bacteria | 3144 |
| 362 | Ga0207680_10057899 | 3300025903 | Bacteria | 2347 |
| 363 | Ga0207647_10003504 | 3300025904 | Bacteria | 11767 |
| 364 | Ga0207647_10008790 | 3300025904 | Bacteria | 7210 |
| 365 | Ga0207699_10052537 | 3300025906 | Bacteria | 2412 |
| 366 | Ga0207699_10074353 | 3300025906 | Bacteria | 2087 |
| 367 | Ga0207699_10076009 | 3300025906 | Bacteria | 2067 |
| 368 | Ga0207645_10000248 | 3300025907 | Bacteria | 44949 |
| 369 | Ga0207643_10000064 | 3300025908 | Bacteria | 70490 |
| 370 | Ga0207643_10200940 | 3300025908 | Bacteria | 1214 |
| 371 | Ga0207654_10001623 | 3300025911 | Bacteria | 11742 |
| 372 | Ga0207654_10055710 | 3300025911 | Bacteria | 2290 |
| 373 | Ga0207654_10109549 | 3300025911 | Bacteria | 1716 |
| 374 | Ga0207707_10002084 | 3300025912 | Bacteria | 18100 |
| 375 | Ga0207707_10276060 | 3300025912 | Bacteria | 1456 |
| 376 | Ga0207695_10387313 | 3300025913 | Bacteria | 1283 |
| 377 | Ga0207695_10424328 | 3300025913 | Bacteria | 1214 |
| 378 | Ga0207671_10007347 | 3300025914 | Bacteria | 9567 |
| 379 | Ga0207671_10016982 | 3300025914 | Bacteria | 5633 |
| 380 | Ga0207693_10015019 | 3300025915 | Bacteria | 6216 |
| 381 | Ga0207693_10016146 | 3300025915 | Bacteria | 5972 |
| 382 | Ga0207693_10031012 | 3300025915 | Bacteria | 4223 |
| 383 | Ga0207693_10050174 | 3300025915 | Bacteria | 3277 |
| 384 | Ga0207663_10033406 | 3300025916 | Bacteria | 3064 |
| 385 | Ga0207660_10000194 | 3300025917 | Bacteria | 38742 |
| 386 | Ga0207660_10020931 | 3300025917 | Bacteria | 4394 |
| 387 | Ga0207660_10387402 | 3300025917 | Bacteria | 1124 |
| 388 | Ga0207662_10001637 | 3300025918 | Bacteria | 10959 |
| 389 | Ga0207662_10012055 | 3300025918 | Bacteria | 4809 |
| 390 | Ga0207657_10006919 | 3300025919 | Bacteria | 11695 |
| 391 | Ga0207657_10103323 | 3300025919 | Bacteria | 2362 |
| 392 | Ga0207657_10126273 | 3300025919 | Bacteria | 2101 |
| 393 | Ga0207657_10146132 | 3300025919 | Bacteria | 1928 |
| 394 | Ga0207649_10000234 | 3300025920 | Bacteria | 45397 |
| 395 | Ga0207649_10195825 | 3300025920 | Bacteria | 1424 |
| 396 | Ga0207649_10259803 | 3300025920 | Bacteria | 1254 |
| 397 | Ga0207652_10001613 | 3300025921 | Bacteria | 19823 |
| 398 | Ga0207652_10002210 | 3300025921 | Bacteria | 16600 |
| 399 | Ga0207652_10033371 | 3300025921 | Bacteria | 4334 |
| 400 | Ga0207652_10108802 | 3300025921 | Bacteria | 2456 |
| 401 | Ga0207652_10248611 | 3300025921 | Bacteria | 1604 |
| 402 | Ga0207646_10161302 | 3300025922 | Bacteria | 2023 |
| 403 | Ga0207681_10000794 | 3300025923 | Bacteria | 20828 |
| 404 | Ga0207650_10010580 | 3300025925 | Bacteria | 6336 |
| 405 | Ga0207650_10174661 | 3300025925 | Bacteria | 1709 |
| 406 | Ga0207659_10000172 | 3300025926 | Bacteria | 38725 |
| 407 | Ga0207659_10130264 | 3300025926 | Bacteria | 1940 |
| 408 | Ga0207659_10611563 | 3300025926 | Bacteria | 930 |
| 409 | Ga0207687_10008699 | 3300025927 | Bacteria | 6631 |
| 410 | Ga0207687_10018894 | 3300025927 | Bacteria | 4558 |
| 411 | Ga0207687_10158696 | 3300025927 | Bacteria | 1733 |
| 412 | Ga0207700_10339698 | 3300025928 | Bacteria | 1305 |
| 413 | Ga0207700_10459064 | 3300025928 | Bacteria | 1123 |
| 414 | Ga0207700_11199531 | 3300025928 | Bacteria | 677 |
| 415 | Ga0207664_10011995 | 3300025929 | Bacteria | 6186 |
| 416 | Ga0207664_10259341 | 3300025929 | Bacteria | 1520 |
| 417 | Ga0207664_10260833 | 3300025929 | Bacteria | 1515 |
| 418 | Ga0207644_10000439 | 3300025931 | Bacteria | 26923 |
| 419 | Ga0207644_10041647 | 3300025931 | Bacteria | 3250 |
| 420 | Ga0207644_10050000 | 3300025931 | Bacteria | 2995 |
| 421 | Ga0207690_10000796 | 3300025932 | Bacteria | 20342 |
| 422 | Ga0207690_10013199 | 3300025932 | Bacteria | 4958 |
| 423 | Ga0207690_10260751 | 3300025932 | Bacteria | 1343 |
| 424 | Ga0207706_10005059 | 3300025933 | Bacteria | 12314 |
| 425 | Ga0207706_10031628 | 3300025933 | Bacteria | 4713 |
| 426 | Ga0207706_10032340 | 3300025933 | Bacteria | 4660 |
| 427 | Ga0207706_10230288 | 3300025933 | Bacteria | 1621 |
| 428 | Ga0207686_10001093 | 3300025934 | Bacteria | 15891 |
| 429 | Ga0207686_10028444 | 3300025934 | Bacteria | 3286 |
| 430 | Ga0207686_10058609 | 3300025934 | Bacteria | 2428 |
| 431 | Ga0207686_10227163 | 3300025934 | Bacteria | 1351 |
| 432 | Ga0207709_10001438 | 3300025935 | Bacteria | 16619 |
| 433 | Ga0207709_10012223 | 3300025935 | Bacteria | 4730 |
| 434 | Ga0207709_10038752 | 3300025935 | Bacteria | 2842 |
| 435 | Ga0207670_10000608 | 3300025936 | Bacteria | 19358 |
| 436 | Ga0207670_10000807 | 3300025936 | Bacteria | 16336 |
| 437 | Ga0207670_10104914 | 3300025936 | Bacteria | 2025 |
| 438 | Ga0207670_10412987 | 3300025936 | Bacteria | 1081 |
| 439 | Ga0207669_10000141 | 3300025937 | Bacteria | 34618 |
| 440 | Ga0207669_10211782 | 3300025937 | Bacteria | 1415 |
| 441 | Ga0207704_10000755 | 3300025938 | Bacteria | 14264 |
| 442 | Ga0207704_10019206 | 3300025938 | Bacteria | 3585 |
| 443 | Ga0207704_10022632 | 3300025938 | Bacteria | 3372 |
| 444 | Ga0207704_10286088 | 3300025938 | Bacteria | 1255 |
| 445 | Ga0207665_10003066 | 3300025939 | Bacteria | 11213 |
| 446 | Ga0207665_10034796 | 3300025939 | Bacteria | 3342 |
| 447 | Ga0207665_10372956 | 3300025939 | Bacteria | 1081 |
| 448 | Ga0207665_10495413 | 3300025939 | Bacteria | 943 |
| 449 | Ga0207691_10006997 | 3300025940 | Bacteria | 10884 |
| 450 | Ga0207691_10221408 | 3300025940 | Bacteria | 1641 |
| 451 | Ga0207691_10371733 | 3300025940 | Bacteria | 1221 |
| 452 | Ga0207711_10003636 | 3300025941 | Bacteria | 13333 |
| 453 | Ga0207711_10004836 | 3300025941 | Bacteria | 11448 |
| 454 | Ga0207711_10006747 | 3300025941 | Bacteria | 9652 |
| 455 | Ga0207711_10089790 | 3300025941 | Bacteria | 2700 |
| 456 | Ga0207711_10241018 | 3300025941 | Bacteria | 1658 |
| 457 | Ga0207689_10004430 | 3300025942 | Bacteria | 12738 |
| 458 | Ga0207689_10122069 | 3300025942 | Bacteria | 2142 |
| 459 | Ga0207689_10239138 | 3300025942 | Bacteria | 1501 |
| 460 | Ga0207689_11094343 | 3300025942 | Bacteria | 672 |
| 461 | Ga0207661_10000098 | 3300025944 | Bacteria | 55518 |
| 462 | Ga0207661_10096962 | 3300025944 | Bacteria | 2468 |
| 463 | Ga0207679_10000174 | 3300025945 | Bacteria | 53051 |
| 464 | Ga0207679_10021341 | 3300025945 | Bacteria | 4390 |
| 465 | Ga0207679_10620957 | 3300025945 | Bacteria | 976 |
| 466 | Ga0207679_10925973 | 3300025945 | Bacteria | 798 |
| 467 | Ga0207679_11052426 | 3300025945 | Bacteria | 746 |
| 468 | Ga0207667_10004743 | 3300025949 | Bacteria | 16630 |
| 469 | Ga0207651_10000782 | 3300025960 | Bacteria | 13684 |
| 470 | Ga0207651_10002999 | 3300025960 | Bacteria | 8177 |
| 471 | Ga0207651_10233029 | 3300025960 | Bacteria | 1496 |
| 472 | Ga0207712_10000659 | 3300025961 | Bacteria | 26800 |
| 473 | Ga0207712_10039876 | 3300025961 | Bacteria | 3220 |
| 474 | Ga0207712_10332225 | 3300025961 | Bacteria | 1258 |
| 475 | Ga0207668_10001107 | 3300025972 | Bacteria | 16030 |
| 476 | Ga0207668_10012828 | 3300025972 | Bacteria | 5142 |
| 477 | Ga0207640_10000846 | 3300025981 | Bacteria | 17376 |
| 478 | Ga0207658_10001843 | 3300025986 | Bacteria | 15875 |
| 479 | Ga0207658_10123524 | 3300025986 | Bacteria | 2068 |
| 480 | Ga0207658_10154750 | 3300025986 | Bacteria | 1872 |
| 481 | Ga0207658_10191697 | 3300025986 | Bacteria | 1699 |
| 482 | Ga0207677_10101282 | 3300026023 | Bacteria | 2120 |
| 483 | Ga0207677_10348421 | 3300026023 | Bacteria | 1240 |
| 484 | Ga0207703_10002433 | 3300026035 | Bacteria | 16135 |
| 485 | Ga0207703_10006706 | 3300026035 | Bacteria | 9188 |
| 486 | Ga0207703_10043948 | 3300026035 | Bacteria | 3588 |
| 487 | Ga0207703_10306701 | 3300026035 | Bacteria | 1450 |
| 488 | Ga0207703_10398746 | 3300026035 | Bacteria | 1276 |
| 489 | Ga0207703_11506208 | 3300026035 | Bacteria | 647 |
| 490 | Ga0207639_10001774 | 3300026041 | Bacteria | 14522 |
| 491 | Ga0207639_10388798 | 3300026041 | Bacteria | 1254 |
| 492 | Ga0207678_10001059 | 3300026067 | Bacteria | 25176 |
| 493 | Ga0207678_10006214 | 3300026067 | Bacteria | 10613 |
| 494 | Ga0207678_10030636 | 3300026067 | Bacteria | 4696 |
| 495 | Ga0207678_10082021 | 3300026067 | Bacteria | 2760 |
| 496 | Ga0207678_10406356 | 3300026067 | Bacteria | 1179 |
| 497 | Ga0207708_10002793 | 3300026075 | Bacteria | 12833 |
| 498 | Ga0207708_10020046 | 3300026075 | Bacteria | 5042 |
| 499 | Ga0207702_10014464 | 3300026078 | Bacteria | 6553 |
| 500 | Ga0207702_10041934 | 3300026078 | Bacteria | 3838 |
| 501 | Ga0207702_10169832 | 3300026078 | Bacteria | 1999 |
| 502 | Ga0207641_10000622 | 3300026088 | Bacteria | 38657 |
| 503 | Ga0207641_10640641 | 3300026088 | Bacteria | 1043 |
| 504 | Ga0207648_10009300 | 3300026089 | Bacteria | 9423 |
| 505 | Ga0207648_10062170 | 3300026089 | Bacteria | 3256 |
| 506 | Ga0207648_10735065 | 3300026089 | Bacteria | 916 |
| 507 | Ga0207676_10002696 | 3300026095 | Bacteria | 12630 |
| 508 | Ga0207676_10231674 | 3300026095 | Bacteria | 1651 |
| 509 | Ga0207676_10347863 | 3300026095 | Bacteria | 1370 |
| 510 | Ga0207674_10001342 | 3300026116 | Bacteria | 31848 |
| 511 | Ga0207674_10036947 | 3300026116 | Bacteria | 5083 |
| 512 | Ga0207675_100006706 | 3300026118 | Bacteria | 10886 |
| 513 | Ga0207675_100011711 | 3300026118 | Bacteria | 8203 |
| 514 | Ga0207683_10001193 | 3300026121 | Bacteria | 23509 |
| 515 | Ga0207683_10024887 | 3300026121 | Bacteria | 5159 |
| 516 | Ga0207683_10027481 | 3300026121 | Bacteria | 4916 |
| 517 | Ga0207683_10054787 | 3300026121 | Bacteria | 3497 |
| 518 | Ga0207698_10007867 | 3300026142 | Bacteria | 6709 |
| 519 | Ga0209996_1014069 | 3300027395 | Bacteria | 1086 |
| 520 | Ga0209970_1008074 | 3300027614 | Bacteria | 1728 |
| 521 | Ga0210002_1000401 | 3300027617 | Bacteria | 5920 |
| 522 | Ga0209983_1007094 | 3300027665 | Bacteria | 2300 |
| 523 | Ga0209971_1007630 | 3300027682 | Bacteria | 2567 |
| 524 | Ga0209966_1001072 | 3300027695 | Bacteria | 4995 |
| 525 | Ga0209998_10001333 | 3300027717 | Bacteria | 5996 |
| 526 | Ga0209998_10001362 | 3300027717 | Bacteria | 5937 |
| 527 | Ga0209974_10115781 | 3300027876 | Bacteria | 946 |
| 528 | Ga0207428_10000513 | 3300027907 | Bacteria | 46311 |
| 529 | Ga0207428_10000626 | 3300027907 | Bacteria | 41522 |
| 530 | Ga0207428_10001020 | 3300027907 | Bacteria | 31018 |
| 531 | Ga0268265_10002370 | 3300028380 | Bacteria | 14256 |
| 532 | Ga0268265_10014719 | 3300028380 | Bacteria | 5337 |
| 533 | Ga0268264_10004444 | 3300028381 | Bacteria | 11961 |
| 534 | Ga0268264_10188687 | 3300028381 | Bacteria | 1877 |
| 535 | Ga0265337_1009173 | 3300028556 | Bacteria | 3550 |
| 536 | Ga0307515_10339874 | 3300028794 | Bacteria | 1154 |
| 537 | Ga0265338_10462939 | 3300028800 | Bacteria | 897 |
| 538 | Ga0265325_10007153 | 3300031241 | Bacteria | 6708 |
| 539 | Ga0265325_10012441 | 3300031241 | Bacteria | 4864 |
| 540 | Ga0265325_10017987 | 3300031241 | Bacteria | 3923 |
| 541 | Ga0265325_10029347 | 3300031241 | Bacteria | 2957 |
| 542 | Ga0265339_10032503 | 3300031249 | Bacteria | 2942 |
| 543 | Ga0265331_10086462 | 3300031250 | Bacteria | 1452 |
| 544 | Ga0265316_10386059 | 3300031344 | Bacteria | 1010 |
| 545 | Ga0307513_10645055 | 3300031456 | Bacteria | 766 |
| 546 | Ga0307408_100964926 | 3300031548 | Bacteria | 784 |
| 547 | Ga0265313_10000525 | 3300031595 | Bacteria | 40049 |
| 548 | Ga0265313_10008290 | 3300031595 | Bacteria | 6926 |
| 549 | Ga0265313_10016157 | 3300031595 | Bacteria | 4304 |
| 550 | Ga0265313_10107984 | 3300031595 | Bacteria | 1227 |
| 551 | Ga0265313_10164418 | 3300031595 | Bacteria | 941 |
| 552 | Ga0316579_10068836 | 3300031691 | Bacteria | 1674 |
| 553 | Ga0265314_10006316 | 3300031711 | Bacteria | 10511 |
| 554 | Ga0307409_101365069 | 3300031995 | Bacteria | 735 |
| 555 | Ga0307415_100958170 | 3300032126 | Bacteria | 793 |
| 556 | Ga0373948_0000049 | 3300034817 | Bacteria | 12986 |
| 557 | Ga0373948_0014293 | 3300034817 | Bacteria | 1444 |
| 558 | Ga0373948_0056125 | 3300034817 | Bacteria | 856 |
| 559 | Ga0373950_0000665 | 3300034818 | Bacteria | 4258 |
| 560 | Ga0373950_0001094 | 3300034818 | Bacteria | 3462 |
| 561 | Ga0373958_0000026 | 3300034819 | Bacteria | 16079 |
| 562 | Ga0373958_0000135 | 3300034819 | Bacteria | 8219 |
| 563 | Ga0373958_0004984 | 3300034819 | Bacteria | 1993 |
| 564 | Ga0373958_0028965 | 3300034819 | Bacteria | 1075 |
| 565 | Ga0373958_0085299 | 3300034819 | Bacteria | 721 |
| 566 | Ga0373959_0001171 | 3300034820 | Bacteria | 4235 |
| 567 | Ga0373938_0000133 | 3300034957 | Bacteria | 10609 |
| 568 | Ga0373938_0000538 | 3300034957 | Bacteria | 6129 |
| 569 | Ga0373938_0003284 | 3300034957 | Bacteria | 2639 |
| 570 | Ga0373928_0001408 | 3300035084 | Bacteria | 4691 |
| 571 | Ga0373929_0000110 | 3300035085 | Bacteria | 13537 |
| 572 | Ga0373934_0030387 | 3300035086 | Bacteria | 2113 |
| 573 | Ga0373940_0001333 | 3300035088 | Bacteria | 4407 |
| 574 | Ga0373940_0002247 | 3300035088 | Bacteria | 3714 |
| 575 | Ga0373944_0110061 | 3300035089 | Bacteria | 939 |
| 576 | Ga0373944_0153535 | 3300035089 | Bacteria | 813 |
| 577 | Ga0373949_0000771 | 3300035090 | Bacteria | 10307 |
| 578 | Ga0373949_0001010 | 3300035090 | Bacteria | 8668 |
| 579 | Ga0373949_0009925 | 3300035090 | Bacteria | 2082 |
| 580 | Ga0373949_0110874 | 3300035090 | Bacteria | 761 |
| 581 | Ga0373949_0163103 | 3300035090 | Bacteria | 651 |
| 582 | Ga0373951_0001038 | 3300035091 | Bacteria | 7468 |
| 583 | Ga0373951_0002914 | 3300035091 | Bacteria | 4253 |
| 584 | Ga0373951_0003615 | 3300035091 | Bacteria | 3728 |
| 585 | Ga0373951_0033003 | 3300035091 | Bacteria | 1226 |
| 586 | Ga0373952_0000200 | 3300035092 | Bacteria | 9497 |
| 587 | Ga0373952_0000271 | 3300035092 | Bacteria | 8517 |
| 588 | Ga0373952_0002332 | 3300035092 | Bacteria | 3422 |
| 589 | Ga0373923_0059044 | 3300035111 | Bacteria | 1625 |
| 590 | Ga0373923_0098540 | 3300035111 | Bacteria | 1286 |
| 591 | Ga0373923_0278883 | 3300035111 | Bacteria | 787 |
| 592 | Ga0373932_0000822 | 3300035112 | Bacteria | 9175 |
| 593 | Ga0373932_0001180 | 3300035112 | Bacteria | 7469 |
| 594 | Ga0373932_0008434 | 3300035112 | Bacteria | 2464 |
| 595 | Ga0373932_0011585 | 3300035112 | Bacteria | 2158 |
| 596 | Ga0373936_0002908 | 3300035113 | Bacteria | 6397 |
| 597 | Ga0373939_0003897 | 3300035114 | Bacteria | 3509 |
| 598 | Ga0373939_0004068 | 3300035114 | Bacteria | 3443 |
| 599 | Ga0373939_0005157 | 3300035114 | Bacteria | 3107 |
| 600 | Ga0373941_0000259 | 3300035115 | Bacteria | 10177 |
| 601 | Ga0373941_0000952 | 3300035115 | Bacteria | 5977 |
| 602 | Ga0373941_0006275 | 3300035115 | Bacteria | 2854 |
| 603 | Ga0373945_0002980 | 3300035116 | Bacteria | 5317 |
| 604 | Ga0373945_0017410 | 3300035116 | Bacteria | 2433 |
| 605 | Ga0373953_0026413 | 3300035117 | Bacteria | 2224 |
| 606 | Ga0373953_0078767 | 3300035117 | Bacteria | 1367 |
| 607 | Ga0373954_0001844 | 3300035118 | Bacteria | 8749 |
| 608 | Ga0373954_0004126 | 3300035118 | Bacteria | 6225 |
| 609 | Ga0373956_0001114 | 3300035119 | Bacteria | 11079 |
| 610 | Ga0373956_0013063 | 3300035119 | Bacteria | 3451 |
| 611 | Ga0373956_0040689 | 3300035119 | Bacteria | 2062 |
| 612 | Ga0373957_0001424 | 3300035120 | Bacteria | 6472 |
| 613 | Ga0373957_0010241 | 3300035120 | Bacteria | 3092 |
| 614 | Ga0373957_0017200 | 3300035120 | Bacteria | 2514 |
| 615 | Ga0373960_0000277 | 3300035121 | Bacteria | 9832 |
| 616 | Ga0373960_0001175 | 3300035121 | Bacteria | 5700 |
| 617 | Ga0373943_0000267 | 3300035170 | Bacteria | 21498 |
| 618 | Ga0373943_0005699 | 3300035170 | Bacteria | 5588 |
| 619 | Ga0373943_0007845 | 3300035170 | Bacteria | 4793 |
| 620 | Ga0373943_0453324 | 3300035170 | Bacteria | 745 |
| 621 | Ga0373943_0464868 | 3300035170 | Bacteria | 736 |
| 622 | Ga0373946_0006942 | 3300035171 | Bacteria | 4123 |
| 623 | Ga0373946_0010659 | 3300035171 | Bacteria | 3408 |
| 624 | Ga0373946_0302123 | 3300035171 | Bacteria | 791 |
| 625 | Ga0373955_0005446 | 3300035172 | Bacteria | 5720 |
| 626 | Ga0373955_0027080 | 3300035172 | Bacteria | 2959 |
| 627 | Ga0373955_0092033 | 3300035172 | Bacteria | 1729 |
| 628 | Ga0373942_0000533 | 3300035207 | Bacteria | 10673 |
| 629 | Ga0373942_0007137 | 3300035207 | Bacteria | 2586 |
| 630 | Ga0373942_0040070 | 3300035207 | Bacteria | 1276 |
| 631 | Ga0373942_0152320 | 3300035207 | Bacteria | 743 |
| 632 | Ga0373961_0001383 | 3300035241 | Bacteria | 7253 |
| 633 | Ga0373961_0001598 | 3300035241 | Bacteria | 6444 |
| 634 | Ga0373961_0046126 | 3300035241 | Bacteria | 1276 |
| 635 | Ga0373962_0000275 | 3300035242 | Bacteria | 11095 |
| 636 | Ga0373962_0001638 | 3300035242 | Bacteria | 5319 |
| 637 | Ga0373962_0018817 | 3300035242 | Bacteria | 1801 |
| 638 | Ga0373962_0039498 | 3300035242 | Bacteria | 1324 |
| 639 | Ga0373931_0002417 | 3300035691 | Bacteria | 8259 |
| 640 | Ga0373931_0004020 | 3300035691 | Bacteria | 6662 |
| 641 | Ga0373931_0007842 | 3300035691 | Bacteria | 5046 |
| 642 | Ga0373931_0100883 | 3300035691 | Bacteria | 1623 |
| 643 | Ga0373931_0515845 | 3300035691 | Bacteria | 773 |
| 644 | Ga0373935_0001440 | 3300035692 | Bacteria | 13192 |
| 645 | Ga0373935_0001725 | 3300035692 | Bacteria | 12243 |
| 646 | Ga0373927_0002318 | 3300035695 | Bacteria | 13902 |
| 647 | Ga0373927_0008373 | 3300035695 | Bacteria | 6962 |
| 648 | Ga0373927_0016357 | 3300035695 | Bacteria | 4894 |
| 649 | Ga0373927_0053503 | 3300035695 | Bacteria | 2612 |
| 650 | Ga0373927_0209104 | 3300035695 | Bacteria | 1281 |
| 651 | Ga0373933_0003523 | 3300035724 | Bacteria | 8715 |
| 652 | Ga0373933_0022799 | 3300035724 | Bacteria | 3570 |
| 653 | Ga0373933_0041923 | 3300035724 | Bacteria | 2704 |
| 654 | Ga0373933_0143952 | 3300035724 | Bacteria | 1506 |
| 655 | Ga0373933_0607407 | 3300035724 | Bacteria | 718 |
| 656 | Ga0373947_0001425 | 3300035725 | Bacteria | 14710 |
| 657 | Ga0373947_0138212 | 3300035725 | Bacteria | 1560 |
| 658 | Ga0373947_0143833 | 3300035725 | Bacteria | 1532 |
| 659 | Ga0373947_0303149 | 3300035725 | Bacteria | 1065 |
| 660 | Ga0373937_0004926 | 3300036401 | Bacteria | 11347 |
| 661 | Ga0373937_0012806 | 3300036401 | Bacteria | 7386 |
| 662 | Ga0373937_0021169 | 3300036401 | Bacteria | 5836 |
| 663 | Ga0373937_0055967 | 3300036401 | Bacteria | 3621 |
| 664 | Ga0373937_0096606 | 3300036401 | Bacteria | 2740 |
| 665 | Ga0373937_0144215 | 3300036401 | Bacteria | 2228 |
| 666 | Ga0373937_0293079 | 3300036401 | Bacteria | 1537 |
| 667 | Ga0373937_0630658 | 3300036401 | Bacteria | 1017 |
| 668 | Ga0373937_1008473 | 3300036401 | Bacteria | 781 |
| 669 | Ga0373937_1685113 | 3300036401 | Bacteria | 581 |
| 670 | Ga0373925_0001642 | 3300037068 | Bacteria | 18838 |
| 671 | Ga0373925_0015058 | 3300037068 | Bacteria | 5590 |
| 672 | Ga0373925_0116048 | 3300037068 | Bacteria | 2073 |
| 673 | Ga0373925_0149194 | 3300037068 | Bacteria | 1835 |
| 674 | Ga0395900_0001475 | 3300037418 | Bacteria | 28056 |
| 675 | Ga0395900_0071587 | 3300037418 | Bacteria | 3564 |
| 676 | Ga0395900_0391293 | 3300037418 | Bacteria | 1356 |
| 677 | Ga0395898_0057650 | 3300037466 | Bacteria | 3784 |
| 678 | Ga0395898_0074306 | 3300037466 | Bacteria | 3283 |
| 679 | Ga0395898_1295201 | 3300037466 | Bacteria | 658 |
| 680 | Ga0395901_0023603 | 3300038443 | Bacteria | 6306 |
| 681 | Ga0395901_0098684 | 3300038443 | Bacteria | 3062 |
| 682 | Ga0436365_1111585 | 3300039437 | Bacteria | 1112 |
| 683 | Ga0439465_0119165 | 3300041413 | Bacteria | 924 |
| 684 | Ga0451839_1007098 | 3300041496 | Bacteria | 1293 |
| 685 | Ga0451843_1140181 | 3300041509 | Bacteria | 1141 |
| 686 | Ga0439459_0040327 | 3300042438 | Bacteria | 990 |
| 687 | Ga0450893_0059057 | 3300042532 | Bacteria | 730 |
| 688 | Ga0451577_0074007 | 3300042876 | Bacteria | 3039 |
| 689 | Ga0466963_0415975 | 3300044694 | Bacteria | 948 |
| 690 | Ga0466964_0233612 | 3300044706 | Bacteria | 899 |
| 691 | Ga0453684_0077244 | 3300044712 | Bacteria | 4176 |
| 692 | Ga0466957_0282360 | 3300044842 | Bacteria | 1111 |
| 693 | Ga0466959_0090698 | 3300045049 | Bacteria | 2195 |
| 694 | Ga0451576_0013587 | 3300045051 | Bacteria | 9101 |
| 695 | Ga0466967_0804417 | 3300045976 | Bacteria | 933 |
| 696 | Ga0495617_006700 | 3300046452 | Bacteria | 4027 |
| 697 | Ga0495592_0001131 | 3300046454 | Bacteria | 18562 |
| 698 | Ga0495592_0007618 | 3300046454 | Bacteria | 8111 |
| 699 | Ga0495592_0012894 | 3300046454 | Bacteria | 6353 |
| 700 | Ga0495592_0114193 | 3300046454 | Bacteria | 1908 |
| 701 | Ga0495603_0034243 | 3300046455 | Bacteria | 3054 |
| 702 | Ga0495629_0000748 | 3300046459 | Bacteria | 26249 |
| 703 | Ga0495629_0386423 | 3300046459 | Bacteria | 952 |
| 704 | Ga0495638_0021650 | 3300046460 | Bacteria | 4231 |
| 705 | Ga0495641_0023167 | 3300046461 | Bacteria | 3091 |
| 706 | Ga0495641_0025462 | 3300046461 | Bacteria | 2904 |
| 707 | Ga0495651_0131592 | 3300046462 | Bacteria | 1826 |
| 708 | Ga0495651_0148077 | 3300046462 | Bacteria | 1695 |
| 709 | Ga0495651_0165626 | 3300046462 | Bacteria | 1579 |
| 710 | Ga0495653_0006076 | 3300046463 | Bacteria | 9893 |
| 711 | Ga0495653_0151260 | 3300046463 | Bacteria | 1621 |
| 712 | Ga0495653_0178772 | 3300046463 | Bacteria | 1458 |
| 713 | Ga0495653_0318976 | 3300046463 | Bacteria | 1008 |
| 714 | Ga0495580_0027411 | 3300046472 | Bacteria | 4145 |
| 715 | Ga0495580_0132890 | 3300046472 | Bacteria | 1725 |
| 716 | Ga0495582_0020868 | 3300046473 | Bacteria | 3587 |
| 717 | Ga0495582_0061501 | 3300046473 | Bacteria | 2073 |
| 718 | Ga0495639_0005351 | 3300046475 | Bacteria | 5527 |
| 719 | Ga0495639_0012936 | 3300046475 | Bacteria | 3601 |
| 720 | Ga0495662_0159630 | 3300046476 | Bacteria | 1111 |
| 721 | Ga0495662_0328264 | 3300046476 | Bacteria | 752 |
| 722 | Ga0495664_0038492 | 3300046477 | Bacteria | 2822 |
| 723 | Ga0495664_0130634 | 3300046477 | Bacteria | 1520 |
| 724 | Ga0495664_0195979 | 3300046477 | Bacteria | 1224 |
| 725 | Ga0495584_0035359 | 3300046491 | Bacteria | 2526 |
| 726 | Ga0495585_0000546 | 3300046492 | Bacteria | 35582 |
| 727 | Ga0495594_0012140 | 3300046499 | Bacteria | 4485 |
| 728 | Ga0495594_0034883 | 3300046499 | Bacteria | 2738 |
| 729 | Ga0495594_0132898 | 3300046499 | Bacteria | 1409 |
| 730 | Ga0495607_0002967 | 3300046501 | Bacteria | 13310 |
| 731 | Ga0495608_0000557 | 3300046511 | Bacteria | 25706 |
| 732 | Ga0495608_0009270 | 3300046511 | Bacteria | 6884 |
| 733 | Ga0495608_0140150 | 3300046511 | Bacteria | 1544 |
| 734 | Ga0495608_0311387 | 3300046511 | Bacteria | 974 |
| 735 | Ga0495618_0014639 | 3300046514 | Bacteria | 4782 |
| 736 | Ga0495618_0017294 | 3300046514 | Bacteria | 4419 |
| 737 | Ga0495618_0036560 | 3300046514 | Bacteria | 3081 |
| 738 | Ga0495618_0092002 | 3300046514 | Bacteria | 1939 |
| 739 | Ga0495628_0061817 | 3300046516 | Bacteria | 2936 |
| 740 | Ga0495628_0148926 | 3300046516 | Bacteria | 1783 |
| 741 | Ga0495630_0007320 | 3300046517 | Bacteria | 7880 |
| 742 | Ga0495630_0114341 | 3300046517 | Bacteria | 2045 |
| 743 | Ga0495630_0307506 | 3300046517 | Bacteria | 1211 |
| 744 | Ga0495631_0018545 | 3300046518 | Bacteria | 3274 |
| 745 | Ga0495644_0014751 | 3300046523 | Bacteria | 2992 |
| 746 | Ga0495666_0012431 | 3300046526 | Bacteria | 4244 |
| 747 | Ga0495666_0024785 | 3300046526 | Bacteria | 2963 |
| 748 | Ga0495666_0027064 | 3300046526 | Bacteria | 2823 |
| 749 | Ga0495652_0019278 | 3300046529 | Bacteria | 6077 |
| 750 | Ga0495652_0229583 | 3300046529 | Bacteria | 1389 |
| 751 | Ga0495665_0026242 | 3300046531 | Bacteria | 3129 |
| 752 | Ga0495665_0196386 | 3300046531 | Bacteria | 1047 |
| 753 | Ga0495640_0006625 | 3300046533 | Bacteria | 9136 |
| 754 | Ga0495640_0283421 | 3300046533 | Bacteria | 1031 |
| 755 | Ga0495640_0311360 | 3300046533 | Bacteria | 976 |
| 756 | Ga0495586_0004986 | 3300046535 | Bacteria | 7101 |
| 757 | Ga0495586_0053932 | 3300046535 | Bacteria | 2178 |
| 758 | Ga0495587_0004155 | 3300046536 | Bacteria | 9581 |
| 759 | Ga0495587_0014061 | 3300046536 | Bacteria | 5026 |
| 760 | Ga0495587_0027416 | 3300046536 | Bacteria | 3469 |
| 761 | Ga0495598_0022225 | 3300046537 | Bacteria | 1695 |
| 762 | Ga0495621_0056148 | 3300046539 | Bacteria | 1419 |
| 763 | Ga0495645_0007749 | 3300046543 | Bacteria | 7469 |
| 764 | Ga0495645_0062950 | 3300046543 | Bacteria | 2686 |
| 765 | Ga0495645_0084739 | 3300046543 | Bacteria | 2269 |
| 766 | Ga0495622_0008152 | 3300046557 | Bacteria | 4854 |
| 767 | Ga0495633_0008413 | 3300046558 | Bacteria | 5816 |
| 768 | Ga0495667_0001194 | 3300046559 | Bacteria | 16949 |
| 769 | Ga0495667_0002899 | 3300046559 | Bacteria | 11503 |
| 770 | Ga0495667_0009830 | 3300046559 | Bacteria | 6479 |
| 771 | Ga0495667_0030978 | 3300046559 | Bacteria | 3592 |
| 772 | Ga0495656_0282358 | 3300046615 | Bacteria | 846 |
| 773 | Ga0495634_0022647 | 3300046642 | Bacteria | 4425 |
| 774 | Ga0495634_0084280 | 3300046642 | Bacteria | 2072 |
| 775 | Ga0495634_0129488 | 3300046642 | Bacteria | 1610 |
| 776 | Ga0495635_0019672 | 3300046663 | Bacteria | 4701 |
| 777 | Ga0495635_0091251 | 3300046663 | Bacteria | 2083 |
| 778 | Ga0495635_0141048 | 3300046663 | Bacteria | 1641 |
| 779 | Ga0495635_0314070 | 3300046663 | Bacteria | 1049 |
| 780 | Ga0495659_0000633 | 3300046664 | Bacteria | 12802 |
| 781 | Ga0495588_0144505 | 3300046674 | Bacteria | 1257 |
| 782 | Ga0495657_0040922 | 3300046675 | Bacteria | 3175 |
| 783 | Ga0495657_0041424 | 3300046675 | Bacteria | 3151 |
| 784 | Ga0495599_0001663 | 3300046678 | Bacteria | 12840 |
| 785 | Ga0495599_0017327 | 3300046678 | Bacteria | 4479 |
| 786 | Ga0495623_0001616 | 3300046679 | Bacteria | 15135 |
| 787 | Ga0495623_0007933 | 3300046679 | Bacteria | 6902 |
| 788 | Ga0495646_0003032 | 3300046680 | Bacteria | 10400 |
| 789 | Ga0495646_0005955 | 3300046680 | Bacteria | 7729 |
| 790 | Ga0495646_0116695 | 3300046680 | Bacteria | 1514 |
| 791 | Ga0495647_0000453 | 3300046681 | Bacteria | 11831 |
| 792 | Ga0495647_0004002 | 3300046681 | Bacteria | 4756 |
| 793 | Ga0495647_0008665 | 3300046681 | Bacteria | 3423 |
| 794 | Ga0495647_0091397 | 3300046681 | Bacteria | 1248 |
| 795 | Ga0495658_0001515 | 3300046683 | Bacteria | 12183 |
| 796 | Ga0495658_0003288 | 3300046683 | Bacteria | 8032 |
| 797 | Ga0495669_0077930 | 3300046684 | Bacteria | 1518 |
| 798 | Ga0495613_0063175 | 3300046689 | Bacteria | 2709 |
| 799 | Ga0495613_0169781 | 3300046689 | Bacteria | 1548 |
| 800 | Ga0495613_0287942 | 3300046689 | Bacteria | 1139 |
| 801 | Ga0495624_0002572 | 3300046690 | Bacteria | 13714 |
| 802 | Ga0495624_0010998 | 3300046690 | Bacteria | 6232 |
| 803 | Ga0495624_0139800 | 3300046690 | Bacteria | 1484 |
| 804 | Ga0495600_0002049 | 3300046809 | Bacteria | 11360 |
| 805 | Ga0495600_0011556 | 3300046809 | Bacteria | 5506 |
| 806 | Ga0495581_0055265 | 3300047315 | Bacteria | 2291 |
| 807 | Ga0495581_0063230 | 3300047315 | Bacteria | 2138 |
| 808 | Ga0495604_0001274 | 3300047317 | Bacteria | 20598 |
| 809 | Ga0495604_0003734 | 3300047317 | Bacteria | 12126 |
| 810 | Ga0495604_0018396 | 3300047317 | Bacteria | 5595 |
| 811 | Ga0495674_0016969 | 3300047319 | Bacteria | 6786 |
| 812 | Ga0495674_0079579 | 3300047319 | Bacteria | 2814 |
| 813 | Ga0495674_0125471 | 3300047319 | Bacteria | 2166 |
| 814 | Ga0495674_0171607 | 3300047319 | Bacteria | 1809 |
| 815 | Ga0495676_0027741 | 3300047321 | Bacteria | 4851 |
| 816 | Ga0495676_0065631 | 3300047321 | Bacteria | 2816 |
| 817 | Ga0495676_0148043 | 3300047321 | Bacteria | 1674 |
| 818 | Ga0495676_0372758 | 3300047321 | Bacteria | 951 |
| 819 | Ga0495680_0006572 | 3300047322 | Bacteria | 10788 |
| 820 | Ga0495680_0008513 | 3300047322 | Bacteria | 9321 |
| 821 | Ga0495680_0012421 | 3300047322 | Bacteria | 7495 |
| 822 | Ga0495680_0036047 | 3300047322 | Bacteria | 3976 |
| 823 | Ga0495680_0039455 | 3300047322 | Bacteria | 3767 |
| 824 | Ga0495680_0061841 | 3300047322 | Bacteria | 2879 |
| 825 | Ga0495675_0000740 | 3300047444 | Bacteria | 20363 |
| 826 | Ga0495675_0005699 | 3300047444 | Bacteria | 7613 |
| 827 | Ga0495675_0010997 | 3300047444 | Bacteria | 5672 |
| 828 | Ga0495684_0004959 | 3300047471 | Bacteria | 10397 |
| 829 | Ga0495684_0034085 | 3300047471 | Bacteria | 3906 |
| 830 | Ga0495684_0169551 | 3300047471 | Bacteria | 1624 |
| 831 | Ga0495684_0199773 | 3300047471 | Bacteria | 1474 |
| 832 | Ga0495684_0234651 | 3300047471 | Bacteria | 1340 |
| 833 | Ga0495593_0006602 | 3300047673 | Bacteria | 6788 |
| 834 | Ga0495593_0021323 | 3300047673 | Bacteria | 3621 |
| 835 | Ga0495593_0048086 | 3300047673 | Bacteria | 2267 |
| 836 | Ga0495602_0002218 | 3300048088 | Bacteria | 19614 |
| 837 | Ga0495602_0051357 | 3300048088 | Bacteria | 3672 |
| 838 | Ga0495602_0054723 | 3300048088 | Bacteria | 3520 |
| 839 | Ga0495602_0076279 | 3300048088 | Bacteria | 2841 |
| 840 | Ga0495614_0180128 | 3300048089 | Bacteria | 950 |
| 841 | Ga0495614_0425799 | 3300048089 | Bacteria | 626 |
| 842 | Ga0496100_0000447 | 3300048903 | Bacteria | 19924 |
| 843 | Ga0496100_0000501 | 3300048903 | Bacteria | 18814 |
| 844 | Ga0496100_0018638 | 3300048903 | Bacteria | 4121 |
| 845 | Ga0496100_0080583 | 3300048903 | Bacteria | 2197 |
| 846 | Ga0496100_0749709 | 3300048903 | Bacteria | 764 |
| 847 | Ga0496101_0001349 | 3300048904 | Bacteria | 14712 |
| 848 | Ga0496101_0005470 | 3300048904 | Bacteria | 8098 |
| 849 | Ga0496101_0039625 | 3300048904 | Bacteria | 3352 |
| 850 | Ga0496102_0002354 | 3300048905 | Bacteria | 16125 |
| 851 | Ga0496102_0083393 | 3300048905 | Bacteria | 2949 |
| 852 | Ga0496102_0096599 | 3300048905 | Bacteria | 2739 |
| 853 | Ga0496102_0346195 | 3300048905 | Bacteria | 1399 |
| 854 | Ga0496102_0430748 | 3300048905 | Bacteria | 1238 |
| 855 | Ga0496103_0000837 | 3300048906 | Bacteria | 22480 |
| 856 | Ga0496103_0023448 | 3300048906 | Bacteria | 3721 |
| 857 | Ga0496103_0036345 | 3300048906 | Bacteria | 3016 |
| 858 | Ga0496103_0102731 | 3300048906 | Bacteria | 1810 |
| 859 | Ga0496104_0000126 | 3300048907 | Bacteria | 70488 |
| 860 | Ga0496104_0004960 | 3300048907 | Bacteria | 11617 |
| 861 | Ga0496104_0027230 | 3300048907 | Bacteria | 5290 |
| 862 | Ga0496104_0074672 | 3300048907 | Bacteria | 3227 |
| 863 | Ga0496104_0131627 | 3300048907 | Bacteria | 2403 |
| 864 | Ga0496104_0904560 | 3300048907 | Bacteria | 787 |
| 865 | Ga0496105_0000117 | 3300048908 | Bacteria | 54274 |
| 866 | Ga0496105_0002637 | 3300048908 | Bacteria | 13054 |
| 867 | Ga0496105_0020680 | 3300048908 | Bacteria | 5320 |
| 868 | Ga0496105_0024254 | 3300048908 | Bacteria | 4929 |
| 869 | Ga0496106_0001351 | 3300048909 | Bacteria | 18370 |
| 870 | Ga0496106_0011805 | 3300048909 | Bacteria | 6448 |
| 871 | Ga0496106_0012975 | 3300048909 | Bacteria | 6148 |
| 872 | Ga0496106_0037295 | 3300048909 | Bacteria | 3636 |
| 873 | Ga0496106_0122012 | 3300048909 | Bacteria | 2037 |
| 874 | Ga0496106_0318858 | 3300048909 | Bacteria | 1247 |
| 875 | Ga0496107_0001211 | 3300048910 | Bacteria | 15713 |
| 876 | Ga0496107_0016353 | 3300048910 | Bacteria | 5207 |
| 877 | Ga0496107_0017254 | 3300048910 | Bacteria | 5076 |
| 878 | Ga0496107_0056195 | 3300048910 | Bacteria | 2843 |
| 879 | Ga0496107_0127761 | 3300048910 | Bacteria | 1875 |
| 880 | Ga0496107_0129895 | 3300048910 | Bacteria | 1859 |
| 881 | Ga0496108_0006065 | 3300048911 | Bacteria | 9774 |
| 882 | Ga0496108_0015761 | 3300048911 | Bacteria | 6161 |
| 883 | Ga0496108_0016812 | 3300048911 | Bacteria | 5977 |
| 884 | Ga0496108_0397554 | 3300048911 | Bacteria | 1203 |
| 885 | Ga0496109_0000188 | 3300048912 | Bacteria | 61633 |
| 886 | Ga0496109_0002868 | 3300048912 | Bacteria | 14419 |
| 887 | Ga0496109_0005044 | 3300048912 | Bacteria | 11034 |
| 888 | Ga0496109_0056119 | 3300048912 | Bacteria | 3594 |
| 889 | Ga0496109_0057110 | 3300048912 | Bacteria | 3561 |
| 890 | Ga0496109_0066995 | 3300048912 | Bacteria | 3288 |
| 891 | Ga0496109_0361875 | 3300048912 | Bacteria | 1370 |
| 892 | Ga0496109_0409615 | 3300048912 | Bacteria | 1281 |
| 893 | Ga0496109_0684842 | 3300048912 | Bacteria | 962 |
| 894 | Ga0496110_0006025 | 3300048913 | Bacteria | 9550 |
| 895 | Ga0496110_0006085 | 3300048913 | Bacteria | 9508 |
| 896 | Ga0496110_0030903 | 3300048913 | Bacteria | 4619 |
| 897 | Ga0496110_0068915 | 3300048913 | Bacteria | 3132 |
| 898 | Ga0496110_0203676 | 3300048913 | Bacteria | 1798 |
| 899 | Ga0496110_0368821 | 3300048913 | Bacteria | 1308 |
| 900 | Ga0496111_0008703 | 3300048914 | Bacteria | 6735 |
| 901 | Ga0496111_0040142 | 3300048914 | Bacteria | 3356 |
| 902 | Ga0496111_0045141 | 3300048914 | Bacteria | 3170 |
| 903 | Ga0496111_0188898 | 3300048914 | Bacteria | 1532 |
| 904 | Ga0496112_0004798 | 3300048915 | Bacteria | 11537 |
| 905 | Ga0496112_0026058 | 3300048915 | Bacteria | 5621 |
| 906 | Ga0496112_0099248 | 3300048915 | Bacteria | 2881 |
| 907 | Ga0496112_0142749 | 3300048915 | Bacteria | 2363 |
| 908 | Ga0496113_0004222 | 3300048916 | Bacteria | 8788 |
| 909 | Ga0496113_0066091 | 3300048916 | Bacteria | 2738 |
| 910 | Ga0496113_0098160 | 3300048916 | Bacteria | 2267 |
| 911 | Ga0496113_0106322 | 3300048916 | Bacteria | 2180 |
| 912 | Ga0496113_0114080 | 3300048916 | Bacteria | 2106 |
| 913 | Ga0496113_0254442 | 3300048916 | Bacteria | 1402 |
| 914 | Ga0496114_0001734 | 3300048917 | Bacteria | 16551 |
| 915 | Ga0496114_0008857 | 3300048917 | Bacteria | 7976 |
| 916 | Ga0496114_0022764 | 3300048917 | Bacteria | 5107 |
| 917 | Ga0496114_0207371 | 3300048917 | Bacteria | 1718 |
| 918 | Ga0496114_0208722 | 3300048917 | Bacteria | 1712 |
| 919 | Ga0496115_0000592 | 3300048918 | Bacteria | 27769 |
| 920 | Ga0496115_0027143 | 3300048918 | Bacteria | 4475 |
| 921 | Ga0496115_0062645 | 3300048918 | Bacteria | 3001 |
| 922 | Ga0496115_0070401 | 3300048918 | Bacteria | 2835 |
| 923 | Ga0496115_0083249 | 3300048918 | Bacteria | 2608 |
| 924 | Ga0496115_0140201 | 3300048918 | Bacteria | 1994 |
| 925 | Ga0496115_0255662 | 3300048918 | Bacteria | 1441 |
| 926 | Ga0496115_0272788 | 3300048918 | Bacteria | 1389 |
| 927 | Ga0496123_0227291 | 3300048926 | Bacteria | 937 |
| 928 | Ga0501032_0030974 | 3300049569 | Bacteria | 3669 |
| 929 | Ga0501032_0195940 | 3300049569 | Bacteria | 1319 |
| 930 | Ga0501033_0017120 | 3300049570 | Bacteria | 5479 |
| 931 | Ga0501033_0092352 | 3300049570 | Bacteria | 2213 |
| 932 | Ga0501033_0365779 | 3300049570 | Bacteria | 1009 |
| 933 | Ga0501034_0008567 | 3300049571 | Bacteria | 10794 |
| 934 | Ga0501034_0040118 | 3300049571 | Bacteria | 4740 |
| 935 | Ga0501034_0041240 | 3300049571 | Bacteria | 4670 |
| 936 | Ga0501034_0092690 | 3300049571 | Bacteria | 3017 |
| 937 | Ga0501034_0163904 | 3300049571 | Bacteria | 2192 |
| 938 | Ga0501034_0288833 | 3300049571 | Bacteria | 1578 |
| 939 | Ga0501034_0904130 | 3300049571 | Bacteria | 770 |
| 940 | Ga0501036_0000281 | 3300049572 | Bacteria | 35045 |
| 941 | Ga0501036_0134137 | 3300049572 | Bacteria | 2089 |
| 942 | Ga0501036_0284551 | 3300049572 | Bacteria | 1383 |
| 943 | Ga0501036_0527761 | 3300049572 | Bacteria | 981 |
| 944 | Ga0501036_0628177 | 3300049572 | Bacteria | 890 |
| 945 | Ga0501037_0014910 | 3300049573 | Bacteria | 5718 |
| 946 | Ga0501037_0039382 | 3300049573 | Bacteria | 3479 |
| 947 | Ga0501037_0109601 | 3300049573 | Bacteria | 1989 |
| 948 | Ga0501037_0124625 | 3300049573 | Bacteria | 1850 |
| 949 | Ga0501038_0039412 | 3300049574 | Bacteria | 4132 |
| 950 | Ga0501038_0039534 | 3300049574 | Bacteria | 4125 |
| 951 | Ga0501038_0282093 | 3300049574 | Bacteria | 1307 |
| 952 | Ga0501038_0490513 | 3300049574 | Bacteria | 940 |
| 953 | Ga0501039_0112844 | 3300049575 | Bacteria | 2125 |
| 954 | Ga0501039_0330335 | 3300049575 | Bacteria | 1198 |
| 955 | Ga0501040_0317409 | 3300049576 | Bacteria | 1114 |
| 956 | Ga0501043_0005571 | 3300049579 | Bacteria | 10146 |
| 957 | Ga0501043_0102011 | 3300049579 | Bacteria | 2255 |
| 958 | Ga0501043_0139445 | 3300049579 | Bacteria | 1899 |
| 959 | Ga0501043_0735154 | 3300049579 | Bacteria | 718 |
| 960 | Ga0501046_0398364 | 3300049580 | Bacteria | 995 |
| 961 | Ga0501047_0000316 | 3300049581 | Bacteria | 55680 |
| 962 | Ga0501047_0109688 | 3300049581 | Bacteria | 2642 |
| 963 | Ga0501047_0194915 | 3300049581 | Bacteria | 1888 |
| 964 | Ga0501047_0205130 | 3300049581 | Bacteria | 1831 |
| 965 | Ga0501048_0000150 | 3300049582 | Bacteria | 42721 |
| 966 | Ga0501048_0093929 | 3300049582 | Bacteria | 2116 |
| 967 | Ga0501048_0241721 | 3300049582 | Bacteria | 1281 |
| 968 | Ga0501067_0015221 | 3300049583 | Bacteria | 4259 |
| 969 | Ga0501068_0046081 | 3300049584 | Bacteria | 2628 |
| 970 | Ga0501068_0152941 | 3300049584 | Bacteria | 1450 |
| 971 | Ga0501068_0439341 | 3300049584 | Bacteria | 843 |
| 972 | Ga0501068_0643654 | 3300049584 | Bacteria | 692 |
| 973 | Ga0501069_0602264 | 3300049585 | Bacteria | 659 |
| 974 | Ga0501070_0015099 | 3300049586 | Bacteria | 6501 |
| 975 | Ga0501070_0092398 | 3300049586 | Bacteria | 2504 |
| 976 | Ga0501070_0283795 | 3300049586 | Bacteria | 1350 |
| 977 | Ga0501070_0427535 | 3300049586 | Bacteria | 1069 |
| 978 | Ga0501070_1111479 | 3300049586 | Bacteria | 609 |
| 979 | Ga0501071_0020000 | 3300049587 | Bacteria | 4650 |
| 980 | Ga0501071_0098843 | 3300049587 | Bacteria | 2150 |
| 981 | Ga0501072_0205727 | 3300049588 | Bacteria | 1569 |
| 982 | Ga0501073_0095755 | 3300049589 | Bacteria | 2061 |
| 983 | Ga0501074_0024398 | 3300049590 | Bacteria | 4395 |
| 984 | Ga0501079_0031559 | 3300049741 | Bacteria | 4072 |
| 985 | Ga0501079_0541084 | 3300049741 | Bacteria | 916 |
| 986 | Ga0501080_0001372 | 3300049742 | Bacteria | 20366 |
| 987 | Ga0501080_0061704 | 3300049742 | Bacteria | 3489 |
| 988 | Ga0501080_0077738 | 3300049742 | Bacteria | 3086 |
| 989 | Ga0501080_0097720 | 3300049742 | Bacteria | 2726 |
| 990 | Ga0501083_0002096 | 3300049744 | Bacteria | 13707 |
| 991 | Ga0501083_0066063 | 3300049744 | Bacteria | 2409 |
| 992 | Ga0501035_0089759 | 3300049822 | Bacteria | 2706 |
| 993 | Ga0501035_0131817 | 3300049822 | Bacteria | 2178 |
| 994 | Ga0501035_0170047 | 3300049822 | Bacteria | 1883 |
| 995 | Ga0501044_0009598 | 3300049823 | Bacteria | 10531 |
| 996 | Ga0501044_0069472 | 3300049823 | Bacteria | 3585 |
| 997 | Ga0501044_0082385 | 3300049823 | Bacteria | 3255 |
| 998 | Ga0501044_0096639 | 3300049823 | Bacteria | 2975 |
| 999 | Ga0501044_0190547 | 3300049823 | Bacteria | 2013 |
| 1000 | Ga0501044_0444213 | 3300049823 | Bacteria | 1204 |
| 1001 | Ga0501045_0265619 | 3300049824 | Bacteria | 1278 |
| 1002 | Ga0501045_0328052 | 3300049824 | Bacteria | 1139 |
| 1003 | nmdc:mga03n38_100195_c1 | 3300050490 | Bacteria | 1396 |
| 1004 | nmdc:mga03n38_43234_c1 | 3300050490 | Bacteria | 1974 |
| 1005 | nmdc:mga03n38_8072_c1 | 3300050490 | Bacteria | 3757 |
| 1006 | nmdc:mga00v17_151054_c1 | 3300050491 | Bacteria | 1493 |
| 1007 | nmdc:mga00v17_551079_c1 | 3300050491 | Bacteria | 746 |
| 1008 | nmdc:mga0k408_134146_c1 | 3300050493 | Bacteria | 1471 |
| 1009 | nmdc:mga0k408_475333_c1 | 3300050493 | Bacteria | 741 |
| 1010 | nmdc:mga06z11_321150_c1 | 3300050494 | Bacteria | 924 |
| 1011 | nmdc:mga04h51_254273_c1 | 3300050495 | Bacteria | 705 |
| 1012 | nmdc:mga07m45_123873_c1 | 3300050496 | Bacteria | 1494 |
| 1013 | nmdc:mga07m45_144875_c1 | 3300050496 | Bacteria | 1377 |
| 1014 | nmdc:mga07m45_176630_c1 | 3300050496 | Bacteria | 1242 |
| 1015 | nmdc:mga07m45_31114_c1 | 3300050496 | Bacteria | 2956 |
| 1016 | nmdc:mga05p37_1114_c1 | 3300050507 | Bacteria | 30870 |
| 1017 | nmdc:mga05p37_79219_c1 | 3300050507 | Bacteria | 4046 |
| 1018 | nmdc:mga09592_1302_c1 | 3300050508 | Bacteria | 20054 |
| 1019 | nmdc:mga0qj67_276_c1 | 3300050509 | Bacteria | 35718 |
| 1020 | nmdc:mga06r32_3728_c1 | 3300050510 | Bacteria | 13639 |
| 1021 | nmdc:mga08y16_3668_c1 | 3300050511 | Bacteria | 15982 |
| 1022 | nmdc:mga08y16_7407_c1 | 3300050511 | Bacteria | 11499 |
| 1023 | nmdc:mga08y16_8959_c1 | 3300050511 | Bacteria | 10509 |
| 1024 | nmdc:mga0n895_124362_c1 | 3300050512 | Bacteria | 2602 |
| 1025 | nmdc:mga0n895_217077_c1 | 3300050512 | Bacteria | 1942 |
| 1026 | nmdc:mga0n895_224722_c1 | 3300050512 | Bacteria | 1906 |
| 1027 | nmdc:mga0n895_3698_c1 | 3300050512 | Bacteria | 12366 |
| 1028 | nmdc:mga0n895_651_c1 | 3300050512 | Bacteria | 24245 |
| 1029 | nmdc:mga0n895_682_c1 | 3300050512 | Bacteria | 23848 |
| 1030 | nmdc:mga0rr50_2190_c1 | 3300050513 | Bacteria | 10950 |
| 1031 | nmdc:mga0rr50_286227_c1 | 3300050513 | Bacteria | 1376 |
| 1032 | nmdc:mga0rr50_453760_c1 | 3300050513 | Bacteria | 1087 |
| 1033 | nmdc:mga0rr50_919_c1 | 3300050513 | Bacteria | 15930 |
| 1034 | nmdc:mga08x19_56758_c1 | 3300050514 | Bacteria | 2528 |
| 1035 | nmdc:mga08x19_87785_c1 | 3300050514 | Bacteria | 2049 |
| 1036 | nmdc:mga0a205_1012_c1 | 3300050515 | Bacteria | 23345 |
| 1037 | nmdc:mga0a205_1633_c1 | 3300050515 | Bacteria | 19288 |
| 1038 | nmdc:mga0a205_190661_c1 | 3300050515 | Bacteria | 1942 |
| 1039 | nmdc:mga0a205_21841_c1 | 3300050515 | Bacteria | 6053 |
| 1040 | nmdc:mga0sz30_105616_c1 | 3300050516 | Bacteria | 1232 |
| 1041 | nmdc:mga0sz30_170913_c1 | 3300050516 | Bacteria | 964 |
| 1042 | Ga0495601_0000128 | 3300053077 | Bacteria | 42850 |
| 1043 | Ga0495601_0011860 | 3300053077 | Bacteria | 5225 |
| 1044 | Ga0495601_0020775 | 3300053077 | Bacteria | 4013 |
| 1045 | Ga0495601_0070486 | 3300053077 | Bacteria | 2231 |
| 1046 | Ga0495601_0071243 | 3300053077 | Bacteria | 2219 |
| 1047 | Ga0495612_0002217 | 3300053078 | Bacteria | 7992 |
| 1048 | Ga0495612_0009092 | 3300053078 | Bacteria | 4029 |
| 1049 | Ga0495595_0000976 | 3300053084 | Bacteria | 11021 |
| 1050 | Ga0495595_0003217 | 3300053084 | Bacteria | 6484 |
| 1051 | Ga0495595_0004577 | 3300053084 | Bacteria | 5562 |
| 1052 | Ga0495595_0011834 | 3300053084 | Bacteria | 3657 |
| 1053 | Ga0495595_0099156 | 3300053084 | Bacteria | 1405 |
| 1054 | Ga0495595_0102320 | 3300053084 | Bacteria | 1384 |
| 1055 | Ga0495595_0215650 | 3300053084 | Bacteria | 957 |
| 1056 | Ga0495619_0000016 | 3300053085 | Bacteria | 231442 |
| 1057 | Ga0495619_0000231 | 3300053085 | Bacteria | 40742 |
| 1058 | Ga0495619_0000252 | 3300053085 | Bacteria | 38976 |
| 1059 | Ga0495619_0011260 | 3300053085 | Bacteria | 5625 |
| 1060 | Ga0495619_0011414 | 3300053085 | Bacteria | 5594 |
| 1061 | Ga0495619_0016668 | 3300053085 | Bacteria | 4649 |
| 1062 | Ga0495619_0049308 | 3300053085 | Bacteria | 2776 |
| 1063 | Ga0495619_0136775 | 3300053085 | Bacteria | 1686 |
| 1064 | Ga0495619_0383660 | 3300053085 | Bacteria | 971 |
| 1065 | Ga0500578_0118419 | 3300053086 | Bacteria | 1666 |
| 1066 | Ga0500566_0058632 | 3300053094 | Bacteria | 2185 |
| 1067 | Ga0500569_235355 | 3300053109 | Bacteria | 622 |
| 1068 | Ga0500595_034410 | 3300053119 | Bacteria | 1675 |
| 1069 | Ga0500608_189135 | 3300053122 | Bacteria | 863 |
| 1070 | Ga0500616_0202446 | 3300053153 | Bacteria | 878 |
| 1071 | Ga0500622_0026738 | 3300053156 | Bacteria | 3043 |
| 1072 | Ga0500636_0002418 | 3300053177 | Bacteria | 10334 |
| 1073 | Ga0501084_0089085 | 3300054114 | Bacteria | 2590 |
| 1074 | Ga0501082_0216941 | 3300060353 | Bacteria | 1665 |
| 1075 | 2643758725 | 2643221547 | Bacteria | 4740017 |
| 1076 | 2739308458 | 2738543024 | Bacteria | 5603683 |
| 1077 | 2841915518 | 2841911363 | Bacteria | 6173697 |
| 1078 | 2841920720 | 2841917233 | Bacteria | 6173500 |
| 1079 | 2889918277 | 2889914905 | Bacteria | 5702301 |
| 1080 | Ga0265332_10212302 | |||
| 1081 | 2214544925 | |||
| 1082 | ARcpr5oldR_c000010 | |||
| 1083 | ARSoilYngRDRAFT_c00060 | |||
| 1084 | ARcpr5yngRDRAFT_c000016 | |||
| 1085 | ARSoilOldRDRAFT_c000011 | |||
| 1086 | ARCol0oldRDRAFT_c00012 | |||
| 1087 | ARCol0yngRDRAFT_1000018 | |||
| 1088 | JGI24032J14994_100108 | |||
| 1089 | JGI24741J21665_1013514 | |||
| 1090 | JGI24746J21847_1001357 | |||
| 1091 | JGI24747J21853_1000086 | |||
| 1092 | JGI24740J21852_10025886 | |||
| 1093 | JGI24739J22299_10000724 | |||
| 1094 | JGI24737J22298_10001113 | |||
| 1095 | JGI24750J21931_1000096 | |||
| 1096 | JGI24748J21848_1001964 | |||
| 1097 | JGI24738J21930_10000997 | |||
| 1098 | JGI24749J21850_1024770 | |||
| 1099 | JGI24744J21845_10000153 | |||
| 1100 | JGI24035J26624_1000660 | |||
| 1101 | JGI24034J26672_10000231 | |||
| 1102 | JGI24742J22300_10000137 | |||
| 1103 | JGI24751J29686_10013941 | |||
| 1104 | JGI25405J52794_10011519 | |||
| 1105 | Ga0065717_1002132 | |||
| 1106 | Ga0065704_10127429 | |||
| 1107 | Ga0065712_10011139 | |||
| 1108 | Ga0065712_10071510 | |||
| 1109 | Ga0065712_10082223 | |||
| 1110 | Ga0065715_10001079 | |||
| 1111 | Ga0065715_10008006 | |||
| 1112 | Ga0065707_10091944 | |||
| 1113 | Ga0070676_10000506 | |||
| 1114 | Ga0070683_100009453 | |||
| 1115 | Ga0070683_100120932 | |||
| 1116 | Ga0070690_100002629 | |||
| 1117 | Ga0070690_100005686 | |||
| 1118 | Ga0070670_100004573 | |||
| 1119 | Ga0070677_10000227 | |||
| 1120 | Ga0070677_10489552 | |||
| 1121 | Ga0068869_100001832 | |||
| 1122 | Ga0068869_100347149 | |||
| 1123 | Ga0070666_10025905 | |||
| 1124 | Ga0070666_10027715 | |||
| 1125 | Ga0070666_10161884 | |||
| 1126 | Ga0070666_10273376 | |||
| 1127 | Ga0070680_100003424 | |||
| 1128 | Ga0070680_100025759 | |||
| 1129 | Ga0070682_100001699 | |||
| 1130 | Ga0070682_100032433 | |||
| 1131 | Ga0070682_100207755 | |||
| 1132 | Ga0070682_100529188 | |||
| 1133 | Ga0068868_100007757 | |||
| 1134 | Ga0070660_100008125 | |||
| 1135 | Ga0070660_100145897 | |||
| 1136 | Ga0070660_100169729 | |||
| 1137 | Ga0070689_100000668 | |||
| 1138 | Ga0070689_100001841 | |||
| 1139 | Ga0070689_100297102 | |||
| 1140 | Ga0070689_100344038 | |||
| 1141 | Ga0070691_10014066 | |||
| 1142 | Ga0070691_10161599 | |||
| 1143 | Ga0070691_10293750 | |||
| 1144 | Ga0070687_100000527 | |||
| 1145 | Ga0070661_100003238 | |||
| 1146 | Ga0070661_100344664 | |||
| 1147 | Ga0070661_100373633 | |||
| 1148 | Ga0070692_10001083 | |||
| 1149 | Ga0070668_100003117 | |||
| 1150 | Ga0070668_100130887 | |||
| 1151 | Ga0070669_100001315 | |||
| 1152 | Ga0070675_100002954 | |||
| 1153 | Ga0070675_100015172 | |||
| 1154 | Ga0070675_100369657 | |||
| 1155 | Ga0070675_100720913 | |||
| 1156 | Ga0070671_100033121 | |||
| 1157 | Ga0070671_100035414 | |||
| 1158 | Ga0070674_100002968 | |||
| 1159 | Ga0070674_100720369 | |||
| 1160 | Ga0070673_100001477 | |||
| 1161 | Ga0070673_100101479 | |||
| 1162 | Ga0070688_100001239 | |||
| 1163 | Ga0070688_100006198 | |||
| 1164 | Ga0070688_100033995 | |||
| 1165 | Ga0070688_100162605 | |||
| 1166 | Ga0070659_100002622 | |||
| 1167 | Ga0070659_100015463 | |||
| 1168 | Ga0070659_100172634 | |||
| 1169 | Ga0070667_100005188 | |||
| 1170 | Ga0070667_100089585 | |||
| 1171 | Ga0070703_10006319 | |||
| 1172 | Ga0070703_10010223 | |||
| 1173 | Ga0070709_10108172 | |||
| 1174 | Ga0070709_10109350 | |||
| 1175 | Ga0070709_10532718 | |||
| 1176 | Ga0070714_100074400 | |||
| 1177 | Ga0070714_100132937 | |||
| 1178 | Ga0070714_100330733 | |||
| 1179 | Ga0070713_100248163 | |||
| 1180 | Ga0070713_100268476 | |||
| 1181 | Ga0070710_10018331 | |||
| 1182 | Ga0070710_10059094 | |||
| 1183 | Ga0070710_10091163 | |||
| 1184 | Ga0070701_10002283 | |||
| 1185 | Ga0070701_10008389 | |||
| 1186 | Ga0070711_100130116 | |||
| 1187 | Ga0070711_100206562 | |||
| 1188 | Ga0070705_100001458 | |||
| 1189 | Ga0070705_100018737 | |||
| 1190 | Ga0070705_100020503 | |||
| 1191 | Ga0070700_100001211 | |||
| 1192 | Ga0070700_100019152 | |||
| 1193 | Ga0070694_100001764 | |||
| 1194 | Ga0070694_100070014 | |||
| 1195 | Ga0070708_100023985 | |||
| 1196 | Ga0070708_100124631 | |||
| 1197 | Ga0070663_100000761 | |||
| 1198 | Ga0070663_100038492 | |||
| 1199 | Ga0070663_100107071 | |||
| 1200 | Ga0070663_100230715 | |||
| 1201 | Ga0070663_100620418 | |||
| 1202 | Ga0070678_100000525 | |||
| 1203 | Ga0070678_100125575 | |||
| 1204 | Ga0070678_100375734 | |||
| 1205 | Ga0070662_100002968 | |||
| 1206 | Ga0070662_100050510 | |||
| 1207 | Ga0070662_100072657 | |||
| 1208 | Ga0070681_10004977 | |||
| 1209 | Ga0070681_10220689 | |||
| 1210 | Ga0070681_10221180 | |||
| 1211 | Ga0070681_10410226 | |||
| 1212 | Ga0070681_10805059 | |||
| 1213 | Ga0070681_10905305 | |||
| 1214 | Ga0068867_100002950 | |||
| 1215 | Ga0068867_100092156 | |||
| 1216 | Ga0070685_10004716 | |||
| 1217 | Ga0070685_10025023 | |||
| 1218 | Ga0070685_10027875 | |||
| 1219 | Ga0070707_100517710 | |||
| 1220 | Ga0070698_100584318 | |||
| 1221 | Ga0070679_100015045 | |||
| 1222 | Ga0070679_100315891 | |||
| 1223 | Ga0070684_100005941 | |||
| 1224 | Ga0070684_100019299 | |||
| 1225 | Ga0070684_100034783 | |||
| 1226 | Ga0070697_100467633 | |||
| 1227 | Ga0068853_100003070 | |||
| 1228 | Ga0068853_100050832 | |||
| 1229 | Ga0068853_100594036 | |||
| 1230 | Ga0070672_100002960 | |||
| 1231 | Ga0070672_100339281 | |||
| 1232 | Ga0070686_100001573 | |||
| 1233 | Ga0070686_100008797 | |||
| 1234 | Ga0070686_100065168 | |||
| 1235 | Ga0070686_100222585 | |||
| 1236 | Ga0070695_100002369 | |||
| 1237 | Ga0070695_100014478 | |||
| 1238 | Ga0070696_100016306 | |||
| 1239 | Ga0070696_100021005 | |||
| 1240 | Ga0070696_100029021 | |||
| 1241 | Ga0070693_100000880 | |||
| 1242 | Ga0070704_100001917 | |||
| 1243 | Ga0070704_100031811 | |||
| 1244 | Ga0068855_100009051 | |||
| 1245 | Ga0070664_100002934 | |||
| 1246 | Ga0070664_100020499 | |||
| 1247 | Ga0070664_100660809 | |||
| 1248 | Ga0068857_100000358 | |||
| 1249 | Ga0068857_100086207 | |||
| 1250 | Ga0068854_100007075 | |||
| 1251 | Ga0068856_100045885 | |||
| 1252 | Ga0068856_100161948 | |||
| 1253 | Ga0070702_100000526 | |||
| 1254 | Ga0070702_100308500 | |||
| 1255 | Ga0068852_100009893 | |||
| 1256 | Ga0068859_100005591 | |||
| 1257 | Ga0068859_100038332 | |||
| 1258 | Ga0068859_100065369 | |||
| 1259 | Ga0068859_101334038 | |||
| 1260 | Ga0068864_100001988 | |||
| 1261 | Ga0068864_100783779 | |||
| 1262 | Ga0068866_10000916 | |||
| 1263 | Ga0068866_10161547 | |||
| 1264 | Ga0068866_10197133 | |||
| 1265 | Ga0068861_100001805 | |||
| 1266 | Ga0068861_100011624 | |||
| 1267 | Ga0068861_101009703 | |||
| 1268 | Ga0068870_10000025 | |||
| 1269 | Ga0068870_10135764 | |||
| 1270 | Ga0068863_100002964 | |||
| 1271 | Ga0068863_100185951 | |||
| 1272 | Ga0068863_100460690 | |||
| 1273 | Ga0068858_100003227 | |||
| 1274 | Ga0068858_100099681 | |||
| 1275 | Ga0068858_100343073 | |||
| 1276 | Ga0068860_100007120 | |||
| 1277 | Ga0068860_100060928 | |||
| 1278 | Ga0068860_100180869 | |||
| 1279 | Ga0068862_100011988 | |||
| 1280 | Ga0068862_100032289 | |||
| 1281 | Ga0081455_10002463 | |||
| 1282 | Ga0081455_10012779 | |||
| 1283 | Ga0081455_10020122 | |||
| 1284 | Ga0081455_10188085 | |||
| 1285 | Ga0070717_10074409 | |||
| 1286 | Ga0070717_10236183 | |||
| 1287 | Ga0070717_11465233 | |||
| 1288 | Ga0075432_10004844 | |||
| 1289 | Ga0075432_10011268 | |||
| 1290 | Ga0070715_10030799 | |||
| 1291 | Ga0070716_100127591 | |||
| 1292 | Ga0070716_100255281 | |||
| 1293 | Ga0070712_100022909 | |||
| 1294 | Ga0070712_100082682 | |||
| 1295 | Ga0070712_100396740 | |||
| 1296 | Ga0075367_10081426 | |||
| 1297 | Ga0075427_10000109 | |||
| 1298 | Ga0097621_100000456 | |||
| 1299 | Ga0097621_100010034 | |||
| 1300 | Ga0097621_100150100 | |||
| 1301 | Ga0068871_100000269 | |||
| 1302 | Ga0068871_100290885 | |||
| 1303 | Ga0068871_100883976 | |||
| 1304 | Ga0075430_100000094 | |||
| 1305 | Ga0075431_100002169 | |||
| 1306 | Ga0075433_10001242 | |||
| 1307 | Ga0075433_10021666 | |||
| 1308 | Ga0075433_10037552 | |||
| 1309 | Ga0075433_10324029 | |||
| 1310 | Ga0075434_100000299 | |||
| 1311 | Ga0075434_100011399 | |||
| 1312 | Ga0075434_100022390 | |||
| 1313 | Ga0075434_100211482 | |||
| 1314 | Ga0075434_100351544 | |||
| 1315 | Ga0075429_100002930 | |||
| 1316 | Ga0068865_100001731 | |||
| 1317 | Ga0068865_100054063 | |||
| 1318 | Ga0068865_100055301 | |||
| 1319 | Ga0075436_100390243 | |||
| 1320 | Ga0097620_100005590 | |||
| 1321 | Ga0097620_100038332 | |||
| 1322 | Ga0097620_100065370 | |||
| 1323 | Ga0097620_101333829 | |||
| 1324 | Ga0075435_100023116 | |||
| 1325 | Ga0075435_100047923 | |||
| 1326 | Ga0075435_100276152 | |||
| 1327 | Ga0075435_100289239 | |||
| 1328 | Ga0075435_100593923 | |||
| 1329 | Ga0105244_10023092 | |||
| 1330 | Ga0105240_10024320 | |||
| 1331 | Ga0105240_10582449 | |||
| 1332 | Ga0105240_11282096 | |||
| 1333 | Ga0111539_10003217 | |||
| 1334 | Ga0111539_10003331 | |||
| 1335 | Ga0111539_10007321 | |||
| 1336 | Ga0111539_10076769 | |||
| 1337 | Ga0105245_10000183 | |||
| 1338 | Ga0105245_10088559 | |||
| 1339 | Ga0105245_10882646 | |||
| 1340 | Ga0105247_10210490 | |||
| 1341 | Ga0105247_10225672 | |||
| 1342 | Ga0114129_10001218 | |||
| 1343 | Ga0114129_10002246 | |||
| 1344 | Ga0114129_10866549 | |||
| 1345 | Ga0105243_10001561 | |||
| 1346 | Ga0105243_10100210 | |||
| 1347 | Ga0105243_10171621 | |||
| 1348 | Ga0105241_10003567 | |||
| 1349 | Ga0105241_10063456 | |||
| 1350 | Ga0105241_10203232 | |||
| 1351 | Ga0105241_10338921 | |||
| 1352 | Ga0105242_10000701 | |||
| 1353 | Ga0105242_10006507 | |||
| 1354 | Ga0105242_10033043 | |||
| 1355 | Ga0105248_10006263 | |||
| 1356 | Ga0105248_10010394 | |||
| 1357 | Ga0105248_10040556 | |||
| 1358 | Ga0105248_10153094 | |||
| 1359 | Ga0105248_10424133 | |||
| 1360 | Ga0105248_10719629 | |||
| 1361 | Ga0105237_10010897 | |||
| 1362 | Ga0105237_10125419 | |||
| 1363 | Ga0105237_10150914 | |||
| 1364 | Ga0105237_10650127 | |||
| 1365 | Ga0105237_10822676 | |||
| 1366 | Ga0105238_11051622 | |||
| 1367 | Ga0105249_10009795 | |||
| 1368 | Ga0105249_10124718 | |||
| 1369 | Ga0105249_10190361 | |||
| 1370 | Ga0105239_10007315 | |||
| 1371 | Ga0105239_10054653 | |||
| 1372 | Ga0105239_10169366 | |||
| 1373 | Ga0105246_10002447 | |||
| 1374 | Ga0105246_10049961 | |||
| 1375 | Ga0105246_10528029 | |||
| 1376 | Ga0105246_10555642 | |||
| 1377 | Ga0157321_1002428 | |||
| 1378 | Ga0157335_1000784 | |||
| 1379 | Ga0157342_1002072 | |||
| 1380 | Ga0157373_10017762 | |||
| 1381 | Ga0157373_10237996 | |||
| 1382 | Ga0157371_10018807 | |||
| 1383 | Ga0157370_10175628 | |||
| 1384 | Ga0157370_10292424 | |||
| 1385 | Ga0157370_10739344 | |||
| 1386 | Ga0157369_10449243 | |||
| 1387 | Ga0157374_10000463 | |||
| 1388 | Ga0157374_10145086 | |||
| 1389 | Ga0157378_10000613 | |||
| 1390 | Ga0157378_10139508 | |||
| 1391 | Ga0157378_10407146 | |||
| 1392 | Ga0163162_10005908 | |||
| 1393 | Ga0163162_10020966 | |||
| 1394 | Ga0163162_10210444 | |||
| 1395 | Ga0163162_10492272 | |||
| 1396 | Ga0163162_11082860 | |||
| 1397 | Ga0163162_11834567 | |||
| 1398 | Ga0157372_10010921 | |||
| 1399 | Ga0157372_10219504 | |||
| 1400 | Ga0157372_10843730 | |||
| 1401 | Ga0157375_10004786 | |||
| 1402 | Ga0157375_10250000 | |||
| 1403 | Ga0157375_10791497 | |||
| 1404 | Ga0157375_11065711 | |||
| 1405 | Ga0163163_10001239 | |||
| 1406 | Ga0163163_10035378 | |||
| 1407 | Ga0163163_10548246 | |||
| 1408 | Ga0157380_10004641 | |||
| 1409 | Ga0182008_10065920 | |||
| 1410 | Ga0157377_10000358 | |||
| 1411 | Ga0157377_10160273 | |||
| 1412 | Ga0157377_10731243 | |||
| 1413 | Ga0157379_10003902 | |||
| 1414 | Ga0157379_10073473 | |||
| 1415 | Ga0157379_10111692 | |||
| 1416 | Ga0157376_10003730 | |||
| 1417 | Ga0157376_10117525 | |||
| 1418 | Ga0157376_10309774 | |||
| 1419 | Ga0157376_10628833 | |||
| 1420 | Ga0163161_10001492 | |||
| 1421 | Ga0207666_1000140 | |||
| 1422 | Ga0207666_1000838 | |||
| 1423 | Ga0207673_1000039 | |||
| 1424 | Ga0207697_10000763 | |||
| 1425 | Ga0207697_10015702 | |||
| 1426 | Ga0207653_10001778 | |||
| 1427 | Ga0207653_10004542 | |||
| 1428 | Ga0207682_10000062 | |||
| 1429 | Ga0207692_10009135 | |||
| 1430 | Ga0207692_10027325 | |||
| 1431 | Ga0207692_10063538 | |||
| 1432 | Ga0207642_10002089 | |||
| 1433 | Ga0207642_10037083 | |||
| 1434 | Ga0207642_10291787 | |||
| 1435 | Ga0207710_10010626 | |||
| 1436 | Ga0207710_10016965 | |||
| 1437 | Ga0207688_10001992 | |||
| 1438 | Ga0207688_10023221 | |||
| 1439 | Ga0207680_10000740 | |||
| 1440 | Ga0207680_10028054 | |||
| 1441 | Ga0207680_10057899 | |||
| 1442 | Ga0207647_10003504 | |||
| 1443 | Ga0207647_10008790 | |||
| 1444 | Ga0207699_10052537 | |||
| 1445 | Ga0207699_10074353 | |||
| 1446 | Ga0207699_10076009 | |||
| 1447 | Ga0207645_10000248 | |||
| 1448 | Ga0207643_10000064 | |||
| 1449 | Ga0207643_10200940 | |||
| 1450 | Ga0207654_10001623 | |||
| 1451 | Ga0207654_10055710 | |||
| 1452 | Ga0207654_10109549 | |||
| 1453 | Ga0207707_10002084 | |||
| 1454 | Ga0207707_10276060 | |||
| 1455 | Ga0207695_10387313 | |||
| 1456 | Ga0207695_10424328 | |||
| 1457 | Ga0207671_10007347 | |||
| 1458 | Ga0207671_10016982 | |||
| 1459 | Ga0207693_10015019 | |||
| 1460 | Ga0207693_10016146 | |||
| 1461 | Ga0207693_10031012 | |||
| 1462 | Ga0207693_10050174 | |||
| 1463 | Ga0207663_10033406 | |||
| 1464 | Ga0207660_10000194 | |||
| 1465 | Ga0207660_10020931 | |||
| 1466 | Ga0207660_10387402 | |||
| 1467 | Ga0207662_10001637 | |||
| 1468 | Ga0207662_10012055 | |||
| 1469 | Ga0207657_10006919 | |||
| 1470 | Ga0207657_10103323 | |||
| 1471 | Ga0207657_10126273 | |||
| 1472 | Ga0207657_10146132 | |||
| 1473 | Ga0207649_10000234 | |||
| 1474 | Ga0207649_10195825 | |||
| 1475 | Ga0207649_10259803 | |||
| 1476 | Ga0207652_10001613 | |||
| 1477 | Ga0207652_10002210 | |||
| 1478 | Ga0207652_10033371 | |||
| 1479 | Ga0207652_10108802 | |||
| 1480 | Ga0207652_10248611 | |||
| 1481 | Ga0207646_10161302 | |||
| 1482 | Ga0207681_10000794 | |||
| 1483 | Ga0207650_10010580 | |||
| 1484 | Ga0207650_10174661 | |||
| 1485 | Ga0207659_10000172 | |||
| 1486 | Ga0207659_10130264 | |||
| 1487 | Ga0207659_10611563 | |||
| 1488 | Ga0207687_10008699 | |||
| 1489 | Ga0207687_10018894 | |||
| 1490 | Ga0207687_10158696 | |||
| 1491 | Ga0207700_10339698 | |||
| 1492 | Ga0207700_10459064 | |||
| 1493 | Ga0207700_11199531 | |||
| 1494 | Ga0207664_10011995 | |||
| 1495 | Ga0207664_10259341 | |||
| 1496 | Ga0207664_10260833 | |||
| 1497 | Ga0207644_10000439 | |||
| 1498 | Ga0207644_10041647 | |||
| 1499 | Ga0207644_10050000 | |||
| 1500 | Ga0207690_10000796 | |||
| 1501 | Ga0207690_10013199 | |||
| 1502 | Ga0207690_10260751 | |||
| 1503 | Ga0207706_10005059 | |||
| 1504 | Ga0207706_10031628 | |||
| 1505 | Ga0207706_10032340 | |||
| 1506 | Ga0207706_10230288 | |||
| 1507 | Ga0207686_10001093 | |||
| 1508 | Ga0207686_10028444 | |||
| 1509 | Ga0207686_10058609 | |||
| 1510 | Ga0207686_10227163 | |||
| 1511 | Ga0207709_10001438 | |||
| 1512 | Ga0207709_10012223 | |||
| 1513 | Ga0207709_10038752 | |||
| 1514 | Ga0207670_10000608 | |||
| 1515 | Ga0207670_10000807 | |||
| 1516 | Ga0207670_10104914 | |||
| 1517 | Ga0207670_10412987 | |||
| 1518 | Ga0207669_10000141 | |||
| 1519 | Ga0207669_10211782 | |||
| 1520 | Ga0207704_10000755 | |||
| 1521 | Ga0207704_10019206 | |||
| 1522 | Ga0207704_10022632 | |||
| 1523 | Ga0207704_10286088 | |||
| 1524 | Ga0207665_10003066 | |||
| 1525 | Ga0207665_10034796 | |||
| 1526 | Ga0207665_10372956 | |||
| 1527 | Ga0207665_10495413 | |||
| 1528 | Ga0207691_10006997 | |||
| 1529 | Ga0207691_10221408 | |||
| 1530 | Ga0207691_10371733 | |||
| 1531 | Ga0207711_10003636 | |||
| 1532 | Ga0207711_10004836 | |||
| 1533 | Ga0207711_10006747 | |||
| 1534 | Ga0207711_10089790 | |||
| 1535 | Ga0207711_10241018 | |||
| 1536 | Ga0207689_10004430 | |||
| 1537 | Ga0207689_10122069 | |||
| 1538 | Ga0207689_10239138 | |||
| 1539 | Ga0207689_11094343 | |||
| 1540 | Ga0207661_10000098 | |||
| 1541 | Ga0207661_10096962 | |||
| 1542 | Ga0207679_10000174 | |||
| 1543 | Ga0207679_10021341 | |||
| 1544 | Ga0207679_10620957 | |||
| 1545 | Ga0207679_10925973 | |||
| 1546 | Ga0207679_11052426 | |||
| 1547 | Ga0207667_10004743 | |||
| 1548 | Ga0207651_10000782 | |||
| 1549 | Ga0207651_10002999 | |||
| 1550 | Ga0207651_10233029 | |||
| 1551 | Ga0207712_10000659 | |||
| 1552 | Ga0207712_10039876 | |||
| 1553 | Ga0207712_10332225 | |||
| 1554 | Ga0207668_10001107 | |||
| 1555 | Ga0207668_10012828 | |||
| 1556 | Ga0207640_10000846 | |||
| 1557 | Ga0207658_10001843 | |||
| 1558 | Ga0207658_10123524 | |||
| 1559 | Ga0207658_10154750 | |||
| 1560 | Ga0207658_10191697 | |||
| 1561 | Ga0207677_10101282 | |||
| 1562 | Ga0207677_10348421 | |||
| 1563 | Ga0207703_10002433 | |||
| 1564 | Ga0207703_10006706 | |||
| 1565 | Ga0207703_10043948 | |||
| 1566 | Ga0207703_10306701 | |||
| 1567 | Ga0207703_10398746 | |||
| 1568 | Ga0207703_11506208 | |||
| 1569 | Ga0207639_10001774 | |||
| 1570 | Ga0207639_10388798 | |||
| 1571 | Ga0207678_10001059 | |||
| 1572 | Ga0207678_10006214 | |||
| 1573 | Ga0207678_10030636 | |||
| 1574 | Ga0207678_10082021 | |||
| 1575 | Ga0207678_10406356 | |||
| 1576 | Ga0207708_10002793 | |||
| 1577 | Ga0207708_10020046 | |||
| 1578 | Ga0207702_10014464 | |||
| 1579 | Ga0207702_10041934 | |||
| 1580 | Ga0207702_10169832 | |||
| 1581 | Ga0207641_10000622 | |||
| 1582 | Ga0207641_10640641 | |||
| 1583 | Ga0207648_10009300 | |||
| 1584 | Ga0207648_10062170 | |||
| 1585 | Ga0207648_10735065 | |||
| 1586 | Ga0207676_10002696 | |||
| 1587 | Ga0207676_10231674 | |||
| 1588 | Ga0207676_10347863 | |||
| 1589 | Ga0207674_10001342 | |||
| 1590 | Ga0207674_10036947 | |||
| 1591 | Ga0207675_100006706 | |||
| 1592 | Ga0207675_100011711 | |||
| 1593 | Ga0207683_10001193 | |||
| 1594 | Ga0207683_10024887 | |||
| 1595 | Ga0207683_10027481 | |||
| 1596 | Ga0207683_10054787 | |||
| 1597 | Ga0207698_10007867 | |||
| 1598 | Ga0209996_1014069 | |||
| 1599 | Ga0209970_1008074 | |||
| 1600 | Ga0210002_1000401 | |||
| 1601 | Ga0209983_1007094 | |||
| 1602 | Ga0209971_1007630 | |||
| 1603 | Ga0209966_1001072 | |||
| 1604 | Ga0209998_10001333 | |||
| 1605 | Ga0209998_10001362 | |||
| 1606 | Ga0209974_10115781 | |||
| 1607 | Ga0207428_10000513 | |||
| 1608 | Ga0207428_10000626 | |||
| 1609 | Ga0207428_10001020 | |||
| 1610 | Ga0268265_10002370 | |||
| 1611 | Ga0268265_10014719 | |||
| 1612 | Ga0268264_10004444 | |||
| 1613 | Ga0268264_10188687 | |||
| 1614 | Ga0265337_1009173 | |||
| 1615 | Ga0307515_10339874 | |||
| 1616 | Ga0265338_10462939 | |||
| 1617 | Ga0265325_10007153 | |||
| 1618 | Ga0265325_10012441 | |||
| 1619 | Ga0265325_10017987 | |||
| 1620 | Ga0265325_10029347 | |||
| 1621 | Ga0265339_10032503 | |||
| 1622 | Ga0265331_10086462 | |||
| 1623 | Ga0265316_10386059 | |||
| 1624 | Ga0307513_10645055 | |||
| 1625 | Ga0307408_100964926 | |||
| 1626 | Ga0265313_10000525 | |||
| 1627 | Ga0265313_10008290 | |||
| 1628 | Ga0265313_10016157 | |||
| 1629 | Ga0265313_10107984 | |||
| 1630 | Ga0265313_10164418 | |||
| 1631 | Ga0316579_10068836 | |||
| 1632 | Ga0265314_10006316 | |||
| 1633 | Ga0307409_101365069 | |||
| 1634 | Ga0307415_100958170 | |||
| 1635 | Ga0373948_0000049 | |||
| 1636 | Ga0373948_0014293 | |||
| 1637 | Ga0373948_0056125 | |||
| 1638 | Ga0373950_0000665 | |||
| 1639 | Ga0373950_0001094 | |||
| 1640 | Ga0373958_0000026 | |||
| 1641 | Ga0373958_0000135 | |||
| 1642 | Ga0373958_0004984 | |||
| 1643 | Ga0373958_0028965 | |||
| 1644 | Ga0373958_0085299 | |||
| 1645 | Ga0373959_0001171 | |||
| 1646 | Ga0373938_0000133 | |||
| 1647 | Ga0373938_0000538 | |||
| 1648 | Ga0373938_0003284 | |||
| 1649 | Ga0373928_0001408 | |||
| 1650 | Ga0373929_0000110 | |||
| 1651 | Ga0373934_0030387 | |||
| 1652 | Ga0373940_0001333 | |||
| 1653 | Ga0373940_0002247 | |||
| 1654 | Ga0373944_0110061 | |||
| 1655 | Ga0373944_0153535 | |||
| 1656 | Ga0373949_0000771 | |||
| 1657 | Ga0373949_0001010 | |||
| 1658 | Ga0373949_0009925 | |||
| 1659 | Ga0373949_0110874 | |||
| 1660 | Ga0373949_0163103 | |||
| 1661 | Ga0373951_0001038 | |||
| 1662 | Ga0373951_0002914 | |||
| 1663 | Ga0373951_0003615 | |||
| 1664 | Ga0373951_0033003 | |||
| 1665 | Ga0373952_0000200 | |||
| 1666 | Ga0373952_0000271 | |||
| 1667 | Ga0373952_0002332 | |||
| 1668 | Ga0373923_0059044 | |||
| 1669 | Ga0373923_0098540 | |||
| 1670 | Ga0373923_0278883 | |||
| 1671 | Ga0373932_0000822 | |||
| 1672 | Ga0373932_0001180 | |||
| 1673 | Ga0373932_0008434 | |||
| 1674 | Ga0373932_0011585 | |||
| 1675 | Ga0373936_0002908 | |||
| 1676 | Ga0373939_0003897 | |||
| 1677 | Ga0373939_0004068 | |||
| 1678 | Ga0373939_0005157 | |||
| 1679 | Ga0373941_0000259 | |||
| 1680 | Ga0373941_0000952 | |||
| 1681 | Ga0373941_0006275 | |||
| 1682 | Ga0373945_0002980 | |||
| 1683 | Ga0373945_0017410 | |||
| 1684 | Ga0373953_0026413 | |||
| 1685 | Ga0373953_0078767 | |||
| 1686 | Ga0373954_0001844 | |||
| 1687 | Ga0373954_0004126 | |||
| 1688 | Ga0373956_0001114 | |||
| 1689 | Ga0373956_0013063 | |||
| 1690 | Ga0373956_0040689 | |||
| 1691 | Ga0373957_0001424 | |||
| 1692 | Ga0373957_0010241 | |||
| 1693 | Ga0373957_0017200 | |||
| 1694 | Ga0373960_0000277 | |||
| 1695 | Ga0373960_0001175 | |||
| 1696 | Ga0373943_0000267 | |||
| 1697 | Ga0373943_0005699 | |||
| 1698 | Ga0373943_0007845 | |||
| 1699 | Ga0373943_0453324 | |||
| 1700 | Ga0373943_0464868 | |||
| 1701 | Ga0373946_0006942 | |||
| 1702 | Ga0373946_0010659 | |||
| 1703 | Ga0373946_0302123 | |||
| 1704 | Ga0373955_0005446 | |||
| 1705 | Ga0373955_0027080 | |||
| 1706 | Ga0373955_0092033 | |||
| 1707 | Ga0373942_0000533 | |||
| 1708 | Ga0373942_0007137 | |||
| 1709 | Ga0373942_0040070 | |||
| 1710 | Ga0373942_0152320 | |||
| 1711 | Ga0373961_0001383 | |||
| 1712 | Ga0373961_0001598 | |||
| 1713 | Ga0373961_0046126 | |||
| 1714 | Ga0373962_0000275 | |||
| 1715 | Ga0373962_0001638 | |||
| 1716 | Ga0373962_0018817 | |||
| 1717 | Ga0373962_0039498 | |||
| 1718 | Ga0373931_0002417 | |||
| 1719 | Ga0373931_0004020 | |||
| 1720 | Ga0373931_0007842 | |||
| 1721 | Ga0373931_0100883 | |||
| 1722 | Ga0373931_0515845 | |||
| 1723 | Ga0373935_0001440 | |||
| 1724 | Ga0373935_0001725 | |||
| 1725 | Ga0373927_0002318 | |||
| 1726 | Ga0373927_0008373 | |||
| 1727 | Ga0373927_0016357 | |||
| 1728 | Ga0373927_0053503 | |||
| 1729 | Ga0373927_0209104 | |||
| 1730 | Ga0373933_0003523 | |||
| 1731 | Ga0373933_0022799 | |||
| 1732 | Ga0373933_0041923 | |||
| 1733 | Ga0373933_0143952 | |||
| 1734 | Ga0373933_0607407 | |||
| 1735 | Ga0373947_0001425 | |||
| 1736 | Ga0373947_0138212 | |||
| 1737 | Ga0373947_0143833 | |||
| 1738 | Ga0373947_0303149 | |||
| 1739 | Ga0373937_0004926 | |||
| 1740 | Ga0373937_0012806 | |||
| 1741 | Ga0373937_0021169 | |||
| 1742 | Ga0373937_0055967 | |||
| 1743 | Ga0373937_0096606 | |||
| 1744 | Ga0373937_0144215 | |||
| 1745 | Ga0373937_0293079 | |||
| 1746 | Ga0373937_0630658 | |||
| 1747 | Ga0373937_1008473 | |||
| 1748 | Ga0373937_1685113 | |||
| 1749 | Ga0373925_0001642 | |||
| 1750 | Ga0373925_0015058 | |||
| 1751 | Ga0373925_0116048 | |||
| 1752 | Ga0373925_0149194 | |||
| 1753 | Ga0395900_0001475 | |||
| 1754 | Ga0395900_0071587 | |||
| 1755 | Ga0395900_0391293 | |||
| 1756 | Ga0395898_0057650 | |||
| 1757 | Ga0395898_0074306 | |||
| 1758 | Ga0395898_1295201 | |||
| 1759 | Ga0395901_0023603 | |||
| 1760 | Ga0395901_0098684 | |||
| 1761 | Ga0436365_1111585 | |||
| 1762 | Ga0439465_0119165 | |||
| 1763 | Ga0451839_1007098 | |||
| 1764 | Ga0451843_1140181 | |||
| 1765 | Ga0439459_0040327 | |||
| 1766 | Ga0450893_0059057 | |||
| 1767 | Ga0451577_0074007 | |||
| 1768 | Ga0466963_0415975 | |||
| 1769 | Ga0466964_0233612 | |||
| 1770 | Ga0453684_0077244 | |||
| 1771 | Ga0466957_0282360 | |||
| 1772 | Ga0466959_0090698 | |||
| 1773 | Ga0451576_0013587 | |||
| 1774 | Ga0466967_0804417 | |||
| 1775 | Ga0495617_006700 | |||
| 1776 | Ga0495592_0001131 | |||
| 1777 | Ga0495592_0007618 | |||
| 1778 | Ga0495592_0012894 | |||
| 1779 | Ga0495592_0114193 | |||
| 1780 | Ga0495603_0034243 | |||
| 1781 | Ga0495629_0000748 | |||
| 1782 | Ga0495629_0386423 | |||
| 1783 | Ga0495638_0021650 | |||
| 1784 | Ga0495641_0023167 | |||
| 1785 | Ga0495641_0025462 | |||
| 1786 | Ga0495651_0131592 | |||
| 1787 | Ga0495651_0148077 | |||
| 1788 | Ga0495651_0165626 | |||
| 1789 | Ga0495653_0006076 | |||
| 1790 | Ga0495653_0151260 | |||
| 1791 | Ga0495653_0178772 | |||
| 1792 | Ga0495653_0318976 | |||
| 1793 | Ga0495580_0027411 | |||
| 1794 | Ga0495580_0132890 | |||
| 1795 | Ga0495582_0020868 | |||
| 1796 | Ga0495582_0061501 | |||
| 1797 | Ga0495639_0005351 | |||
| 1798 | Ga0495639_0012936 | |||
| 1799 | Ga0495662_0159630 | |||
| 1800 | Ga0495662_0328264 | |||
| 1801 | Ga0495664_0038492 | |||
| 1802 | Ga0495664_0130634 | |||
| 1803 | Ga0495664_0195979 | |||
| 1804 | Ga0495584_0035359 | |||
| 1805 | Ga0495585_0000546 | |||
| 1806 | Ga0495594_0012140 | |||
| 1807 | Ga0495594_0034883 | |||
| 1808 | Ga0495594_0132898 | |||
| 1809 | Ga0495607_0002967 | |||
| 1810 | Ga0495608_0000557 | |||
| 1811 | Ga0495608_0009270 | |||
| 1812 | Ga0495608_0140150 | |||
| 1813 | Ga0495608_0311387 | |||
| 1814 | Ga0495618_0014639 | |||
| 1815 | Ga0495618_0017294 | |||
| 1816 | Ga0495618_0036560 | |||
| 1817 | Ga0495618_0092002 | |||
| 1818 | Ga0495628_0061817 | |||
| 1819 | Ga0495628_0148926 | |||
| 1820 | Ga0495630_0007320 | |||
| 1821 | Ga0495630_0114341 | |||
| 1822 | Ga0495630_0307506 | |||
| 1823 | Ga0495631_0018545 | |||
| 1824 | Ga0495644_0014751 | |||
| 1825 | Ga0495666_0012431 | |||
| 1826 | Ga0495666_0024785 | |||
| 1827 | Ga0495666_0027064 | |||
| 1828 | Ga0495652_0019278 | |||
| 1829 | Ga0495652_0229583 | |||
| 1830 | Ga0495665_0026242 | |||
| 1831 | Ga0495665_0196386 | |||
| 1832 | Ga0495640_0006625 | |||
| 1833 | Ga0495640_0283421 | |||
| 1834 | Ga0495640_0311360 | |||
| 1835 | Ga0495586_0004986 | |||
| 1836 | Ga0495586_0053932 | |||
| 1837 | Ga0495587_0004155 | |||
| 1838 | Ga0495587_0014061 | |||
| 1839 | Ga0495587_0027416 | |||
| 1840 | Ga0495598_0022225 | |||
| 1841 | Ga0495621_0056148 | |||
| 1842 | Ga0495645_0007749 | |||
| 1843 | Ga0495645_0062950 | |||
| 1844 | Ga0495645_0084739 | |||
| 1845 | Ga0495622_0008152 | |||
| 1846 | Ga0495633_0008413 | |||
| 1847 | Ga0495667_0001194 | |||
| 1848 | Ga0495667_0002899 | |||
| 1849 | Ga0495667_0009830 | |||
| 1850 | Ga0495667_0030978 | |||
| 1851 | Ga0495656_0282358 | |||
| 1852 | Ga0495634_0022647 | |||
| 1853 | Ga0495634_0084280 | |||
| 1854 | Ga0495634_0129488 | |||
| 1855 | Ga0495635_0019672 | |||
| 1856 | Ga0495635_0091251 | |||
| 1857 | Ga0495635_0141048 | |||
| 1858 | Ga0495635_0314070 | |||
| 1859 | Ga0495659_0000633 | |||
| 1860 | Ga0495588_0144505 | |||
| 1861 | Ga0495657_0040922 | |||
| 1862 | Ga0495657_0041424 | |||
| 1863 | Ga0495599_0001663 | |||
| 1864 | Ga0495599_0017327 | |||
| 1865 | Ga0495623_0001616 | |||
| 1866 | Ga0495623_0007933 | |||
| 1867 | Ga0495646_0003032 | |||
| 1868 | Ga0495646_0005955 | |||
| 1869 | Ga0495646_0116695 | |||
| 1870 | Ga0495647_0000453 | |||
| 1871 | Ga0495647_0004002 | |||
| 1872 | Ga0495647_0008665 | |||
| 1873 | Ga0495647_0091397 | |||
| 1874 | Ga0495658_0001515 | |||
| 1875 | Ga0495658_0003288 | |||
| 1876 | Ga0495669_0077930 | |||
| 1877 | Ga0495613_0063175 | |||
| 1878 | Ga0495613_0169781 | |||
| 1879 | Ga0495613_0287942 | |||
| 1880 | Ga0495624_0002572 | |||
| 1881 | Ga0495624_0010998 | |||
| 1882 | Ga0495624_0139800 | |||
| 1883 | Ga0495600_0002049 | |||
| 1884 | Ga0495600_0011556 | |||
| 1885 | Ga0495581_0055265 | |||
| 1886 | Ga0495581_0063230 | |||
| 1887 | Ga0495604_0001274 | |||
| 1888 | Ga0495604_0003734 | |||
| 1889 | Ga0495604_0018396 | |||
| 1890 | Ga0495674_0016969 | |||
| 1891 | Ga0495674_0079579 | |||
| 1892 | Ga0495674_0125471 | |||
| 1893 | Ga0495674_0171607 | |||
| 1894 | Ga0495676_0027741 | |||
| 1895 | Ga0495676_0065631 | |||
| 1896 | Ga0495676_0148043 | |||
| 1897 | Ga0495676_0372758 | |||
| 1898 | Ga0495680_0006572 | |||
| 1899 | Ga0495680_0008513 | |||
| 1900 | Ga0495680_0012421 | |||
| 1901 | Ga0495680_0036047 | |||
| 1902 | Ga0495680_0039455 | |||
| 1903 | Ga0495680_0061841 | |||
| 1904 | Ga0495675_0000740 | |||
| 1905 | Ga0495675_0005699 | |||
| 1906 | Ga0495675_0010997 | |||
| 1907 | Ga0495684_0004959 | |||
| 1908 | Ga0495684_0034085 | |||
| 1909 | Ga0495684_0169551 | |||
| 1910 | Ga0495684_0199773 | |||
| 1911 | Ga0495684_0234651 | |||
| 1912 | Ga0495593_0006602 | |||
| 1913 | Ga0495593_0021323 | |||
| 1914 | Ga0495593_0048086 | |||
| 1915 | Ga0495602_0002218 | |||
| 1916 | Ga0495602_0051357 | |||
| 1917 | Ga0495602_0054723 | |||
| 1918 | Ga0495602_0076279 | |||
| 1919 | Ga0495614_0180128 | |||
| 1920 | Ga0495614_0425799 | |||
| 1921 | Ga0496100_0000447 | |||
| 1922 | Ga0496100_0000501 | |||
| 1923 | Ga0496100_0018638 | |||
| 1924 | Ga0496100_0080583 | |||
| 1925 | Ga0496100_0749709 | |||
| 1926 | Ga0496101_0001349 | |||
| 1927 | Ga0496101_0005470 | |||
| 1928 | Ga0496101_0039625 | |||
| 1929 | Ga0496102_0002354 | |||
| 1930 | Ga0496102_0083393 | |||
| 1931 | Ga0496102_0096599 | |||
| 1932 | Ga0496102_0346195 | |||
| 1933 | Ga0496102_0430748 | |||
| 1934 | Ga0496103_0000837 | |||
| 1935 | Ga0496103_0023448 | |||
| 1936 | Ga0496103_0036345 | |||
| 1937 | Ga0496103_0102731 | |||
| 1938 | Ga0496104_0000126 | |||
| 1939 | Ga0496104_0004960 | |||
| 1940 | Ga0496104_0027230 | |||
| 1941 | Ga0496104_0074672 | |||
| 1942 | Ga0496104_0131627 | |||
| 1943 | Ga0496104_0904560 | |||
| 1944 | Ga0496105_0000117 | |||
| 1945 | Ga0496105_0002637 | |||
| 1946 | Ga0496105_0020680 | |||
| 1947 | Ga0496105_0024254 | |||
| 1948 | Ga0496106_0001351 | |||
| 1949 | Ga0496106_0011805 | |||
| 1950 | Ga0496106_0012975 | |||
| 1951 | Ga0496106_0037295 | |||
| 1952 | Ga0496106_0122012 | |||
| 1953 | Ga0496106_0318858 | |||
| 1954 | Ga0496107_0001211 | |||
| 1955 | Ga0496107_0016353 | |||
| 1956 | Ga0496107_0017254 | |||
| 1957 | Ga0496107_0056195 | |||
| 1958 | Ga0496107_0127761 | |||
| 1959 | Ga0496107_0129895 | |||
| 1960 | Ga0496108_0006065 | |||
| 1961 | Ga0496108_0015761 | |||
| 1962 | Ga0496108_0016812 | |||
| 1963 | Ga0496108_0397554 | |||
| 1964 | Ga0496109_0000188 | |||
| 1965 | Ga0496109_0002868 | |||
| 1966 | Ga0496109_0005044 | |||
| 1967 | Ga0496109_0056119 | |||
| 1968 | Ga0496109_0057110 | |||
| 1969 | Ga0496109_0066995 | |||
| 1970 | Ga0496109_0361875 | |||
| 1971 | Ga0496109_0409615 | |||
| 1972 | Ga0496109_0684842 | |||
| 1973 | Ga0496110_0006025 | |||
| 1974 | Ga0496110_0006085 | |||
| 1975 | Ga0496110_0030903 | |||
| 1976 | Ga0496110_0068915 | |||
| 1977 | Ga0496110_0203676 | |||
| 1978 | Ga0496110_0368821 | |||
| 1979 | Ga0496111_0008703 | |||
| 1980 | Ga0496111_0040142 | |||
| 1981 | Ga0496111_0045141 | |||
| 1982 | Ga0496111_0188898 | |||
| 1983 | Ga0496112_0004798 | |||
| 1984 | Ga0496112_0026058 | |||
| 1985 | Ga0496112_0099248 | |||
| 1986 | Ga0496112_0142749 | |||
| 1987 | Ga0496113_0004222 | |||
| 1988 | Ga0496113_0066091 | |||
| 1989 | Ga0496113_0098160 | |||
| 1990 | Ga0496113_0106322 | |||
| 1991 | Ga0496113_0114080 | |||
| 1992 | Ga0496113_0254442 | |||
| 1993 | Ga0496114_0001734 | |||
| 1994 | Ga0496114_0008857 | |||
| 1995 | Ga0496114_0022764 | |||
| 1996 | Ga0496114_0207371 | |||
| 1997 | Ga0496114_0208722 | |||
| 1998 | Ga0496115_0000592 | |||
| 1999 | Ga0496115_0027143 | |||
| 2000 | Ga0496115_0062645 | |||
| 2001 | Ga0496115_0070401 | |||
| 2002 | Ga0496115_0083249 | |||
| 2003 | Ga0496115_0140201 | |||
| 2004 | Ga0496115_0255662 | |||
| 2005 | Ga0496115_0272788 | |||
| 2006 | Ga0496123_0227291 | |||
| 2007 | Ga0501032_0030974 | |||
| 2008 | Ga0501032_0195940 | |||
| 2009 | Ga0501033_0017120 | |||
| 2010 | Ga0501033_0092352 | |||
| 2011 | Ga0501033_0365779 | |||
| 2012 | Ga0501034_0008567 | |||
| 2013 | Ga0501034_0040118 | |||
| 2014 | Ga0501034_0041240 | |||
| 2015 | Ga0501034_0092690 | |||
| 2016 | Ga0501034_0163904 | |||
| 2017 | Ga0501034_0288833 | |||
| 2018 | Ga0501034_0904130 | |||
| 2019 | Ga0501036_0000281 | |||
| 2020 | Ga0501036_0134137 | |||
| 2021 | Ga0501036_0284551 | |||
| 2022 | Ga0501036_0527761 | |||
| 2023 | Ga0501036_0628177 | |||
| 2024 | Ga0501037_0014910 | |||
| 2025 | Ga0501037_0039382 | |||
| 2026 | Ga0501037_0109601 | |||
| 2027 | Ga0501037_0124625 | |||
| 2028 | Ga0501038_0039412 | |||
| 2029 | Ga0501038_0039534 | |||
| 2030 | Ga0501038_0282093 | |||
| 2031 | Ga0501038_0490513 | |||
| 2032 | Ga0501039_0112844 | |||
| 2033 | Ga0501039_0330335 | |||
| 2034 | Ga0501040_0317409 | |||
| 2035 | Ga0501043_0005571 | |||
| 2036 | Ga0501043_0102011 | |||
| 2037 | Ga0501043_0139445 | |||
| 2038 | Ga0501043_0735154 | |||
| 2039 | Ga0501046_0398364 | |||
| 2040 | Ga0501047_0000316 | |||
| 2041 | Ga0501047_0109688 | |||
| 2042 | Ga0501047_0194915 | |||
| 2043 | Ga0501047_0205130 | |||
| 2044 | Ga0501048_0000150 | |||
| 2045 | Ga0501048_0093929 | |||
| 2046 | Ga0501048_0241721 | |||
| 2047 | Ga0501067_0015221 | |||
| 2048 | Ga0501068_0046081 | |||
| 2049 | Ga0501068_0152941 | |||
| 2050 | Ga0501068_0439341 | |||
| 2051 | Ga0501068_0643654 | |||
| 2052 | Ga0501069_0602264 | |||
| 2053 | Ga0501070_0015099 | |||
| 2054 | Ga0501070_0092398 | |||
| 2055 | Ga0501070_0283795 | |||
| 2056 | Ga0501070_0427535 | |||
| 2057 | Ga0501070_1111479 | |||
| 2058 | Ga0501071_0020000 | |||
| 2059 | Ga0501071_0098843 | |||
| 2060 | Ga0501072_0205727 | |||
| 2061 | Ga0501073_0095755 | |||
| 2062 | Ga0501074_0024398 | |||
| 2063 | Ga0501079_0031559 | |||
| 2064 | Ga0501079_0541084 | |||
| 2065 | Ga0501080_0001372 | |||
| 2066 | Ga0501080_0061704 | |||
| 2067 | Ga0501080_0077738 | |||
| 2068 | Ga0501080_0097720 | |||
| 2069 | Ga0501083_0002096 | |||
| 2070 | Ga0501083_0066063 | |||
| 2071 | Ga0501035_0089759 | |||
| 2072 | Ga0501035_0131817 | |||
| 2073 | Ga0501035_0170047 | |||
| 2074 | Ga0501044_0009598 | |||
| 2075 | Ga0501044_0069472 | |||
| 2076 | Ga0501044_0082385 | |||
| 2077 | Ga0501044_0096639 | |||
| 2078 | Ga0501044_0190547 | |||
| 2079 | Ga0501044_0444213 | |||
| 2080 | Ga0501045_0265619 | |||
| 2081 | Ga0501045_0328052 | |||
| 2082 | nmdc:mga03n38_100195_c1 | |||
| 2083 | nmdc:mga03n38_43234_c1 | |||
| 2084 | nmdc:mga03n38_8072_c1 | |||
| 2085 | nmdc:mga00v17_151054_c1 | |||
| 2086 | nmdc:mga00v17_551079_c1 | |||
| 2087 | nmdc:mga0k408_134146_c1 | |||
| 2088 | nmdc:mga0k408_475333_c1 | |||
| 2089 | nmdc:mga06z11_321150_c1 | |||
| 2090 | nmdc:mga04h51_254273_c1 | |||
| 2091 | nmdc:mga07m45_123873_c1 | |||
| 2092 | nmdc:mga07m45_144875_c1 | |||
| 2093 | nmdc:mga07m45_176630_c1 | |||
| 2094 | nmdc:mga07m45_31114_c1 | |||
| 2095 | nmdc:mga05p37_1114_c1 | |||
| 2096 | nmdc:mga05p37_79219_c1 | |||
| 2097 | nmdc:mga09592_1302_c1 | |||
| 2098 | nmdc:mga0qj67_276_c1 | |||
| 2099 | nmdc:mga06r32_3728_c1 | |||
| 2100 | nmdc:mga08y16_3668_c1 | |||
| 2101 | nmdc:mga08y16_7407_c1 | |||
| 2102 | nmdc:mga08y16_8959_c1 | |||
| 2103 | nmdc:mga0n895_124362_c1 | |||
| 2104 | nmdc:mga0n895_217077_c1 | |||
| 2105 | nmdc:mga0n895_224722_c1 | |||
| 2106 | nmdc:mga0n895_3698_c1 | |||
| 2107 | nmdc:mga0n895_651_c1 | |||
| 2108 | nmdc:mga0n895_682_c1 | |||
| 2109 | nmdc:mga0rr50_2190_c1 | |||
| 2110 | nmdc:mga0rr50_286227_c1 | |||
| 2111 | nmdc:mga0rr50_453760_c1 | |||
| 2112 | nmdc:mga0rr50_919_c1 | |||
| 2113 | nmdc:mga08x19_56758_c1 | |||
| 2114 | nmdc:mga08x19_87785_c1 | |||
| 2115 | nmdc:mga0a205_1012_c1 | |||
| 2116 | nmdc:mga0a205_1633_c1 | |||
| 2117 | nmdc:mga0a205_190661_c1 | |||
| 2118 | nmdc:mga0a205_21841_c1 | |||
| 2119 | nmdc:mga0sz30_105616_c1 | |||
| 2120 | nmdc:mga0sz30_170913_c1 | |||
| 2121 | Ga0495601_0000128 | |||
| 2122 | Ga0495601_0011860 | |||
| 2123 | Ga0495601_0020775 | |||
| 2124 | Ga0495601_0070486 | |||
| 2125 | Ga0495601_0071243 | |||
| 2126 | Ga0495612_0002217 | |||
| 2127 | Ga0495612_0009092 | |||
| 2128 | Ga0495595_0000976 | |||
| 2129 | Ga0495595_0003217 | |||
| 2130 | Ga0495595_0004577 | |||
| 2131 | Ga0495595_0011834 | |||
| 2132 | Ga0495595_0099156 | |||
| 2133 | Ga0495595_0102320 | |||
| 2134 | Ga0495595_0215650 | |||
| 2135 | Ga0495619_0000016 | |||
| 2136 | Ga0495619_0000231 | |||
| 2137 | Ga0495619_0000252 | |||
| 2138 | Ga0495619_0011260 | |||
| 2139 | Ga0495619_0011414 | |||
| 2140 | Ga0495619_0016668 | |||
| 2141 | Ga0495619_0049308 | |||
| 2142 | Ga0495619_0136775 | |||
| 2143 | Ga0495619_0383660 | |||
| 2144 | Ga0500578_0118419 | |||
| 2145 | Ga0500566_0058632 | |||
| 2146 | Ga0500569_235355 | |||
| 2147 | Ga0500595_034410 | |||
| 2148 | Ga0500608_189135 | |||
| 2149 | Ga0500616_0202446 | |||
| 2150 | Ga0500622_0026738 | |||
| 2151 | Ga0500636_0002418 | |||
| 2152 | Ga0501084_0089085 | |||
| 2153 | Ga0501082_0216941 | |||
| 2154 | 2643758725 | |||
| 2155 | 2739308458 | |||
| 2156 | 2841915518 | |||
| 2157 | 2841920720 | |||
| 2158 | 2889918277 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s17-assembly2.cif.gz_B | identification of novel potent bicyclic peptide deformylase inhibitors | 0.9748 | 2 | 166 |
| 1lry-assembly1.cif.gz_A | crystal structure of p. aeruginosa peptide deformylase complexed with antibiotic actinonin | 0.9717 | 2 | 166 |
| 1lme-assembly2.cif.gz_B | crystal structure of peptide deformylase from thermotoga maritima | 0.9696 | 1 | 151 |
| 3k6l-assembly3.cif.gz_C | the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 | 0.9637 | 3 | 162 |
| 1s17-assembly2.cif.gz_B | identification of novel potent bicyclic peptide deformylase inhibitors | 0.9632 | 2 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9694 | 1 | 151 | 3.90.45.10 |
| 1ws1A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9574 | 1 | 151 | 3.90.45.10 |
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9564 | 1 | 151 | 3.90.45.10 |
| 3uwaA00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9444 | 4 | 150 | 3.90.45.10 |
| 3u04A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.942 | 1 | 165 | 3.90.45.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5R2MX39-F1-model_v4 | Peptide deformylase-like (Polypeptide deformylase-like) | 0.9924 | 51 | 151 |
GO:0042586
GO:0043686 |
| AF-P63913-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9898 | 1 | 168 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A175RMI5-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9887 | 1 | 169 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-F7QG71-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9878 | 4 | 167 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A4R3XLY2-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.987 | 1 | 168 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |