F489563

General Info

Members Datasets Scaffolds Average Seq Length
1075 400 2150 111

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100495571|Ga0207675_1004955712
Length 133
Sequence VANHKADLLQGTLDLLILKTLAVQELHGLGISNRIAQITNGTFQVKPGSLFPALHRMEEAGWLKASWGESENNRRAKYYRLTKAGERQLQIETADWQRISLAIASAFIIARALLTVSSYSRCGSESATMPAPA

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
202 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
205 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
209 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
210 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
211 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
219 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
224 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
225 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
231 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
251 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
252 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
253 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
254 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
255 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
256 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
257 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
258 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
259 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
260 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
261 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
262 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
263 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
264 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
275 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
288 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
289 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
290 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
327 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
328 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
329 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
330 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
331 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
332 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
336 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
337 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
338 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
339 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
340 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
341 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
342 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
343 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
344 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
345 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
346 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
347 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
348 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
349 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
350 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
351 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
352 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
353 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
354 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
355 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
356 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
357 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
358 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
359 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
360 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
361 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
362 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
363 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
364 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
365 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
366 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
367 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
368 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
369 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
370 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
371 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
372 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
373 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
374 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
375 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
376 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
377 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
382 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
383 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
384 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
385 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
386 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
387 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
388 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
389 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
390 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
391 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
392 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
393 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
394 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
395 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
396 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
397 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
400 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 2.14
Rhizosphere 93.95
Stem 0
Stem Tuber 0
Unclassified 33.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100495571 3300026118 Bacteria 1215
2 Ga0065712_10660374 3300005290 Unclassified 563
3 Ga0065715_10036657 3300005293 Unclassified 1177
4 Ga0065715_10182647 3300005293 Unclassified 1466
5 Ga0065715_10206825 3300005293 Unclassified 1333
6 Ga0065715_10686545 3300005293 Unclassified 660
7 Ga0065707_10005725 3300005295 Bacteria 3031
8 Ga0065707_10153081 3300005295 Bacteria 1637
9 Ga0065707_10270071 3300005295 Bacteria 1073
10 Ga0065707_10386432 3300005295 Unclassified 835
11 Ga0070658_10324717 3300005327 Bacteria 1315
12 Ga0070658_10377500 3300005327 Bacteria 1216
13 Ga0070676_10126069 3300005328 Unclassified 1613
14 Ga0070676_10569696 3300005328 Bacteria 813
15 Ga0070683_100048180 3300005329 Bacteria 3939
16 Ga0070683_100058164 3300005329 Bacteria 3592
17 Ga0070683_100180310 3300005329 Bacteria 2005
18 Ga0070683_100186840 3300005329 Bacteria 1967
19 Ga0070683_100214790 3300005329 Bacteria 1828
20 Ga0070683_100366706 3300005329 Unclassified 1372
21 Ga0070683_100875266 3300005329 Bacteria 862
22 Ga0070683_101580605 3300005329 Bacteria 630
23 Ga0070683_102127131 3300005329 Unclassified 539
24 Ga0070670_100032878 3300005331 Bacteria 4469
25 Ga0070670_100039831 3300005331 Unclassified 4040
26 Ga0070670_100165886 3300005331 Bacteria 1915
27 Ga0070670_100287719 3300005331 Unclassified 1436
28 Ga0070677_10784482 3300005333 Unclassified 543
29 Ga0068869_100038165 3300005334 Bacteria 3420
30 Ga0068869_100250604 3300005334 Unclassified 1414
31 Ga0068869_100317306 3300005334 Bacteria 1263
32 Ga0068869_101903253 3300005334 Unclassified 533
33 Ga0070666_10082292 3300005335 Bacteria 2202
34 Ga0070666_10167053 3300005335 Bacteria 1540
35 Ga0070680_100007133 3300005336 Bacteria 8515
36 Ga0070680_100130567 3300005336 Bacteria 2102
37 Ga0070680_100271982 3300005336 Bacteria 1435
38 Ga0068868_100256491 3300005338 Bacteria 1473
39 Ga0068868_100316342 3300005338 Unclassified 1329
40 Ga0068868_100595207 3300005338 Bacteria 979
41 Ga0068868_100610189 3300005338 Unclassified 968
42 Ga0068868_101291647 3300005338 Bacteria 678
43 Ga0068868_101830275 3300005338 Bacteria 574
44 Ga0070660_100113504 3300005339 Bacteria 2157
45 Ga0070660_100593044 3300005339 Unclassified 926
46 Ga0070660_101398214 3300005339 Unclassified 594
47 Ga0070689_100050282 3300005340 Bacteria 3220
48 Ga0070689_100096732 3300005340 Unclassified 2334
49 Ga0070689_100709323 3300005340 Bacteria 879
50 Ga0070689_100874938 3300005340 Bacteria 794
51 Ga0070689_101020403 3300005340 Unclassified 737
52 Ga0070687_100005760 3300005343 Bacteria 5031
53 Ga0070687_100181136 3300005343 Unclassified 1262
54 Ga0070661_100008191 3300005344 Bacteria 7210
55 Ga0070661_100397257 3300005344 Bacteria 1089
56 Ga0070661_100484310 3300005344 Bacteria 988
57 Ga0070692_10024117 3300005345 Unclassified 2987
58 Ga0070668_100028835 3300005347 Bacteria 4212
59 Ga0070668_100041989 3300005347 Bacteria 3504
60 Ga0070669_100010554 3300005353 Bacteria 6558
61 Ga0070669_100014982 3300005353 Bacteria 5526
62 Ga0070669_100114733 3300005353 Bacteria 2048
63 Ga0070669_100786415 3300005353 Bacteria 808
64 Ga0070675_100058123 3300005354 Bacteria 3190
65 Ga0070675_100106446 3300005354 Unclassified 2368
66 Ga0070675_100497576 3300005354 Unclassified 1098
67 Ga0070675_100554275 3300005354 Bacteria 1040
68 Ga0070675_100691126 3300005354 Bacteria 929
69 Ga0070675_100941567 3300005354 Bacteria 792
70 Ga0070671_100098714 3300005355 Bacteria 2449
71 Ga0070671_100258870 3300005355 Bacteria 1479
72 Ga0070671_101107461 3300005355 Bacteria 695
73 Ga0070674_100237683 3300005356 Bacteria 1425
74 Ga0070674_100274107 3300005356 Bacteria 1335
75 Ga0070674_100699649 3300005356 Bacteria 866
76 Ga0070674_101193599 3300005356 Unclassified 675
77 Ga0070673_100592426 3300005364 Bacteria 1010
78 Ga0070673_100668931 3300005364 Bacteria 951
79 Ga0070673_101674110 3300005364 Bacteria 602
80 Ga0070673_101745764 3300005364 Bacteria 589
81 Ga0070673_101857801 3300005364 Unclassified 571
82 Ga0070688_100346497 3300005365 Bacteria 1086
83 Ga0070688_100733954 3300005365 Unclassified 767
84 Ga0070688_100873883 3300005365 Unclassified 708
85 Ga0070659_100030150 3300005366 Bacteria 4196
86 Ga0070659_100224607 3300005366 Bacteria 1551
87 Ga0070659_100456039 3300005366 Bacteria 1085
88 Ga0070659_101463435 3300005366 Unclassified 608
89 Ga0070667_100069000 3300005367 Bacteria 3008
90 Ga0070667_101463429 3300005367 Bacteria 641
91 Ga0070667_102129448 3300005367 Unclassified 528
92 Ga0070709_11534376 3300005434 Unclassified 541
93 Ga0070714_100068098 3300005435 Bacteria 3071
94 Ga0070714_100271706 3300005435 Unclassified 1572
95 Ga0070714_100492161 3300005435 Bacteria 1168
96 Ga0070714_100506247 3300005435 Bacteria 1152
97 Ga0070713_100038744 3300005436 Unclassified 3865
98 Ga0070713_100460516 3300005436 Bacteria 1195
99 Ga0070713_100677256 3300005436 Unclassified 984
100 Ga0070713_101408438 3300005436 Unclassified 676
101 Ga0070710_10902612 3300005437 Bacteria 638
102 Ga0070701_10186801 3300005438 Bacteria 1217
103 Ga0070711_100026538 3300005439 Unclassified 3796
104 Ga0070711_100592807 3300005439 Unclassified 924
105 Ga0070705_100444918 3300005440 Unclassified 971
106 Ga0070705_100900422 3300005440 Unclassified 711
107 Ga0070700_100089669 3300005441 Bacteria 2004
108 Ga0070700_100670454 3300005441 Bacteria 821
109 Ga0070694_100123457 3300005444 Bacteria 1861
110 Ga0070694_100458843 3300005444 Unclassified 1007
111 Ga0070694_100762858 3300005444 Bacteria 791
112 Ga0070708_100261606 3300005445 Bacteria 1626
113 Ga0070708_100437115 3300005445 Bacteria 1234
114 Ga0070663_100048398 3300005455 Bacteria 3015
115 Ga0070663_100365386 3300005455 Bacteria 1172
116 Ga0070663_100888077 3300005455 Bacteria 769
117 Ga0070663_101051761 3300005455 Unclassified 710
118 Ga0070663_101921582 3300005455 Bacteria 532
119 Ga0070678_100090652 3300005456 Unclassified 2344
120 Ga0070678_100150438 3300005456 Unclassified 1875
121 Ga0070678_101654425 3300005456 Bacteria 602
122 Ga0070662_100067643 3300005457 Bacteria 2624
123 Ga0070662_100083085 3300005457 Unclassified 2390
124 Ga0070662_100275435 3300005457 Unclassified 1360
125 Ga0070662_100277436 3300005457 Bacteria 1355
126 Ga0070681_10000342 3300005458 Bacteria 37579
127 Ga0070681_10000540 3300005458 Bacteria 31122
128 Ga0070681_10188496 3300005458 Bacteria 1982
129 Ga0068867_100025648 3300005459 Bacteria 4230
130 Ga0068867_100031093 3300005459 Bacteria 3853
131 Ga0068867_100230564 3300005459 Bacteria 1497
132 Ga0068867_100882871 3300005459 Bacteria 803
133 Ga0070685_10241681 3300005466 Bacteria 1192
134 Ga0070685_10413548 3300005466 Unclassified 937
135 Ga0070706_100019461 3300005467 Bacteria 6260
136 Ga0070706_100022641 3300005467 Bacteria 5786
137 Ga0070706_100136440 3300005467 Unclassified 2290
138 Ga0070706_100607898 3300005467 Bacteria 1016
139 Ga0070706_101110221 3300005467 Unclassified 728
140 Ga0070706_101769679 3300005467 Unclassified 562
141 Ga0070707_100152417 3300005468 Bacteria 2251
142 Ga0070707_100315612 3300005468 Unclassified 1519
143 Ga0070707_100400964 3300005468 Unclassified 1332
144 Ga0070707_100430875 3300005468 Bacteria 1279
145 Ga0070707_100938440 3300005468 Bacteria 830
146 Ga0070698_100000807 3300005471 Bacteria 34196
147 Ga0070698_100021834 3300005471 Bacteria 6704
148 Ga0070698_100029299 3300005471 Bacteria 5713
149 Ga0070698_100037758 3300005471 Unclassified 4979
150 Ga0070698_100904801 3300005471 Bacteria 828
151 Ga0070699_100000932 3300005518 Bacteria 27306
152 Ga0070699_100042673 3300005518 Bacteria 3925
153 Ga0070699_100160165 3300005518 Bacteria 1992
154 Ga0070699_100396045 3300005518 Bacteria 1248
155 Ga0070699_101745354 3300005518 Bacteria 570
156 Ga0070679_100001118 3300005530 Bacteria 23399
157 Ga0070679_100094928 3300005530 Bacteria 2970
158 Ga0070684_100028747 3300005535 Bacteria 4704
159 Ga0070684_100033883 3300005535 Bacteria 4363
160 Ga0070684_100148555 3300005535 Unclassified 2122
161 Ga0070684_100370080 3300005535 Bacteria 1319
162 Ga0070684_100784750 3300005535 Unclassified 890
163 Ga0070684_101063118 3300005535 Bacteria 760
164 Ga0070684_101490097 3300005535 Unclassified 638
165 Ga0070697_100097813 3300005536 Bacteria 2436
166 Ga0070697_100123086 3300005536 Bacteria 2171
167 Ga0070697_100302832 3300005536 Unclassified 1374
168 Ga0070697_100642730 3300005536 Bacteria 934
169 Ga0070697_100704835 3300005536 Unclassified 891
170 Ga0070697_100907185 3300005536 Unclassified 782
171 Ga0068853_100026648 3300005539 Bacteria 4855
172 Ga0068853_101964902 3300005539 Unclassified 567
173 Ga0070672_100026379 3300005543 Bacteria 4322
174 Ga0070672_100078935 3300005543 Bacteria 2634
175 Ga0070672_100199736 3300005543 Bacteria 1672
176 Ga0070672_100242100 3300005543 Unclassified 1517
177 Ga0070686_100094199 3300005544 Unclassified 2010
178 Ga0070695_100738678 3300005545 Unclassified 784
179 Ga0070695_100845637 3300005545 Unclassified 736
180 Ga0070695_101783004 3300005545 Bacteria 516
181 Ga0070696_100024803 3300005546 Unclassified 4075
182 Ga0070696_100143523 3300005546 Unclassified 1747
183 Ga0070696_100281287 3300005546 Unclassified 1268
184 Ga0070696_100329680 3300005546 Bacteria 1177
185 Ga0070696_100335105 3300005546 Bacteria 1168
186 Ga0070696_100436486 3300005546 Unclassified 1031
187 Ga0070696_100941659 3300005546 Bacteria 718
188 Ga0070696_101168568 3300005546 Unclassified 649
189 Ga0070693_100983327 3300005547 Bacteria 637
190 Ga0070665_100064090 3300005548 Bacteria 3685
191 Ga0070665_100440955 3300005548 Bacteria 1311
192 Ga0070665_102367276 3300005548 Bacteria 533
193 Ga0070704_100360352 3300005549 Bacteria 1230
194 Ga0070704_100801675 3300005549 Bacteria 841
195 Ga0070704_101516302 3300005549 Bacteria 617
196 Ga0070704_101519133 3300005549 Unclassified 616
197 Ga0068855_100668579 3300005563 Bacteria 1114
198 Ga0070664_100002183 3300005564 Bacteria 15715
199 Ga0070664_100021615 3300005564 Bacteria 5306
200 Ga0070664_100048449 3300005564 Bacteria 3591
201 Ga0070664_100419362 3300005564 Bacteria 1226
202 Ga0070664_100532195 3300005564 Bacteria 1085
203 Ga0070664_100713440 3300005564 Bacteria 935
204 Ga0070664_100885174 3300005564 Bacteria 837
205 Ga0070664_101602292 3300005564 Bacteria 617
206 Ga0068857_100002781 3300005577 Bacteria 14384
207 Ga0068857_100014310 3300005577 Bacteria 6914
208 Ga0068857_100165935 3300005577 Bacteria 2005
209 Ga0068857_100353045 3300005577 Bacteria 1362
210 Ga0068857_100512003 3300005577 Unclassified 1127
211 Ga0068857_101585719 3300005577 Bacteria 639
212 Ga0068854_100100973 3300005578 Bacteria 2163
213 Ga0068854_100184631 3300005578 Bacteria 1631
214 Ga0068854_100377101 3300005578 Bacteria 1168
215 Ga0068854_101929406 3300005578 Unclassified 543
216 Ga0068856_100137259 3300005614 Bacteria 2451
217 Ga0068856_100771281 3300005614 Bacteria 981
218 Ga0068856_100791106 3300005614 Bacteria 968
219 Ga0068856_102273566 3300005614 Unclassified 551
220 Ga0070702_100169846 3300005615 Bacteria 1417
221 Ga0070702_100507407 3300005615 Unclassified 887
222 Ga0068852_100147413 3300005616 Bacteria 2184
223 Ga0068852_100157205 3300005616 Unclassified 2119
224 Ga0068852_100176039 3300005616 Unclassified 2009
225 Ga0068852_100919444 3300005616 Bacteria 892
226 Ga0068852_101692964 3300005616 Bacteria 655
227 Ga0068859_100087820 3300005617 Unclassified 3158
228 Ga0068859_100122061 3300005617 Bacteria 2672
229 Ga0068859_100162769 3300005617 Bacteria 2310
230 Ga0068859_100453637 3300005617 Bacteria 1378
231 Ga0068859_100831096 3300005617 Unclassified 1010
232 Ga0068859_101963370 3300005617 Bacteria 646
233 Ga0068859_101994992 3300005617 Bacteria 641
234 Ga0068864_100013175 3300005618 Bacteria 6846
235 Ga0068864_100040517 3300005618 Bacteria 3985
236 Ga0068864_100150045 3300005618 Bacteria 2111
237 Ga0068864_100356750 3300005618 Bacteria 1381
238 Ga0068864_100580603 3300005618 Bacteria 1086
239 Ga0068864_100925682 3300005618 Unclassified 862
240 Ga0068864_101115594 3300005618 Unclassified 785
241 Ga0068864_101689392 3300005618 Bacteria 638
242 Ga0068866_10060789 3300005718 Bacteria 1960
243 Ga0068861_100017142 3300005719 Bacteria 5136
244 Ga0068861_100105025 3300005719 Unclassified 2255
245 Ga0068861_100126622 3300005719 Bacteria 2067
246 Ga0068861_100590775 3300005719 Bacteria 1018
247 Ga0068861_100783604 3300005719 Bacteria 893
248 Ga0068861_100945778 3300005719 Unclassified 819
249 Ga0068861_101398816 3300005719 Unclassified 683
250 Ga0068851_10191259 3300005834 Bacteria 1138
251 Ga0068851_10422233 3300005834 Unclassified 788
252 Ga0068851_10753066 3300005834 Unclassified 603
253 Ga0068870_10004730 3300005840 Bacteria 5882
254 Ga0068870_10383105 3300005840 Bacteria 911
255 Ga0068870_10440690 3300005840 Bacteria 857
256 Ga0068863_100006098 3300005841 Bacteria 11823
257 Ga0068863_100065803 3300005841 Bacteria 3430
258 Ga0068863_100446718 3300005841 Bacteria 1269
259 Ga0068863_100890355 3300005841 Unclassified 890
260 Ga0068863_102688735 3300005841 Unclassified 506
261 Ga0068858_100419991 3300005842 Unclassified 1286
262 Ga0068858_100783161 3300005842 Bacteria 930
263 Ga0068858_102449797 3300005842 Bacteria 516
264 Ga0068860_100103197 3300005843 Bacteria 2722
265 Ga0068860_100124247 3300005843 Bacteria 2473
266 Ga0068860_100803622 3300005843 Bacteria 954
267 Ga0068860_101352914 3300005843 Unclassified 733
268 Ga0068862_100002139 3300005844 Bacteria 17795
269 Ga0068862_100030031 3300005844 Bacteria 4580
270 Ga0068862_100221043 3300005844 Bacteria 1715
271 Ga0068862_100266094 3300005844 Bacteria 1566
272 Ga0068862_102508543 3300005844 Bacteria 527
273 Ga0081455_10012197 3300005937 Bacteria 8582
274 Ga0081455_10041053 3300005937 Bacteria 4074
275 Ga0081455_10044796 3300005937 Unclassified 3855
276 Ga0081455_10052145 3300005937 Bacteria 3504
277 Ga0081455_10510666 3300005937 Bacteria 805
278 Ga0081540_1002800 3300005983 Bacteria 14129
279 Ga0081540_1038826 3300005983 Bacteria 2503
280 Ga0081539_10000346 3300005985 Bacteria 101962
281 Ga0070717_10112750 3300006028 Bacteria 2321
282 Ga0070717_10148522 3300006028 Bacteria 2026
283 Ga0070717_10432067 3300006028 Bacteria 1185
284 Ga0070717_11293225 3300006028 Bacteria 663
285 Ga0070716_100021514 3300006173 Unclassified 3400
286 Ga0070712_100047146 3300006175 Bacteria 2981
287 Ga0070712_100194498 3300006175 Bacteria 1589
288 Ga0070712_100674170 3300006175 Unclassified 880
289 Ga0097621_100197725 3300006237 Bacteria 1744
290 Ga0097621_100323174 3300006237 Unclassified 1367
291 Ga0097621_100333780 3300006237 Bacteria 1345
292 Ga0097621_100657609 3300006237 Bacteria 962
293 Ga0068871_100144991 3300006358 Bacteria 2021
294 Ga0068871_100265382 3300006358 Bacteria 1499
295 Ga0068871_100470617 3300006358 Bacteria 1129
296 Ga0068871_101009500 3300006358 Bacteria 775
297 Ga0075428_100105930 3300006844 Bacteria 3066
298 Ga0075428_100147946 3300006844 Unclassified 2553
299 Ga0075428_100256489 3300006844 Bacteria 1884
300 Ga0075428_100459191 3300006844 Unclassified 1364
301 Ga0075428_100467150 3300006844 Bacteria 1351
302 Ga0075428_100598582 3300006844 Bacteria 1178
303 Ga0075428_100822785 3300006844 Bacteria 987
304 Ga0075428_101584253 3300006844 Bacteria 685
305 Ga0075430_101601138 3300006846 Bacteria 535
306 Ga0075431_100022067 3300006847 Bacteria 6510
307 Ga0075431_100046470 3300006847 Bacteria 4477
308 Ga0075431_100320914 3300006847 Unclassified 1562
309 Ga0075431_101348546 3300006847 Unclassified 674
310 Ga0075433_10428798 3300006852 Bacteria 1166
311 Ga0075433_10735655 3300006852 Bacteria 863
312 Ga0075433_10817172 3300006852 Bacteria 814
313 Ga0075433_10947108 3300006852 Bacteria 751
314 Ga0075433_11042595 3300006852 Unclassified 712
315 Ga0075434_100011626 3300006871 Bacteria 8313
316 Ga0075434_100049011 3300006871 Bacteria 4192
317 Ga0075434_100209988 3300006871 Bacteria 1967
318 Ga0075434_100384599 3300006871 Bacteria 1424
319 Ga0075434_100983549 3300006871 Bacteria 858
320 Ga0075434_101063208 3300006871 Bacteria 823
321 Ga0075434_101855844 3300006871 Unclassified 609
322 Ga0075429_100120426 3300006880 Unclassified 2294
323 Ga0075429_100694077 3300006880 Bacteria 892
324 Ga0075429_101432013 3300006880 Bacteria 602
325 Ga0068865_100073433 3300006881 Bacteria 2432
326 Ga0068865_100132500 3300006881 Bacteria 1869
327 Ga0075436_100038127 3300006914 Bacteria 3318
328 Ga0075436_100286426 3300006914 Bacteria 1179
329 Ga0075436_100289977 3300006914 Bacteria 1171
330 Ga0075436_100300208 3300006914 Bacteria 1151
331 Ga0075436_100527139 3300006914 Bacteria 866
332 Ga0075436_101127692 3300006914 Unclassified 591
333 Ga0075436_101358092 3300006914 Unclassified 538
334 Ga0097620_100087814 3300006931 Unclassified 3158
335 Ga0097620_100122047 3300006931 Bacteria 2672
336 Ga0097620_100162767 3300006931 Bacteria 2310
337 Ga0097620_100453651 3300006931 Bacteria 1378
338 Ga0097620_100831175 3300006931 Unclassified 1010
339 Ga0097620_101963595 3300006931 Bacteria 646
340 Ga0097620_101994733 3300006931 Bacteria 641
341 Ga0075435_100091492 3300007076 Bacteria 2511
342 Ga0075435_100991315 3300007076 Bacteria 734
343 Ga0105240_10006670 3300009093 Bacteria 16929
344 Ga0105240_10110797 3300009093 Bacteria 3322
345 Ga0105240_11276879 3300009093 Unclassified 775
346 Ga0105240_11447559 3300009093 Unclassified 721
347 Ga0111539_10186107 3300009094 Unclassified 2425
348 Ga0111539_10589106 3300009094 Bacteria 1295
349 Ga0111539_10602974 3300009094 Bacteria 1279
350 Ga0111539_10624407 3300009094 Bacteria 1255
351 Ga0111539_12276647 3300009094 Unclassified 629
352 Ga0111539_12711727 3300009094 Unclassified 574
353 Ga0105245_10052246 3300009098 Bacteria 3665
354 Ga0105245_10491718 3300009098 Bacteria 1242
355 Ga0105245_11196822 3300009098 Bacteria 808
356 Ga0105245_12286554 3300009098 Bacteria 594
357 Ga0105245_12473326 3300009098 Bacteria 573
358 Ga0105247_10102995 3300009101 Bacteria 1827
359 Ga0114129_10071093 3300009147 Bacteria 4852
360 Ga0114129_10071190 3300009147 Bacteria 4849
361 Ga0114129_10300462 3300009147 Unclassified 2140
362 Ga0114129_10324579 3300009147 Bacteria 2046
363 Ga0114129_10338910 3300009147 Bacteria 1995
364 Ga0114129_11145781 3300009147 Unclassified 971
365 Ga0114129_13085928 3300009147 Unclassified 545
366 Ga0105243_11962505 3300009148 Bacteria 619
367 Ga0105243_12070090 3300009148 Unclassified 604
368 Ga0105241_10626006 3300009174 Bacteria 975
369 Ga0105241_10945855 3300009174 Bacteria 803
370 Ga0105241_12296665 3300009174 Unclassified 537
371 Ga0105242_10062799 3300009176 Bacteria 3058
372 Ga0105242_10324824 3300009176 Unclassified 1413
373 Ga0105242_11520369 3300009176 Bacteria 701
374 Ga0105242_11631902 3300009176 Bacteria 679
375 Ga0105242_12773844 3300009176 Unclassified 540
376 Ga0105248_10000003 3300009177 Bacteria 1019601
377 Ga0105248_10000056 3300009177 Bacteria 139437
378 Ga0105248_10008788 3300009177 Bacteria 11093
379 Ga0105248_10017537 3300009177 Bacteria 7895
380 Ga0105248_10175016 3300009177 Unclassified 2419
381 Ga0105248_10183966 3300009177 Bacteria 2355
382 Ga0105248_10185943 3300009177 Bacteria 2341
383 Ga0105248_10394385 3300009177 Bacteria 1558
384 Ga0105248_10501000 3300009177 Bacteria 1369
385 Ga0105248_10516422 3300009177 Unclassified 1347
386 Ga0105248_10833146 3300009177 Bacteria 1041
387 Ga0105248_12424132 3300009177 Bacteria 598
388 Ga0105248_13092700 3300009177 Bacteria 530
389 Ga0105237_10018281 3300009545 Bacteria 7254
390 Ga0105237_10218985 3300009545 Bacteria 1904
391 Ga0105237_10414823 3300009545 Bacteria 1351
392 Ga0105238_10193653 3300009551 Bacteria 2009
393 Ga0105238_10247758 3300009551 Bacteria 1759
394 Ga0105238_10654212 3300009551 Unclassified 1061
395 Ga0105238_10730004 3300009551 Bacteria 1004
396 Ga0105249_10000575 3300009553 Bacteria 33720
397 Ga0105249_10157212 3300009553 Unclassified 2193
398 Ga0105249_10162858 3300009553 Unclassified 2157
399 Ga0105249_10339212 3300009553 Bacteria 1519
400 Ga0105249_13386565 3300009553 Unclassified 513
401 Ga0105239_10051306 3300010375 Bacteria 4522
402 Ga0105239_10140307 3300010375 Bacteria 2693
403 Ga0105239_11148406 3300010375 Unclassified 895
404 Ga0105239_11150712 3300010375 Unclassified 894
405 Ga0105246_10385280 3300011119 Bacteria 1160
406 Ga0105246_10396849 3300011119 Bacteria 1144
407 Ga0105246_10513941 3300011119 Bacteria 1019
408 Ga0105246_10915898 3300011119 Bacteria 787
409 Ga0105246_12263906 3300011119 Unclassified 530
410 Ga0157373_10518316 3300013100 Bacteria 862
411 Ga0157371_10098997 3300013102 Bacteria 2068
412 Ga0157371_10650840 3300013102 Bacteria 786
413 Ga0157371_11435265 3300013102 Unclassified 537
414 Ga0157369_10077988 3300013105 Bacteria 3550
415 Ga0157369_10110846 3300013105 Unclassified 2917
416 Ga0157369_10182355 3300013105 Bacteria 2209
417 Ga0157369_10324275 3300013105 Bacteria 1601
418 Ga0157369_10581058 3300013105 Bacteria 1157
419 Ga0157374_10187548 3300013296 Bacteria 2022
420 Ga0157374_10665322 3300013296 Unclassified 1053
421 Ga0157374_11331313 3300013296 Unclassified 740
422 Ga0157374_11533070 3300013296 Unclassified 690
423 Ga0157378_10252660 3300013297 Unclassified 1688
424 Ga0157378_10337837 3300013297 Unclassified 1468
425 Ga0157378_10426183 3300013297 Bacteria 1312
426 Ga0157378_10678069 3300013297 Bacteria 1048
427 Ga0157378_11748592 3300013297 Bacteria 669
428 Ga0157378_11914503 3300013297 Bacteria 642
429 Ga0157378_12856308 3300013297 Unclassified 535
430 Ga0157378_12945605 3300013297 Unclassified 528
431 Ga0157378_13286061 3300013297 Unclassified 502
432 Ga0163162_10610606 3300013306 Unclassified 1216
433 Ga0163162_10693155 3300013306 Unclassified 1141
434 Ga0163162_10772202 3300013306 Bacteria 1079
435 Ga0163162_11212122 3300013306 Unclassified 857
436 Ga0163162_11708247 3300013306 Unclassified 719
437 Ga0163162_12505867 3300013306 Bacteria 593
438 Ga0157372_10073774 3300013307 Bacteria 3847
439 Ga0157372_10224975 3300013307 Unclassified 2175
440 Ga0157372_11614229 3300013307 Bacteria 746
441 Ga0157372_11807962 3300013307 Bacteria 703
442 Ga0157372_12347356 3300013307 Unclassified 613
443 Ga0157375_10366339 3300013308 Bacteria 1607
444 Ga0157375_10472610 3300013308 Bacteria 1419
445 Ga0157375_10880022 3300013308 Bacteria 1041
446 Ga0157375_11374836 3300013308 Bacteria 831
447 Ga0157375_12829824 3300013308 Unclassified 580
448 Ga0157375_13577226 3300013308 Bacteria 517
449 Ga0163163_10009538 3300014325 Bacteria 8671
450 Ga0163163_10013787 3300014325 Bacteria 7411
451 Ga0163163_10031393 3300014325 Bacteria 5127
452 Ga0163163_10081016 3300014325 Bacteria 3247
453 Ga0163163_10218222 3300014325 Unclassified 1956
454 Ga0163163_10450901 3300014325 Bacteria 1347
455 Ga0163163_11263366 3300014325 Bacteria 801
456 Ga0163163_11611513 3300014325 Bacteria 710
457 Ga0157380_10017178 3300014326 Bacteria 5351
458 Ga0157380_10030544 3300014326 Bacteria 4128
459 Ga0157380_10070030 3300014326 Bacteria 2833
460 Ga0157380_10200705 3300014326 Bacteria 1769
461 Ga0157380_12550446 3300014326 Unclassified 577
462 Ga0157377_10248803 3300014745 Unclassified 1151
463 Ga0157379_10105435 3300014968 Bacteria 2530
464 Ga0157379_10126249 3300014968 Bacteria 2302
465 Ga0157379_12038670 3300014968 Bacteria 568
466 Ga0157376_10245643 3300014969 Bacteria 1669
467 Ga0157376_10423107 3300014969 Unclassified 1293
468 Ga0157376_11390312 3300014969 Unclassified 733
469 Ga0157376_11644641 3300014969 Unclassified 677
470 Ga0157376_12349454 3300014969 Unclassified 572
471 Ga0182005_1078999 3300015265 Bacteria 907
472 Ga0163161_10522853 3300017792 Unclassified 969
473 Ga0163161_11518201 3300017792 Bacteria 588
474 Ga0213873_10147142 3300021358 Unclassified 707
475 Ga0213876_10000206 3300021384 Bacteria 59646
476 Ga0213876_10023144 3300021384 Unclassified 3282
477 Ga0213876_10097677 3300021384 Bacteria 1556
478 Ga0213876_10143304 3300021384 Bacteria 1271
479 Ga0213875_10012134 3300021388 Unclassified 4262
480 Ga0213875_10039681 3300021388 Bacteria 2218
481 Ga0213875_10135683 3300021388 Bacteria 1151
482 Ga0213875_10193174 3300021388 Bacteria 957
483 Ga0213875_10193905 3300021388 Unclassified 955
484 Ga0213875_10580513 3300021388 Bacteria 541
485 Ga0213871_10100652 3300021441 Unclassified 845
486 Ga0207697_10007722 3300025315 Bacteria 4767
487 Ga0207656_10015913 3300025321 Bacteria 2919
488 Ga0207656_10320170 3300025321 Bacteria 770
489 Ga0207682_10154334 3300025893 Bacteria 1037
490 Ga0207682_10244679 3300025893 Bacteria 834
491 Ga0207682_10357048 3300025893 Unclassified 689
492 Ga0207692_10216577 3300025898 Unclassified 1133
493 Ga0207642_10329846 3300025899 Bacteria 894
494 Ga0207710_10257171 3300025900 Bacteria 874
495 Ga0207688_10550961 3300025901 Unclassified 725
496 Ga0207680_10153678 3300025903 Bacteria 1536
497 Ga0207680_10386534 3300025903 Bacteria 987
498 Ga0207647_10132759 3300025904 Bacteria 1463
499 Ga0207647_10591242 3300025904 Bacteria 613
500 Ga0207647_10701094 3300025904 Bacteria 552
501 Ga0207685_10073708 3300025905 Bacteria 1392
502 Ga0207699_10000041 3300025906 Bacteria 120229
503 Ga0207699_10175088 3300025906 Bacteria 1438
504 Ga0207699_10264877 3300025906 Unclassified 1189
505 Ga0207699_10415383 3300025906 Bacteria 960
506 Ga0207699_10454972 3300025906 Bacteria 919
507 Ga0207645_10014818 3300025907 Bacteria 5204
508 Ga0207645_10292592 3300025907 Bacteria 1083
509 Ga0207645_10343750 3300025907 Bacteria 998
510 Ga0207643_10006545 3300025908 Bacteria 6244
511 Ga0207643_10335355 3300025908 Bacteria 947
512 Ga0207643_11045959 3300025908 Unclassified 527
513 Ga0207705_11432835 3300025909 Bacteria 524
514 Ga0207684_10016942 3300025910 Bacteria 6260
515 Ga0207684_10855643 3300025910 Bacteria 766
516 Ga0207684_11176035 3300025910 Unclassified 636
517 Ga0207684_11541010 3300025910 Unclassified 540
518 Ga0207654_10257396 3300025911 Bacteria 1172
519 Ga0207707_10013498 3300025912 Bacteria 7120
520 Ga0207707_10033085 3300025912 Bacteria 4524
521 Ga0207707_10061107 3300025912 Bacteria 3278
522 Ga0207695_10048750 3300025913 Bacteria 4471
523 Ga0207695_10242933 3300025913 Bacteria 1701
524 Ga0207695_10770162 3300025913 Bacteria 843
525 Ga0207671_10022782 3300025914 Bacteria 4731
526 Ga0207671_10653801 3300025914 Unclassified 837
527 Ga0207693_10037588 3300025915 Bacteria 3816
528 Ga0207693_10075667 3300025915 Bacteria 2636
529 Ga0207693_10467346 3300025915 Unclassified 985
530 Ga0207693_10854613 3300025915 Unclassified 700
531 Ga0207663_10155012 3300025916 Unclassified 1610
532 Ga0207660_10014478 3300025917 Bacteria 5189
533 Ga0207660_10057596 3300025917 Bacteria 2784
534 Ga0207660_11163444 3300025917 Unclassified 628
535 Ga0207662_10006257 3300025918 Bacteria 6412
536 Ga0207662_10031007 3300025918 Bacteria 3106
537 Ga0207657_10105516 3300025919 Bacteria 2332
538 Ga0207657_10123410 3300025919 Bacteria 2129
539 Ga0207657_10248876 3300025919 Unclassified 1417
540 Ga0207657_10460905 3300025919 Bacteria 997
541 Ga0207649_10010961 3300025920 Bacteria 4986
542 Ga0207649_10023497 3300025920 Bacteria 3571
543 Ga0207649_10044817 3300025920 Bacteria 2709
544 Ga0207649_10086988 3300025920 Bacteria 2038
545 Ga0207649_10170768 3300025920 Unclassified 1515
546 Ga0207652_10027842 3300025921 Bacteria 4713
547 Ga0207652_10194704 3300025921 Bacteria 1823
548 Ga0207646_10448425 3300025922 Bacteria 1164
549 Ga0207646_10912011 3300025922 Unclassified 779
550 Ga0207646_11194520 3300025922 Bacteria 667
551 Ga0207681_10000550 3300025923 Bacteria 25892
552 Ga0207681_10906346 3300025923 Unclassified 738
553 Ga0207694_10088562 3300025924 Bacteria 2440
554 Ga0207694_10313981 3300025924 Bacteria 1293
555 Ga0207694_10327190 3300025924 Unclassified 1266
556 Ga0207694_10498669 3300025924 Bacteria 1019
557 Ga0207694_10836087 3300025924 Unclassified 778
558 Ga0207694_11163536 3300025924 Unclassified 653
559 Ga0207650_10208118 3300025925 Bacteria 1570
560 Ga0207650_10267264 3300025925 Unclassified 1389
561 Ga0207650_10283208 3300025925 Bacteria 1350
562 Ga0207650_10646628 3300025925 Bacteria 891
563 Ga0207650_10820936 3300025925 Bacteria 788
564 Ga0207659_10039573 3300025926 Bacteria 3290
565 Ga0207659_10135140 3300025926 Bacteria 1908
566 Ga0207659_10646234 3300025926 Unclassified 904
567 Ga0207659_10733135 3300025926 Unclassified 847
568 Ga0207687_11495422 3300025927 Bacteria 580
569 Ga0207700_10071873 3300025928 Unclassified 2666
570 Ga0207700_10352709 3300025928 Unclassified 1281
571 Ga0207664_10057224 3300025929 Bacteria 3099
572 Ga0207664_11264385 3300025929 Bacteria 657
573 Ga0207644_10110086 3300025931 Unclassified 2082
574 Ga0207690_10155523 3300025932 Bacteria 1699
575 Ga0207690_10555137 3300025932 Unclassified 934
576 Ga0207690_10914189 3300025932 Bacteria 728
577 Ga0207706_10000408 3300025933 Bacteria 46179
578 Ga0207706_10028618 3300025933 Bacteria 4976
579 Ga0207706_10031686 3300025933 Unclassified 4708
580 Ga0207706_10125485 3300025933 Bacteria 2257
581 Ga0207706_10152449 3300025933 Bacteria 2033
582 Ga0207706_10684825 3300025933 Unclassified 877
583 Ga0207686_10568614 3300025934 Bacteria 888
584 Ga0207686_11150041 3300025934 Unclassified 634
585 Ga0207709_10236795 3300025935 Bacteria 1325
586 Ga0207670_10090290 3300025936 Unclassified 2164
587 Ga0207670_10141330 3300025936 Bacteria 1776
588 Ga0207670_10695221 3300025936 Bacteria 841
589 Ga0207670_11080580 3300025936 Unclassified 677
590 Ga0207669_10710356 3300025937 Bacteria 827
591 Ga0207669_11060438 3300025937 Unclassified 683
592 Ga0207704_10121560 3300025938 Bacteria 1788
593 Ga0207704_10251840 3300025938 Bacteria 1326
594 Ga0207704_10935001 3300025938 Bacteria 731
595 Ga0207665_10167738 3300025939 Bacteria 1583
596 Ga0207665_10181610 3300025939 Bacteria 1524
597 Ga0207665_10318729 3300025939 Unclassified 1166
598 Ga0207665_11359046 3300025939 Unclassified 566
599 Ga0207691_10001059 3300025940 Bacteria 27335
600 Ga0207691_10003253 3300025940 Bacteria 15828
601 Ga0207691_10259415 3300025940 Bacteria 1498
602 Ga0207691_10291030 3300025940 Unclassified 1404
603 Ga0207691_10856994 3300025940 Bacteria 762
604 Ga0207711_10000012 3300025941 Bacteria 515147
605 Ga0207711_10000063 3300025941 Bacteria 121296
606 Ga0207711_10018490 3300025941 Bacteria 5795
607 Ga0207711_10099650 3300025941 Bacteria 2569
608 Ga0207711_10150239 3300025941 Bacteria 2101
609 Ga0207711_10322538 3300025941 Bacteria 1427
610 Ga0207711_11615190 3300025941 Bacteria 592
611 Ga0207689_10083503 3300025942 Unclassified 2626
612 Ga0207689_10489377 3300025942 Bacteria 1030
613 Ga0207689_10811480 3300025942 Unclassified 790
614 Ga0207689_11526002 3300025942 Unclassified 557
615 Ga0207661_10030958 3300025944 Bacteria 4127
616 Ga0207661_10043586 3300025944 Bacteria 3542
617 Ga0207661_10122341 3300025944 Bacteria 2217
618 Ga0207661_10201599 3300025944 Unclassified 1749
619 Ga0207661_10506913 3300025944 Bacteria 1103
620 Ga0207661_11104544 3300025944 Bacteria 730
621 Ga0207679_10009699 3300025945 Bacteria 6172
622 Ga0207679_10165370 3300025945 Unclassified 1816
623 Ga0207679_10273865 3300025945 Bacteria 1445
624 Ga0207679_10394381 3300025945 Bacteria 1216
625 Ga0207679_10643763 3300025945 Bacteria 958
626 Ga0207679_11289916 3300025945 Bacteria 670
627 Ga0207667_10083340 3300025949 Unclassified 3311
628 Ga0207651_10117426 3300025960 Bacteria 2010
629 Ga0207651_10291987 3300025960 Bacteria 1352
630 Ga0207651_10419642 3300025960 Bacteria 1142
631 Ga0207651_10788294 3300025960 Unclassified 842
632 Ga0207651_11264869 3300025960 Bacteria 663
633 Ga0207651_11963549 3300025960 Bacteria 526
634 Ga0207712_10000952 3300025961 Bacteria 20873
635 Ga0207712_10108477 3300025961 Unclassified 2077
636 Ga0207668_10092371 3300025972 Bacteria 2227
637 Ga0207668_10500263 3300025972 Unclassified 1045
638 Ga0207640_10289857 3300025981 Unclassified 1290
639 Ga0207640_11334165 3300025981 Bacteria 641
640 Ga0207640_11510088 3300025981 Unclassified 604
641 Ga0207658_10280876 3300025986 Unclassified 1427
642 Ga0207677_10062111 3300026023 Bacteria 2590
643 Ga0207677_10458568 3300026023 Unclassified 1093
644 Ga0207677_10989500 3300026023 Bacteria 762
645 Ga0207677_11838646 3300026023 Bacteria 562
646 Ga0207703_10958589 3300026035 Bacteria 820
647 Ga0207703_11080271 3300026035 Bacteria 771
648 Ga0207703_11225203 3300026035 Bacteria 721
649 Ga0207639_10042113 3300026041 Unclassified 3421
650 Ga0207678_10115178 3300026067 Bacteria 2293
651 Ga0207678_11023667 3300026067 Bacteria 731
652 Ga0207678_11033199 3300026067 Bacteria 727
653 Ga0207678_11394160 3300026067 Bacteria 620
654 Ga0207678_11874085 3300026067 Unclassified 524
655 Ga0207708_10192914 3300026075 Bacteria 1622
656 Ga0207702_10045580 3300026078 Bacteria 3688
657 Ga0207702_10051399 3300026078 Unclassified 3482
658 Ga0207702_10226761 3300026078 Unclassified 1744
659 Ga0207702_10400077 3300026078 Bacteria 1324
660 Ga0207702_12011658 3300026078 Unclassified 568
661 Ga0207702_12427773 3300026078 Unclassified 511
662 Ga0207641_10011867 3300026088 Bacteria 7148
663 Ga0207641_10096014 3300026088 Bacteria 2603
664 Ga0207641_10253684 3300026088 Bacteria 1644
665 Ga0207641_10464959 3300026088 Bacteria 1224
666 Ga0207641_12467815 3300026088 Bacteria 518
667 Ga0207641_12582032 3300026088 Unclassified 506
668 Ga0207648_10016223 3300026089 Bacteria 6815
669 Ga0207648_10238007 3300026089 Bacteria 1620
670 Ga0207648_11588780 3300026089 Unclassified 615
671 Ga0207676_10028909 3300026095 Bacteria 4146
672 Ga0207676_10189178 3300026095 Bacteria 1810
673 Ga0207676_11307582 3300026095 Unclassified 720
674 Ga0207676_11945953 3300026095 Bacteria 587
675 Ga0207676_12148929 3300026095 Bacteria 556
676 Ga0207676_12386893 3300026095 Bacteria 526
677 Ga0207674_10000409 3300026116 Bacteria 55809
678 Ga0207674_10000815 3300026116 Bacteria 40507
679 Ga0207674_10004412 3300026116 Bacteria 16954
680 Ga0207674_10042814 3300026116 Bacteria 4673
681 Ga0207674_10147842 3300026116 Bacteria 2308
682 Ga0207674_10676470 3300026116 Bacteria 996
683 Ga0207674_11523430 3300026116 Unclassified 638
684 Ga0207674_11542572 3300026116 Unclassified 633
685 Ga0207675_100000465 3300026118 Bacteria 39473
686 Ga0207675_100047183 3300026118 Bacteria 4022
687 Ga0207675_100142753 3300026118 Unclassified 2275
688 Ga0207675_100319211 3300026118 Bacteria 1516
689 Ga0207675_100371633 3300026118 Bacteria 1405
690 Ga0207675_101107025 3300026118 Bacteria 812
691 Ga0207675_102354458 3300026118 Unclassified 545
692 Ga0207683_10060993 3300026121 Bacteria 3317
693 Ga0207683_10271784 3300026121 Bacteria 1548
694 Ga0207683_11262652 3300026121 Bacteria 684
695 Ga0207698_10365494 3300026142 Unclassified 1368
696 Ga0207698_10620786 3300026142 Bacteria 1068
697 Ga0207698_10829203 3300026142 Bacteria 929
698 Ga0209981_1025677 3300027378 Unclassified 853
699 Ga0209996_1076888 3300027395 Bacteria 522
700 Ga0209995_1074634 3300027471 Bacteria 581
701 Ga0209974_10120436 3300027876 Bacteria 929
702 Ga0207428_10274170 3300027907 Bacteria 1253
703 Ga0268266_10019400 3300028379 Bacteria 5790
704 Ga0268266_10048329 3300028379 Bacteria 3647
705 Ga0268266_10181009 3300028379 Bacteria 1919
706 Ga0268266_10195470 3300028379 Bacteria 1849
707 Ga0268265_10032898 3300028380 Bacteria 3763
708 Ga0268265_10304035 3300028380 Bacteria 1437
709 Ga0268264_10741153 3300028381 Bacteria 978
710 Ga0268264_11396691 3300028381 Bacteria 711
711 Ga0268264_12349013 3300028381 Unclassified 540
712 Ga0265318_10203881 3300028577 Bacteria 723
713 Ga0265336_10076894 3300028666 Bacteria 997
714 Ga0265338_10015988 3300028800 Bacteria 8203
715 Ga0265338_10206542 3300028800 Bacteria 1477
716 Ga0265324_10090892 3300029957 Bacteria 1038
717 Ga0265324_10095033 3300029957 Bacteria 1014
718 Ga0265762_1076621 3300030760 Unclassified 710
719 Ga0265770_1012381 3300030878 Bacteria 1263
720 Ga0265332_10010511 3300031238 Bacteria 4121
721 Ga0265332_10029395 3300031238 Unclassified 2403
722 Ga0265332_10134446 3300031238 Bacteria 1037
723 Ga0265328_10087219 3300031239 Bacteria 1152
724 Ga0265328_10172109 3300031239 Bacteria 818
725 Ga0265328_10252018 3300031239 Unclassified 676
726 Ga0265320_10156777 3300031240 Bacteria 1026
727 Ga0265329_10020834 3300031242 Unclassified 2210
728 Ga0265340_10508202 3300031247 Bacteria 530
729 Ga0265339_10001981 3300031249 Bacteria 15057
730 Ga0265331_10001122 3300031250 Bacteria 20520
731 Ga0265316_10010261 3300031344 Bacteria 8546
732 Ga0265316_10052198 3300031344 Bacteria 3208
733 Ga0265316_11010204 3300031344 Bacteria 579
734 Ga0265316_11287756 3300031344 Bacteria 505
735 Ga0307408_100019101 3300031548 Bacteria 4612
736 Ga0316575_10189927 3300031665 Bacteria 854
737 Ga0265314_10010188 3300031711 Bacteria 7872
738 Ga0265314_10342152 3300031711 Bacteria 825
739 Ga0265342_10053136 3300031712 Bacteria 2412
740 Ga0265342_10106319 3300031712 Bacteria 1593
741 Ga0307405_10369717 3300031731 Unclassified 1112
742 Ga0307413_10293865 3300031824 Unclassified 1229
743 Ga0307413_10950949 3300031824 Unclassified 733
744 Ga0307410_10449162 3300031852 Unclassified 1051
745 Ga0307410_11508171 3300031852 Unclassified 592
746 Ga0307406_10017940 3300031901 Bacteria 4128
747 Ga0307406_10123298 3300031901 Unclassified 1806
748 Ga0307406_10871216 3300031901 Bacteria 765
749 Ga0307407_10721978 3300031903 Bacteria 752
750 Ga0307407_11405098 3300031903 Unclassified 550
751 Ga0307412_10033868 3300031911 Unclassified 3250
752 Ga0307412_10924836 3300031911 Bacteria 766
753 Ga0307409_100090263 3300031995 Unclassified 2508
754 Ga0307409_100693331 3300031995 Bacteria 1017
755 Ga0307409_101466946 3300031995 Bacteria 709
756 Ga0307416_100049701 3300032002 Unclassified 3336
757 Ga0307416_100715213 3300032002 Bacteria 1092
758 Ga0307416_100995648 3300032002 Unclassified 941
759 Ga0307416_102064713 3300032002 Bacteria 672
760 Ga0307414_10144388 3300032004 Bacteria 1868
761 Ga0307414_11461688 3300032004 Unclassified 636
762 Ga0307411_10330721 3300032005 Unclassified 1234
763 Ga0307411_12356559 3300032005 Unclassified 501
764 Ga0307415_100011183 3300032126 Bacteria 5122
765 Ga0307415_100128397 3300032126 Unclassified 1914
766 Ga0307415_100882202 3300032126 Bacteria 823
767 Ga0307415_101568436 3300032126 Bacteria 632
768 Ga0373930_0104598 3300034816 Unclassified 676
769 Ga0373923_0208600 3300035111 Bacteria 905
770 Ga0373941_0329975 3300035115 Bacteria 616
771 Ga0373960_0084997 3300035121 Bacteria 1003
772 Ga0373943_0511796 3300035170 Bacteria 702
773 Ga0373946_0422828 3300035171 Unclassified 675
774 Ga0373946_0702244 3300035171 Unclassified 529
775 Ga0373955_0690088 3300035172 Unclassified 627
776 Ga0373961_0053135 3300035241 Bacteria 1208
777 Ga0373931_0059445 3300035691 Bacteria 2056
778 Ga0373935_0403863 3300035692 Unclassified 982
779 Ga0373935_0973151 3300035692 Bacteria 630
780 Ga0373933_0613021 3300035724 Unclassified 715
781 Ga0373933_0636623 3300035724 Unclassified 701
782 Ga0373933_0670433 3300035724 Unclassified 682
783 Ga0373947_0690174 3300035725 Unclassified 696
784 Ga0373947_0946844 3300035725 Unclassified 588
785 Ga0373937_0435531 3300036401 Bacteria 1245
786 Ga0373937_0630192 3300036401 Bacteria 1017
787 Ga0373925_0577134 3300037068 Bacteria 926
788 Ga0395899_0851077 3300037312 Bacteria 560
789 Ga0395898_1477896 3300037466 Unclassified 606
790 Ga0395905_0286306 3300037471 Bacteria 1535
791 Ga0395905_1365026 3300037471 Bacteria 613
792 Ga0395905_1373870 3300037471 Bacteria 610
793 Ga0395905_1460095 3300037471 Bacteria 588
794 Ga0436364_0071833 3300037853 Unclassified 530
795 Ga0436364_0084445 3300037853 Unclassified 3596
796 Ga0436364_0245695 3300037853 Bacteria 6578
797 Ga0436364_0344295 3300037853 Bacteria 4806
798 Ga0436364_0550968 3300037853 Bacteria 2329
799 Ga0436364_0608459 3300037853 Bacteria 2254
800 Ga0436364_0945746 3300037853 Bacteria 1187
801 Ga0436364_0961976 3300037853 Bacteria 541
802 Ga0436364_1075961 3300037853 Bacteria 6596
803 Ga0436364_1147843 3300037853 Bacteria 5892
804 Ga0436364_1414926 3300037853 Unclassified 2059
805 Ga0395901_2082388 3300038443 Bacteria 513
806 Ga0436365_0235741 3300039437 Bacteria 3785
807 Ga0436365_0281371 3300039437 Bacteria 16997
808 Ga0436365_0420834 3300039437 Bacteria 1411
809 Ga0436365_0747350 3300039437 Bacteria 1657
810 Ga0436365_0798073 3300039437 Bacteria 1953
811 Ga0436365_0880687 3300039437 Bacteria 59690
812 Ga0436365_1242450 3300039437 Unclassified 777
813 Ga0436365_1823448 3300039437 Bacteria 2281
814 Ga0436360_0295315 3300039438 Unclassified 1114
815 Ga0436361_1058012 3300039447 Unclassified 4765
816 Ga0436363_1067817 3300039450 Bacteria 1561
817 Ga0436362_0131534 3300039453 Bacteria 716
818 Ga0436362_0383078 3300039453 Bacteria 633
819 Ga0436362_0875147 3300039453 Unclassified 1292
820 Ga0439461_0107425 3300041410 Unclassified 685
821 Ga0451800_0073639 3300041459 Unclassified 751
822 Ga0451800_1331463 3300041459 Unclassified 522
823 Ga0451807_2070311 3300041486 Bacteria 1866
824 Ga0451835_0018883 3300041492 Unclassified 508
825 Ga0451837_0678076 3300041494 Bacteria 885
826 Ga0451853_0276731 3300041512 Bacteria 1142
827 Ga0451853_2338877 3300041512 Unclassified 611
828 Ga0439448_0202122 3300042005 Bacteria 697
829 Ga0439450_230610 3300042008 Unclassified 500
830 Ga0451577_0497588 3300042876 Bacteria 1107
831 Ga0451577_0942989 3300042876 Bacteria 776
832 Ga0453683_0616396 3300044673 Unclassified 708
833 Ga0453684_0574527 3300044712 Bacteria 1239
834 Ga0466957_0230999 3300044842 Bacteria 1225
835 Ga0451576_0043236 3300045051 Bacteria 4754
836 Ga0451576_0044841 3300045051 Bacteria 4659
837 Ga0451576_1196362 3300045051 Bacteria 794
838 Ga0451576_1510156 3300045051 Unclassified 698
839 Ga0466967_0696264 3300045976 Bacteria 1006
840 Ga0495592_0434321 3300046454 Bacteria 826
841 Ga0495603_0714944 3300046455 Unclassified 573
842 Ga0495641_0394308 3300046461 Unclassified 628
843 Ga0495651_0174839 3300046462 Bacteria 1525
844 Ga0495653_0627869 3300046463 Unclassified 658
845 Ga0495580_0001156 3300046472 Bacteria 23183
846 Ga0495580_0488543 3300046472 Unclassified 823
847 Ga0495580_0951240 3300046472 Unclassified 550
848 Ga0495582_0005527 3300046473 Bacteria 7037
849 Ga0495582_0006475 3300046473 Bacteria 6501
850 Ga0495582_0177409 3300046473 Unclassified 1214
851 Ga0495582_0351593 3300046473 Bacteria 849
852 Ga0495582_0794709 3300046473 Bacteria 547
853 Ga0495639_0009523 3300046475 Bacteria 4169
854 Ga0495662_0044704 3300046476 Bacteria 2138
855 Ga0495662_0065746 3300046476 Bacteria 1753
856 Ga0495662_0242446 3300046476 Unclassified 888
857 Ga0495664_0222015 3300046477 Bacteria 1144
858 Ga0495664_0317542 3300046477 Unclassified 940
859 Ga0495664_0347964 3300046477 Unclassified 893
860 Ga0495664_0353735 3300046477 Unclassified 884
861 Ga0495585_0448032 3300046492 Unclassified 618
862 Ga0495594_0004234 3300046499 Bacteria 7368
863 Ga0495594_0038140 3300046499 Bacteria 2623
864 Ga0495594_0452151 3300046499 Unclassified 730
865 Ga0495608_0037023 3300046511 Bacteria 3282
866 Ga0495608_0047440 3300046511 Bacteria 2856
867 Ga0495608_0258398 3300046511 Bacteria 1085
868 Ga0495618_0105291 3300046514 Unclassified 1806
869 Ga0495628_0030113 3300046516 Unclassified 4396
870 Ga0495630_0070664 3300046517 Bacteria 2626
871 Ga0495630_0095522 3300046517 Bacteria 2247
872 Ga0495630_0559257 3300046517 Unclassified 877
873 Ga0495666_0030172 3300046526 Bacteria 2663
874 Ga0495642_0279535 3300046528 Unclassified 731
875 Ga0495652_0361064 3300046529 Unclassified 1038
876 Ga0495652_0373025 3300046529 Bacteria 1017
877 Ga0495652_0700375 3300046529 Unclassified 682
878 Ga0495665_0129863 3300046531 Bacteria 1319
879 Ga0495665_0482560 3300046531 Unclassified 625
880 Ga0495640_0122118 3300046533 Bacteria 1692
881 Ga0495640_0310523 3300046533 Bacteria 978
882 Ga0495640_0523807 3300046533 Bacteria 720
883 Ga0495586_0119998 3300046535 Bacteria 1468
884 Ga0495586_0290263 3300046535 Bacteria 936
885 Ga0495587_0526678 3300046536 Bacteria 653
886 Ga0495645_0179847 3300046543 Bacteria 1450
887 Ga0495622_0182592 3300046557 Unclassified 940
888 Ga0495667_0016789 3300046559 Bacteria 4945
889 Ga0495667_0054510 3300046559 Bacteria 2631
890 Ga0495667_0131357 3300046559 Bacteria 1615
891 Ga0495667_0251964 3300046559 Bacteria 1124
892 Ga0495634_0007046 3300046642 Bacteria 8480
893 Ga0495634_0223121 3300046642 Bacteria 1162
894 Ga0495635_0048591 3300046663 Bacteria 2925
895 Ga0495635_0294489 3300046663 Bacteria 1089
896 Ga0495635_0874209 3300046663 Unclassified 576
897 Ga0495657_0224750 3300046675 Bacteria 1137
898 Ga0495599_0302474 3300046678 Bacteria 965
899 Ga0495599_0307060 3300046678 Bacteria 957
900 Ga0495623_0261377 3300046679 Bacteria 970
901 Ga0495647_0064481 3300046681 Bacteria 1453
902 Ga0495658_0028050 3300046683 Bacteria 3035
903 Ga0495658_0086255 3300046683 Unclassified 1852
904 Ga0495669_0556401 3300046684 Unclassified 558
905 Ga0495613_0246383 3300046689 Unclassified 1248
906 Ga0495613_0521826 3300046689 Bacteria 798
907 Ga0495613_0634513 3300046689 Bacteria 708
908 Ga0495613_0971914 3300046689 Unclassified 546
909 Ga0495624_0216882 3300046690 Unclassified 1161
910 Ga0495624_0369741 3300046690 Unclassified 862
911 Ga0495670_0429835 3300046691 Unclassified 715
912 Ga0495600_0038111 3300046809 Bacteria 3127
913 Ga0495581_0179579 3300047315 Bacteria 1238
914 Ga0495604_0425665 3300047317 Bacteria 871
915 Ga0495674_0043085 3300047319 Bacteria 4020
916 Ga0495674_0308928 3300047319 Bacteria 1290
917 Ga0495680_0041600 3300047322 Bacteria 3653
918 Ga0495680_0269889 3300047322 Bacteria 1201
919 Ga0495675_0110055 3300047444 Bacteria 1720
920 Ga0495684_0035857 3300047471 Bacteria 3803
921 Ga0495684_0899041 3300047471 Unclassified 570
922 Ga0495593_0098073 3300047673 Bacteria 1505
923 Ga0495593_0499416 3300047673 Bacteria 610
924 Ga0495593_0599636 3300047673 Unclassified 553
925 Ga0495602_0131255 3300048088 Bacteria 1997
926 Ga0495602_0648625 3300048088 Bacteria 721
927 Ga0496100_0241612 3300048903 Unclassified 1333
928 Ga0496102_0008398 3300048905 Bacteria 8847
929 Ga0496102_0610013 3300048905 Unclassified 1014
930 Ga0496102_0755733 3300048905 Unclassified 895
931 Ga0496102_1500267 3300048905 Unclassified 593
932 Ga0496103_0054035 3300048906 Bacteria 2490
933 Ga0496104_0445952 3300048907 Bacteria 1206
934 Ga0496105_0096752 3300048908 Unclassified 2438
935 Ga0496108_0064910 3300048911 Bacteria 3076
936 Ga0496108_0721370 3300048911 Bacteria 864
937 Ga0496108_0799115 3300048911 Bacteria 814
938 Ga0496109_0030769 3300048912 Bacteria 4811
939 Ga0496110_0081672 3300048913 Bacteria 2882
940 Ga0496112_0091004 3300048915 Bacteria 3019
941 Ga0496112_0218186 3300048915 Bacteria 1864
942 Ga0496112_0428700 3300048915 Unclassified 1261
943 Ga0496112_0745299 3300048915 Unclassified 906
944 Ga0496113_0073660 3300048916 Bacteria 2602
945 Ga0496115_0093153 3300048918 Bacteria 2463
946 Ga0496115_0480237 3300048918 Bacteria 1001
947 Ga0496126_0676664 3300048929 Unclassified 804
948 Ga0501290_006760 3300049513 Bacteria 1436
949 Ga0501291_077909 3300049514 Unclassified 655
950 Ga0501292_020009 3300049515 Unclassified 1075
951 Ga0501292_137908 3300049515 Bacteria 508
952 Ga0501296_036365 3300049519 Bacteria 680
953 Ga0501297_009815 3300049520 Bacteria 1075
954 Ga0501298_007554 3300049521 Bacteria 1804
955 Ga0501298_013070 3300049521 Bacteria 1464
956 Ga0501298_044940 3300049521 Unclassified 903
957 Ga0501299_014499 3300049522 Bacteria 1372
958 Ga0501299_026435 3300049522 Unclassified 1096
959 Ga0501299_114242 3300049522 Bacteria 643
960 Ga0501034_1626256 3300049571 Unclassified 519
961 Ga0501041_0149844 3300049577 Bacteria 1456
962 Ga0501041_1080958 3300049577 Unclassified 517
963 Ga0501075_0273874 3300049591 Bacteria 1286
964 Ga0501076_0633222 3300049592 Unclassified 882
965 Ga0501076_0946180 3300049592 Bacteria 710
966 Ga0501198_086517 3300049649 Unclassified 615
967 Ga0501202_143760 3300049652 Unclassified 619
968 Ga0501206_022651 3300049653 Unclassified 902
969 Ga0501208_087532 3300049655 Unclassified 650
970 Ga0501208_092554 3300049655 Unclassified 637
971 Ga0501216_019463 3300049660 Bacteria 1178
972 Ga0501217_009648 3300049661 Bacteria 2103
973 Ga0501217_016676 3300049661 Unclassified 1686
974 Ga0501217_076107 3300049661 Unclassified 921
975 Ga0501217_212845 3300049661 Bacteria 607
976 Ga0501223_023553 3300049663 Unclassified 1200
977 Ga0501224_004561 3300049664 Bacteria 1969
978 Ga0501224_041242 3300049664 Bacteria 698
979 Ga0501228_011412 3300049666 Unclassified 899
980 Ga0501233_027158 3300049668 Bacteria 1269
981 Ga0501233_111223 3300049668 Unclassified 733
982 Ga0501235_001714 3300049669 Bacteria 4706
983 Ga0501239_016392 3300049672 Bacteria 874
984 Ga0501239_076184 3300049672 Bacteria 530
985 Ga0501240_005359 3300049673 Bacteria 1534
986 Ga0501240_110553 3300049673 Bacteria 536
987 Ga0501242_019328 3300049674 Unclassified 870
988 Ga0501243_002924 3300049675 Unclassified 2515
989 Ga0501246_013222 3300049676 Unclassified 782
990 Ga0501247_007552 3300049677 Unclassified 1252
991 Ga0501247_031814 3300049677 Bacteria 724
992 Ga0501249_100801 3300049679 Unclassified 691
993 Ga0501249_158729 3300049679 Unclassified 573
994 Ga0501250_098332 3300049680 Unclassified 518
995 Ga0501251_012585 3300049681 Bacteria 1025
996 Ga0501252_007966 3300049682 Unclassified 1210
997 Ga0501255_001777 3300049684 Bacteria 1799
998 Ga0501257_049001 3300049686 Unclassified 1051
999 Ga0501257_104406 3300049686 Unclassified 747
1000 Ga0501261_005956 3300049690 Unclassified 1545
1001 Ga0501261_123073 3300049690 Unclassified 516
1002 Ga0501221_083632 3300049704 Unclassified 771
1003 Ga0501225_0034047 3300049705 Unclassified 1402
1004 Ga0501225_0101150 3300049705 Unclassified 842
1005 Ga0501225_0307005 3300049705 Unclassified 538
1006 Ga0501229_064728 3300049706 Bacteria 563
1007 Ga0501229_083937 3300049706 Bacteria 513
1008 Ga0501234_019895 3300049707 Unclassified 1066
1009 Ga0501245_011475 3300049708 Unclassified 1290
1010 Ga0501079_0199004 3300049741 Bacteria 1565
1011 Ga0501079_0370742 3300049741 Bacteria 1122
1012 Ga0501080_0667562 3300049742 Unclassified 919
1013 Ga0501081_0151596 3300049743 Bacteria 1665
1014 Ga0501263_050347 3300049760 Bacteria 632
1015 Ga0501263_051868 3300049760 Unclassified 626
1016 Ga0501264_026136 3300049761 Unclassified 647
1017 Ga0501265_023382 3300049762 Bacteria 850
1018 Ga0501265_114680 3300049762 Bacteria 507
1019 Ga0501268_063473 3300049765 Unclassified 736
1020 Ga0501268_100729 3300049765 Bacteria 619
1021 Ga0501270_006461 3300049767 Unclassified 1409
1022 Ga0501270_039599 3300049767 Bacteria 815
1023 Ga0501271_006322 3300049768 Bacteria 1174
1024 Ga0501279_016527 3300049775 Bacteria 1028
1025 Ga0501280_094272 3300049776 Unclassified 568
1026 Ga0501283_001918 3300049779 Bacteria 2687
1027 Ga0501283_026167 3300049779 Unclassified 959
1028 Ga0501035_0786373 3300049822 Bacteria 761
1029 Ga0501044_0477113 3300049823 Unclassified 1151
1030 Ga0501045_0755568 3300049824 Unclassified 717
1031 Ga0501212_036662 3300049851 Bacteria 803
1032 nmdc:mga05p37_107880_c1 3300050507 Unclassified 3425
1033 nmdc:mga05p37_2026779_c1 3300050507 Unclassified 543
1034 nmdc:mga05p37_336502_c1 3300050507 Unclassified 1781
1035 nmdc:mga05p37_554399_c1 3300050507 Bacteria 1307
1036 nmdc:mga05p37_75128_c1 3300050507 Bacteria 4160
1037 nmdc:mga05p37_777537_c1 3300050507 Bacteria 1051
1038 nmdc:mga09592_179882_c1 3300050508 Bacteria 1829
1039 nmdc:mga09592_446432_c1 3300050508 Unclassified 1116
1040 nmdc:mga09592_884699_c1 3300050508 Unclassified 751
1041 nmdc:mga0qj67_1427558_c1 3300050509 Bacteria 534
1042 nmdc:mga06r32_157880_c1 3300050510 Unclassified 2250
1043 nmdc:mga06r32_375826_c1 3300050510 Unclassified 1404
1044 nmdc:mga06r32_39679_c1 3300050510 Bacteria 4468
1045 nmdc:mga06r32_439658_c1 3300050510 Unclassified 1284
1046 nmdc:mga06r32_623792_c1 3300050510 Unclassified 1048
1047 nmdc:mga08y16_473655_c1 3300050511 Bacteria 1275
1048 nmdc:mga08y16_662230_c1 3300050511 Bacteria 1047
1049 nmdc:mga0n895_14141_c1 3300050512 Bacteria 7236
1050 nmdc:mga0n895_185362_c1 3300050512 Bacteria 2112
1051 nmdc:mga0n895_2003103_c1 3300050512 Bacteria 537
1052 nmdc:mga0n895_692996_c1 3300050512 Bacteria 1015
1053 nmdc:mga0n895_725159_c1 3300050512 Bacteria 989
1054 nmdc:mga0n895_773563_c1 3300050512 Unclassified 952
1055 nmdc:mga0n895_883260_c1 3300050512 Bacteria 880
1056 nmdc:mga0rr50_1467314_c1 3300050513 Bacteria 577
1057 nmdc:mga0rr50_43180_c1 3300050513 Bacteria 3297
1058 nmdc:mga08x19_1067473_c1 3300050514 Unclassified 573
1059 nmdc:mga08x19_259321_c1 3300050514 Unclassified 1201
1060 nmdc:mga08x19_277462_c1 3300050514 Bacteria 1161
1061 nmdc:mga08x19_389744_c1 3300050514 Unclassified 976
1062 nmdc:mga08x19_555_c1 3300050514 Bacteria 4833
1063 nmdc:mga08x19_716327_c1 3300050514 Unclassified 710
1064 nmdc:mga0a205_233729_c1 3300050515 Unclassified 1721
1065 Ga0495601_0063207 3300053077 Bacteria 2353
1066 Ga0500635_0284117 3300053080 Bacteria 652
1067 Ga0500644_0027062 3300053088 Bacteria 1781
1068 Ga0500555_051781 3300053103 Bacteria 1122
1069 Ga0500555_106057 3300053103 Bacteria 710
1070 Ga0500595_043978 3300053119 Bacteria 1418
1071 Ga0500627_0133357 3300053158 Unclassified 1122
1072 Ga0500596_065914 3300053735 Unclassified 612
1073 Ga0501084_0193711 3300054114 Bacteria 1715
1074 Ga0590071_090121 3300059421 Bacteria 767
1075 Ga0587066_014514 3300059490 Bacteria 1212
1076 Ga0207675_100495571
1077 Ga0065712_10660374
1078 Ga0065715_10036657
1079 Ga0065715_10182647
1080 Ga0065715_10206825
1081 Ga0065715_10686545
1082 Ga0065707_10005725
1083 Ga0065707_10153081
1084 Ga0065707_10270071
1085 Ga0065707_10386432
1086 Ga0070658_10324717
1087 Ga0070658_10377500
1088 Ga0070676_10126069
1089 Ga0070676_10569696
1090 Ga0070683_100048180
1091 Ga0070683_100058164
1092 Ga0070683_100180310
1093 Ga0070683_100186840
1094 Ga0070683_100214790
1095 Ga0070683_100366706
1096 Ga0070683_100875266
1097 Ga0070683_101580605
1098 Ga0070683_102127131
1099 Ga0070670_100032878
1100 Ga0070670_100039831
1101 Ga0070670_100165886
1102 Ga0070670_100287719
1103 Ga0070677_10784482
1104 Ga0068869_100038165
1105 Ga0068869_100250604
1106 Ga0068869_100317306
1107 Ga0068869_101903253
1108 Ga0070666_10082292
1109 Ga0070666_10167053
1110 Ga0070680_100007133
1111 Ga0070680_100130567
1112 Ga0070680_100271982
1113 Ga0068868_100256491
1114 Ga0068868_100316342
1115 Ga0068868_100595207
1116 Ga0068868_100610189
1117 Ga0068868_101291647
1118 Ga0068868_101830275
1119 Ga0070660_100113504
1120 Ga0070660_100593044
1121 Ga0070660_101398214
1122 Ga0070689_100050282
1123 Ga0070689_100096732
1124 Ga0070689_100709323
1125 Ga0070689_100874938
1126 Ga0070689_101020403
1127 Ga0070687_100005760
1128 Ga0070687_100181136
1129 Ga0070661_100008191
1130 Ga0070661_100397257
1131 Ga0070661_100484310
1132 Ga0070692_10024117
1133 Ga0070668_100028835
1134 Ga0070668_100041989
1135 Ga0070669_100010554
1136 Ga0070669_100014982
1137 Ga0070669_100114733
1138 Ga0070669_100786415
1139 Ga0070675_100058123
1140 Ga0070675_100106446
1141 Ga0070675_100497576
1142 Ga0070675_100554275
1143 Ga0070675_100691126
1144 Ga0070675_100941567
1145 Ga0070671_100098714
1146 Ga0070671_100258870
1147 Ga0070671_101107461
1148 Ga0070674_100237683
1149 Ga0070674_100274107
1150 Ga0070674_100699649
1151 Ga0070674_101193599
1152 Ga0070673_100592426
1153 Ga0070673_100668931
1154 Ga0070673_101674110
1155 Ga0070673_101745764
1156 Ga0070673_101857801
1157 Ga0070688_100346497
1158 Ga0070688_100733954
1159 Ga0070688_100873883
1160 Ga0070659_100030150
1161 Ga0070659_100224607
1162 Ga0070659_100456039
1163 Ga0070659_101463435
1164 Ga0070667_100069000
1165 Ga0070667_101463429
1166 Ga0070667_102129448
1167 Ga0070709_11534376
1168 Ga0070714_100068098
1169 Ga0070714_100271706
1170 Ga0070714_100492161
1171 Ga0070714_100506247
1172 Ga0070713_100038744
1173 Ga0070713_100460516
1174 Ga0070713_100677256
1175 Ga0070713_101408438
1176 Ga0070710_10902612
1177 Ga0070701_10186801
1178 Ga0070711_100026538
1179 Ga0070711_100592807
1180 Ga0070705_100444918
1181 Ga0070705_100900422
1182 Ga0070700_100089669
1183 Ga0070700_100670454
1184 Ga0070694_100123457
1185 Ga0070694_100458843
1186 Ga0070694_100762858
1187 Ga0070708_100261606
1188 Ga0070708_100437115
1189 Ga0070663_100048398
1190 Ga0070663_100365386
1191 Ga0070663_100888077
1192 Ga0070663_101051761
1193 Ga0070663_101921582
1194 Ga0070678_100090652
1195 Ga0070678_100150438
1196 Ga0070678_101654425
1197 Ga0070662_100067643
1198 Ga0070662_100083085
1199 Ga0070662_100275435
1200 Ga0070662_100277436
1201 Ga0070681_10000342
1202 Ga0070681_10000540
1203 Ga0070681_10188496
1204 Ga0068867_100025648
1205 Ga0068867_100031093
1206 Ga0068867_100230564
1207 Ga0068867_100882871
1208 Ga0070685_10241681
1209 Ga0070685_10413548
1210 Ga0070706_100019461
1211 Ga0070706_100022641
1212 Ga0070706_100136440
1213 Ga0070706_100607898
1214 Ga0070706_101110221
1215 Ga0070706_101769679
1216 Ga0070707_100152417
1217 Ga0070707_100315612
1218 Ga0070707_100400964
1219 Ga0070707_100430875
1220 Ga0070707_100938440
1221 Ga0070698_100000807
1222 Ga0070698_100021834
1223 Ga0070698_100029299
1224 Ga0070698_100037758
1225 Ga0070698_100904801
1226 Ga0070699_100000932
1227 Ga0070699_100042673
1228 Ga0070699_100160165
1229 Ga0070699_100396045
1230 Ga0070699_101745354
1231 Ga0070679_100001118
1232 Ga0070679_100094928
1233 Ga0070684_100028747
1234 Ga0070684_100033883
1235 Ga0070684_100148555
1236 Ga0070684_100370080
1237 Ga0070684_100784750
1238 Ga0070684_101063118
1239 Ga0070684_101490097
1240 Ga0070697_100097813
1241 Ga0070697_100123086
1242 Ga0070697_100302832
1243 Ga0070697_100642730
1244 Ga0070697_100704835
1245 Ga0070697_100907185
1246 Ga0068853_100026648
1247 Ga0068853_101964902
1248 Ga0070672_100026379
1249 Ga0070672_100078935
1250 Ga0070672_100199736
1251 Ga0070672_100242100
1252 Ga0070686_100094199
1253 Ga0070695_100738678
1254 Ga0070695_100845637
1255 Ga0070695_101783004
1256 Ga0070696_100024803
1257 Ga0070696_100143523
1258 Ga0070696_100281287
1259 Ga0070696_100329680
1260 Ga0070696_100335105
1261 Ga0070696_100436486
1262 Ga0070696_100941659
1263 Ga0070696_101168568
1264 Ga0070693_100983327
1265 Ga0070665_100064090
1266 Ga0070665_100440955
1267 Ga0070665_102367276
1268 Ga0070704_100360352
1269 Ga0070704_100801675
1270 Ga0070704_101516302
1271 Ga0070704_101519133
1272 Ga0068855_100668579
1273 Ga0070664_100002183
1274 Ga0070664_100021615
1275 Ga0070664_100048449
1276 Ga0070664_100419362
1277 Ga0070664_100532195
1278 Ga0070664_100713440
1279 Ga0070664_100885174
1280 Ga0070664_101602292
1281 Ga0068857_100002781
1282 Ga0068857_100014310
1283 Ga0068857_100165935
1284 Ga0068857_100353045
1285 Ga0068857_100512003
1286 Ga0068857_101585719
1287 Ga0068854_100100973
1288 Ga0068854_100184631
1289 Ga0068854_100377101
1290 Ga0068854_101929406
1291 Ga0068856_100137259
1292 Ga0068856_100771281
1293 Ga0068856_100791106
1294 Ga0068856_102273566
1295 Ga0070702_100169846
1296 Ga0070702_100507407
1297 Ga0068852_100147413
1298 Ga0068852_100157205
1299 Ga0068852_100176039
1300 Ga0068852_100919444
1301 Ga0068852_101692964
1302 Ga0068859_100087820
1303 Ga0068859_100122061
1304 Ga0068859_100162769
1305 Ga0068859_100453637
1306 Ga0068859_100831096
1307 Ga0068859_101963370
1308 Ga0068859_101994992
1309 Ga0068864_100013175
1310 Ga0068864_100040517
1311 Ga0068864_100150045
1312 Ga0068864_100356750
1313 Ga0068864_100580603
1314 Ga0068864_100925682
1315 Ga0068864_101115594
1316 Ga0068864_101689392
1317 Ga0068866_10060789
1318 Ga0068861_100017142
1319 Ga0068861_100105025
1320 Ga0068861_100126622
1321 Ga0068861_100590775
1322 Ga0068861_100783604
1323 Ga0068861_100945778
1324 Ga0068861_101398816
1325 Ga0068851_10191259
1326 Ga0068851_10422233
1327 Ga0068851_10753066
1328 Ga0068870_10004730
1329 Ga0068870_10383105
1330 Ga0068870_10440690
1331 Ga0068863_100006098
1332 Ga0068863_100065803
1333 Ga0068863_100446718
1334 Ga0068863_100890355
1335 Ga0068863_102688735
1336 Ga0068858_100419991
1337 Ga0068858_100783161
1338 Ga0068858_102449797
1339 Ga0068860_100103197
1340 Ga0068860_100124247
1341 Ga0068860_100803622
1342 Ga0068860_101352914
1343 Ga0068862_100002139
1344 Ga0068862_100030031
1345 Ga0068862_100221043
1346 Ga0068862_100266094
1347 Ga0068862_102508543
1348 Ga0081455_10012197
1349 Ga0081455_10041053
1350 Ga0081455_10044796
1351 Ga0081455_10052145
1352 Ga0081455_10510666
1353 Ga0081540_1002800
1354 Ga0081540_1038826
1355 Ga0081539_10000346
1356 Ga0070717_10112750
1357 Ga0070717_10148522
1358 Ga0070717_10432067
1359 Ga0070717_11293225
1360 Ga0070716_100021514
1361 Ga0070712_100047146
1362 Ga0070712_100194498
1363 Ga0070712_100674170
1364 Ga0097621_100197725
1365 Ga0097621_100323174
1366 Ga0097621_100333780
1367 Ga0097621_100657609
1368 Ga0068871_100144991
1369 Ga0068871_100265382
1370 Ga0068871_100470617
1371 Ga0068871_101009500
1372 Ga0075428_100105930
1373 Ga0075428_100147946
1374 Ga0075428_100256489
1375 Ga0075428_100459191
1376 Ga0075428_100467150
1377 Ga0075428_100598582
1378 Ga0075428_100822785
1379 Ga0075428_101584253
1380 Ga0075430_101601138
1381 Ga0075431_100022067
1382 Ga0075431_100046470
1383 Ga0075431_100320914
1384 Ga0075431_101348546
1385 Ga0075433_10428798
1386 Ga0075433_10735655
1387 Ga0075433_10817172
1388 Ga0075433_10947108
1389 Ga0075433_11042595
1390 Ga0075434_100011626
1391 Ga0075434_100049011
1392 Ga0075434_100209988
1393 Ga0075434_100384599
1394 Ga0075434_100983549
1395 Ga0075434_101063208
1396 Ga0075434_101855844
1397 Ga0075429_100120426
1398 Ga0075429_100694077
1399 Ga0075429_101432013
1400 Ga0068865_100073433
1401 Ga0068865_100132500
1402 Ga0075436_100038127
1403 Ga0075436_100286426
1404 Ga0075436_100289977
1405 Ga0075436_100300208
1406 Ga0075436_100527139
1407 Ga0075436_101127692
1408 Ga0075436_101358092
1409 Ga0097620_100087814
1410 Ga0097620_100122047
1411 Ga0097620_100162767
1412 Ga0097620_100453651
1413 Ga0097620_100831175
1414 Ga0097620_101963595
1415 Ga0097620_101994733
1416 Ga0075435_100091492
1417 Ga0075435_100991315
1418 Ga0105240_10006670
1419 Ga0105240_10110797
1420 Ga0105240_11276879
1421 Ga0105240_11447559
1422 Ga0111539_10186107
1423 Ga0111539_10589106
1424 Ga0111539_10602974
1425 Ga0111539_10624407
1426 Ga0111539_12276647
1427 Ga0111539_12711727
1428 Ga0105245_10052246
1429 Ga0105245_10491718
1430 Ga0105245_11196822
1431 Ga0105245_12286554
1432 Ga0105245_12473326
1433 Ga0105247_10102995
1434 Ga0114129_10071093
1435 Ga0114129_10071190
1436 Ga0114129_10300462
1437 Ga0114129_10324579
1438 Ga0114129_10338910
1439 Ga0114129_11145781
1440 Ga0114129_13085928
1441 Ga0105243_11962505
1442 Ga0105243_12070090
1443 Ga0105241_10626006
1444 Ga0105241_10945855
1445 Ga0105241_12296665
1446 Ga0105242_10062799
1447 Ga0105242_10324824
1448 Ga0105242_11520369
1449 Ga0105242_11631902
1450 Ga0105242_12773844
1451 Ga0105248_10000003
1452 Ga0105248_10000056
1453 Ga0105248_10008788
1454 Ga0105248_10017537
1455 Ga0105248_10175016
1456 Ga0105248_10183966
1457 Ga0105248_10185943
1458 Ga0105248_10394385
1459 Ga0105248_10501000
1460 Ga0105248_10516422
1461 Ga0105248_10833146
1462 Ga0105248_12424132
1463 Ga0105248_13092700
1464 Ga0105237_10018281
1465 Ga0105237_10218985
1466 Ga0105237_10414823
1467 Ga0105238_10193653
1468 Ga0105238_10247758
1469 Ga0105238_10654212
1470 Ga0105238_10730004
1471 Ga0105249_10000575
1472 Ga0105249_10157212
1473 Ga0105249_10162858
1474 Ga0105249_10339212
1475 Ga0105249_13386565
1476 Ga0105239_10051306
1477 Ga0105239_10140307
1478 Ga0105239_11148406
1479 Ga0105239_11150712
1480 Ga0105246_10385280
1481 Ga0105246_10396849
1482 Ga0105246_10513941
1483 Ga0105246_10915898
1484 Ga0105246_12263906
1485 Ga0157373_10518316
1486 Ga0157371_10098997
1487 Ga0157371_10650840
1488 Ga0157371_11435265
1489 Ga0157369_10077988
1490 Ga0157369_10110846
1491 Ga0157369_10182355
1492 Ga0157369_10324275
1493 Ga0157369_10581058
1494 Ga0157374_10187548
1495 Ga0157374_10665322
1496 Ga0157374_11331313
1497 Ga0157374_11533070
1498 Ga0157378_10252660
1499 Ga0157378_10337837
1500 Ga0157378_10426183
1501 Ga0157378_10678069
1502 Ga0157378_11748592
1503 Ga0157378_11914503
1504 Ga0157378_12856308
1505 Ga0157378_12945605
1506 Ga0157378_13286061
1507 Ga0163162_10610606
1508 Ga0163162_10693155
1509 Ga0163162_10772202
1510 Ga0163162_11212122
1511 Ga0163162_11708247
1512 Ga0163162_12505867
1513 Ga0157372_10073774
1514 Ga0157372_10224975
1515 Ga0157372_11614229
1516 Ga0157372_11807962
1517 Ga0157372_12347356
1518 Ga0157375_10366339
1519 Ga0157375_10472610
1520 Ga0157375_10880022
1521 Ga0157375_11374836
1522 Ga0157375_12829824
1523 Ga0157375_13577226
1524 Ga0163163_10009538
1525 Ga0163163_10013787
1526 Ga0163163_10031393
1527 Ga0163163_10081016
1528 Ga0163163_10218222
1529 Ga0163163_10450901
1530 Ga0163163_11263366
1531 Ga0163163_11611513
1532 Ga0157380_10017178
1533 Ga0157380_10030544
1534 Ga0157380_10070030
1535 Ga0157380_10200705
1536 Ga0157380_12550446
1537 Ga0157377_10248803
1538 Ga0157379_10105435
1539 Ga0157379_10126249
1540 Ga0157379_12038670
1541 Ga0157376_10245643
1542 Ga0157376_10423107
1543 Ga0157376_11390312
1544 Ga0157376_11644641
1545 Ga0157376_12349454
1546 Ga0182005_1078999
1547 Ga0163161_10522853
1548 Ga0163161_11518201
1549 Ga0213873_10147142
1550 Ga0213876_10000206
1551 Ga0213876_10023144
1552 Ga0213876_10097677
1553 Ga0213876_10143304
1554 Ga0213875_10012134
1555 Ga0213875_10039681
1556 Ga0213875_10135683
1557 Ga0213875_10193174
1558 Ga0213875_10193905
1559 Ga0213875_10580513
1560 Ga0213871_10100652
1561 Ga0207697_10007722
1562 Ga0207656_10015913
1563 Ga0207656_10320170
1564 Ga0207682_10154334
1565 Ga0207682_10244679
1566 Ga0207682_10357048
1567 Ga0207692_10216577
1568 Ga0207642_10329846
1569 Ga0207710_10257171
1570 Ga0207688_10550961
1571 Ga0207680_10153678
1572 Ga0207680_10386534
1573 Ga0207647_10132759
1574 Ga0207647_10591242
1575 Ga0207647_10701094
1576 Ga0207685_10073708
1577 Ga0207699_10000041
1578 Ga0207699_10175088
1579 Ga0207699_10264877
1580 Ga0207699_10415383
1581 Ga0207699_10454972
1582 Ga0207645_10014818
1583 Ga0207645_10292592
1584 Ga0207645_10343750
1585 Ga0207643_10006545
1586 Ga0207643_10335355
1587 Ga0207643_11045959
1588 Ga0207705_11432835
1589 Ga0207684_10016942
1590 Ga0207684_10855643
1591 Ga0207684_11176035
1592 Ga0207684_11541010
1593 Ga0207654_10257396
1594 Ga0207707_10013498
1595 Ga0207707_10033085
1596 Ga0207707_10061107
1597 Ga0207695_10048750
1598 Ga0207695_10242933
1599 Ga0207695_10770162
1600 Ga0207671_10022782
1601 Ga0207671_10653801
1602 Ga0207693_10037588
1603 Ga0207693_10075667
1604 Ga0207693_10467346
1605 Ga0207693_10854613
1606 Ga0207663_10155012
1607 Ga0207660_10014478
1608 Ga0207660_10057596
1609 Ga0207660_11163444
1610 Ga0207662_10006257
1611 Ga0207662_10031007
1612 Ga0207657_10105516
1613 Ga0207657_10123410
1614 Ga0207657_10248876
1615 Ga0207657_10460905
1616 Ga0207649_10010961
1617 Ga0207649_10023497
1618 Ga0207649_10044817
1619 Ga0207649_10086988
1620 Ga0207649_10170768
1621 Ga0207652_10027842
1622 Ga0207652_10194704
1623 Ga0207646_10448425
1624 Ga0207646_10912011
1625 Ga0207646_11194520
1626 Ga0207681_10000550
1627 Ga0207681_10906346
1628 Ga0207694_10088562
1629 Ga0207694_10313981
1630 Ga0207694_10327190
1631 Ga0207694_10498669
1632 Ga0207694_10836087
1633 Ga0207694_11163536
1634 Ga0207650_10208118
1635 Ga0207650_10267264
1636 Ga0207650_10283208
1637 Ga0207650_10646628
1638 Ga0207650_10820936
1639 Ga0207659_10039573
1640 Ga0207659_10135140
1641 Ga0207659_10646234
1642 Ga0207659_10733135
1643 Ga0207687_11495422
1644 Ga0207700_10071873
1645 Ga0207700_10352709
1646 Ga0207664_10057224
1647 Ga0207664_11264385
1648 Ga0207644_10110086
1649 Ga0207690_10155523
1650 Ga0207690_10555137
1651 Ga0207690_10914189
1652 Ga0207706_10000408
1653 Ga0207706_10028618
1654 Ga0207706_10031686
1655 Ga0207706_10125485
1656 Ga0207706_10152449
1657 Ga0207706_10684825
1658 Ga0207686_10568614
1659 Ga0207686_11150041
1660 Ga0207709_10236795
1661 Ga0207670_10090290
1662 Ga0207670_10141330
1663 Ga0207670_10695221
1664 Ga0207670_11080580
1665 Ga0207669_10710356
1666 Ga0207669_11060438
1667 Ga0207704_10121560
1668 Ga0207704_10251840
1669 Ga0207704_10935001
1670 Ga0207665_10167738
1671 Ga0207665_10181610
1672 Ga0207665_10318729
1673 Ga0207665_11359046
1674 Ga0207691_10001059
1675 Ga0207691_10003253
1676 Ga0207691_10259415
1677 Ga0207691_10291030
1678 Ga0207691_10856994
1679 Ga0207711_10000012
1680 Ga0207711_10000063
1681 Ga0207711_10018490
1682 Ga0207711_10099650
1683 Ga0207711_10150239
1684 Ga0207711_10322538
1685 Ga0207711_11615190
1686 Ga0207689_10083503
1687 Ga0207689_10489377
1688 Ga0207689_10811480
1689 Ga0207689_11526002
1690 Ga0207661_10030958
1691 Ga0207661_10043586
1692 Ga0207661_10122341
1693 Ga0207661_10201599
1694 Ga0207661_10506913
1695 Ga0207661_11104544
1696 Ga0207679_10009699
1697 Ga0207679_10165370
1698 Ga0207679_10273865
1699 Ga0207679_10394381
1700 Ga0207679_10643763
1701 Ga0207679_11289916
1702 Ga0207667_10083340
1703 Ga0207651_10117426
1704 Ga0207651_10291987
1705 Ga0207651_10419642
1706 Ga0207651_10788294
1707 Ga0207651_11264869
1708 Ga0207651_11963549
1709 Ga0207712_10000952
1710 Ga0207712_10108477
1711 Ga0207668_10092371
1712 Ga0207668_10500263
1713 Ga0207640_10289857
1714 Ga0207640_11334165
1715 Ga0207640_11510088
1716 Ga0207658_10280876
1717 Ga0207677_10062111
1718 Ga0207677_10458568
1719 Ga0207677_10989500
1720 Ga0207677_11838646
1721 Ga0207703_10958589
1722 Ga0207703_11080271
1723 Ga0207703_11225203
1724 Ga0207639_10042113
1725 Ga0207678_10115178
1726 Ga0207678_11023667
1727 Ga0207678_11033199
1728 Ga0207678_11394160
1729 Ga0207678_11874085
1730 Ga0207708_10192914
1731 Ga0207702_10045580
1732 Ga0207702_10051399
1733 Ga0207702_10226761
1734 Ga0207702_10400077
1735 Ga0207702_12011658
1736 Ga0207702_12427773
1737 Ga0207641_10011867
1738 Ga0207641_10096014
1739 Ga0207641_10253684
1740 Ga0207641_10464959
1741 Ga0207641_12467815
1742 Ga0207641_12582032
1743 Ga0207648_10016223
1744 Ga0207648_10238007
1745 Ga0207648_11588780
1746 Ga0207676_10028909
1747 Ga0207676_10189178
1748 Ga0207676_11307582
1749 Ga0207676_11945953
1750 Ga0207676_12148929
1751 Ga0207676_12386893
1752 Ga0207674_10000409
1753 Ga0207674_10000815
1754 Ga0207674_10004412
1755 Ga0207674_10042814
1756 Ga0207674_10147842
1757 Ga0207674_10676470
1758 Ga0207674_11523430
1759 Ga0207674_11542572
1760 Ga0207675_100000465
1761 Ga0207675_100047183
1762 Ga0207675_100142753
1763 Ga0207675_100319211
1764 Ga0207675_100371633
1765 Ga0207675_101107025
1766 Ga0207675_102354458
1767 Ga0207683_10060993
1768 Ga0207683_10271784
1769 Ga0207683_11262652
1770 Ga0207698_10365494
1771 Ga0207698_10620786
1772 Ga0207698_10829203
1773 Ga0209981_1025677
1774 Ga0209996_1076888
1775 Ga0209995_1074634
1776 Ga0209974_10120436
1777 Ga0207428_10274170
1778 Ga0268266_10019400
1779 Ga0268266_10048329
1780 Ga0268266_10181009
1781 Ga0268266_10195470
1782 Ga0268265_10032898
1783 Ga0268265_10304035
1784 Ga0268264_10741153
1785 Ga0268264_11396691
1786 Ga0268264_12349013
1787 Ga0265318_10203881
1788 Ga0265336_10076894
1789 Ga0265338_10015988
1790 Ga0265338_10206542
1791 Ga0265324_10090892
1792 Ga0265324_10095033
1793 Ga0265762_1076621
1794 Ga0265770_1012381
1795 Ga0265332_10010511
1796 Ga0265332_10029395
1797 Ga0265332_10134446
1798 Ga0265328_10087219
1799 Ga0265328_10172109
1800 Ga0265328_10252018
1801 Ga0265320_10156777
1802 Ga0265329_10020834
1803 Ga0265340_10508202
1804 Ga0265339_10001981
1805 Ga0265331_10001122
1806 Ga0265316_10010261
1807 Ga0265316_10052198
1808 Ga0265316_11010204
1809 Ga0265316_11287756
1810 Ga0307408_100019101
1811 Ga0316575_10189927
1812 Ga0265314_10010188
1813 Ga0265314_10342152
1814 Ga0265342_10053136
1815 Ga0265342_10106319
1816 Ga0307405_10369717
1817 Ga0307413_10293865
1818 Ga0307413_10950949
1819 Ga0307410_10449162
1820 Ga0307410_11508171
1821 Ga0307406_10017940
1822 Ga0307406_10123298
1823 Ga0307406_10871216
1824 Ga0307407_10721978
1825 Ga0307407_11405098
1826 Ga0307412_10033868
1827 Ga0307412_10924836
1828 Ga0307409_100090263
1829 Ga0307409_100693331
1830 Ga0307409_101466946
1831 Ga0307416_100049701
1832 Ga0307416_100715213
1833 Ga0307416_100995648
1834 Ga0307416_102064713
1835 Ga0307414_10144388
1836 Ga0307414_11461688
1837 Ga0307411_10330721
1838 Ga0307411_12356559
1839 Ga0307415_100011183
1840 Ga0307415_100128397
1841 Ga0307415_100882202
1842 Ga0307415_101568436
1843 Ga0373930_0104598
1844 Ga0373923_0208600
1845 Ga0373941_0329975
1846 Ga0373960_0084997
1847 Ga0373943_0511796
1848 Ga0373946_0422828
1849 Ga0373946_0702244
1850 Ga0373955_0690088
1851 Ga0373961_0053135
1852 Ga0373931_0059445
1853 Ga0373935_0403863
1854 Ga0373935_0973151
1855 Ga0373933_0613021
1856 Ga0373933_0636623
1857 Ga0373933_0670433
1858 Ga0373947_0690174
1859 Ga0373947_0946844
1860 Ga0373937_0435531
1861 Ga0373937_0630192
1862 Ga0373925_0577134
1863 Ga0395899_0851077
1864 Ga0395898_1477896
1865 Ga0395905_0286306
1866 Ga0395905_1365026
1867 Ga0395905_1373870
1868 Ga0395905_1460095
1869 Ga0436364_0071833
1870 Ga0436364_0084445
1871 Ga0436364_0245695
1872 Ga0436364_0344295
1873 Ga0436364_0550968
1874 Ga0436364_0608459
1875 Ga0436364_0945746
1876 Ga0436364_0961976
1877 Ga0436364_1075961
1878 Ga0436364_1147843
1879 Ga0436364_1414926
1880 Ga0395901_2082388
1881 Ga0436365_0235741
1882 Ga0436365_0281371
1883 Ga0436365_0420834
1884 Ga0436365_0747350
1885 Ga0436365_0798073
1886 Ga0436365_0880687
1887 Ga0436365_1242450
1888 Ga0436365_1823448
1889 Ga0436360_0295315
1890 Ga0436361_1058012
1891 Ga0436363_1067817
1892 Ga0436362_0131534
1893 Ga0436362_0383078
1894 Ga0436362_0875147
1895 Ga0439461_0107425
1896 Ga0451800_0073639
1897 Ga0451800_1331463
1898 Ga0451807_2070311
1899 Ga0451835_0018883
1900 Ga0451837_0678076
1901 Ga0451853_0276731
1902 Ga0451853_2338877
1903 Ga0439448_0202122
1904 Ga0439450_230610
1905 Ga0451577_0497588
1906 Ga0451577_0942989
1907 Ga0453683_0616396
1908 Ga0453684_0574527
1909 Ga0466957_0230999
1910 Ga0451576_0043236
1911 Ga0451576_0044841
1912 Ga0451576_1196362
1913 Ga0451576_1510156
1914 Ga0466967_0696264
1915 Ga0495592_0434321
1916 Ga0495603_0714944
1917 Ga0495641_0394308
1918 Ga0495651_0174839
1919 Ga0495653_0627869
1920 Ga0495580_0001156
1921 Ga0495580_0488543
1922 Ga0495580_0951240
1923 Ga0495582_0005527
1924 Ga0495582_0006475
1925 Ga0495582_0177409
1926 Ga0495582_0351593
1927 Ga0495582_0794709
1928 Ga0495639_0009523
1929 Ga0495662_0044704
1930 Ga0495662_0065746
1931 Ga0495662_0242446
1932 Ga0495664_0222015
1933 Ga0495664_0317542
1934 Ga0495664_0347964
1935 Ga0495664_0353735
1936 Ga0495585_0448032
1937 Ga0495594_0004234
1938 Ga0495594_0038140
1939 Ga0495594_0452151
1940 Ga0495608_0037023
1941 Ga0495608_0047440
1942 Ga0495608_0258398
1943 Ga0495618_0105291
1944 Ga0495628_0030113
1945 Ga0495630_0070664
1946 Ga0495630_0095522
1947 Ga0495630_0559257
1948 Ga0495666_0030172
1949 Ga0495642_0279535
1950 Ga0495652_0361064
1951 Ga0495652_0373025
1952 Ga0495652_0700375
1953 Ga0495665_0129863
1954 Ga0495665_0482560
1955 Ga0495640_0122118
1956 Ga0495640_0310523
1957 Ga0495640_0523807
1958 Ga0495586_0119998
1959 Ga0495586_0290263
1960 Ga0495587_0526678
1961 Ga0495645_0179847
1962 Ga0495622_0182592
1963 Ga0495667_0016789
1964 Ga0495667_0054510
1965 Ga0495667_0131357
1966 Ga0495667_0251964
1967 Ga0495634_0007046
1968 Ga0495634_0223121
1969 Ga0495635_0048591
1970 Ga0495635_0294489
1971 Ga0495635_0874209
1972 Ga0495657_0224750
1973 Ga0495599_0302474
1974 Ga0495599_0307060
1975 Ga0495623_0261377
1976 Ga0495647_0064481
1977 Ga0495658_0028050
1978 Ga0495658_0086255
1979 Ga0495669_0556401
1980 Ga0495613_0246383
1981 Ga0495613_0521826
1982 Ga0495613_0634513
1983 Ga0495613_0971914
1984 Ga0495624_0216882
1985 Ga0495624_0369741
1986 Ga0495670_0429835
1987 Ga0495600_0038111
1988 Ga0495581_0179579
1989 Ga0495604_0425665
1990 Ga0495674_0043085
1991 Ga0495674_0308928
1992 Ga0495680_0041600
1993 Ga0495680_0269889
1994 Ga0495675_0110055
1995 Ga0495684_0035857
1996 Ga0495684_0899041
1997 Ga0495593_0098073
1998 Ga0495593_0499416
1999 Ga0495593_0599636
2000 Ga0495602_0131255
2001 Ga0495602_0648625
2002 Ga0496100_0241612
2003 Ga0496102_0008398
2004 Ga0496102_0610013
2005 Ga0496102_0755733
2006 Ga0496102_1500267
2007 Ga0496103_0054035
2008 Ga0496104_0445952
2009 Ga0496105_0096752
2010 Ga0496108_0064910
2011 Ga0496108_0721370
2012 Ga0496108_0799115
2013 Ga0496109_0030769
2014 Ga0496110_0081672
2015 Ga0496112_0091004
2016 Ga0496112_0218186
2017 Ga0496112_0428700
2018 Ga0496112_0745299
2019 Ga0496113_0073660
2020 Ga0496115_0093153
2021 Ga0496115_0480237
2022 Ga0496126_0676664
2023 Ga0501290_006760
2024 Ga0501291_077909
2025 Ga0501292_020009
2026 Ga0501292_137908
2027 Ga0501296_036365
2028 Ga0501297_009815
2029 Ga0501298_007554
2030 Ga0501298_013070
2031 Ga0501298_044940
2032 Ga0501299_014499
2033 Ga0501299_026435
2034 Ga0501299_114242
2035 Ga0501034_1626256
2036 Ga0501041_0149844
2037 Ga0501041_1080958
2038 Ga0501075_0273874
2039 Ga0501076_0633222
2040 Ga0501076_0946180
2041 Ga0501198_086517
2042 Ga0501202_143760
2043 Ga0501206_022651
2044 Ga0501208_087532
2045 Ga0501208_092554
2046 Ga0501216_019463
2047 Ga0501217_009648
2048 Ga0501217_016676
2049 Ga0501217_076107
2050 Ga0501217_212845
2051 Ga0501223_023553
2052 Ga0501224_004561
2053 Ga0501224_041242
2054 Ga0501228_011412
2055 Ga0501233_027158
2056 Ga0501233_111223
2057 Ga0501235_001714
2058 Ga0501239_016392
2059 Ga0501239_076184
2060 Ga0501240_005359
2061 Ga0501240_110553
2062 Ga0501242_019328
2063 Ga0501243_002924
2064 Ga0501246_013222
2065 Ga0501247_007552
2066 Ga0501247_031814
2067 Ga0501249_100801
2068 Ga0501249_158729
2069 Ga0501250_098332
2070 Ga0501251_012585
2071 Ga0501252_007966
2072 Ga0501255_001777
2073 Ga0501257_049001
2074 Ga0501257_104406
2075 Ga0501261_005956
2076 Ga0501261_123073
2077 Ga0501221_083632
2078 Ga0501225_0034047
2079 Ga0501225_0101150
2080 Ga0501225_0307005
2081 Ga0501229_064728
2082 Ga0501229_083937
2083 Ga0501234_019895
2084 Ga0501245_011475
2085 Ga0501079_0199004
2086 Ga0501079_0370742
2087 Ga0501080_0667562
2088 Ga0501081_0151596
2089 Ga0501263_050347
2090 Ga0501263_051868
2091 Ga0501264_026136
2092 Ga0501265_023382
2093 Ga0501265_114680
2094 Ga0501268_063473
2095 Ga0501268_100729
2096 Ga0501270_006461
2097 Ga0501270_039599
2098 Ga0501271_006322
2099 Ga0501279_016527
2100 Ga0501280_094272
2101 Ga0501283_001918
2102 Ga0501283_026167
2103 Ga0501035_0786373
2104 Ga0501044_0477113
2105 Ga0501045_0755568
2106 Ga0501212_036662
2107 nmdc:mga05p37_107880_c1
2108 nmdc:mga05p37_2026779_c1
2109 nmdc:mga05p37_336502_c1
2110 nmdc:mga05p37_554399_c1
2111 nmdc:mga05p37_75128_c1
2112 nmdc:mga05p37_777537_c1
2113 nmdc:mga09592_179882_c1
2114 nmdc:mga09592_446432_c1
2115 nmdc:mga09592_884699_c1
2116 nmdc:mga0qj67_1427558_c1
2117 nmdc:mga06r32_157880_c1
2118 nmdc:mga06r32_375826_c1
2119 nmdc:mga06r32_39679_c1
2120 nmdc:mga06r32_439658_c1
2121 nmdc:mga06r32_623792_c1
2122 nmdc:mga08y16_473655_c1
2123 nmdc:mga08y16_662230_c1
2124 nmdc:mga0n895_14141_c1
2125 nmdc:mga0n895_185362_c1
2126 nmdc:mga0n895_2003103_c1
2127 nmdc:mga0n895_692996_c1
2128 nmdc:mga0n895_725159_c1
2129 nmdc:mga0n895_773563_c1
2130 nmdc:mga0n895_883260_c1
2131 nmdc:mga0rr50_1467314_c1
2132 nmdc:mga0rr50_43180_c1
2133 nmdc:mga08x19_1067473_c1
2134 nmdc:mga08x19_259321_c1
2135 nmdc:mga08x19_277462_c1
2136 nmdc:mga08x19_389744_c1
2137 nmdc:mga08x19_555_c1
2138 nmdc:mga08x19_716327_c1
2139 nmdc:mga0a205_233729_c1
2140 Ga0495601_0063207
2141 Ga0500635_0284117
2142 Ga0500644_0027062
2143 Ga0500555_051781
2144 Ga0500555_106057
2145 Ga0500595_043978
2146 Ga0500627_0133357
2147 Ga0500596_065914
2148 Ga0501084_0193711
2149 Ga0590071_090121
2150 Ga0587066_014514

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

17

91

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8844 21 118
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8808 19 120
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8784 20 118
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.8748 20 120
5x11-assembly1.cif.gz_B crystal structure of bacillus subtilis padr in complex with operator dna 0.8726 26 105
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8844 21 118 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8787 16 117 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8786 27 105 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8729 26 105 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8712 22 124 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2W4T7F0-F1-model_v4 PadR family transcriptional regulator 0.9859 20 95
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9856 22 103
AF-A0A7Y3IAF1-F1-model_v4 PadR family transcriptional regulator 0.9781 24 122
AF-A0A2V6MFC0-F1-model_v4 PadR family transcriptional regulator 0.9767 21 111
AF-A0A2V9H684-F1-model_v4 PadR family transcriptional regulator 0.9759 18 107

Map