F489563
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1075 | 400 | 2150 | 111 |
Family's Representative Sequence
| Representative Sequence | 3300026118|Ga0207675_100495571|Ga0207675_1004955712 |
| Length | 133 |
| Sequence | VANHKADLLQGTLDLLILKTLAVQELHGLGISNRIAQITNGTFQVKPGSLFPALHRMEEAGWLKASWGESENNRRAKYYRLTKAGERQLQIETADWQRISLAIASAFIIARALLTVSSYSRCGSESATMPAPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 126 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 212 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 221 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 222 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 223 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 224 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 226 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 227 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 230 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 247 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 250 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 251 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 252 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 253 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 254 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 255 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 258 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 259 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 260 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 261 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 262 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 263 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 264 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 325 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 326 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 327 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 328 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 329 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 330 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 331 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 332 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 333 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 338 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 339 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 340 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 341 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 342 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 343 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 344 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 345 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 346 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 347 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 348 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 349 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 350 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 351 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 352 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 353 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 354 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 355 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 356 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 357 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 358 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 359 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 360 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 361 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 362 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 363 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 364 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 365 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 366 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 370 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 371 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 372 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 373 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 374 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 375 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 376 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 377 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 382 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 393 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 395 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 396 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 397 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 398 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 400 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.72 |
| Metatranscriptomes | 0.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.65 |
| Nodule | 0 |
| Rhizoplane | 2.14 |
| Rhizosphere | 93.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 33.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207675_100495571 | 3300026118 | Bacteria | 1215 |
| 2 | Ga0065712_10660374 | 3300005290 | Unclassified | 563 |
| 3 | Ga0065715_10036657 | 3300005293 | Unclassified | 1177 |
| 4 | Ga0065715_10182647 | 3300005293 | Unclassified | 1466 |
| 5 | Ga0065715_10206825 | 3300005293 | Unclassified | 1333 |
| 6 | Ga0065715_10686545 | 3300005293 | Unclassified | 660 |
| 7 | Ga0065707_10005725 | 3300005295 | Bacteria | 3031 |
| 8 | Ga0065707_10153081 | 3300005295 | Bacteria | 1637 |
| 9 | Ga0065707_10270071 | 3300005295 | Bacteria | 1073 |
| 10 | Ga0065707_10386432 | 3300005295 | Unclassified | 835 |
| 11 | Ga0070658_10324717 | 3300005327 | Bacteria | 1315 |
| 12 | Ga0070658_10377500 | 3300005327 | Bacteria | 1216 |
| 13 | Ga0070676_10126069 | 3300005328 | Unclassified | 1613 |
| 14 | Ga0070676_10569696 | 3300005328 | Bacteria | 813 |
| 15 | Ga0070683_100048180 | 3300005329 | Bacteria | 3939 |
| 16 | Ga0070683_100058164 | 3300005329 | Bacteria | 3592 |
| 17 | Ga0070683_100180310 | 3300005329 | Bacteria | 2005 |
| 18 | Ga0070683_100186840 | 3300005329 | Bacteria | 1967 |
| 19 | Ga0070683_100214790 | 3300005329 | Bacteria | 1828 |
| 20 | Ga0070683_100366706 | 3300005329 | Unclassified | 1372 |
| 21 | Ga0070683_100875266 | 3300005329 | Bacteria | 862 |
| 22 | Ga0070683_101580605 | 3300005329 | Bacteria | 630 |
| 23 | Ga0070683_102127131 | 3300005329 | Unclassified | 539 |
| 24 | Ga0070670_100032878 | 3300005331 | Bacteria | 4469 |
| 25 | Ga0070670_100039831 | 3300005331 | Unclassified | 4040 |
| 26 | Ga0070670_100165886 | 3300005331 | Bacteria | 1915 |
| 27 | Ga0070670_100287719 | 3300005331 | Unclassified | 1436 |
| 28 | Ga0070677_10784482 | 3300005333 | Unclassified | 543 |
| 29 | Ga0068869_100038165 | 3300005334 | Bacteria | 3420 |
| 30 | Ga0068869_100250604 | 3300005334 | Unclassified | 1414 |
| 31 | Ga0068869_100317306 | 3300005334 | Bacteria | 1263 |
| 32 | Ga0068869_101903253 | 3300005334 | Unclassified | 533 |
| 33 | Ga0070666_10082292 | 3300005335 | Bacteria | 2202 |
| 34 | Ga0070666_10167053 | 3300005335 | Bacteria | 1540 |
| 35 | Ga0070680_100007133 | 3300005336 | Bacteria | 8515 |
| 36 | Ga0070680_100130567 | 3300005336 | Bacteria | 2102 |
| 37 | Ga0070680_100271982 | 3300005336 | Bacteria | 1435 |
| 38 | Ga0068868_100256491 | 3300005338 | Bacteria | 1473 |
| 39 | Ga0068868_100316342 | 3300005338 | Unclassified | 1329 |
| 40 | Ga0068868_100595207 | 3300005338 | Bacteria | 979 |
| 41 | Ga0068868_100610189 | 3300005338 | Unclassified | 968 |
| 42 | Ga0068868_101291647 | 3300005338 | Bacteria | 678 |
| 43 | Ga0068868_101830275 | 3300005338 | Bacteria | 574 |
| 44 | Ga0070660_100113504 | 3300005339 | Bacteria | 2157 |
| 45 | Ga0070660_100593044 | 3300005339 | Unclassified | 926 |
| 46 | Ga0070660_101398214 | 3300005339 | Unclassified | 594 |
| 47 | Ga0070689_100050282 | 3300005340 | Bacteria | 3220 |
| 48 | Ga0070689_100096732 | 3300005340 | Unclassified | 2334 |
| 49 | Ga0070689_100709323 | 3300005340 | Bacteria | 879 |
| 50 | Ga0070689_100874938 | 3300005340 | Bacteria | 794 |
| 51 | Ga0070689_101020403 | 3300005340 | Unclassified | 737 |
| 52 | Ga0070687_100005760 | 3300005343 | Bacteria | 5031 |
| 53 | Ga0070687_100181136 | 3300005343 | Unclassified | 1262 |
| 54 | Ga0070661_100008191 | 3300005344 | Bacteria | 7210 |
| 55 | Ga0070661_100397257 | 3300005344 | Bacteria | 1089 |
| 56 | Ga0070661_100484310 | 3300005344 | Bacteria | 988 |
| 57 | Ga0070692_10024117 | 3300005345 | Unclassified | 2987 |
| 58 | Ga0070668_100028835 | 3300005347 | Bacteria | 4212 |
| 59 | Ga0070668_100041989 | 3300005347 | Bacteria | 3504 |
| 60 | Ga0070669_100010554 | 3300005353 | Bacteria | 6558 |
| 61 | Ga0070669_100014982 | 3300005353 | Bacteria | 5526 |
| 62 | Ga0070669_100114733 | 3300005353 | Bacteria | 2048 |
| 63 | Ga0070669_100786415 | 3300005353 | Bacteria | 808 |
| 64 | Ga0070675_100058123 | 3300005354 | Bacteria | 3190 |
| 65 | Ga0070675_100106446 | 3300005354 | Unclassified | 2368 |
| 66 | Ga0070675_100497576 | 3300005354 | Unclassified | 1098 |
| 67 | Ga0070675_100554275 | 3300005354 | Bacteria | 1040 |
| 68 | Ga0070675_100691126 | 3300005354 | Bacteria | 929 |
| 69 | Ga0070675_100941567 | 3300005354 | Bacteria | 792 |
| 70 | Ga0070671_100098714 | 3300005355 | Bacteria | 2449 |
| 71 | Ga0070671_100258870 | 3300005355 | Bacteria | 1479 |
| 72 | Ga0070671_101107461 | 3300005355 | Bacteria | 695 |
| 73 | Ga0070674_100237683 | 3300005356 | Bacteria | 1425 |
| 74 | Ga0070674_100274107 | 3300005356 | Bacteria | 1335 |
| 75 | Ga0070674_100699649 | 3300005356 | Bacteria | 866 |
| 76 | Ga0070674_101193599 | 3300005356 | Unclassified | 675 |
| 77 | Ga0070673_100592426 | 3300005364 | Bacteria | 1010 |
| 78 | Ga0070673_100668931 | 3300005364 | Bacteria | 951 |
| 79 | Ga0070673_101674110 | 3300005364 | Bacteria | 602 |
| 80 | Ga0070673_101745764 | 3300005364 | Bacteria | 589 |
| 81 | Ga0070673_101857801 | 3300005364 | Unclassified | 571 |
| 82 | Ga0070688_100346497 | 3300005365 | Bacteria | 1086 |
| 83 | Ga0070688_100733954 | 3300005365 | Unclassified | 767 |
| 84 | Ga0070688_100873883 | 3300005365 | Unclassified | 708 |
| 85 | Ga0070659_100030150 | 3300005366 | Bacteria | 4196 |
| 86 | Ga0070659_100224607 | 3300005366 | Bacteria | 1551 |
| 87 | Ga0070659_100456039 | 3300005366 | Bacteria | 1085 |
| 88 | Ga0070659_101463435 | 3300005366 | Unclassified | 608 |
| 89 | Ga0070667_100069000 | 3300005367 | Bacteria | 3008 |
| 90 | Ga0070667_101463429 | 3300005367 | Bacteria | 641 |
| 91 | Ga0070667_102129448 | 3300005367 | Unclassified | 528 |
| 92 | Ga0070709_11534376 | 3300005434 | Unclassified | 541 |
| 93 | Ga0070714_100068098 | 3300005435 | Bacteria | 3071 |
| 94 | Ga0070714_100271706 | 3300005435 | Unclassified | 1572 |
| 95 | Ga0070714_100492161 | 3300005435 | Bacteria | 1168 |
| 96 | Ga0070714_100506247 | 3300005435 | Bacteria | 1152 |
| 97 | Ga0070713_100038744 | 3300005436 | Unclassified | 3865 |
| 98 | Ga0070713_100460516 | 3300005436 | Bacteria | 1195 |
| 99 | Ga0070713_100677256 | 3300005436 | Unclassified | 984 |
| 100 | Ga0070713_101408438 | 3300005436 | Unclassified | 676 |
| 101 | Ga0070710_10902612 | 3300005437 | Bacteria | 638 |
| 102 | Ga0070701_10186801 | 3300005438 | Bacteria | 1217 |
| 103 | Ga0070711_100026538 | 3300005439 | Unclassified | 3796 |
| 104 | Ga0070711_100592807 | 3300005439 | Unclassified | 924 |
| 105 | Ga0070705_100444918 | 3300005440 | Unclassified | 971 |
| 106 | Ga0070705_100900422 | 3300005440 | Unclassified | 711 |
| 107 | Ga0070700_100089669 | 3300005441 | Bacteria | 2004 |
| 108 | Ga0070700_100670454 | 3300005441 | Bacteria | 821 |
| 109 | Ga0070694_100123457 | 3300005444 | Bacteria | 1861 |
| 110 | Ga0070694_100458843 | 3300005444 | Unclassified | 1007 |
| 111 | Ga0070694_100762858 | 3300005444 | Bacteria | 791 |
| 112 | Ga0070708_100261606 | 3300005445 | Bacteria | 1626 |
| 113 | Ga0070708_100437115 | 3300005445 | Bacteria | 1234 |
| 114 | Ga0070663_100048398 | 3300005455 | Bacteria | 3015 |
| 115 | Ga0070663_100365386 | 3300005455 | Bacteria | 1172 |
| 116 | Ga0070663_100888077 | 3300005455 | Bacteria | 769 |
| 117 | Ga0070663_101051761 | 3300005455 | Unclassified | 710 |
| 118 | Ga0070663_101921582 | 3300005455 | Bacteria | 532 |
| 119 | Ga0070678_100090652 | 3300005456 | Unclassified | 2344 |
| 120 | Ga0070678_100150438 | 3300005456 | Unclassified | 1875 |
| 121 | Ga0070678_101654425 | 3300005456 | Bacteria | 602 |
| 122 | Ga0070662_100067643 | 3300005457 | Bacteria | 2624 |
| 123 | Ga0070662_100083085 | 3300005457 | Unclassified | 2390 |
| 124 | Ga0070662_100275435 | 3300005457 | Unclassified | 1360 |
| 125 | Ga0070662_100277436 | 3300005457 | Bacteria | 1355 |
| 126 | Ga0070681_10000342 | 3300005458 | Bacteria | 37579 |
| 127 | Ga0070681_10000540 | 3300005458 | Bacteria | 31122 |
| 128 | Ga0070681_10188496 | 3300005458 | Bacteria | 1982 |
| 129 | Ga0068867_100025648 | 3300005459 | Bacteria | 4230 |
| 130 | Ga0068867_100031093 | 3300005459 | Bacteria | 3853 |
| 131 | Ga0068867_100230564 | 3300005459 | Bacteria | 1497 |
| 132 | Ga0068867_100882871 | 3300005459 | Bacteria | 803 |
| 133 | Ga0070685_10241681 | 3300005466 | Bacteria | 1192 |
| 134 | Ga0070685_10413548 | 3300005466 | Unclassified | 937 |
| 135 | Ga0070706_100019461 | 3300005467 | Bacteria | 6260 |
| 136 | Ga0070706_100022641 | 3300005467 | Bacteria | 5786 |
| 137 | Ga0070706_100136440 | 3300005467 | Unclassified | 2290 |
| 138 | Ga0070706_100607898 | 3300005467 | Bacteria | 1016 |
| 139 | Ga0070706_101110221 | 3300005467 | Unclassified | 728 |
| 140 | Ga0070706_101769679 | 3300005467 | Unclassified | 562 |
| 141 | Ga0070707_100152417 | 3300005468 | Bacteria | 2251 |
| 142 | Ga0070707_100315612 | 3300005468 | Unclassified | 1519 |
| 143 | Ga0070707_100400964 | 3300005468 | Unclassified | 1332 |
| 144 | Ga0070707_100430875 | 3300005468 | Bacteria | 1279 |
| 145 | Ga0070707_100938440 | 3300005468 | Bacteria | 830 |
| 146 | Ga0070698_100000807 | 3300005471 | Bacteria | 34196 |
| 147 | Ga0070698_100021834 | 3300005471 | Bacteria | 6704 |
| 148 | Ga0070698_100029299 | 3300005471 | Bacteria | 5713 |
| 149 | Ga0070698_100037758 | 3300005471 | Unclassified | 4979 |
| 150 | Ga0070698_100904801 | 3300005471 | Bacteria | 828 |
| 151 | Ga0070699_100000932 | 3300005518 | Bacteria | 27306 |
| 152 | Ga0070699_100042673 | 3300005518 | Bacteria | 3925 |
| 153 | Ga0070699_100160165 | 3300005518 | Bacteria | 1992 |
| 154 | Ga0070699_100396045 | 3300005518 | Bacteria | 1248 |
| 155 | Ga0070699_101745354 | 3300005518 | Bacteria | 570 |
| 156 | Ga0070679_100001118 | 3300005530 | Bacteria | 23399 |
| 157 | Ga0070679_100094928 | 3300005530 | Bacteria | 2970 |
| 158 | Ga0070684_100028747 | 3300005535 | Bacteria | 4704 |
| 159 | Ga0070684_100033883 | 3300005535 | Bacteria | 4363 |
| 160 | Ga0070684_100148555 | 3300005535 | Unclassified | 2122 |
| 161 | Ga0070684_100370080 | 3300005535 | Bacteria | 1319 |
| 162 | Ga0070684_100784750 | 3300005535 | Unclassified | 890 |
| 163 | Ga0070684_101063118 | 3300005535 | Bacteria | 760 |
| 164 | Ga0070684_101490097 | 3300005535 | Unclassified | 638 |
| 165 | Ga0070697_100097813 | 3300005536 | Bacteria | 2436 |
| 166 | Ga0070697_100123086 | 3300005536 | Bacteria | 2171 |
| 167 | Ga0070697_100302832 | 3300005536 | Unclassified | 1374 |
| 168 | Ga0070697_100642730 | 3300005536 | Bacteria | 934 |
| 169 | Ga0070697_100704835 | 3300005536 | Unclassified | 891 |
| 170 | Ga0070697_100907185 | 3300005536 | Unclassified | 782 |
| 171 | Ga0068853_100026648 | 3300005539 | Bacteria | 4855 |
| 172 | Ga0068853_101964902 | 3300005539 | Unclassified | 567 |
| 173 | Ga0070672_100026379 | 3300005543 | Bacteria | 4322 |
| 174 | Ga0070672_100078935 | 3300005543 | Bacteria | 2634 |
| 175 | Ga0070672_100199736 | 3300005543 | Bacteria | 1672 |
| 176 | Ga0070672_100242100 | 3300005543 | Unclassified | 1517 |
| 177 | Ga0070686_100094199 | 3300005544 | Unclassified | 2010 |
| 178 | Ga0070695_100738678 | 3300005545 | Unclassified | 784 |
| 179 | Ga0070695_100845637 | 3300005545 | Unclassified | 736 |
| 180 | Ga0070695_101783004 | 3300005545 | Bacteria | 516 |
| 181 | Ga0070696_100024803 | 3300005546 | Unclassified | 4075 |
| 182 | Ga0070696_100143523 | 3300005546 | Unclassified | 1747 |
| 183 | Ga0070696_100281287 | 3300005546 | Unclassified | 1268 |
| 184 | Ga0070696_100329680 | 3300005546 | Bacteria | 1177 |
| 185 | Ga0070696_100335105 | 3300005546 | Bacteria | 1168 |
| 186 | Ga0070696_100436486 | 3300005546 | Unclassified | 1031 |
| 187 | Ga0070696_100941659 | 3300005546 | Bacteria | 718 |
| 188 | Ga0070696_101168568 | 3300005546 | Unclassified | 649 |
| 189 | Ga0070693_100983327 | 3300005547 | Bacteria | 637 |
| 190 | Ga0070665_100064090 | 3300005548 | Bacteria | 3685 |
| 191 | Ga0070665_100440955 | 3300005548 | Bacteria | 1311 |
| 192 | Ga0070665_102367276 | 3300005548 | Bacteria | 533 |
| 193 | Ga0070704_100360352 | 3300005549 | Bacteria | 1230 |
| 194 | Ga0070704_100801675 | 3300005549 | Bacteria | 841 |
| 195 | Ga0070704_101516302 | 3300005549 | Bacteria | 617 |
| 196 | Ga0070704_101519133 | 3300005549 | Unclassified | 616 |
| 197 | Ga0068855_100668579 | 3300005563 | Bacteria | 1114 |
| 198 | Ga0070664_100002183 | 3300005564 | Bacteria | 15715 |
| 199 | Ga0070664_100021615 | 3300005564 | Bacteria | 5306 |
| 200 | Ga0070664_100048449 | 3300005564 | Bacteria | 3591 |
| 201 | Ga0070664_100419362 | 3300005564 | Bacteria | 1226 |
| 202 | Ga0070664_100532195 | 3300005564 | Bacteria | 1085 |
| 203 | Ga0070664_100713440 | 3300005564 | Bacteria | 935 |
| 204 | Ga0070664_100885174 | 3300005564 | Bacteria | 837 |
| 205 | Ga0070664_101602292 | 3300005564 | Bacteria | 617 |
| 206 | Ga0068857_100002781 | 3300005577 | Bacteria | 14384 |
| 207 | Ga0068857_100014310 | 3300005577 | Bacteria | 6914 |
| 208 | Ga0068857_100165935 | 3300005577 | Bacteria | 2005 |
| 209 | Ga0068857_100353045 | 3300005577 | Bacteria | 1362 |
| 210 | Ga0068857_100512003 | 3300005577 | Unclassified | 1127 |
| 211 | Ga0068857_101585719 | 3300005577 | Bacteria | 639 |
| 212 | Ga0068854_100100973 | 3300005578 | Bacteria | 2163 |
| 213 | Ga0068854_100184631 | 3300005578 | Bacteria | 1631 |
| 214 | Ga0068854_100377101 | 3300005578 | Bacteria | 1168 |
| 215 | Ga0068854_101929406 | 3300005578 | Unclassified | 543 |
| 216 | Ga0068856_100137259 | 3300005614 | Bacteria | 2451 |
| 217 | Ga0068856_100771281 | 3300005614 | Bacteria | 981 |
| 218 | Ga0068856_100791106 | 3300005614 | Bacteria | 968 |
| 219 | Ga0068856_102273566 | 3300005614 | Unclassified | 551 |
| 220 | Ga0070702_100169846 | 3300005615 | Bacteria | 1417 |
| 221 | Ga0070702_100507407 | 3300005615 | Unclassified | 887 |
| 222 | Ga0068852_100147413 | 3300005616 | Bacteria | 2184 |
| 223 | Ga0068852_100157205 | 3300005616 | Unclassified | 2119 |
| 224 | Ga0068852_100176039 | 3300005616 | Unclassified | 2009 |
| 225 | Ga0068852_100919444 | 3300005616 | Bacteria | 892 |
| 226 | Ga0068852_101692964 | 3300005616 | Bacteria | 655 |
| 227 | Ga0068859_100087820 | 3300005617 | Unclassified | 3158 |
| 228 | Ga0068859_100122061 | 3300005617 | Bacteria | 2672 |
| 229 | Ga0068859_100162769 | 3300005617 | Bacteria | 2310 |
| 230 | Ga0068859_100453637 | 3300005617 | Bacteria | 1378 |
| 231 | Ga0068859_100831096 | 3300005617 | Unclassified | 1010 |
| 232 | Ga0068859_101963370 | 3300005617 | Bacteria | 646 |
| 233 | Ga0068859_101994992 | 3300005617 | Bacteria | 641 |
| 234 | Ga0068864_100013175 | 3300005618 | Bacteria | 6846 |
| 235 | Ga0068864_100040517 | 3300005618 | Bacteria | 3985 |
| 236 | Ga0068864_100150045 | 3300005618 | Bacteria | 2111 |
| 237 | Ga0068864_100356750 | 3300005618 | Bacteria | 1381 |
| 238 | Ga0068864_100580603 | 3300005618 | Bacteria | 1086 |
| 239 | Ga0068864_100925682 | 3300005618 | Unclassified | 862 |
| 240 | Ga0068864_101115594 | 3300005618 | Unclassified | 785 |
| 241 | Ga0068864_101689392 | 3300005618 | Bacteria | 638 |
| 242 | Ga0068866_10060789 | 3300005718 | Bacteria | 1960 |
| 243 | Ga0068861_100017142 | 3300005719 | Bacteria | 5136 |
| 244 | Ga0068861_100105025 | 3300005719 | Unclassified | 2255 |
| 245 | Ga0068861_100126622 | 3300005719 | Bacteria | 2067 |
| 246 | Ga0068861_100590775 | 3300005719 | Bacteria | 1018 |
| 247 | Ga0068861_100783604 | 3300005719 | Bacteria | 893 |
| 248 | Ga0068861_100945778 | 3300005719 | Unclassified | 819 |
| 249 | Ga0068861_101398816 | 3300005719 | Unclassified | 683 |
| 250 | Ga0068851_10191259 | 3300005834 | Bacteria | 1138 |
| 251 | Ga0068851_10422233 | 3300005834 | Unclassified | 788 |
| 252 | Ga0068851_10753066 | 3300005834 | Unclassified | 603 |
| 253 | Ga0068870_10004730 | 3300005840 | Bacteria | 5882 |
| 254 | Ga0068870_10383105 | 3300005840 | Bacteria | 911 |
| 255 | Ga0068870_10440690 | 3300005840 | Bacteria | 857 |
| 256 | Ga0068863_100006098 | 3300005841 | Bacteria | 11823 |
| 257 | Ga0068863_100065803 | 3300005841 | Bacteria | 3430 |
| 258 | Ga0068863_100446718 | 3300005841 | Bacteria | 1269 |
| 259 | Ga0068863_100890355 | 3300005841 | Unclassified | 890 |
| 260 | Ga0068863_102688735 | 3300005841 | Unclassified | 506 |
| 261 | Ga0068858_100419991 | 3300005842 | Unclassified | 1286 |
| 262 | Ga0068858_100783161 | 3300005842 | Bacteria | 930 |
| 263 | Ga0068858_102449797 | 3300005842 | Bacteria | 516 |
| 264 | Ga0068860_100103197 | 3300005843 | Bacteria | 2722 |
| 265 | Ga0068860_100124247 | 3300005843 | Bacteria | 2473 |
| 266 | Ga0068860_100803622 | 3300005843 | Bacteria | 954 |
| 267 | Ga0068860_101352914 | 3300005843 | Unclassified | 733 |
| 268 | Ga0068862_100002139 | 3300005844 | Bacteria | 17795 |
| 269 | Ga0068862_100030031 | 3300005844 | Bacteria | 4580 |
| 270 | Ga0068862_100221043 | 3300005844 | Bacteria | 1715 |
| 271 | Ga0068862_100266094 | 3300005844 | Bacteria | 1566 |
| 272 | Ga0068862_102508543 | 3300005844 | Bacteria | 527 |
| 273 | Ga0081455_10012197 | 3300005937 | Bacteria | 8582 |
| 274 | Ga0081455_10041053 | 3300005937 | Bacteria | 4074 |
| 275 | Ga0081455_10044796 | 3300005937 | Unclassified | 3855 |
| 276 | Ga0081455_10052145 | 3300005937 | Bacteria | 3504 |
| 277 | Ga0081455_10510666 | 3300005937 | Bacteria | 805 |
| 278 | Ga0081540_1002800 | 3300005983 | Bacteria | 14129 |
| 279 | Ga0081540_1038826 | 3300005983 | Bacteria | 2503 |
| 280 | Ga0081539_10000346 | 3300005985 | Bacteria | 101962 |
| 281 | Ga0070717_10112750 | 3300006028 | Bacteria | 2321 |
| 282 | Ga0070717_10148522 | 3300006028 | Bacteria | 2026 |
| 283 | Ga0070717_10432067 | 3300006028 | Bacteria | 1185 |
| 284 | Ga0070717_11293225 | 3300006028 | Bacteria | 663 |
| 285 | Ga0070716_100021514 | 3300006173 | Unclassified | 3400 |
| 286 | Ga0070712_100047146 | 3300006175 | Bacteria | 2981 |
| 287 | Ga0070712_100194498 | 3300006175 | Bacteria | 1589 |
| 288 | Ga0070712_100674170 | 3300006175 | Unclassified | 880 |
| 289 | Ga0097621_100197725 | 3300006237 | Bacteria | 1744 |
| 290 | Ga0097621_100323174 | 3300006237 | Unclassified | 1367 |
| 291 | Ga0097621_100333780 | 3300006237 | Bacteria | 1345 |
| 292 | Ga0097621_100657609 | 3300006237 | Bacteria | 962 |
| 293 | Ga0068871_100144991 | 3300006358 | Bacteria | 2021 |
| 294 | Ga0068871_100265382 | 3300006358 | Bacteria | 1499 |
| 295 | Ga0068871_100470617 | 3300006358 | Bacteria | 1129 |
| 296 | Ga0068871_101009500 | 3300006358 | Bacteria | 775 |
| 297 | Ga0075428_100105930 | 3300006844 | Bacteria | 3066 |
| 298 | Ga0075428_100147946 | 3300006844 | Unclassified | 2553 |
| 299 | Ga0075428_100256489 | 3300006844 | Bacteria | 1884 |
| 300 | Ga0075428_100459191 | 3300006844 | Unclassified | 1364 |
| 301 | Ga0075428_100467150 | 3300006844 | Bacteria | 1351 |
| 302 | Ga0075428_100598582 | 3300006844 | Bacteria | 1178 |
| 303 | Ga0075428_100822785 | 3300006844 | Bacteria | 987 |
| 304 | Ga0075428_101584253 | 3300006844 | Bacteria | 685 |
| 305 | Ga0075430_101601138 | 3300006846 | Bacteria | 535 |
| 306 | Ga0075431_100022067 | 3300006847 | Bacteria | 6510 |
| 307 | Ga0075431_100046470 | 3300006847 | Bacteria | 4477 |
| 308 | Ga0075431_100320914 | 3300006847 | Unclassified | 1562 |
| 309 | Ga0075431_101348546 | 3300006847 | Unclassified | 674 |
| 310 | Ga0075433_10428798 | 3300006852 | Bacteria | 1166 |
| 311 | Ga0075433_10735655 | 3300006852 | Bacteria | 863 |
| 312 | Ga0075433_10817172 | 3300006852 | Bacteria | 814 |
| 313 | Ga0075433_10947108 | 3300006852 | Bacteria | 751 |
| 314 | Ga0075433_11042595 | 3300006852 | Unclassified | 712 |
| 315 | Ga0075434_100011626 | 3300006871 | Bacteria | 8313 |
| 316 | Ga0075434_100049011 | 3300006871 | Bacteria | 4192 |
| 317 | Ga0075434_100209988 | 3300006871 | Bacteria | 1967 |
| 318 | Ga0075434_100384599 | 3300006871 | Bacteria | 1424 |
| 319 | Ga0075434_100983549 | 3300006871 | Bacteria | 858 |
| 320 | Ga0075434_101063208 | 3300006871 | Bacteria | 823 |
| 321 | Ga0075434_101855844 | 3300006871 | Unclassified | 609 |
| 322 | Ga0075429_100120426 | 3300006880 | Unclassified | 2294 |
| 323 | Ga0075429_100694077 | 3300006880 | Bacteria | 892 |
| 324 | Ga0075429_101432013 | 3300006880 | Bacteria | 602 |
| 325 | Ga0068865_100073433 | 3300006881 | Bacteria | 2432 |
| 326 | Ga0068865_100132500 | 3300006881 | Bacteria | 1869 |
| 327 | Ga0075436_100038127 | 3300006914 | Bacteria | 3318 |
| 328 | Ga0075436_100286426 | 3300006914 | Bacteria | 1179 |
| 329 | Ga0075436_100289977 | 3300006914 | Bacteria | 1171 |
| 330 | Ga0075436_100300208 | 3300006914 | Bacteria | 1151 |
| 331 | Ga0075436_100527139 | 3300006914 | Bacteria | 866 |
| 332 | Ga0075436_101127692 | 3300006914 | Unclassified | 591 |
| 333 | Ga0075436_101358092 | 3300006914 | Unclassified | 538 |
| 334 | Ga0097620_100087814 | 3300006931 | Unclassified | 3158 |
| 335 | Ga0097620_100122047 | 3300006931 | Bacteria | 2672 |
| 336 | Ga0097620_100162767 | 3300006931 | Bacteria | 2310 |
| 337 | Ga0097620_100453651 | 3300006931 | Bacteria | 1378 |
| 338 | Ga0097620_100831175 | 3300006931 | Unclassified | 1010 |
| 339 | Ga0097620_101963595 | 3300006931 | Bacteria | 646 |
| 340 | Ga0097620_101994733 | 3300006931 | Bacteria | 641 |
| 341 | Ga0075435_100091492 | 3300007076 | Bacteria | 2511 |
| 342 | Ga0075435_100991315 | 3300007076 | Bacteria | 734 |
| 343 | Ga0105240_10006670 | 3300009093 | Bacteria | 16929 |
| 344 | Ga0105240_10110797 | 3300009093 | Bacteria | 3322 |
| 345 | Ga0105240_11276879 | 3300009093 | Unclassified | 775 |
| 346 | Ga0105240_11447559 | 3300009093 | Unclassified | 721 |
| 347 | Ga0111539_10186107 | 3300009094 | Unclassified | 2425 |
| 348 | Ga0111539_10589106 | 3300009094 | Bacteria | 1295 |
| 349 | Ga0111539_10602974 | 3300009094 | Bacteria | 1279 |
| 350 | Ga0111539_10624407 | 3300009094 | Bacteria | 1255 |
| 351 | Ga0111539_12276647 | 3300009094 | Unclassified | 629 |
| 352 | Ga0111539_12711727 | 3300009094 | Unclassified | 574 |
| 353 | Ga0105245_10052246 | 3300009098 | Bacteria | 3665 |
| 354 | Ga0105245_10491718 | 3300009098 | Bacteria | 1242 |
| 355 | Ga0105245_11196822 | 3300009098 | Bacteria | 808 |
| 356 | Ga0105245_12286554 | 3300009098 | Bacteria | 594 |
| 357 | Ga0105245_12473326 | 3300009098 | Bacteria | 573 |
| 358 | Ga0105247_10102995 | 3300009101 | Bacteria | 1827 |
| 359 | Ga0114129_10071093 | 3300009147 | Bacteria | 4852 |
| 360 | Ga0114129_10071190 | 3300009147 | Bacteria | 4849 |
| 361 | Ga0114129_10300462 | 3300009147 | Unclassified | 2140 |
| 362 | Ga0114129_10324579 | 3300009147 | Bacteria | 2046 |
| 363 | Ga0114129_10338910 | 3300009147 | Bacteria | 1995 |
| 364 | Ga0114129_11145781 | 3300009147 | Unclassified | 971 |
| 365 | Ga0114129_13085928 | 3300009147 | Unclassified | 545 |
| 366 | Ga0105243_11962505 | 3300009148 | Bacteria | 619 |
| 367 | Ga0105243_12070090 | 3300009148 | Unclassified | 604 |
| 368 | Ga0105241_10626006 | 3300009174 | Bacteria | 975 |
| 369 | Ga0105241_10945855 | 3300009174 | Bacteria | 803 |
| 370 | Ga0105241_12296665 | 3300009174 | Unclassified | 537 |
| 371 | Ga0105242_10062799 | 3300009176 | Bacteria | 3058 |
| 372 | Ga0105242_10324824 | 3300009176 | Unclassified | 1413 |
| 373 | Ga0105242_11520369 | 3300009176 | Bacteria | 701 |
| 374 | Ga0105242_11631902 | 3300009176 | Bacteria | 679 |
| 375 | Ga0105242_12773844 | 3300009176 | Unclassified | 540 |
| 376 | Ga0105248_10000003 | 3300009177 | Bacteria | 1019601 |
| 377 | Ga0105248_10000056 | 3300009177 | Bacteria | 139437 |
| 378 | Ga0105248_10008788 | 3300009177 | Bacteria | 11093 |
| 379 | Ga0105248_10017537 | 3300009177 | Bacteria | 7895 |
| 380 | Ga0105248_10175016 | 3300009177 | Unclassified | 2419 |
| 381 | Ga0105248_10183966 | 3300009177 | Bacteria | 2355 |
| 382 | Ga0105248_10185943 | 3300009177 | Bacteria | 2341 |
| 383 | Ga0105248_10394385 | 3300009177 | Bacteria | 1558 |
| 384 | Ga0105248_10501000 | 3300009177 | Bacteria | 1369 |
| 385 | Ga0105248_10516422 | 3300009177 | Unclassified | 1347 |
| 386 | Ga0105248_10833146 | 3300009177 | Bacteria | 1041 |
| 387 | Ga0105248_12424132 | 3300009177 | Bacteria | 598 |
| 388 | Ga0105248_13092700 | 3300009177 | Bacteria | 530 |
| 389 | Ga0105237_10018281 | 3300009545 | Bacteria | 7254 |
| 390 | Ga0105237_10218985 | 3300009545 | Bacteria | 1904 |
| 391 | Ga0105237_10414823 | 3300009545 | Bacteria | 1351 |
| 392 | Ga0105238_10193653 | 3300009551 | Bacteria | 2009 |
| 393 | Ga0105238_10247758 | 3300009551 | Bacteria | 1759 |
| 394 | Ga0105238_10654212 | 3300009551 | Unclassified | 1061 |
| 395 | Ga0105238_10730004 | 3300009551 | Bacteria | 1004 |
| 396 | Ga0105249_10000575 | 3300009553 | Bacteria | 33720 |
| 397 | Ga0105249_10157212 | 3300009553 | Unclassified | 2193 |
| 398 | Ga0105249_10162858 | 3300009553 | Unclassified | 2157 |
| 399 | Ga0105249_10339212 | 3300009553 | Bacteria | 1519 |
| 400 | Ga0105249_13386565 | 3300009553 | Unclassified | 513 |
| 401 | Ga0105239_10051306 | 3300010375 | Bacteria | 4522 |
| 402 | Ga0105239_10140307 | 3300010375 | Bacteria | 2693 |
| 403 | Ga0105239_11148406 | 3300010375 | Unclassified | 895 |
| 404 | Ga0105239_11150712 | 3300010375 | Unclassified | 894 |
| 405 | Ga0105246_10385280 | 3300011119 | Bacteria | 1160 |
| 406 | Ga0105246_10396849 | 3300011119 | Bacteria | 1144 |
| 407 | Ga0105246_10513941 | 3300011119 | Bacteria | 1019 |
| 408 | Ga0105246_10915898 | 3300011119 | Bacteria | 787 |
| 409 | Ga0105246_12263906 | 3300011119 | Unclassified | 530 |
| 410 | Ga0157373_10518316 | 3300013100 | Bacteria | 862 |
| 411 | Ga0157371_10098997 | 3300013102 | Bacteria | 2068 |
| 412 | Ga0157371_10650840 | 3300013102 | Bacteria | 786 |
| 413 | Ga0157371_11435265 | 3300013102 | Unclassified | 537 |
| 414 | Ga0157369_10077988 | 3300013105 | Bacteria | 3550 |
| 415 | Ga0157369_10110846 | 3300013105 | Unclassified | 2917 |
| 416 | Ga0157369_10182355 | 3300013105 | Bacteria | 2209 |
| 417 | Ga0157369_10324275 | 3300013105 | Bacteria | 1601 |
| 418 | Ga0157369_10581058 | 3300013105 | Bacteria | 1157 |
| 419 | Ga0157374_10187548 | 3300013296 | Bacteria | 2022 |
| 420 | Ga0157374_10665322 | 3300013296 | Unclassified | 1053 |
| 421 | Ga0157374_11331313 | 3300013296 | Unclassified | 740 |
| 422 | Ga0157374_11533070 | 3300013296 | Unclassified | 690 |
| 423 | Ga0157378_10252660 | 3300013297 | Unclassified | 1688 |
| 424 | Ga0157378_10337837 | 3300013297 | Unclassified | 1468 |
| 425 | Ga0157378_10426183 | 3300013297 | Bacteria | 1312 |
| 426 | Ga0157378_10678069 | 3300013297 | Bacteria | 1048 |
| 427 | Ga0157378_11748592 | 3300013297 | Bacteria | 669 |
| 428 | Ga0157378_11914503 | 3300013297 | Bacteria | 642 |
| 429 | Ga0157378_12856308 | 3300013297 | Unclassified | 535 |
| 430 | Ga0157378_12945605 | 3300013297 | Unclassified | 528 |
| 431 | Ga0157378_13286061 | 3300013297 | Unclassified | 502 |
| 432 | Ga0163162_10610606 | 3300013306 | Unclassified | 1216 |
| 433 | Ga0163162_10693155 | 3300013306 | Unclassified | 1141 |
| 434 | Ga0163162_10772202 | 3300013306 | Bacteria | 1079 |
| 435 | Ga0163162_11212122 | 3300013306 | Unclassified | 857 |
| 436 | Ga0163162_11708247 | 3300013306 | Unclassified | 719 |
| 437 | Ga0163162_12505867 | 3300013306 | Bacteria | 593 |
| 438 | Ga0157372_10073774 | 3300013307 | Bacteria | 3847 |
| 439 | Ga0157372_10224975 | 3300013307 | Unclassified | 2175 |
| 440 | Ga0157372_11614229 | 3300013307 | Bacteria | 746 |
| 441 | Ga0157372_11807962 | 3300013307 | Bacteria | 703 |
| 442 | Ga0157372_12347356 | 3300013307 | Unclassified | 613 |
| 443 | Ga0157375_10366339 | 3300013308 | Bacteria | 1607 |
| 444 | Ga0157375_10472610 | 3300013308 | Bacteria | 1419 |
| 445 | Ga0157375_10880022 | 3300013308 | Bacteria | 1041 |
| 446 | Ga0157375_11374836 | 3300013308 | Bacteria | 831 |
| 447 | Ga0157375_12829824 | 3300013308 | Unclassified | 580 |
| 448 | Ga0157375_13577226 | 3300013308 | Bacteria | 517 |
| 449 | Ga0163163_10009538 | 3300014325 | Bacteria | 8671 |
| 450 | Ga0163163_10013787 | 3300014325 | Bacteria | 7411 |
| 451 | Ga0163163_10031393 | 3300014325 | Bacteria | 5127 |
| 452 | Ga0163163_10081016 | 3300014325 | Bacteria | 3247 |
| 453 | Ga0163163_10218222 | 3300014325 | Unclassified | 1956 |
| 454 | Ga0163163_10450901 | 3300014325 | Bacteria | 1347 |
| 455 | Ga0163163_11263366 | 3300014325 | Bacteria | 801 |
| 456 | Ga0163163_11611513 | 3300014325 | Bacteria | 710 |
| 457 | Ga0157380_10017178 | 3300014326 | Bacteria | 5351 |
| 458 | Ga0157380_10030544 | 3300014326 | Bacteria | 4128 |
| 459 | Ga0157380_10070030 | 3300014326 | Bacteria | 2833 |
| 460 | Ga0157380_10200705 | 3300014326 | Bacteria | 1769 |
| 461 | Ga0157380_12550446 | 3300014326 | Unclassified | 577 |
| 462 | Ga0157377_10248803 | 3300014745 | Unclassified | 1151 |
| 463 | Ga0157379_10105435 | 3300014968 | Bacteria | 2530 |
| 464 | Ga0157379_10126249 | 3300014968 | Bacteria | 2302 |
| 465 | Ga0157379_12038670 | 3300014968 | Bacteria | 568 |
| 466 | Ga0157376_10245643 | 3300014969 | Bacteria | 1669 |
| 467 | Ga0157376_10423107 | 3300014969 | Unclassified | 1293 |
| 468 | Ga0157376_11390312 | 3300014969 | Unclassified | 733 |
| 469 | Ga0157376_11644641 | 3300014969 | Unclassified | 677 |
| 470 | Ga0157376_12349454 | 3300014969 | Unclassified | 572 |
| 471 | Ga0182005_1078999 | 3300015265 | Bacteria | 907 |
| 472 | Ga0163161_10522853 | 3300017792 | Unclassified | 969 |
| 473 | Ga0163161_11518201 | 3300017792 | Bacteria | 588 |
| 474 | Ga0213873_10147142 | 3300021358 | Unclassified | 707 |
| 475 | Ga0213876_10000206 | 3300021384 | Bacteria | 59646 |
| 476 | Ga0213876_10023144 | 3300021384 | Unclassified | 3282 |
| 477 | Ga0213876_10097677 | 3300021384 | Bacteria | 1556 |
| 478 | Ga0213876_10143304 | 3300021384 | Bacteria | 1271 |
| 479 | Ga0213875_10012134 | 3300021388 | Unclassified | 4262 |
| 480 | Ga0213875_10039681 | 3300021388 | Bacteria | 2218 |
| 481 | Ga0213875_10135683 | 3300021388 | Bacteria | 1151 |
| 482 | Ga0213875_10193174 | 3300021388 | Bacteria | 957 |
| 483 | Ga0213875_10193905 | 3300021388 | Unclassified | 955 |
| 484 | Ga0213875_10580513 | 3300021388 | Bacteria | 541 |
| 485 | Ga0213871_10100652 | 3300021441 | Unclassified | 845 |
| 486 | Ga0207697_10007722 | 3300025315 | Bacteria | 4767 |
| 487 | Ga0207656_10015913 | 3300025321 | Bacteria | 2919 |
| 488 | Ga0207656_10320170 | 3300025321 | Bacteria | 770 |
| 489 | Ga0207682_10154334 | 3300025893 | Bacteria | 1037 |
| 490 | Ga0207682_10244679 | 3300025893 | Bacteria | 834 |
| 491 | Ga0207682_10357048 | 3300025893 | Unclassified | 689 |
| 492 | Ga0207692_10216577 | 3300025898 | Unclassified | 1133 |
| 493 | Ga0207642_10329846 | 3300025899 | Bacteria | 894 |
| 494 | Ga0207710_10257171 | 3300025900 | Bacteria | 874 |
| 495 | Ga0207688_10550961 | 3300025901 | Unclassified | 725 |
| 496 | Ga0207680_10153678 | 3300025903 | Bacteria | 1536 |
| 497 | Ga0207680_10386534 | 3300025903 | Bacteria | 987 |
| 498 | Ga0207647_10132759 | 3300025904 | Bacteria | 1463 |
| 499 | Ga0207647_10591242 | 3300025904 | Bacteria | 613 |
| 500 | Ga0207647_10701094 | 3300025904 | Bacteria | 552 |
| 501 | Ga0207685_10073708 | 3300025905 | Bacteria | 1392 |
| 502 | Ga0207699_10000041 | 3300025906 | Bacteria | 120229 |
| 503 | Ga0207699_10175088 | 3300025906 | Bacteria | 1438 |
| 504 | Ga0207699_10264877 | 3300025906 | Unclassified | 1189 |
| 505 | Ga0207699_10415383 | 3300025906 | Bacteria | 960 |
| 506 | Ga0207699_10454972 | 3300025906 | Bacteria | 919 |
| 507 | Ga0207645_10014818 | 3300025907 | Bacteria | 5204 |
| 508 | Ga0207645_10292592 | 3300025907 | Bacteria | 1083 |
| 509 | Ga0207645_10343750 | 3300025907 | Bacteria | 998 |
| 510 | Ga0207643_10006545 | 3300025908 | Bacteria | 6244 |
| 511 | Ga0207643_10335355 | 3300025908 | Bacteria | 947 |
| 512 | Ga0207643_11045959 | 3300025908 | Unclassified | 527 |
| 513 | Ga0207705_11432835 | 3300025909 | Bacteria | 524 |
| 514 | Ga0207684_10016942 | 3300025910 | Bacteria | 6260 |
| 515 | Ga0207684_10855643 | 3300025910 | Bacteria | 766 |
| 516 | Ga0207684_11176035 | 3300025910 | Unclassified | 636 |
| 517 | Ga0207684_11541010 | 3300025910 | Unclassified | 540 |
| 518 | Ga0207654_10257396 | 3300025911 | Bacteria | 1172 |
| 519 | Ga0207707_10013498 | 3300025912 | Bacteria | 7120 |
| 520 | Ga0207707_10033085 | 3300025912 | Bacteria | 4524 |
| 521 | Ga0207707_10061107 | 3300025912 | Bacteria | 3278 |
| 522 | Ga0207695_10048750 | 3300025913 | Bacteria | 4471 |
| 523 | Ga0207695_10242933 | 3300025913 | Bacteria | 1701 |
| 524 | Ga0207695_10770162 | 3300025913 | Bacteria | 843 |
| 525 | Ga0207671_10022782 | 3300025914 | Bacteria | 4731 |
| 526 | Ga0207671_10653801 | 3300025914 | Unclassified | 837 |
| 527 | Ga0207693_10037588 | 3300025915 | Bacteria | 3816 |
| 528 | Ga0207693_10075667 | 3300025915 | Bacteria | 2636 |
| 529 | Ga0207693_10467346 | 3300025915 | Unclassified | 985 |
| 530 | Ga0207693_10854613 | 3300025915 | Unclassified | 700 |
| 531 | Ga0207663_10155012 | 3300025916 | Unclassified | 1610 |
| 532 | Ga0207660_10014478 | 3300025917 | Bacteria | 5189 |
| 533 | Ga0207660_10057596 | 3300025917 | Bacteria | 2784 |
| 534 | Ga0207660_11163444 | 3300025917 | Unclassified | 628 |
| 535 | Ga0207662_10006257 | 3300025918 | Bacteria | 6412 |
| 536 | Ga0207662_10031007 | 3300025918 | Bacteria | 3106 |
| 537 | Ga0207657_10105516 | 3300025919 | Bacteria | 2332 |
| 538 | Ga0207657_10123410 | 3300025919 | Bacteria | 2129 |
| 539 | Ga0207657_10248876 | 3300025919 | Unclassified | 1417 |
| 540 | Ga0207657_10460905 | 3300025919 | Bacteria | 997 |
| 541 | Ga0207649_10010961 | 3300025920 | Bacteria | 4986 |
| 542 | Ga0207649_10023497 | 3300025920 | Bacteria | 3571 |
| 543 | Ga0207649_10044817 | 3300025920 | Bacteria | 2709 |
| 544 | Ga0207649_10086988 | 3300025920 | Bacteria | 2038 |
| 545 | Ga0207649_10170768 | 3300025920 | Unclassified | 1515 |
| 546 | Ga0207652_10027842 | 3300025921 | Bacteria | 4713 |
| 547 | Ga0207652_10194704 | 3300025921 | Bacteria | 1823 |
| 548 | Ga0207646_10448425 | 3300025922 | Bacteria | 1164 |
| 549 | Ga0207646_10912011 | 3300025922 | Unclassified | 779 |
| 550 | Ga0207646_11194520 | 3300025922 | Bacteria | 667 |
| 551 | Ga0207681_10000550 | 3300025923 | Bacteria | 25892 |
| 552 | Ga0207681_10906346 | 3300025923 | Unclassified | 738 |
| 553 | Ga0207694_10088562 | 3300025924 | Bacteria | 2440 |
| 554 | Ga0207694_10313981 | 3300025924 | Bacteria | 1293 |
| 555 | Ga0207694_10327190 | 3300025924 | Unclassified | 1266 |
| 556 | Ga0207694_10498669 | 3300025924 | Bacteria | 1019 |
| 557 | Ga0207694_10836087 | 3300025924 | Unclassified | 778 |
| 558 | Ga0207694_11163536 | 3300025924 | Unclassified | 653 |
| 559 | Ga0207650_10208118 | 3300025925 | Bacteria | 1570 |
| 560 | Ga0207650_10267264 | 3300025925 | Unclassified | 1389 |
| 561 | Ga0207650_10283208 | 3300025925 | Bacteria | 1350 |
| 562 | Ga0207650_10646628 | 3300025925 | Bacteria | 891 |
| 563 | Ga0207650_10820936 | 3300025925 | Bacteria | 788 |
| 564 | Ga0207659_10039573 | 3300025926 | Bacteria | 3290 |
| 565 | Ga0207659_10135140 | 3300025926 | Bacteria | 1908 |
| 566 | Ga0207659_10646234 | 3300025926 | Unclassified | 904 |
| 567 | Ga0207659_10733135 | 3300025926 | Unclassified | 847 |
| 568 | Ga0207687_11495422 | 3300025927 | Bacteria | 580 |
| 569 | Ga0207700_10071873 | 3300025928 | Unclassified | 2666 |
| 570 | Ga0207700_10352709 | 3300025928 | Unclassified | 1281 |
| 571 | Ga0207664_10057224 | 3300025929 | Bacteria | 3099 |
| 572 | Ga0207664_11264385 | 3300025929 | Bacteria | 657 |
| 573 | Ga0207644_10110086 | 3300025931 | Unclassified | 2082 |
| 574 | Ga0207690_10155523 | 3300025932 | Bacteria | 1699 |
| 575 | Ga0207690_10555137 | 3300025932 | Unclassified | 934 |
| 576 | Ga0207690_10914189 | 3300025932 | Bacteria | 728 |
| 577 | Ga0207706_10000408 | 3300025933 | Bacteria | 46179 |
| 578 | Ga0207706_10028618 | 3300025933 | Bacteria | 4976 |
| 579 | Ga0207706_10031686 | 3300025933 | Unclassified | 4708 |
| 580 | Ga0207706_10125485 | 3300025933 | Bacteria | 2257 |
| 581 | Ga0207706_10152449 | 3300025933 | Bacteria | 2033 |
| 582 | Ga0207706_10684825 | 3300025933 | Unclassified | 877 |
| 583 | Ga0207686_10568614 | 3300025934 | Bacteria | 888 |
| 584 | Ga0207686_11150041 | 3300025934 | Unclassified | 634 |
| 585 | Ga0207709_10236795 | 3300025935 | Bacteria | 1325 |
| 586 | Ga0207670_10090290 | 3300025936 | Unclassified | 2164 |
| 587 | Ga0207670_10141330 | 3300025936 | Bacteria | 1776 |
| 588 | Ga0207670_10695221 | 3300025936 | Bacteria | 841 |
| 589 | Ga0207670_11080580 | 3300025936 | Unclassified | 677 |
| 590 | Ga0207669_10710356 | 3300025937 | Bacteria | 827 |
| 591 | Ga0207669_11060438 | 3300025937 | Unclassified | 683 |
| 592 | Ga0207704_10121560 | 3300025938 | Bacteria | 1788 |
| 593 | Ga0207704_10251840 | 3300025938 | Bacteria | 1326 |
| 594 | Ga0207704_10935001 | 3300025938 | Bacteria | 731 |
| 595 | Ga0207665_10167738 | 3300025939 | Bacteria | 1583 |
| 596 | Ga0207665_10181610 | 3300025939 | Bacteria | 1524 |
| 597 | Ga0207665_10318729 | 3300025939 | Unclassified | 1166 |
| 598 | Ga0207665_11359046 | 3300025939 | Unclassified | 566 |
| 599 | Ga0207691_10001059 | 3300025940 | Bacteria | 27335 |
| 600 | Ga0207691_10003253 | 3300025940 | Bacteria | 15828 |
| 601 | Ga0207691_10259415 | 3300025940 | Bacteria | 1498 |
| 602 | Ga0207691_10291030 | 3300025940 | Unclassified | 1404 |
| 603 | Ga0207691_10856994 | 3300025940 | Bacteria | 762 |
| 604 | Ga0207711_10000012 | 3300025941 | Bacteria | 515147 |
| 605 | Ga0207711_10000063 | 3300025941 | Bacteria | 121296 |
| 606 | Ga0207711_10018490 | 3300025941 | Bacteria | 5795 |
| 607 | Ga0207711_10099650 | 3300025941 | Bacteria | 2569 |
| 608 | Ga0207711_10150239 | 3300025941 | Bacteria | 2101 |
| 609 | Ga0207711_10322538 | 3300025941 | Bacteria | 1427 |
| 610 | Ga0207711_11615190 | 3300025941 | Bacteria | 592 |
| 611 | Ga0207689_10083503 | 3300025942 | Unclassified | 2626 |
| 612 | Ga0207689_10489377 | 3300025942 | Bacteria | 1030 |
| 613 | Ga0207689_10811480 | 3300025942 | Unclassified | 790 |
| 614 | Ga0207689_11526002 | 3300025942 | Unclassified | 557 |
| 615 | Ga0207661_10030958 | 3300025944 | Bacteria | 4127 |
| 616 | Ga0207661_10043586 | 3300025944 | Bacteria | 3542 |
| 617 | Ga0207661_10122341 | 3300025944 | Bacteria | 2217 |
| 618 | Ga0207661_10201599 | 3300025944 | Unclassified | 1749 |
| 619 | Ga0207661_10506913 | 3300025944 | Bacteria | 1103 |
| 620 | Ga0207661_11104544 | 3300025944 | Bacteria | 730 |
| 621 | Ga0207679_10009699 | 3300025945 | Bacteria | 6172 |
| 622 | Ga0207679_10165370 | 3300025945 | Unclassified | 1816 |
| 623 | Ga0207679_10273865 | 3300025945 | Bacteria | 1445 |
| 624 | Ga0207679_10394381 | 3300025945 | Bacteria | 1216 |
| 625 | Ga0207679_10643763 | 3300025945 | Bacteria | 958 |
| 626 | Ga0207679_11289916 | 3300025945 | Bacteria | 670 |
| 627 | Ga0207667_10083340 | 3300025949 | Unclassified | 3311 |
| 628 | Ga0207651_10117426 | 3300025960 | Bacteria | 2010 |
| 629 | Ga0207651_10291987 | 3300025960 | Bacteria | 1352 |
| 630 | Ga0207651_10419642 | 3300025960 | Bacteria | 1142 |
| 631 | Ga0207651_10788294 | 3300025960 | Unclassified | 842 |
| 632 | Ga0207651_11264869 | 3300025960 | Bacteria | 663 |
| 633 | Ga0207651_11963549 | 3300025960 | Bacteria | 526 |
| 634 | Ga0207712_10000952 | 3300025961 | Bacteria | 20873 |
| 635 | Ga0207712_10108477 | 3300025961 | Unclassified | 2077 |
| 636 | Ga0207668_10092371 | 3300025972 | Bacteria | 2227 |
| 637 | Ga0207668_10500263 | 3300025972 | Unclassified | 1045 |
| 638 | Ga0207640_10289857 | 3300025981 | Unclassified | 1290 |
| 639 | Ga0207640_11334165 | 3300025981 | Bacteria | 641 |
| 640 | Ga0207640_11510088 | 3300025981 | Unclassified | 604 |
| 641 | Ga0207658_10280876 | 3300025986 | Unclassified | 1427 |
| 642 | Ga0207677_10062111 | 3300026023 | Bacteria | 2590 |
| 643 | Ga0207677_10458568 | 3300026023 | Unclassified | 1093 |
| 644 | Ga0207677_10989500 | 3300026023 | Bacteria | 762 |
| 645 | Ga0207677_11838646 | 3300026023 | Bacteria | 562 |
| 646 | Ga0207703_10958589 | 3300026035 | Bacteria | 820 |
| 647 | Ga0207703_11080271 | 3300026035 | Bacteria | 771 |
| 648 | Ga0207703_11225203 | 3300026035 | Bacteria | 721 |
| 649 | Ga0207639_10042113 | 3300026041 | Unclassified | 3421 |
| 650 | Ga0207678_10115178 | 3300026067 | Bacteria | 2293 |
| 651 | Ga0207678_11023667 | 3300026067 | Bacteria | 731 |
| 652 | Ga0207678_11033199 | 3300026067 | Bacteria | 727 |
| 653 | Ga0207678_11394160 | 3300026067 | Bacteria | 620 |
| 654 | Ga0207678_11874085 | 3300026067 | Unclassified | 524 |
| 655 | Ga0207708_10192914 | 3300026075 | Bacteria | 1622 |
| 656 | Ga0207702_10045580 | 3300026078 | Bacteria | 3688 |
| 657 | Ga0207702_10051399 | 3300026078 | Unclassified | 3482 |
| 658 | Ga0207702_10226761 | 3300026078 | Unclassified | 1744 |
| 659 | Ga0207702_10400077 | 3300026078 | Bacteria | 1324 |
| 660 | Ga0207702_12011658 | 3300026078 | Unclassified | 568 |
| 661 | Ga0207702_12427773 | 3300026078 | Unclassified | 511 |
| 662 | Ga0207641_10011867 | 3300026088 | Bacteria | 7148 |
| 663 | Ga0207641_10096014 | 3300026088 | Bacteria | 2603 |
| 664 | Ga0207641_10253684 | 3300026088 | Bacteria | 1644 |
| 665 | Ga0207641_10464959 | 3300026088 | Bacteria | 1224 |
| 666 | Ga0207641_12467815 | 3300026088 | Bacteria | 518 |
| 667 | Ga0207641_12582032 | 3300026088 | Unclassified | 506 |
| 668 | Ga0207648_10016223 | 3300026089 | Bacteria | 6815 |
| 669 | Ga0207648_10238007 | 3300026089 | Bacteria | 1620 |
| 670 | Ga0207648_11588780 | 3300026089 | Unclassified | 615 |
| 671 | Ga0207676_10028909 | 3300026095 | Bacteria | 4146 |
| 672 | Ga0207676_10189178 | 3300026095 | Bacteria | 1810 |
| 673 | Ga0207676_11307582 | 3300026095 | Unclassified | 720 |
| 674 | Ga0207676_11945953 | 3300026095 | Bacteria | 587 |
| 675 | Ga0207676_12148929 | 3300026095 | Bacteria | 556 |
| 676 | Ga0207676_12386893 | 3300026095 | Bacteria | 526 |
| 677 | Ga0207674_10000409 | 3300026116 | Bacteria | 55809 |
| 678 | Ga0207674_10000815 | 3300026116 | Bacteria | 40507 |
| 679 | Ga0207674_10004412 | 3300026116 | Bacteria | 16954 |
| 680 | Ga0207674_10042814 | 3300026116 | Bacteria | 4673 |
| 681 | Ga0207674_10147842 | 3300026116 | Bacteria | 2308 |
| 682 | Ga0207674_10676470 | 3300026116 | Bacteria | 996 |
| 683 | Ga0207674_11523430 | 3300026116 | Unclassified | 638 |
| 684 | Ga0207674_11542572 | 3300026116 | Unclassified | 633 |
| 685 | Ga0207675_100000465 | 3300026118 | Bacteria | 39473 |
| 686 | Ga0207675_100047183 | 3300026118 | Bacteria | 4022 |
| 687 | Ga0207675_100142753 | 3300026118 | Unclassified | 2275 |
| 688 | Ga0207675_100319211 | 3300026118 | Bacteria | 1516 |
| 689 | Ga0207675_100371633 | 3300026118 | Bacteria | 1405 |
| 690 | Ga0207675_101107025 | 3300026118 | Bacteria | 812 |
| 691 | Ga0207675_102354458 | 3300026118 | Unclassified | 545 |
| 692 | Ga0207683_10060993 | 3300026121 | Bacteria | 3317 |
| 693 | Ga0207683_10271784 | 3300026121 | Bacteria | 1548 |
| 694 | Ga0207683_11262652 | 3300026121 | Bacteria | 684 |
| 695 | Ga0207698_10365494 | 3300026142 | Unclassified | 1368 |
| 696 | Ga0207698_10620786 | 3300026142 | Bacteria | 1068 |
| 697 | Ga0207698_10829203 | 3300026142 | Bacteria | 929 |
| 698 | Ga0209981_1025677 | 3300027378 | Unclassified | 853 |
| 699 | Ga0209996_1076888 | 3300027395 | Bacteria | 522 |
| 700 | Ga0209995_1074634 | 3300027471 | Bacteria | 581 |
| 701 | Ga0209974_10120436 | 3300027876 | Bacteria | 929 |
| 702 | Ga0207428_10274170 | 3300027907 | Bacteria | 1253 |
| 703 | Ga0268266_10019400 | 3300028379 | Bacteria | 5790 |
| 704 | Ga0268266_10048329 | 3300028379 | Bacteria | 3647 |
| 705 | Ga0268266_10181009 | 3300028379 | Bacteria | 1919 |
| 706 | Ga0268266_10195470 | 3300028379 | Bacteria | 1849 |
| 707 | Ga0268265_10032898 | 3300028380 | Bacteria | 3763 |
| 708 | Ga0268265_10304035 | 3300028380 | Bacteria | 1437 |
| 709 | Ga0268264_10741153 | 3300028381 | Bacteria | 978 |
| 710 | Ga0268264_11396691 | 3300028381 | Bacteria | 711 |
| 711 | Ga0268264_12349013 | 3300028381 | Unclassified | 540 |
| 712 | Ga0265318_10203881 | 3300028577 | Bacteria | 723 |
| 713 | Ga0265336_10076894 | 3300028666 | Bacteria | 997 |
| 714 | Ga0265338_10015988 | 3300028800 | Bacteria | 8203 |
| 715 | Ga0265338_10206542 | 3300028800 | Bacteria | 1477 |
| 716 | Ga0265324_10090892 | 3300029957 | Bacteria | 1038 |
| 717 | Ga0265324_10095033 | 3300029957 | Bacteria | 1014 |
| 718 | Ga0265762_1076621 | 3300030760 | Unclassified | 710 |
| 719 | Ga0265770_1012381 | 3300030878 | Bacteria | 1263 |
| 720 | Ga0265332_10010511 | 3300031238 | Bacteria | 4121 |
| 721 | Ga0265332_10029395 | 3300031238 | Unclassified | 2403 |
| 722 | Ga0265332_10134446 | 3300031238 | Bacteria | 1037 |
| 723 | Ga0265328_10087219 | 3300031239 | Bacteria | 1152 |
| 724 | Ga0265328_10172109 | 3300031239 | Bacteria | 818 |
| 725 | Ga0265328_10252018 | 3300031239 | Unclassified | 676 |
| 726 | Ga0265320_10156777 | 3300031240 | Bacteria | 1026 |
| 727 | Ga0265329_10020834 | 3300031242 | Unclassified | 2210 |
| 728 | Ga0265340_10508202 | 3300031247 | Bacteria | 530 |
| 729 | Ga0265339_10001981 | 3300031249 | Bacteria | 15057 |
| 730 | Ga0265331_10001122 | 3300031250 | Bacteria | 20520 |
| 731 | Ga0265316_10010261 | 3300031344 | Bacteria | 8546 |
| 732 | Ga0265316_10052198 | 3300031344 | Bacteria | 3208 |
| 733 | Ga0265316_11010204 | 3300031344 | Bacteria | 579 |
| 734 | Ga0265316_11287756 | 3300031344 | Bacteria | 505 |
| 735 | Ga0307408_100019101 | 3300031548 | Bacteria | 4612 |
| 736 | Ga0316575_10189927 | 3300031665 | Bacteria | 854 |
| 737 | Ga0265314_10010188 | 3300031711 | Bacteria | 7872 |
| 738 | Ga0265314_10342152 | 3300031711 | Bacteria | 825 |
| 739 | Ga0265342_10053136 | 3300031712 | Bacteria | 2412 |
| 740 | Ga0265342_10106319 | 3300031712 | Bacteria | 1593 |
| 741 | Ga0307405_10369717 | 3300031731 | Unclassified | 1112 |
| 742 | Ga0307413_10293865 | 3300031824 | Unclassified | 1229 |
| 743 | Ga0307413_10950949 | 3300031824 | Unclassified | 733 |
| 744 | Ga0307410_10449162 | 3300031852 | Unclassified | 1051 |
| 745 | Ga0307410_11508171 | 3300031852 | Unclassified | 592 |
| 746 | Ga0307406_10017940 | 3300031901 | Bacteria | 4128 |
| 747 | Ga0307406_10123298 | 3300031901 | Unclassified | 1806 |
| 748 | Ga0307406_10871216 | 3300031901 | Bacteria | 765 |
| 749 | Ga0307407_10721978 | 3300031903 | Bacteria | 752 |
| 750 | Ga0307407_11405098 | 3300031903 | Unclassified | 550 |
| 751 | Ga0307412_10033868 | 3300031911 | Unclassified | 3250 |
| 752 | Ga0307412_10924836 | 3300031911 | Bacteria | 766 |
| 753 | Ga0307409_100090263 | 3300031995 | Unclassified | 2508 |
| 754 | Ga0307409_100693331 | 3300031995 | Bacteria | 1017 |
| 755 | Ga0307409_101466946 | 3300031995 | Bacteria | 709 |
| 756 | Ga0307416_100049701 | 3300032002 | Unclassified | 3336 |
| 757 | Ga0307416_100715213 | 3300032002 | Bacteria | 1092 |
| 758 | Ga0307416_100995648 | 3300032002 | Unclassified | 941 |
| 759 | Ga0307416_102064713 | 3300032002 | Bacteria | 672 |
| 760 | Ga0307414_10144388 | 3300032004 | Bacteria | 1868 |
| 761 | Ga0307414_11461688 | 3300032004 | Unclassified | 636 |
| 762 | Ga0307411_10330721 | 3300032005 | Unclassified | 1234 |
| 763 | Ga0307411_12356559 | 3300032005 | Unclassified | 501 |
| 764 | Ga0307415_100011183 | 3300032126 | Bacteria | 5122 |
| 765 | Ga0307415_100128397 | 3300032126 | Unclassified | 1914 |
| 766 | Ga0307415_100882202 | 3300032126 | Bacteria | 823 |
| 767 | Ga0307415_101568436 | 3300032126 | Bacteria | 632 |
| 768 | Ga0373930_0104598 | 3300034816 | Unclassified | 676 |
| 769 | Ga0373923_0208600 | 3300035111 | Bacteria | 905 |
| 770 | Ga0373941_0329975 | 3300035115 | Bacteria | 616 |
| 771 | Ga0373960_0084997 | 3300035121 | Bacteria | 1003 |
| 772 | Ga0373943_0511796 | 3300035170 | Bacteria | 702 |
| 773 | Ga0373946_0422828 | 3300035171 | Unclassified | 675 |
| 774 | Ga0373946_0702244 | 3300035171 | Unclassified | 529 |
| 775 | Ga0373955_0690088 | 3300035172 | Unclassified | 627 |
| 776 | Ga0373961_0053135 | 3300035241 | Bacteria | 1208 |
| 777 | Ga0373931_0059445 | 3300035691 | Bacteria | 2056 |
| 778 | Ga0373935_0403863 | 3300035692 | Unclassified | 982 |
| 779 | Ga0373935_0973151 | 3300035692 | Bacteria | 630 |
| 780 | Ga0373933_0613021 | 3300035724 | Unclassified | 715 |
| 781 | Ga0373933_0636623 | 3300035724 | Unclassified | 701 |
| 782 | Ga0373933_0670433 | 3300035724 | Unclassified | 682 |
| 783 | Ga0373947_0690174 | 3300035725 | Unclassified | 696 |
| 784 | Ga0373947_0946844 | 3300035725 | Unclassified | 588 |
| 785 | Ga0373937_0435531 | 3300036401 | Bacteria | 1245 |
| 786 | Ga0373937_0630192 | 3300036401 | Bacteria | 1017 |
| 787 | Ga0373925_0577134 | 3300037068 | Bacteria | 926 |
| 788 | Ga0395899_0851077 | 3300037312 | Bacteria | 560 |
| 789 | Ga0395898_1477896 | 3300037466 | Unclassified | 606 |
| 790 | Ga0395905_0286306 | 3300037471 | Bacteria | 1535 |
| 791 | Ga0395905_1365026 | 3300037471 | Bacteria | 613 |
| 792 | Ga0395905_1373870 | 3300037471 | Bacteria | 610 |
| 793 | Ga0395905_1460095 | 3300037471 | Bacteria | 588 |
| 794 | Ga0436364_0071833 | 3300037853 | Unclassified | 530 |
| 795 | Ga0436364_0084445 | 3300037853 | Unclassified | 3596 |
| 796 | Ga0436364_0245695 | 3300037853 | Bacteria | 6578 |
| 797 | Ga0436364_0344295 | 3300037853 | Bacteria | 4806 |
| 798 | Ga0436364_0550968 | 3300037853 | Bacteria | 2329 |
| 799 | Ga0436364_0608459 | 3300037853 | Bacteria | 2254 |
| 800 | Ga0436364_0945746 | 3300037853 | Bacteria | 1187 |
| 801 | Ga0436364_0961976 | 3300037853 | Bacteria | 541 |
| 802 | Ga0436364_1075961 | 3300037853 | Bacteria | 6596 |
| 803 | Ga0436364_1147843 | 3300037853 | Bacteria | 5892 |
| 804 | Ga0436364_1414926 | 3300037853 | Unclassified | 2059 |
| 805 | Ga0395901_2082388 | 3300038443 | Bacteria | 513 |
| 806 | Ga0436365_0235741 | 3300039437 | Bacteria | 3785 |
| 807 | Ga0436365_0281371 | 3300039437 | Bacteria | 16997 |
| 808 | Ga0436365_0420834 | 3300039437 | Bacteria | 1411 |
| 809 | Ga0436365_0747350 | 3300039437 | Bacteria | 1657 |
| 810 | Ga0436365_0798073 | 3300039437 | Bacteria | 1953 |
| 811 | Ga0436365_0880687 | 3300039437 | Bacteria | 59690 |
| 812 | Ga0436365_1242450 | 3300039437 | Unclassified | 777 |
| 813 | Ga0436365_1823448 | 3300039437 | Bacteria | 2281 |
| 814 | Ga0436360_0295315 | 3300039438 | Unclassified | 1114 |
| 815 | Ga0436361_1058012 | 3300039447 | Unclassified | 4765 |
| 816 | Ga0436363_1067817 | 3300039450 | Bacteria | 1561 |
| 817 | Ga0436362_0131534 | 3300039453 | Bacteria | 716 |
| 818 | Ga0436362_0383078 | 3300039453 | Bacteria | 633 |
| 819 | Ga0436362_0875147 | 3300039453 | Unclassified | 1292 |
| 820 | Ga0439461_0107425 | 3300041410 | Unclassified | 685 |
| 821 | Ga0451800_0073639 | 3300041459 | Unclassified | 751 |
| 822 | Ga0451800_1331463 | 3300041459 | Unclassified | 522 |
| 823 | Ga0451807_2070311 | 3300041486 | Bacteria | 1866 |
| 824 | Ga0451835_0018883 | 3300041492 | Unclassified | 508 |
| 825 | Ga0451837_0678076 | 3300041494 | Bacteria | 885 |
| 826 | Ga0451853_0276731 | 3300041512 | Bacteria | 1142 |
| 827 | Ga0451853_2338877 | 3300041512 | Unclassified | 611 |
| 828 | Ga0439448_0202122 | 3300042005 | Bacteria | 697 |
| 829 | Ga0439450_230610 | 3300042008 | Unclassified | 500 |
| 830 | Ga0451577_0497588 | 3300042876 | Bacteria | 1107 |
| 831 | Ga0451577_0942989 | 3300042876 | Bacteria | 776 |
| 832 | Ga0453683_0616396 | 3300044673 | Unclassified | 708 |
| 833 | Ga0453684_0574527 | 3300044712 | Bacteria | 1239 |
| 834 | Ga0466957_0230999 | 3300044842 | Bacteria | 1225 |
| 835 | Ga0451576_0043236 | 3300045051 | Bacteria | 4754 |
| 836 | Ga0451576_0044841 | 3300045051 | Bacteria | 4659 |
| 837 | Ga0451576_1196362 | 3300045051 | Bacteria | 794 |
| 838 | Ga0451576_1510156 | 3300045051 | Unclassified | 698 |
| 839 | Ga0466967_0696264 | 3300045976 | Bacteria | 1006 |
| 840 | Ga0495592_0434321 | 3300046454 | Bacteria | 826 |
| 841 | Ga0495603_0714944 | 3300046455 | Unclassified | 573 |
| 842 | Ga0495641_0394308 | 3300046461 | Unclassified | 628 |
| 843 | Ga0495651_0174839 | 3300046462 | Bacteria | 1525 |
| 844 | Ga0495653_0627869 | 3300046463 | Unclassified | 658 |
| 845 | Ga0495580_0001156 | 3300046472 | Bacteria | 23183 |
| 846 | Ga0495580_0488543 | 3300046472 | Unclassified | 823 |
| 847 | Ga0495580_0951240 | 3300046472 | Unclassified | 550 |
| 848 | Ga0495582_0005527 | 3300046473 | Bacteria | 7037 |
| 849 | Ga0495582_0006475 | 3300046473 | Bacteria | 6501 |
| 850 | Ga0495582_0177409 | 3300046473 | Unclassified | 1214 |
| 851 | Ga0495582_0351593 | 3300046473 | Bacteria | 849 |
| 852 | Ga0495582_0794709 | 3300046473 | Bacteria | 547 |
| 853 | Ga0495639_0009523 | 3300046475 | Bacteria | 4169 |
| 854 | Ga0495662_0044704 | 3300046476 | Bacteria | 2138 |
| 855 | Ga0495662_0065746 | 3300046476 | Bacteria | 1753 |
| 856 | Ga0495662_0242446 | 3300046476 | Unclassified | 888 |
| 857 | Ga0495664_0222015 | 3300046477 | Bacteria | 1144 |
| 858 | Ga0495664_0317542 | 3300046477 | Unclassified | 940 |
| 859 | Ga0495664_0347964 | 3300046477 | Unclassified | 893 |
| 860 | Ga0495664_0353735 | 3300046477 | Unclassified | 884 |
| 861 | Ga0495585_0448032 | 3300046492 | Unclassified | 618 |
| 862 | Ga0495594_0004234 | 3300046499 | Bacteria | 7368 |
| 863 | Ga0495594_0038140 | 3300046499 | Bacteria | 2623 |
| 864 | Ga0495594_0452151 | 3300046499 | Unclassified | 730 |
| 865 | Ga0495608_0037023 | 3300046511 | Bacteria | 3282 |
| 866 | Ga0495608_0047440 | 3300046511 | Bacteria | 2856 |
| 867 | Ga0495608_0258398 | 3300046511 | Bacteria | 1085 |
| 868 | Ga0495618_0105291 | 3300046514 | Unclassified | 1806 |
| 869 | Ga0495628_0030113 | 3300046516 | Unclassified | 4396 |
| 870 | Ga0495630_0070664 | 3300046517 | Bacteria | 2626 |
| 871 | Ga0495630_0095522 | 3300046517 | Bacteria | 2247 |
| 872 | Ga0495630_0559257 | 3300046517 | Unclassified | 877 |
| 873 | Ga0495666_0030172 | 3300046526 | Bacteria | 2663 |
| 874 | Ga0495642_0279535 | 3300046528 | Unclassified | 731 |
| 875 | Ga0495652_0361064 | 3300046529 | Unclassified | 1038 |
| 876 | Ga0495652_0373025 | 3300046529 | Bacteria | 1017 |
| 877 | Ga0495652_0700375 | 3300046529 | Unclassified | 682 |
| 878 | Ga0495665_0129863 | 3300046531 | Bacteria | 1319 |
| 879 | Ga0495665_0482560 | 3300046531 | Unclassified | 625 |
| 880 | Ga0495640_0122118 | 3300046533 | Bacteria | 1692 |
| 881 | Ga0495640_0310523 | 3300046533 | Bacteria | 978 |
| 882 | Ga0495640_0523807 | 3300046533 | Bacteria | 720 |
| 883 | Ga0495586_0119998 | 3300046535 | Bacteria | 1468 |
| 884 | Ga0495586_0290263 | 3300046535 | Bacteria | 936 |
| 885 | Ga0495587_0526678 | 3300046536 | Bacteria | 653 |
| 886 | Ga0495645_0179847 | 3300046543 | Bacteria | 1450 |
| 887 | Ga0495622_0182592 | 3300046557 | Unclassified | 940 |
| 888 | Ga0495667_0016789 | 3300046559 | Bacteria | 4945 |
| 889 | Ga0495667_0054510 | 3300046559 | Bacteria | 2631 |
| 890 | Ga0495667_0131357 | 3300046559 | Bacteria | 1615 |
| 891 | Ga0495667_0251964 | 3300046559 | Bacteria | 1124 |
| 892 | Ga0495634_0007046 | 3300046642 | Bacteria | 8480 |
| 893 | Ga0495634_0223121 | 3300046642 | Bacteria | 1162 |
| 894 | Ga0495635_0048591 | 3300046663 | Bacteria | 2925 |
| 895 | Ga0495635_0294489 | 3300046663 | Bacteria | 1089 |
| 896 | Ga0495635_0874209 | 3300046663 | Unclassified | 576 |
| 897 | Ga0495657_0224750 | 3300046675 | Bacteria | 1137 |
| 898 | Ga0495599_0302474 | 3300046678 | Bacteria | 965 |
| 899 | Ga0495599_0307060 | 3300046678 | Bacteria | 957 |
| 900 | Ga0495623_0261377 | 3300046679 | Bacteria | 970 |
| 901 | Ga0495647_0064481 | 3300046681 | Bacteria | 1453 |
| 902 | Ga0495658_0028050 | 3300046683 | Bacteria | 3035 |
| 903 | Ga0495658_0086255 | 3300046683 | Unclassified | 1852 |
| 904 | Ga0495669_0556401 | 3300046684 | Unclassified | 558 |
| 905 | Ga0495613_0246383 | 3300046689 | Unclassified | 1248 |
| 906 | Ga0495613_0521826 | 3300046689 | Bacteria | 798 |
| 907 | Ga0495613_0634513 | 3300046689 | Bacteria | 708 |
| 908 | Ga0495613_0971914 | 3300046689 | Unclassified | 546 |
| 909 | Ga0495624_0216882 | 3300046690 | Unclassified | 1161 |
| 910 | Ga0495624_0369741 | 3300046690 | Unclassified | 862 |
| 911 | Ga0495670_0429835 | 3300046691 | Unclassified | 715 |
| 912 | Ga0495600_0038111 | 3300046809 | Bacteria | 3127 |
| 913 | Ga0495581_0179579 | 3300047315 | Bacteria | 1238 |
| 914 | Ga0495604_0425665 | 3300047317 | Bacteria | 871 |
| 915 | Ga0495674_0043085 | 3300047319 | Bacteria | 4020 |
| 916 | Ga0495674_0308928 | 3300047319 | Bacteria | 1290 |
| 917 | Ga0495680_0041600 | 3300047322 | Bacteria | 3653 |
| 918 | Ga0495680_0269889 | 3300047322 | Bacteria | 1201 |
| 919 | Ga0495675_0110055 | 3300047444 | Bacteria | 1720 |
| 920 | Ga0495684_0035857 | 3300047471 | Bacteria | 3803 |
| 921 | Ga0495684_0899041 | 3300047471 | Unclassified | 570 |
| 922 | Ga0495593_0098073 | 3300047673 | Bacteria | 1505 |
| 923 | Ga0495593_0499416 | 3300047673 | Bacteria | 610 |
| 924 | Ga0495593_0599636 | 3300047673 | Unclassified | 553 |
| 925 | Ga0495602_0131255 | 3300048088 | Bacteria | 1997 |
| 926 | Ga0495602_0648625 | 3300048088 | Bacteria | 721 |
| 927 | Ga0496100_0241612 | 3300048903 | Unclassified | 1333 |
| 928 | Ga0496102_0008398 | 3300048905 | Bacteria | 8847 |
| 929 | Ga0496102_0610013 | 3300048905 | Unclassified | 1014 |
| 930 | Ga0496102_0755733 | 3300048905 | Unclassified | 895 |
| 931 | Ga0496102_1500267 | 3300048905 | Unclassified | 593 |
| 932 | Ga0496103_0054035 | 3300048906 | Bacteria | 2490 |
| 933 | Ga0496104_0445952 | 3300048907 | Bacteria | 1206 |
| 934 | Ga0496105_0096752 | 3300048908 | Unclassified | 2438 |
| 935 | Ga0496108_0064910 | 3300048911 | Bacteria | 3076 |
| 936 | Ga0496108_0721370 | 3300048911 | Bacteria | 864 |
| 937 | Ga0496108_0799115 | 3300048911 | Bacteria | 814 |
| 938 | Ga0496109_0030769 | 3300048912 | Bacteria | 4811 |
| 939 | Ga0496110_0081672 | 3300048913 | Bacteria | 2882 |
| 940 | Ga0496112_0091004 | 3300048915 | Bacteria | 3019 |
| 941 | Ga0496112_0218186 | 3300048915 | Bacteria | 1864 |
| 942 | Ga0496112_0428700 | 3300048915 | Unclassified | 1261 |
| 943 | Ga0496112_0745299 | 3300048915 | Unclassified | 906 |
| 944 | Ga0496113_0073660 | 3300048916 | Bacteria | 2602 |
| 945 | Ga0496115_0093153 | 3300048918 | Bacteria | 2463 |
| 946 | Ga0496115_0480237 | 3300048918 | Bacteria | 1001 |
| 947 | Ga0496126_0676664 | 3300048929 | Unclassified | 804 |
| 948 | Ga0501290_006760 | 3300049513 | Bacteria | 1436 |
| 949 | Ga0501291_077909 | 3300049514 | Unclassified | 655 |
| 950 | Ga0501292_020009 | 3300049515 | Unclassified | 1075 |
| 951 | Ga0501292_137908 | 3300049515 | Bacteria | 508 |
| 952 | Ga0501296_036365 | 3300049519 | Bacteria | 680 |
| 953 | Ga0501297_009815 | 3300049520 | Bacteria | 1075 |
| 954 | Ga0501298_007554 | 3300049521 | Bacteria | 1804 |
| 955 | Ga0501298_013070 | 3300049521 | Bacteria | 1464 |
| 956 | Ga0501298_044940 | 3300049521 | Unclassified | 903 |
| 957 | Ga0501299_014499 | 3300049522 | Bacteria | 1372 |
| 958 | Ga0501299_026435 | 3300049522 | Unclassified | 1096 |
| 959 | Ga0501299_114242 | 3300049522 | Bacteria | 643 |
| 960 | Ga0501034_1626256 | 3300049571 | Unclassified | 519 |
| 961 | Ga0501041_0149844 | 3300049577 | Bacteria | 1456 |
| 962 | Ga0501041_1080958 | 3300049577 | Unclassified | 517 |
| 963 | Ga0501075_0273874 | 3300049591 | Bacteria | 1286 |
| 964 | Ga0501076_0633222 | 3300049592 | Unclassified | 882 |
| 965 | Ga0501076_0946180 | 3300049592 | Bacteria | 710 |
| 966 | Ga0501198_086517 | 3300049649 | Unclassified | 615 |
| 967 | Ga0501202_143760 | 3300049652 | Unclassified | 619 |
| 968 | Ga0501206_022651 | 3300049653 | Unclassified | 902 |
| 969 | Ga0501208_087532 | 3300049655 | Unclassified | 650 |
| 970 | Ga0501208_092554 | 3300049655 | Unclassified | 637 |
| 971 | Ga0501216_019463 | 3300049660 | Bacteria | 1178 |
| 972 | Ga0501217_009648 | 3300049661 | Bacteria | 2103 |
| 973 | Ga0501217_016676 | 3300049661 | Unclassified | 1686 |
| 974 | Ga0501217_076107 | 3300049661 | Unclassified | 921 |
| 975 | Ga0501217_212845 | 3300049661 | Bacteria | 607 |
| 976 | Ga0501223_023553 | 3300049663 | Unclassified | 1200 |
| 977 | Ga0501224_004561 | 3300049664 | Bacteria | 1969 |
| 978 | Ga0501224_041242 | 3300049664 | Bacteria | 698 |
| 979 | Ga0501228_011412 | 3300049666 | Unclassified | 899 |
| 980 | Ga0501233_027158 | 3300049668 | Bacteria | 1269 |
| 981 | Ga0501233_111223 | 3300049668 | Unclassified | 733 |
| 982 | Ga0501235_001714 | 3300049669 | Bacteria | 4706 |
| 983 | Ga0501239_016392 | 3300049672 | Bacteria | 874 |
| 984 | Ga0501239_076184 | 3300049672 | Bacteria | 530 |
| 985 | Ga0501240_005359 | 3300049673 | Bacteria | 1534 |
| 986 | Ga0501240_110553 | 3300049673 | Bacteria | 536 |
| 987 | Ga0501242_019328 | 3300049674 | Unclassified | 870 |
| 988 | Ga0501243_002924 | 3300049675 | Unclassified | 2515 |
| 989 | Ga0501246_013222 | 3300049676 | Unclassified | 782 |
| 990 | Ga0501247_007552 | 3300049677 | Unclassified | 1252 |
| 991 | Ga0501247_031814 | 3300049677 | Bacteria | 724 |
| 992 | Ga0501249_100801 | 3300049679 | Unclassified | 691 |
| 993 | Ga0501249_158729 | 3300049679 | Unclassified | 573 |
| 994 | Ga0501250_098332 | 3300049680 | Unclassified | 518 |
| 995 | Ga0501251_012585 | 3300049681 | Bacteria | 1025 |
| 996 | Ga0501252_007966 | 3300049682 | Unclassified | 1210 |
| 997 | Ga0501255_001777 | 3300049684 | Bacteria | 1799 |
| 998 | Ga0501257_049001 | 3300049686 | Unclassified | 1051 |
| 999 | Ga0501257_104406 | 3300049686 | Unclassified | 747 |
| 1000 | Ga0501261_005956 | 3300049690 | Unclassified | 1545 |
| 1001 | Ga0501261_123073 | 3300049690 | Unclassified | 516 |
| 1002 | Ga0501221_083632 | 3300049704 | Unclassified | 771 |
| 1003 | Ga0501225_0034047 | 3300049705 | Unclassified | 1402 |
| 1004 | Ga0501225_0101150 | 3300049705 | Unclassified | 842 |
| 1005 | Ga0501225_0307005 | 3300049705 | Unclassified | 538 |
| 1006 | Ga0501229_064728 | 3300049706 | Bacteria | 563 |
| 1007 | Ga0501229_083937 | 3300049706 | Bacteria | 513 |
| 1008 | Ga0501234_019895 | 3300049707 | Unclassified | 1066 |
| 1009 | Ga0501245_011475 | 3300049708 | Unclassified | 1290 |
| 1010 | Ga0501079_0199004 | 3300049741 | Bacteria | 1565 |
| 1011 | Ga0501079_0370742 | 3300049741 | Bacteria | 1122 |
| 1012 | Ga0501080_0667562 | 3300049742 | Unclassified | 919 |
| 1013 | Ga0501081_0151596 | 3300049743 | Bacteria | 1665 |
| 1014 | Ga0501263_050347 | 3300049760 | Bacteria | 632 |
| 1015 | Ga0501263_051868 | 3300049760 | Unclassified | 626 |
| 1016 | Ga0501264_026136 | 3300049761 | Unclassified | 647 |
| 1017 | Ga0501265_023382 | 3300049762 | Bacteria | 850 |
| 1018 | Ga0501265_114680 | 3300049762 | Bacteria | 507 |
| 1019 | Ga0501268_063473 | 3300049765 | Unclassified | 736 |
| 1020 | Ga0501268_100729 | 3300049765 | Bacteria | 619 |
| 1021 | Ga0501270_006461 | 3300049767 | Unclassified | 1409 |
| 1022 | Ga0501270_039599 | 3300049767 | Bacteria | 815 |
| 1023 | Ga0501271_006322 | 3300049768 | Bacteria | 1174 |
| 1024 | Ga0501279_016527 | 3300049775 | Bacteria | 1028 |
| 1025 | Ga0501280_094272 | 3300049776 | Unclassified | 568 |
| 1026 | Ga0501283_001918 | 3300049779 | Bacteria | 2687 |
| 1027 | Ga0501283_026167 | 3300049779 | Unclassified | 959 |
| 1028 | Ga0501035_0786373 | 3300049822 | Bacteria | 761 |
| 1029 | Ga0501044_0477113 | 3300049823 | Unclassified | 1151 |
| 1030 | Ga0501045_0755568 | 3300049824 | Unclassified | 717 |
| 1031 | Ga0501212_036662 | 3300049851 | Bacteria | 803 |
| 1032 | nmdc:mga05p37_107880_c1 | 3300050507 | Unclassified | 3425 |
| 1033 | nmdc:mga05p37_2026779_c1 | 3300050507 | Unclassified | 543 |
| 1034 | nmdc:mga05p37_336502_c1 | 3300050507 | Unclassified | 1781 |
| 1035 | nmdc:mga05p37_554399_c1 | 3300050507 | Bacteria | 1307 |
| 1036 | nmdc:mga05p37_75128_c1 | 3300050507 | Bacteria | 4160 |
| 1037 | nmdc:mga05p37_777537_c1 | 3300050507 | Bacteria | 1051 |
| 1038 | nmdc:mga09592_179882_c1 | 3300050508 | Bacteria | 1829 |
| 1039 | nmdc:mga09592_446432_c1 | 3300050508 | Unclassified | 1116 |
| 1040 | nmdc:mga09592_884699_c1 | 3300050508 | Unclassified | 751 |
| 1041 | nmdc:mga0qj67_1427558_c1 | 3300050509 | Bacteria | 534 |
| 1042 | nmdc:mga06r32_157880_c1 | 3300050510 | Unclassified | 2250 |
| 1043 | nmdc:mga06r32_375826_c1 | 3300050510 | Unclassified | 1404 |
| 1044 | nmdc:mga06r32_39679_c1 | 3300050510 | Bacteria | 4468 |
| 1045 | nmdc:mga06r32_439658_c1 | 3300050510 | Unclassified | 1284 |
| 1046 | nmdc:mga06r32_623792_c1 | 3300050510 | Unclassified | 1048 |
| 1047 | nmdc:mga08y16_473655_c1 | 3300050511 | Bacteria | 1275 |
| 1048 | nmdc:mga08y16_662230_c1 | 3300050511 | Bacteria | 1047 |
| 1049 | nmdc:mga0n895_14141_c1 | 3300050512 | Bacteria | 7236 |
| 1050 | nmdc:mga0n895_185362_c1 | 3300050512 | Bacteria | 2112 |
| 1051 | nmdc:mga0n895_2003103_c1 | 3300050512 | Bacteria | 537 |
| 1052 | nmdc:mga0n895_692996_c1 | 3300050512 | Bacteria | 1015 |
| 1053 | nmdc:mga0n895_725159_c1 | 3300050512 | Bacteria | 989 |
| 1054 | nmdc:mga0n895_773563_c1 | 3300050512 | Unclassified | 952 |
| 1055 | nmdc:mga0n895_883260_c1 | 3300050512 | Bacteria | 880 |
| 1056 | nmdc:mga0rr50_1467314_c1 | 3300050513 | Bacteria | 577 |
| 1057 | nmdc:mga0rr50_43180_c1 | 3300050513 | Bacteria | 3297 |
| 1058 | nmdc:mga08x19_1067473_c1 | 3300050514 | Unclassified | 573 |
| 1059 | nmdc:mga08x19_259321_c1 | 3300050514 | Unclassified | 1201 |
| 1060 | nmdc:mga08x19_277462_c1 | 3300050514 | Bacteria | 1161 |
| 1061 | nmdc:mga08x19_389744_c1 | 3300050514 | Unclassified | 976 |
| 1062 | nmdc:mga08x19_555_c1 | 3300050514 | Bacteria | 4833 |
| 1063 | nmdc:mga08x19_716327_c1 | 3300050514 | Unclassified | 710 |
| 1064 | nmdc:mga0a205_233729_c1 | 3300050515 | Unclassified | 1721 |
| 1065 | Ga0495601_0063207 | 3300053077 | Bacteria | 2353 |
| 1066 | Ga0500635_0284117 | 3300053080 | Bacteria | 652 |
| 1067 | Ga0500644_0027062 | 3300053088 | Bacteria | 1781 |
| 1068 | Ga0500555_051781 | 3300053103 | Bacteria | 1122 |
| 1069 | Ga0500555_106057 | 3300053103 | Bacteria | 710 |
| 1070 | Ga0500595_043978 | 3300053119 | Bacteria | 1418 |
| 1071 | Ga0500627_0133357 | 3300053158 | Unclassified | 1122 |
| 1072 | Ga0500596_065914 | 3300053735 | Unclassified | 612 |
| 1073 | Ga0501084_0193711 | 3300054114 | Bacteria | 1715 |
| 1074 | Ga0590071_090121 | 3300059421 | Bacteria | 767 |
| 1075 | Ga0587066_014514 | 3300059490 | Bacteria | 1212 |
| 1076 | Ga0207675_100495571 | |||
| 1077 | Ga0065712_10660374 | |||
| 1078 | Ga0065715_10036657 | |||
| 1079 | Ga0065715_10182647 | |||
| 1080 | Ga0065715_10206825 | |||
| 1081 | Ga0065715_10686545 | |||
| 1082 | Ga0065707_10005725 | |||
| 1083 | Ga0065707_10153081 | |||
| 1084 | Ga0065707_10270071 | |||
| 1085 | Ga0065707_10386432 | |||
| 1086 | Ga0070658_10324717 | |||
| 1087 | Ga0070658_10377500 | |||
| 1088 | Ga0070676_10126069 | |||
| 1089 | Ga0070676_10569696 | |||
| 1090 | Ga0070683_100048180 | |||
| 1091 | Ga0070683_100058164 | |||
| 1092 | Ga0070683_100180310 | |||
| 1093 | Ga0070683_100186840 | |||
| 1094 | Ga0070683_100214790 | |||
| 1095 | Ga0070683_100366706 | |||
| 1096 | Ga0070683_100875266 | |||
| 1097 | Ga0070683_101580605 | |||
| 1098 | Ga0070683_102127131 | |||
| 1099 | Ga0070670_100032878 | |||
| 1100 | Ga0070670_100039831 | |||
| 1101 | Ga0070670_100165886 | |||
| 1102 | Ga0070670_100287719 | |||
| 1103 | Ga0070677_10784482 | |||
| 1104 | Ga0068869_100038165 | |||
| 1105 | Ga0068869_100250604 | |||
| 1106 | Ga0068869_100317306 | |||
| 1107 | Ga0068869_101903253 | |||
| 1108 | Ga0070666_10082292 | |||
| 1109 | Ga0070666_10167053 | |||
| 1110 | Ga0070680_100007133 | |||
| 1111 | Ga0070680_100130567 | |||
| 1112 | Ga0070680_100271982 | |||
| 1113 | Ga0068868_100256491 | |||
| 1114 | Ga0068868_100316342 | |||
| 1115 | Ga0068868_100595207 | |||
| 1116 | Ga0068868_100610189 | |||
| 1117 | Ga0068868_101291647 | |||
| 1118 | Ga0068868_101830275 | |||
| 1119 | Ga0070660_100113504 | |||
| 1120 | Ga0070660_100593044 | |||
| 1121 | Ga0070660_101398214 | |||
| 1122 | Ga0070689_100050282 | |||
| 1123 | Ga0070689_100096732 | |||
| 1124 | Ga0070689_100709323 | |||
| 1125 | Ga0070689_100874938 | |||
| 1126 | Ga0070689_101020403 | |||
| 1127 | Ga0070687_100005760 | |||
| 1128 | Ga0070687_100181136 | |||
| 1129 | Ga0070661_100008191 | |||
| 1130 | Ga0070661_100397257 | |||
| 1131 | Ga0070661_100484310 | |||
| 1132 | Ga0070692_10024117 | |||
| 1133 | Ga0070668_100028835 | |||
| 1134 | Ga0070668_100041989 | |||
| 1135 | Ga0070669_100010554 | |||
| 1136 | Ga0070669_100014982 | |||
| 1137 | Ga0070669_100114733 | |||
| 1138 | Ga0070669_100786415 | |||
| 1139 | Ga0070675_100058123 | |||
| 1140 | Ga0070675_100106446 | |||
| 1141 | Ga0070675_100497576 | |||
| 1142 | Ga0070675_100554275 | |||
| 1143 | Ga0070675_100691126 | |||
| 1144 | Ga0070675_100941567 | |||
| 1145 | Ga0070671_100098714 | |||
| 1146 | Ga0070671_100258870 | |||
| 1147 | Ga0070671_101107461 | |||
| 1148 | Ga0070674_100237683 | |||
| 1149 | Ga0070674_100274107 | |||
| 1150 | Ga0070674_100699649 | |||
| 1151 | Ga0070674_101193599 | |||
| 1152 | Ga0070673_100592426 | |||
| 1153 | Ga0070673_100668931 | |||
| 1154 | Ga0070673_101674110 | |||
| 1155 | Ga0070673_101745764 | |||
| 1156 | Ga0070673_101857801 | |||
| 1157 | Ga0070688_100346497 | |||
| 1158 | Ga0070688_100733954 | |||
| 1159 | Ga0070688_100873883 | |||
| 1160 | Ga0070659_100030150 | |||
| 1161 | Ga0070659_100224607 | |||
| 1162 | Ga0070659_100456039 | |||
| 1163 | Ga0070659_101463435 | |||
| 1164 | Ga0070667_100069000 | |||
| 1165 | Ga0070667_101463429 | |||
| 1166 | Ga0070667_102129448 | |||
| 1167 | Ga0070709_11534376 | |||
| 1168 | Ga0070714_100068098 | |||
| 1169 | Ga0070714_100271706 | |||
| 1170 | Ga0070714_100492161 | |||
| 1171 | Ga0070714_100506247 | |||
| 1172 | Ga0070713_100038744 | |||
| 1173 | Ga0070713_100460516 | |||
| 1174 | Ga0070713_100677256 | |||
| 1175 | Ga0070713_101408438 | |||
| 1176 | Ga0070710_10902612 | |||
| 1177 | Ga0070701_10186801 | |||
| 1178 | Ga0070711_100026538 | |||
| 1179 | Ga0070711_100592807 | |||
| 1180 | Ga0070705_100444918 | |||
| 1181 | Ga0070705_100900422 | |||
| 1182 | Ga0070700_100089669 | |||
| 1183 | Ga0070700_100670454 | |||
| 1184 | Ga0070694_100123457 | |||
| 1185 | Ga0070694_100458843 | |||
| 1186 | Ga0070694_100762858 | |||
| 1187 | Ga0070708_100261606 | |||
| 1188 | Ga0070708_100437115 | |||
| 1189 | Ga0070663_100048398 | |||
| 1190 | Ga0070663_100365386 | |||
| 1191 | Ga0070663_100888077 | |||
| 1192 | Ga0070663_101051761 | |||
| 1193 | Ga0070663_101921582 | |||
| 1194 | Ga0070678_100090652 | |||
| 1195 | Ga0070678_100150438 | |||
| 1196 | Ga0070678_101654425 | |||
| 1197 | Ga0070662_100067643 | |||
| 1198 | Ga0070662_100083085 | |||
| 1199 | Ga0070662_100275435 | |||
| 1200 | Ga0070662_100277436 | |||
| 1201 | Ga0070681_10000342 | |||
| 1202 | Ga0070681_10000540 | |||
| 1203 | Ga0070681_10188496 | |||
| 1204 | Ga0068867_100025648 | |||
| 1205 | Ga0068867_100031093 | |||
| 1206 | Ga0068867_100230564 | |||
| 1207 | Ga0068867_100882871 | |||
| 1208 | Ga0070685_10241681 | |||
| 1209 | Ga0070685_10413548 | |||
| 1210 | Ga0070706_100019461 | |||
| 1211 | Ga0070706_100022641 | |||
| 1212 | Ga0070706_100136440 | |||
| 1213 | Ga0070706_100607898 | |||
| 1214 | Ga0070706_101110221 | |||
| 1215 | Ga0070706_101769679 | |||
| 1216 | Ga0070707_100152417 | |||
| 1217 | Ga0070707_100315612 | |||
| 1218 | Ga0070707_100400964 | |||
| 1219 | Ga0070707_100430875 | |||
| 1220 | Ga0070707_100938440 | |||
| 1221 | Ga0070698_100000807 | |||
| 1222 | Ga0070698_100021834 | |||
| 1223 | Ga0070698_100029299 | |||
| 1224 | Ga0070698_100037758 | |||
| 1225 | Ga0070698_100904801 | |||
| 1226 | Ga0070699_100000932 | |||
| 1227 | Ga0070699_100042673 | |||
| 1228 | Ga0070699_100160165 | |||
| 1229 | Ga0070699_100396045 | |||
| 1230 | Ga0070699_101745354 | |||
| 1231 | Ga0070679_100001118 | |||
| 1232 | Ga0070679_100094928 | |||
| 1233 | Ga0070684_100028747 | |||
| 1234 | Ga0070684_100033883 | |||
| 1235 | Ga0070684_100148555 | |||
| 1236 | Ga0070684_100370080 | |||
| 1237 | Ga0070684_100784750 | |||
| 1238 | Ga0070684_101063118 | |||
| 1239 | Ga0070684_101490097 | |||
| 1240 | Ga0070697_100097813 | |||
| 1241 | Ga0070697_100123086 | |||
| 1242 | Ga0070697_100302832 | |||
| 1243 | Ga0070697_100642730 | |||
| 1244 | Ga0070697_100704835 | |||
| 1245 | Ga0070697_100907185 | |||
| 1246 | Ga0068853_100026648 | |||
| 1247 | Ga0068853_101964902 | |||
| 1248 | Ga0070672_100026379 | |||
| 1249 | Ga0070672_100078935 | |||
| 1250 | Ga0070672_100199736 | |||
| 1251 | Ga0070672_100242100 | |||
| 1252 | Ga0070686_100094199 | |||
| 1253 | Ga0070695_100738678 | |||
| 1254 | Ga0070695_100845637 | |||
| 1255 | Ga0070695_101783004 | |||
| 1256 | Ga0070696_100024803 | |||
| 1257 | Ga0070696_100143523 | |||
| 1258 | Ga0070696_100281287 | |||
| 1259 | Ga0070696_100329680 | |||
| 1260 | Ga0070696_100335105 | |||
| 1261 | Ga0070696_100436486 | |||
| 1262 | Ga0070696_100941659 | |||
| 1263 | Ga0070696_101168568 | |||
| 1264 | Ga0070693_100983327 | |||
| 1265 | Ga0070665_100064090 | |||
| 1266 | Ga0070665_100440955 | |||
| 1267 | Ga0070665_102367276 | |||
| 1268 | Ga0070704_100360352 | |||
| 1269 | Ga0070704_100801675 | |||
| 1270 | Ga0070704_101516302 | |||
| 1271 | Ga0070704_101519133 | |||
| 1272 | Ga0068855_100668579 | |||
| 1273 | Ga0070664_100002183 | |||
| 1274 | Ga0070664_100021615 | |||
| 1275 | Ga0070664_100048449 | |||
| 1276 | Ga0070664_100419362 | |||
| 1277 | Ga0070664_100532195 | |||
| 1278 | Ga0070664_100713440 | |||
| 1279 | Ga0070664_100885174 | |||
| 1280 | Ga0070664_101602292 | |||
| 1281 | Ga0068857_100002781 | |||
| 1282 | Ga0068857_100014310 | |||
| 1283 | Ga0068857_100165935 | |||
| 1284 | Ga0068857_100353045 | |||
| 1285 | Ga0068857_100512003 | |||
| 1286 | Ga0068857_101585719 | |||
| 1287 | Ga0068854_100100973 | |||
| 1288 | Ga0068854_100184631 | |||
| 1289 | Ga0068854_100377101 | |||
| 1290 | Ga0068854_101929406 | |||
| 1291 | Ga0068856_100137259 | |||
| 1292 | Ga0068856_100771281 | |||
| 1293 | Ga0068856_100791106 | |||
| 1294 | Ga0068856_102273566 | |||
| 1295 | Ga0070702_100169846 | |||
| 1296 | Ga0070702_100507407 | |||
| 1297 | Ga0068852_100147413 | |||
| 1298 | Ga0068852_100157205 | |||
| 1299 | Ga0068852_100176039 | |||
| 1300 | Ga0068852_100919444 | |||
| 1301 | Ga0068852_101692964 | |||
| 1302 | Ga0068859_100087820 | |||
| 1303 | Ga0068859_100122061 | |||
| 1304 | Ga0068859_100162769 | |||
| 1305 | Ga0068859_100453637 | |||
| 1306 | Ga0068859_100831096 | |||
| 1307 | Ga0068859_101963370 | |||
| 1308 | Ga0068859_101994992 | |||
| 1309 | Ga0068864_100013175 | |||
| 1310 | Ga0068864_100040517 | |||
| 1311 | Ga0068864_100150045 | |||
| 1312 | Ga0068864_100356750 | |||
| 1313 | Ga0068864_100580603 | |||
| 1314 | Ga0068864_100925682 | |||
| 1315 | Ga0068864_101115594 | |||
| 1316 | Ga0068864_101689392 | |||
| 1317 | Ga0068866_10060789 | |||
| 1318 | Ga0068861_100017142 | |||
| 1319 | Ga0068861_100105025 | |||
| 1320 | Ga0068861_100126622 | |||
| 1321 | Ga0068861_100590775 | |||
| 1322 | Ga0068861_100783604 | |||
| 1323 | Ga0068861_100945778 | |||
| 1324 | Ga0068861_101398816 | |||
| 1325 | Ga0068851_10191259 | |||
| 1326 | Ga0068851_10422233 | |||
| 1327 | Ga0068851_10753066 | |||
| 1328 | Ga0068870_10004730 | |||
| 1329 | Ga0068870_10383105 | |||
| 1330 | Ga0068870_10440690 | |||
| 1331 | Ga0068863_100006098 | |||
| 1332 | Ga0068863_100065803 | |||
| 1333 | Ga0068863_100446718 | |||
| 1334 | Ga0068863_100890355 | |||
| 1335 | Ga0068863_102688735 | |||
| 1336 | Ga0068858_100419991 | |||
| 1337 | Ga0068858_100783161 | |||
| 1338 | Ga0068858_102449797 | |||
| 1339 | Ga0068860_100103197 | |||
| 1340 | Ga0068860_100124247 | |||
| 1341 | Ga0068860_100803622 | |||
| 1342 | Ga0068860_101352914 | |||
| 1343 | Ga0068862_100002139 | |||
| 1344 | Ga0068862_100030031 | |||
| 1345 | Ga0068862_100221043 | |||
| 1346 | Ga0068862_100266094 | |||
| 1347 | Ga0068862_102508543 | |||
| 1348 | Ga0081455_10012197 | |||
| 1349 | Ga0081455_10041053 | |||
| 1350 | Ga0081455_10044796 | |||
| 1351 | Ga0081455_10052145 | |||
| 1352 | Ga0081455_10510666 | |||
| 1353 | Ga0081540_1002800 | |||
| 1354 | Ga0081540_1038826 | |||
| 1355 | Ga0081539_10000346 | |||
| 1356 | Ga0070717_10112750 | |||
| 1357 | Ga0070717_10148522 | |||
| 1358 | Ga0070717_10432067 | |||
| 1359 | Ga0070717_11293225 | |||
| 1360 | Ga0070716_100021514 | |||
| 1361 | Ga0070712_100047146 | |||
| 1362 | Ga0070712_100194498 | |||
| 1363 | Ga0070712_100674170 | |||
| 1364 | Ga0097621_100197725 | |||
| 1365 | Ga0097621_100323174 | |||
| 1366 | Ga0097621_100333780 | |||
| 1367 | Ga0097621_100657609 | |||
| 1368 | Ga0068871_100144991 | |||
| 1369 | Ga0068871_100265382 | |||
| 1370 | Ga0068871_100470617 | |||
| 1371 | Ga0068871_101009500 | |||
| 1372 | Ga0075428_100105930 | |||
| 1373 | Ga0075428_100147946 | |||
| 1374 | Ga0075428_100256489 | |||
| 1375 | Ga0075428_100459191 | |||
| 1376 | Ga0075428_100467150 | |||
| 1377 | Ga0075428_100598582 | |||
| 1378 | Ga0075428_100822785 | |||
| 1379 | Ga0075428_101584253 | |||
| 1380 | Ga0075430_101601138 | |||
| 1381 | Ga0075431_100022067 | |||
| 1382 | Ga0075431_100046470 | |||
| 1383 | Ga0075431_100320914 | |||
| 1384 | Ga0075431_101348546 | |||
| 1385 | Ga0075433_10428798 | |||
| 1386 | Ga0075433_10735655 | |||
| 1387 | Ga0075433_10817172 | |||
| 1388 | Ga0075433_10947108 | |||
| 1389 | Ga0075433_11042595 | |||
| 1390 | Ga0075434_100011626 | |||
| 1391 | Ga0075434_100049011 | |||
| 1392 | Ga0075434_100209988 | |||
| 1393 | Ga0075434_100384599 | |||
| 1394 | Ga0075434_100983549 | |||
| 1395 | Ga0075434_101063208 | |||
| 1396 | Ga0075434_101855844 | |||
| 1397 | Ga0075429_100120426 | |||
| 1398 | Ga0075429_100694077 | |||
| 1399 | Ga0075429_101432013 | |||
| 1400 | Ga0068865_100073433 | |||
| 1401 | Ga0068865_100132500 | |||
| 1402 | Ga0075436_100038127 | |||
| 1403 | Ga0075436_100286426 | |||
| 1404 | Ga0075436_100289977 | |||
| 1405 | Ga0075436_100300208 | |||
| 1406 | Ga0075436_100527139 | |||
| 1407 | Ga0075436_101127692 | |||
| 1408 | Ga0075436_101358092 | |||
| 1409 | Ga0097620_100087814 | |||
| 1410 | Ga0097620_100122047 | |||
| 1411 | Ga0097620_100162767 | |||
| 1412 | Ga0097620_100453651 | |||
| 1413 | Ga0097620_100831175 | |||
| 1414 | Ga0097620_101963595 | |||
| 1415 | Ga0097620_101994733 | |||
| 1416 | Ga0075435_100091492 | |||
| 1417 | Ga0075435_100991315 | |||
| 1418 | Ga0105240_10006670 | |||
| 1419 | Ga0105240_10110797 | |||
| 1420 | Ga0105240_11276879 | |||
| 1421 | Ga0105240_11447559 | |||
| 1422 | Ga0111539_10186107 | |||
| 1423 | Ga0111539_10589106 | |||
| 1424 | Ga0111539_10602974 | |||
| 1425 | Ga0111539_10624407 | |||
| 1426 | Ga0111539_12276647 | |||
| 1427 | Ga0111539_12711727 | |||
| 1428 | Ga0105245_10052246 | |||
| 1429 | Ga0105245_10491718 | |||
| 1430 | Ga0105245_11196822 | |||
| 1431 | Ga0105245_12286554 | |||
| 1432 | Ga0105245_12473326 | |||
| 1433 | Ga0105247_10102995 | |||
| 1434 | Ga0114129_10071093 | |||
| 1435 | Ga0114129_10071190 | |||
| 1436 | Ga0114129_10300462 | |||
| 1437 | Ga0114129_10324579 | |||
| 1438 | Ga0114129_10338910 | |||
| 1439 | Ga0114129_11145781 | |||
| 1440 | Ga0114129_13085928 | |||
| 1441 | Ga0105243_11962505 | |||
| 1442 | Ga0105243_12070090 | |||
| 1443 | Ga0105241_10626006 | |||
| 1444 | Ga0105241_10945855 | |||
| 1445 | Ga0105241_12296665 | |||
| 1446 | Ga0105242_10062799 | |||
| 1447 | Ga0105242_10324824 | |||
| 1448 | Ga0105242_11520369 | |||
| 1449 | Ga0105242_11631902 | |||
| 1450 | Ga0105242_12773844 | |||
| 1451 | Ga0105248_10000003 | |||
| 1452 | Ga0105248_10000056 | |||
| 1453 | Ga0105248_10008788 | |||
| 1454 | Ga0105248_10017537 | |||
| 1455 | Ga0105248_10175016 | |||
| 1456 | Ga0105248_10183966 | |||
| 1457 | Ga0105248_10185943 | |||
| 1458 | Ga0105248_10394385 | |||
| 1459 | Ga0105248_10501000 | |||
| 1460 | Ga0105248_10516422 | |||
| 1461 | Ga0105248_10833146 | |||
| 1462 | Ga0105248_12424132 | |||
| 1463 | Ga0105248_13092700 | |||
| 1464 | Ga0105237_10018281 | |||
| 1465 | Ga0105237_10218985 | |||
| 1466 | Ga0105237_10414823 | |||
| 1467 | Ga0105238_10193653 | |||
| 1468 | Ga0105238_10247758 | |||
| 1469 | Ga0105238_10654212 | |||
| 1470 | Ga0105238_10730004 | |||
| 1471 | Ga0105249_10000575 | |||
| 1472 | Ga0105249_10157212 | |||
| 1473 | Ga0105249_10162858 | |||
| 1474 | Ga0105249_10339212 | |||
| 1475 | Ga0105249_13386565 | |||
| 1476 | Ga0105239_10051306 | |||
| 1477 | Ga0105239_10140307 | |||
| 1478 | Ga0105239_11148406 | |||
| 1479 | Ga0105239_11150712 | |||
| 1480 | Ga0105246_10385280 | |||
| 1481 | Ga0105246_10396849 | |||
| 1482 | Ga0105246_10513941 | |||
| 1483 | Ga0105246_10915898 | |||
| 1484 | Ga0105246_12263906 | |||
| 1485 | Ga0157373_10518316 | |||
| 1486 | Ga0157371_10098997 | |||
| 1487 | Ga0157371_10650840 | |||
| 1488 | Ga0157371_11435265 | |||
| 1489 | Ga0157369_10077988 | |||
| 1490 | Ga0157369_10110846 | |||
| 1491 | Ga0157369_10182355 | |||
| 1492 | Ga0157369_10324275 | |||
| 1493 | Ga0157369_10581058 | |||
| 1494 | Ga0157374_10187548 | |||
| 1495 | Ga0157374_10665322 | |||
| 1496 | Ga0157374_11331313 | |||
| 1497 | Ga0157374_11533070 | |||
| 1498 | Ga0157378_10252660 | |||
| 1499 | Ga0157378_10337837 | |||
| 1500 | Ga0157378_10426183 | |||
| 1501 | Ga0157378_10678069 | |||
| 1502 | Ga0157378_11748592 | |||
| 1503 | Ga0157378_11914503 | |||
| 1504 | Ga0157378_12856308 | |||
| 1505 | Ga0157378_12945605 | |||
| 1506 | Ga0157378_13286061 | |||
| 1507 | Ga0163162_10610606 | |||
| 1508 | Ga0163162_10693155 | |||
| 1509 | Ga0163162_10772202 | |||
| 1510 | Ga0163162_11212122 | |||
| 1511 | Ga0163162_11708247 | |||
| 1512 | Ga0163162_12505867 | |||
| 1513 | Ga0157372_10073774 | |||
| 1514 | Ga0157372_10224975 | |||
| 1515 | Ga0157372_11614229 | |||
| 1516 | Ga0157372_11807962 | |||
| 1517 | Ga0157372_12347356 | |||
| 1518 | Ga0157375_10366339 | |||
| 1519 | Ga0157375_10472610 | |||
| 1520 | Ga0157375_10880022 | |||
| 1521 | Ga0157375_11374836 | |||
| 1522 | Ga0157375_12829824 | |||
| 1523 | Ga0157375_13577226 | |||
| 1524 | Ga0163163_10009538 | |||
| 1525 | Ga0163163_10013787 | |||
| 1526 | Ga0163163_10031393 | |||
| 1527 | Ga0163163_10081016 | |||
| 1528 | Ga0163163_10218222 | |||
| 1529 | Ga0163163_10450901 | |||
| 1530 | Ga0163163_11263366 | |||
| 1531 | Ga0163163_11611513 | |||
| 1532 | Ga0157380_10017178 | |||
| 1533 | Ga0157380_10030544 | |||
| 1534 | Ga0157380_10070030 | |||
| 1535 | Ga0157380_10200705 | |||
| 1536 | Ga0157380_12550446 | |||
| 1537 | Ga0157377_10248803 | |||
| 1538 | Ga0157379_10105435 | |||
| 1539 | Ga0157379_10126249 | |||
| 1540 | Ga0157379_12038670 | |||
| 1541 | Ga0157376_10245643 | |||
| 1542 | Ga0157376_10423107 | |||
| 1543 | Ga0157376_11390312 | |||
| 1544 | Ga0157376_11644641 | |||
| 1545 | Ga0157376_12349454 | |||
| 1546 | Ga0182005_1078999 | |||
| 1547 | Ga0163161_10522853 | |||
| 1548 | Ga0163161_11518201 | |||
| 1549 | Ga0213873_10147142 | |||
| 1550 | Ga0213876_10000206 | |||
| 1551 | Ga0213876_10023144 | |||
| 1552 | Ga0213876_10097677 | |||
| 1553 | Ga0213876_10143304 | |||
| 1554 | Ga0213875_10012134 | |||
| 1555 | Ga0213875_10039681 | |||
| 1556 | Ga0213875_10135683 | |||
| 1557 | Ga0213875_10193174 | |||
| 1558 | Ga0213875_10193905 | |||
| 1559 | Ga0213875_10580513 | |||
| 1560 | Ga0213871_10100652 | |||
| 1561 | Ga0207697_10007722 | |||
| 1562 | Ga0207656_10015913 | |||
| 1563 | Ga0207656_10320170 | |||
| 1564 | Ga0207682_10154334 | |||
| 1565 | Ga0207682_10244679 | |||
| 1566 | Ga0207682_10357048 | |||
| 1567 | Ga0207692_10216577 | |||
| 1568 | Ga0207642_10329846 | |||
| 1569 | Ga0207710_10257171 | |||
| 1570 | Ga0207688_10550961 | |||
| 1571 | Ga0207680_10153678 | |||
| 1572 | Ga0207680_10386534 | |||
| 1573 | Ga0207647_10132759 | |||
| 1574 | Ga0207647_10591242 | |||
| 1575 | Ga0207647_10701094 | |||
| 1576 | Ga0207685_10073708 | |||
| 1577 | Ga0207699_10000041 | |||
| 1578 | Ga0207699_10175088 | |||
| 1579 | Ga0207699_10264877 | |||
| 1580 | Ga0207699_10415383 | |||
| 1581 | Ga0207699_10454972 | |||
| 1582 | Ga0207645_10014818 | |||
| 1583 | Ga0207645_10292592 | |||
| 1584 | Ga0207645_10343750 | |||
| 1585 | Ga0207643_10006545 | |||
| 1586 | Ga0207643_10335355 | |||
| 1587 | Ga0207643_11045959 | |||
| 1588 | Ga0207705_11432835 | |||
| 1589 | Ga0207684_10016942 | |||
| 1590 | Ga0207684_10855643 | |||
| 1591 | Ga0207684_11176035 | |||
| 1592 | Ga0207684_11541010 | |||
| 1593 | Ga0207654_10257396 | |||
| 1594 | Ga0207707_10013498 | |||
| 1595 | Ga0207707_10033085 | |||
| 1596 | Ga0207707_10061107 | |||
| 1597 | Ga0207695_10048750 | |||
| 1598 | Ga0207695_10242933 | |||
| 1599 | Ga0207695_10770162 | |||
| 1600 | Ga0207671_10022782 | |||
| 1601 | Ga0207671_10653801 | |||
| 1602 | Ga0207693_10037588 | |||
| 1603 | Ga0207693_10075667 | |||
| 1604 | Ga0207693_10467346 | |||
| 1605 | Ga0207693_10854613 | |||
| 1606 | Ga0207663_10155012 | |||
| 1607 | Ga0207660_10014478 | |||
| 1608 | Ga0207660_10057596 | |||
| 1609 | Ga0207660_11163444 | |||
| 1610 | Ga0207662_10006257 | |||
| 1611 | Ga0207662_10031007 | |||
| 1612 | Ga0207657_10105516 | |||
| 1613 | Ga0207657_10123410 | |||
| 1614 | Ga0207657_10248876 | |||
| 1615 | Ga0207657_10460905 | |||
| 1616 | Ga0207649_10010961 | |||
| 1617 | Ga0207649_10023497 | |||
| 1618 | Ga0207649_10044817 | |||
| 1619 | Ga0207649_10086988 | |||
| 1620 | Ga0207649_10170768 | |||
| 1621 | Ga0207652_10027842 | |||
| 1622 | Ga0207652_10194704 | |||
| 1623 | Ga0207646_10448425 | |||
| 1624 | Ga0207646_10912011 | |||
| 1625 | Ga0207646_11194520 | |||
| 1626 | Ga0207681_10000550 | |||
| 1627 | Ga0207681_10906346 | |||
| 1628 | Ga0207694_10088562 | |||
| 1629 | Ga0207694_10313981 | |||
| 1630 | Ga0207694_10327190 | |||
| 1631 | Ga0207694_10498669 | |||
| 1632 | Ga0207694_10836087 | |||
| 1633 | Ga0207694_11163536 | |||
| 1634 | Ga0207650_10208118 | |||
| 1635 | Ga0207650_10267264 | |||
| 1636 | Ga0207650_10283208 | |||
| 1637 | Ga0207650_10646628 | |||
| 1638 | Ga0207650_10820936 | |||
| 1639 | Ga0207659_10039573 | |||
| 1640 | Ga0207659_10135140 | |||
| 1641 | Ga0207659_10646234 | |||
| 1642 | Ga0207659_10733135 | |||
| 1643 | Ga0207687_11495422 | |||
| 1644 | Ga0207700_10071873 | |||
| 1645 | Ga0207700_10352709 | |||
| 1646 | Ga0207664_10057224 | |||
| 1647 | Ga0207664_11264385 | |||
| 1648 | Ga0207644_10110086 | |||
| 1649 | Ga0207690_10155523 | |||
| 1650 | Ga0207690_10555137 | |||
| 1651 | Ga0207690_10914189 | |||
| 1652 | Ga0207706_10000408 | |||
| 1653 | Ga0207706_10028618 | |||
| 1654 | Ga0207706_10031686 | |||
| 1655 | Ga0207706_10125485 | |||
| 1656 | Ga0207706_10152449 | |||
| 1657 | Ga0207706_10684825 | |||
| 1658 | Ga0207686_10568614 | |||
| 1659 | Ga0207686_11150041 | |||
| 1660 | Ga0207709_10236795 | |||
| 1661 | Ga0207670_10090290 | |||
| 1662 | Ga0207670_10141330 | |||
| 1663 | Ga0207670_10695221 | |||
| 1664 | Ga0207670_11080580 | |||
| 1665 | Ga0207669_10710356 | |||
| 1666 | Ga0207669_11060438 | |||
| 1667 | Ga0207704_10121560 | |||
| 1668 | Ga0207704_10251840 | |||
| 1669 | Ga0207704_10935001 | |||
| 1670 | Ga0207665_10167738 | |||
| 1671 | Ga0207665_10181610 | |||
| 1672 | Ga0207665_10318729 | |||
| 1673 | Ga0207665_11359046 | |||
| 1674 | Ga0207691_10001059 | |||
| 1675 | Ga0207691_10003253 | |||
| 1676 | Ga0207691_10259415 | |||
| 1677 | Ga0207691_10291030 | |||
| 1678 | Ga0207691_10856994 | |||
| 1679 | Ga0207711_10000012 | |||
| 1680 | Ga0207711_10000063 | |||
| 1681 | Ga0207711_10018490 | |||
| 1682 | Ga0207711_10099650 | |||
| 1683 | Ga0207711_10150239 | |||
| 1684 | Ga0207711_10322538 | |||
| 1685 | Ga0207711_11615190 | |||
| 1686 | Ga0207689_10083503 | |||
| 1687 | Ga0207689_10489377 | |||
| 1688 | Ga0207689_10811480 | |||
| 1689 | Ga0207689_11526002 | |||
| 1690 | Ga0207661_10030958 | |||
| 1691 | Ga0207661_10043586 | |||
| 1692 | Ga0207661_10122341 | |||
| 1693 | Ga0207661_10201599 | |||
| 1694 | Ga0207661_10506913 | |||
| 1695 | Ga0207661_11104544 | |||
| 1696 | Ga0207679_10009699 | |||
| 1697 | Ga0207679_10165370 | |||
| 1698 | Ga0207679_10273865 | |||
| 1699 | Ga0207679_10394381 | |||
| 1700 | Ga0207679_10643763 | |||
| 1701 | Ga0207679_11289916 | |||
| 1702 | Ga0207667_10083340 | |||
| 1703 | Ga0207651_10117426 | |||
| 1704 | Ga0207651_10291987 | |||
| 1705 | Ga0207651_10419642 | |||
| 1706 | Ga0207651_10788294 | |||
| 1707 | Ga0207651_11264869 | |||
| 1708 | Ga0207651_11963549 | |||
| 1709 | Ga0207712_10000952 | |||
| 1710 | Ga0207712_10108477 | |||
| 1711 | Ga0207668_10092371 | |||
| 1712 | Ga0207668_10500263 | |||
| 1713 | Ga0207640_10289857 | |||
| 1714 | Ga0207640_11334165 | |||
| 1715 | Ga0207640_11510088 | |||
| 1716 | Ga0207658_10280876 | |||
| 1717 | Ga0207677_10062111 | |||
| 1718 | Ga0207677_10458568 | |||
| 1719 | Ga0207677_10989500 | |||
| 1720 | Ga0207677_11838646 | |||
| 1721 | Ga0207703_10958589 | |||
| 1722 | Ga0207703_11080271 | |||
| 1723 | Ga0207703_11225203 | |||
| 1724 | Ga0207639_10042113 | |||
| 1725 | Ga0207678_10115178 | |||
| 1726 | Ga0207678_11023667 | |||
| 1727 | Ga0207678_11033199 | |||
| 1728 | Ga0207678_11394160 | |||
| 1729 | Ga0207678_11874085 | |||
| 1730 | Ga0207708_10192914 | |||
| 1731 | Ga0207702_10045580 | |||
| 1732 | Ga0207702_10051399 | |||
| 1733 | Ga0207702_10226761 | |||
| 1734 | Ga0207702_10400077 | |||
| 1735 | Ga0207702_12011658 | |||
| 1736 | Ga0207702_12427773 | |||
| 1737 | Ga0207641_10011867 | |||
| 1738 | Ga0207641_10096014 | |||
| 1739 | Ga0207641_10253684 | |||
| 1740 | Ga0207641_10464959 | |||
| 1741 | Ga0207641_12467815 | |||
| 1742 | Ga0207641_12582032 | |||
| 1743 | Ga0207648_10016223 | |||
| 1744 | Ga0207648_10238007 | |||
| 1745 | Ga0207648_11588780 | |||
| 1746 | Ga0207676_10028909 | |||
| 1747 | Ga0207676_10189178 | |||
| 1748 | Ga0207676_11307582 | |||
| 1749 | Ga0207676_11945953 | |||
| 1750 | Ga0207676_12148929 | |||
| 1751 | Ga0207676_12386893 | |||
| 1752 | Ga0207674_10000409 | |||
| 1753 | Ga0207674_10000815 | |||
| 1754 | Ga0207674_10004412 | |||
| 1755 | Ga0207674_10042814 | |||
| 1756 | Ga0207674_10147842 | |||
| 1757 | Ga0207674_10676470 | |||
| 1758 | Ga0207674_11523430 | |||
| 1759 | Ga0207674_11542572 | |||
| 1760 | Ga0207675_100000465 | |||
| 1761 | Ga0207675_100047183 | |||
| 1762 | Ga0207675_100142753 | |||
| 1763 | Ga0207675_100319211 | |||
| 1764 | Ga0207675_100371633 | |||
| 1765 | Ga0207675_101107025 | |||
| 1766 | Ga0207675_102354458 | |||
| 1767 | Ga0207683_10060993 | |||
| 1768 | Ga0207683_10271784 | |||
| 1769 | Ga0207683_11262652 | |||
| 1770 | Ga0207698_10365494 | |||
| 1771 | Ga0207698_10620786 | |||
| 1772 | Ga0207698_10829203 | |||
| 1773 | Ga0209981_1025677 | |||
| 1774 | Ga0209996_1076888 | |||
| 1775 | Ga0209995_1074634 | |||
| 1776 | Ga0209974_10120436 | |||
| 1777 | Ga0207428_10274170 | |||
| 1778 | Ga0268266_10019400 | |||
| 1779 | Ga0268266_10048329 | |||
| 1780 | Ga0268266_10181009 | |||
| 1781 | Ga0268266_10195470 | |||
| 1782 | Ga0268265_10032898 | |||
| 1783 | Ga0268265_10304035 | |||
| 1784 | Ga0268264_10741153 | |||
| 1785 | Ga0268264_11396691 | |||
| 1786 | Ga0268264_12349013 | |||
| 1787 | Ga0265318_10203881 | |||
| 1788 | Ga0265336_10076894 | |||
| 1789 | Ga0265338_10015988 | |||
| 1790 | Ga0265338_10206542 | |||
| 1791 | Ga0265324_10090892 | |||
| 1792 | Ga0265324_10095033 | |||
| 1793 | Ga0265762_1076621 | |||
| 1794 | Ga0265770_1012381 | |||
| 1795 | Ga0265332_10010511 | |||
| 1796 | Ga0265332_10029395 | |||
| 1797 | Ga0265332_10134446 | |||
| 1798 | Ga0265328_10087219 | |||
| 1799 | Ga0265328_10172109 | |||
| 1800 | Ga0265328_10252018 | |||
| 1801 | Ga0265320_10156777 | |||
| 1802 | Ga0265329_10020834 | |||
| 1803 | Ga0265340_10508202 | |||
| 1804 | Ga0265339_10001981 | |||
| 1805 | Ga0265331_10001122 | |||
| 1806 | Ga0265316_10010261 | |||
| 1807 | Ga0265316_10052198 | |||
| 1808 | Ga0265316_11010204 | |||
| 1809 | Ga0265316_11287756 | |||
| 1810 | Ga0307408_100019101 | |||
| 1811 | Ga0316575_10189927 | |||
| 1812 | Ga0265314_10010188 | |||
| 1813 | Ga0265314_10342152 | |||
| 1814 | Ga0265342_10053136 | |||
| 1815 | Ga0265342_10106319 | |||
| 1816 | Ga0307405_10369717 | |||
| 1817 | Ga0307413_10293865 | |||
| 1818 | Ga0307413_10950949 | |||
| 1819 | Ga0307410_10449162 | |||
| 1820 | Ga0307410_11508171 | |||
| 1821 | Ga0307406_10017940 | |||
| 1822 | Ga0307406_10123298 | |||
| 1823 | Ga0307406_10871216 | |||
| 1824 | Ga0307407_10721978 | |||
| 1825 | Ga0307407_11405098 | |||
| 1826 | Ga0307412_10033868 | |||
| 1827 | Ga0307412_10924836 | |||
| 1828 | Ga0307409_100090263 | |||
| 1829 | Ga0307409_100693331 | |||
| 1830 | Ga0307409_101466946 | |||
| 1831 | Ga0307416_100049701 | |||
| 1832 | Ga0307416_100715213 | |||
| 1833 | Ga0307416_100995648 | |||
| 1834 | Ga0307416_102064713 | |||
| 1835 | Ga0307414_10144388 | |||
| 1836 | Ga0307414_11461688 | |||
| 1837 | Ga0307411_10330721 | |||
| 1838 | Ga0307411_12356559 | |||
| 1839 | Ga0307415_100011183 | |||
| 1840 | Ga0307415_100128397 | |||
| 1841 | Ga0307415_100882202 | |||
| 1842 | Ga0307415_101568436 | |||
| 1843 | Ga0373930_0104598 | |||
| 1844 | Ga0373923_0208600 | |||
| 1845 | Ga0373941_0329975 | |||
| 1846 | Ga0373960_0084997 | |||
| 1847 | Ga0373943_0511796 | |||
| 1848 | Ga0373946_0422828 | |||
| 1849 | Ga0373946_0702244 | |||
| 1850 | Ga0373955_0690088 | |||
| 1851 | Ga0373961_0053135 | |||
| 1852 | Ga0373931_0059445 | |||
| 1853 | Ga0373935_0403863 | |||
| 1854 | Ga0373935_0973151 | |||
| 1855 | Ga0373933_0613021 | |||
| 1856 | Ga0373933_0636623 | |||
| 1857 | Ga0373933_0670433 | |||
| 1858 | Ga0373947_0690174 | |||
| 1859 | Ga0373947_0946844 | |||
| 1860 | Ga0373937_0435531 | |||
| 1861 | Ga0373937_0630192 | |||
| 1862 | Ga0373925_0577134 | |||
| 1863 | Ga0395899_0851077 | |||
| 1864 | Ga0395898_1477896 | |||
| 1865 | Ga0395905_0286306 | |||
| 1866 | Ga0395905_1365026 | |||
| 1867 | Ga0395905_1373870 | |||
| 1868 | Ga0395905_1460095 | |||
| 1869 | Ga0436364_0071833 | |||
| 1870 | Ga0436364_0084445 | |||
| 1871 | Ga0436364_0245695 | |||
| 1872 | Ga0436364_0344295 | |||
| 1873 | Ga0436364_0550968 | |||
| 1874 | Ga0436364_0608459 | |||
| 1875 | Ga0436364_0945746 | |||
| 1876 | Ga0436364_0961976 | |||
| 1877 | Ga0436364_1075961 | |||
| 1878 | Ga0436364_1147843 | |||
| 1879 | Ga0436364_1414926 | |||
| 1880 | Ga0395901_2082388 | |||
| 1881 | Ga0436365_0235741 | |||
| 1882 | Ga0436365_0281371 | |||
| 1883 | Ga0436365_0420834 | |||
| 1884 | Ga0436365_0747350 | |||
| 1885 | Ga0436365_0798073 | |||
| 1886 | Ga0436365_0880687 | |||
| 1887 | Ga0436365_1242450 | |||
| 1888 | Ga0436365_1823448 | |||
| 1889 | Ga0436360_0295315 | |||
| 1890 | Ga0436361_1058012 | |||
| 1891 | Ga0436363_1067817 | |||
| 1892 | Ga0436362_0131534 | |||
| 1893 | Ga0436362_0383078 | |||
| 1894 | Ga0436362_0875147 | |||
| 1895 | Ga0439461_0107425 | |||
| 1896 | Ga0451800_0073639 | |||
| 1897 | Ga0451800_1331463 | |||
| 1898 | Ga0451807_2070311 | |||
| 1899 | Ga0451835_0018883 | |||
| 1900 | Ga0451837_0678076 | |||
| 1901 | Ga0451853_0276731 | |||
| 1902 | Ga0451853_2338877 | |||
| 1903 | Ga0439448_0202122 | |||
| 1904 | Ga0439450_230610 | |||
| 1905 | Ga0451577_0497588 | |||
| 1906 | Ga0451577_0942989 | |||
| 1907 | Ga0453683_0616396 | |||
| 1908 | Ga0453684_0574527 | |||
| 1909 | Ga0466957_0230999 | |||
| 1910 | Ga0451576_0043236 | |||
| 1911 | Ga0451576_0044841 | |||
| 1912 | Ga0451576_1196362 | |||
| 1913 | Ga0451576_1510156 | |||
| 1914 | Ga0466967_0696264 | |||
| 1915 | Ga0495592_0434321 | |||
| 1916 | Ga0495603_0714944 | |||
| 1917 | Ga0495641_0394308 | |||
| 1918 | Ga0495651_0174839 | |||
| 1919 | Ga0495653_0627869 | |||
| 1920 | Ga0495580_0001156 | |||
| 1921 | Ga0495580_0488543 | |||
| 1922 | Ga0495580_0951240 | |||
| 1923 | Ga0495582_0005527 | |||
| 1924 | Ga0495582_0006475 | |||
| 1925 | Ga0495582_0177409 | |||
| 1926 | Ga0495582_0351593 | |||
| 1927 | Ga0495582_0794709 | |||
| 1928 | Ga0495639_0009523 | |||
| 1929 | Ga0495662_0044704 | |||
| 1930 | Ga0495662_0065746 | |||
| 1931 | Ga0495662_0242446 | |||
| 1932 | Ga0495664_0222015 | |||
| 1933 | Ga0495664_0317542 | |||
| 1934 | Ga0495664_0347964 | |||
| 1935 | Ga0495664_0353735 | |||
| 1936 | Ga0495585_0448032 | |||
| 1937 | Ga0495594_0004234 | |||
| 1938 | Ga0495594_0038140 | |||
| 1939 | Ga0495594_0452151 | |||
| 1940 | Ga0495608_0037023 | |||
| 1941 | Ga0495608_0047440 | |||
| 1942 | Ga0495608_0258398 | |||
| 1943 | Ga0495618_0105291 | |||
| 1944 | Ga0495628_0030113 | |||
| 1945 | Ga0495630_0070664 | |||
| 1946 | Ga0495630_0095522 | |||
| 1947 | Ga0495630_0559257 | |||
| 1948 | Ga0495666_0030172 | |||
| 1949 | Ga0495642_0279535 | |||
| 1950 | Ga0495652_0361064 | |||
| 1951 | Ga0495652_0373025 | |||
| 1952 | Ga0495652_0700375 | |||
| 1953 | Ga0495665_0129863 | |||
| 1954 | Ga0495665_0482560 | |||
| 1955 | Ga0495640_0122118 | |||
| 1956 | Ga0495640_0310523 | |||
| 1957 | Ga0495640_0523807 | |||
| 1958 | Ga0495586_0119998 | |||
| 1959 | Ga0495586_0290263 | |||
| 1960 | Ga0495587_0526678 | |||
| 1961 | Ga0495645_0179847 | |||
| 1962 | Ga0495622_0182592 | |||
| 1963 | Ga0495667_0016789 | |||
| 1964 | Ga0495667_0054510 | |||
| 1965 | Ga0495667_0131357 | |||
| 1966 | Ga0495667_0251964 | |||
| 1967 | Ga0495634_0007046 | |||
| 1968 | Ga0495634_0223121 | |||
| 1969 | Ga0495635_0048591 | |||
| 1970 | Ga0495635_0294489 | |||
| 1971 | Ga0495635_0874209 | |||
| 1972 | Ga0495657_0224750 | |||
| 1973 | Ga0495599_0302474 | |||
| 1974 | Ga0495599_0307060 | |||
| 1975 | Ga0495623_0261377 | |||
| 1976 | Ga0495647_0064481 | |||
| 1977 | Ga0495658_0028050 | |||
| 1978 | Ga0495658_0086255 | |||
| 1979 | Ga0495669_0556401 | |||
| 1980 | Ga0495613_0246383 | |||
| 1981 | Ga0495613_0521826 | |||
| 1982 | Ga0495613_0634513 | |||
| 1983 | Ga0495613_0971914 | |||
| 1984 | Ga0495624_0216882 | |||
| 1985 | Ga0495624_0369741 | |||
| 1986 | Ga0495670_0429835 | |||
| 1987 | Ga0495600_0038111 | |||
| 1988 | Ga0495581_0179579 | |||
| 1989 | Ga0495604_0425665 | |||
| 1990 | Ga0495674_0043085 | |||
| 1991 | Ga0495674_0308928 | |||
| 1992 | Ga0495680_0041600 | |||
| 1993 | Ga0495680_0269889 | |||
| 1994 | Ga0495675_0110055 | |||
| 1995 | Ga0495684_0035857 | |||
| 1996 | Ga0495684_0899041 | |||
| 1997 | Ga0495593_0098073 | |||
| 1998 | Ga0495593_0499416 | |||
| 1999 | Ga0495593_0599636 | |||
| 2000 | Ga0495602_0131255 | |||
| 2001 | Ga0495602_0648625 | |||
| 2002 | Ga0496100_0241612 | |||
| 2003 | Ga0496102_0008398 | |||
| 2004 | Ga0496102_0610013 | |||
| 2005 | Ga0496102_0755733 | |||
| 2006 | Ga0496102_1500267 | |||
| 2007 | Ga0496103_0054035 | |||
| 2008 | Ga0496104_0445952 | |||
| 2009 | Ga0496105_0096752 | |||
| 2010 | Ga0496108_0064910 | |||
| 2011 | Ga0496108_0721370 | |||
| 2012 | Ga0496108_0799115 | |||
| 2013 | Ga0496109_0030769 | |||
| 2014 | Ga0496110_0081672 | |||
| 2015 | Ga0496112_0091004 | |||
| 2016 | Ga0496112_0218186 | |||
| 2017 | Ga0496112_0428700 | |||
| 2018 | Ga0496112_0745299 | |||
| 2019 | Ga0496113_0073660 | |||
| 2020 | Ga0496115_0093153 | |||
| 2021 | Ga0496115_0480237 | |||
| 2022 | Ga0496126_0676664 | |||
| 2023 | Ga0501290_006760 | |||
| 2024 | Ga0501291_077909 | |||
| 2025 | Ga0501292_020009 | |||
| 2026 | Ga0501292_137908 | |||
| 2027 | Ga0501296_036365 | |||
| 2028 | Ga0501297_009815 | |||
| 2029 | Ga0501298_007554 | |||
| 2030 | Ga0501298_013070 | |||
| 2031 | Ga0501298_044940 | |||
| 2032 | Ga0501299_014499 | |||
| 2033 | Ga0501299_026435 | |||
| 2034 | Ga0501299_114242 | |||
| 2035 | Ga0501034_1626256 | |||
| 2036 | Ga0501041_0149844 | |||
| 2037 | Ga0501041_1080958 | |||
| 2038 | Ga0501075_0273874 | |||
| 2039 | Ga0501076_0633222 | |||
| 2040 | Ga0501076_0946180 | |||
| 2041 | Ga0501198_086517 | |||
| 2042 | Ga0501202_143760 | |||
| 2043 | Ga0501206_022651 | |||
| 2044 | Ga0501208_087532 | |||
| 2045 | Ga0501208_092554 | |||
| 2046 | Ga0501216_019463 | |||
| 2047 | Ga0501217_009648 | |||
| 2048 | Ga0501217_016676 | |||
| 2049 | Ga0501217_076107 | |||
| 2050 | Ga0501217_212845 | |||
| 2051 | Ga0501223_023553 | |||
| 2052 | Ga0501224_004561 | |||
| 2053 | Ga0501224_041242 | |||
| 2054 | Ga0501228_011412 | |||
| 2055 | Ga0501233_027158 | |||
| 2056 | Ga0501233_111223 | |||
| 2057 | Ga0501235_001714 | |||
| 2058 | Ga0501239_016392 | |||
| 2059 | Ga0501239_076184 | |||
| 2060 | Ga0501240_005359 | |||
| 2061 | Ga0501240_110553 | |||
| 2062 | Ga0501242_019328 | |||
| 2063 | Ga0501243_002924 | |||
| 2064 | Ga0501246_013222 | |||
| 2065 | Ga0501247_007552 | |||
| 2066 | Ga0501247_031814 | |||
| 2067 | Ga0501249_100801 | |||
| 2068 | Ga0501249_158729 | |||
| 2069 | Ga0501250_098332 | |||
| 2070 | Ga0501251_012585 | |||
| 2071 | Ga0501252_007966 | |||
| 2072 | Ga0501255_001777 | |||
| 2073 | Ga0501257_049001 | |||
| 2074 | Ga0501257_104406 | |||
| 2075 | Ga0501261_005956 | |||
| 2076 | Ga0501261_123073 | |||
| 2077 | Ga0501221_083632 | |||
| 2078 | Ga0501225_0034047 | |||
| 2079 | Ga0501225_0101150 | |||
| 2080 | Ga0501225_0307005 | |||
| 2081 | Ga0501229_064728 | |||
| 2082 | Ga0501229_083937 | |||
| 2083 | Ga0501234_019895 | |||
| 2084 | Ga0501245_011475 | |||
| 2085 | Ga0501079_0199004 | |||
| 2086 | Ga0501079_0370742 | |||
| 2087 | Ga0501080_0667562 | |||
| 2088 | Ga0501081_0151596 | |||
| 2089 | Ga0501263_050347 | |||
| 2090 | Ga0501263_051868 | |||
| 2091 | Ga0501264_026136 | |||
| 2092 | Ga0501265_023382 | |||
| 2093 | Ga0501265_114680 | |||
| 2094 | Ga0501268_063473 | |||
| 2095 | Ga0501268_100729 | |||
| 2096 | Ga0501270_006461 | |||
| 2097 | Ga0501270_039599 | |||
| 2098 | Ga0501271_006322 | |||
| 2099 | Ga0501279_016527 | |||
| 2100 | Ga0501280_094272 | |||
| 2101 | Ga0501283_001918 | |||
| 2102 | Ga0501283_026167 | |||
| 2103 | Ga0501035_0786373 | |||
| 2104 | Ga0501044_0477113 | |||
| 2105 | Ga0501045_0755568 | |||
| 2106 | Ga0501212_036662 | |||
| 2107 | nmdc:mga05p37_107880_c1 | |||
| 2108 | nmdc:mga05p37_2026779_c1 | |||
| 2109 | nmdc:mga05p37_336502_c1 | |||
| 2110 | nmdc:mga05p37_554399_c1 | |||
| 2111 | nmdc:mga05p37_75128_c1 | |||
| 2112 | nmdc:mga05p37_777537_c1 | |||
| 2113 | nmdc:mga09592_179882_c1 | |||
| 2114 | nmdc:mga09592_446432_c1 | |||
| 2115 | nmdc:mga09592_884699_c1 | |||
| 2116 | nmdc:mga0qj67_1427558_c1 | |||
| 2117 | nmdc:mga06r32_157880_c1 | |||
| 2118 | nmdc:mga06r32_375826_c1 | |||
| 2119 | nmdc:mga06r32_39679_c1 | |||
| 2120 | nmdc:mga06r32_439658_c1 | |||
| 2121 | nmdc:mga06r32_623792_c1 | |||
| 2122 | nmdc:mga08y16_473655_c1 | |||
| 2123 | nmdc:mga08y16_662230_c1 | |||
| 2124 | nmdc:mga0n895_14141_c1 | |||
| 2125 | nmdc:mga0n895_185362_c1 | |||
| 2126 | nmdc:mga0n895_2003103_c1 | |||
| 2127 | nmdc:mga0n895_692996_c1 | |||
| 2128 | nmdc:mga0n895_725159_c1 | |||
| 2129 | nmdc:mga0n895_773563_c1 | |||
| 2130 | nmdc:mga0n895_883260_c1 | |||
| 2131 | nmdc:mga0rr50_1467314_c1 | |||
| 2132 | nmdc:mga0rr50_43180_c1 | |||
| 2133 | nmdc:mga08x19_1067473_c1 | |||
| 2134 | nmdc:mga08x19_259321_c1 | |||
| 2135 | nmdc:mga08x19_277462_c1 | |||
| 2136 | nmdc:mga08x19_389744_c1 | |||
| 2137 | nmdc:mga08x19_555_c1 | |||
| 2138 | nmdc:mga08x19_716327_c1 | |||
| 2139 | nmdc:mga0a205_233729_c1 | |||
| 2140 | Ga0495601_0063207 | |||
| 2141 | Ga0500635_0284117 | |||
| 2142 | Ga0500644_0027062 | |||
| 2143 | Ga0500555_051781 | |||
| 2144 | Ga0500555_106057 | |||
| 2145 | Ga0500595_043978 | |||
| 2146 | Ga0500627_0133357 | |||
| 2147 | Ga0500596_065914 | |||
| 2148 | Ga0501084_0193711 | |||
| 2149 | Ga0590071_090121 | |||
| 2150 | Ga0587066_014514 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.8844 | 21 | 118 |
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.8808 | 19 | 120 |
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.8784 | 20 | 118 |
| 6abq-assembly1.cif.gz_A | crystal structure of transcription factor from listeria monocytogenes | 0.8748 | 20 | 120 |
| 5x11-assembly1.cif.gz_B | crystal structure of bacillus subtilis padr in complex with operator dna | 0.8726 | 26 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8844 | 21 | 118 | 1.10.10.10 |
| af_Q2FUS4_1_110_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8787 | 16 | 117 | 1.10.10.10 |
| af_P71704_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8786 | 27 | 105 | 1.10.10.10 |
| 5x11A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8729 | 26 | 105 | 1.10.10.10 |
| af_I6X7F9_1_101_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8712 | 22 | 124 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4T7F0-F1-model_v4 | PadR family transcriptional regulator | 0.9859 | 20 | 95 |
|
| AF-A0A2V8EA09-F1-model_v4 | PadR family transcriptional regulator | 0.9856 | 22 | 103 |
|
| AF-A0A7Y3IAF1-F1-model_v4 | PadR family transcriptional regulator | 0.9781 | 24 | 122 |
|
| AF-A0A2V6MFC0-F1-model_v4 | PadR family transcriptional regulator | 0.9767 | 21 | 111 |
|
| AF-A0A2V9H684-F1-model_v4 | PadR family transcriptional regulator | 0.9759 | 18 | 107 |
|