F489437
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1068 | 356 | 1068 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300013296|Ga0157374_10083135|Ga0157374_100831353 |
| Length | 194 |
| Sequence | VPSTRTGEHDAADSTRGLMTTTEILVEIAFRFTTLSLVAIGGINAILPEIHRVVVDVEGWMSSAEFAELFALAQLSPGPNAMIVALVGWKVAGVAGALVATLAACGPSSIACYFAWAWADRLRRSKLRAVVQRALAPIAIGLILASGYTLALGADRSPGAVALTVVATAALAFTPVNPFWILLAAGAAGVAGLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 138 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 222 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 228 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 233 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 236 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 237 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 238 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 239 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 248 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 255 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 263 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 266 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 267 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 268 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 269 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 270 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 271 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 272 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 273 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 274 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 275 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 276 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 277 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 338 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 339 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 351 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 352 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 353 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 356 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0.09 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.66 |
| Nodule | 0 |
| Rhizoplane | 3.75 |
| Rhizosphere | 95.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1003747 | 3300001978 | Bacteria | 1327 |
| 2 | JGI24743J22301_10000948 | 3300001991 | Bacteria | 3746 |
| 3 | JGI24750J21931_1009036 | 3300002070 | Bacteria | 1277 |
| 4 | JGI24744J21845_10010950 | 3300002077 | Bacteria | 1857 |
| 5 | JGI24742J22300_10040166 | 3300002244 | Bacteria | 833 |
| 6 | JGI26129J50193_1000527 | 3300003349 | Bacteria | 2411 |
| 7 | Ga0065712_10168995 | 3300005290 | Bacteria | 1255 |
| 8 | Ga0065715_10199194 | 3300005293 | Bacteria | 1371 |
| 9 | Ga0070658_10007688 | 3300005327 | Bacteria | 8687 |
| 10 | Ga0070658_10020016 | 3300005327 | Bacteria | 5360 |
| 11 | Ga0070658_10027372 | 3300005327 | Bacteria | 4575 |
| 12 | Ga0070658_10738398 | 3300005327 | Bacteria | 855 |
| 13 | Ga0070676_10002688 | 3300005328 | Bacteria | 9158 |
| 14 | Ga0070676_10076893 | 3300005328 | Bacteria | 2016 |
| 15 | Ga0070676_10139983 | 3300005328 | Bacteria | 1539 |
| 16 | Ga0070676_10388611 | 3300005328 | Bacteria | 968 |
| 17 | Ga0070683_100002119 | 3300005329 | Bacteria | 15664 |
| 18 | Ga0070683_100083329 | 3300005329 | Bacteria | 2995 |
| 19 | Ga0070683_100180934 | 3300005329 | Unclassified | 2001 |
| 20 | Ga0070683_100484853 | 3300005329 | Bacteria | 1181 |
| 21 | Ga0070683_100667335 | 3300005329 | Bacteria | 995 |
| 22 | Ga0070690_100053313 | 3300005330 | Bacteria | 2587 |
| 23 | Ga0070690_100071123 | 3300005330 | Bacteria | 2260 |
| 24 | Ga0070690_100827243 | 3300005330 | Bacteria | 720 |
| 25 | Ga0070670_100008422 | 3300005331 | Bacteria | 8792 |
| 26 | Ga0070670_100093415 | 3300005331 | Bacteria | 2587 |
| 27 | Ga0070670_100196862 | 3300005331 | Bacteria | 1751 |
| 28 | Ga0070670_100395061 | 3300005331 | Bacteria | 1220 |
| 29 | Ga0070677_10004173 | 3300005333 | Bacteria | 4700 |
| 30 | Ga0068869_100000633 | 3300005334 | Bacteria | 19871 |
| 31 | Ga0068869_100003623 | 3300005334 | Bacteria | 9474 |
| 32 | Ga0068869_100019678 | 3300005334 | Bacteria | 4618 |
| 33 | Ga0068869_100078266 | 3300005334 | Bacteria | 2462 |
| 34 | Ga0070666_10022816 | 3300005335 | Bacteria | 4067 |
| 35 | Ga0070666_10026528 | 3300005335 | Bacteria | 3787 |
| 36 | Ga0070666_10057555 | 3300005335 | Unclassified | 2627 |
| 37 | Ga0070680_100002607 | 3300005336 | Bacteria | 13348 |
| 38 | Ga0070680_100061476 | 3300005336 | Bacteria | 3074 |
| 39 | Ga0070680_100078180 | 3300005336 | Bacteria | 2725 |
| 40 | Ga0070680_100131706 | 3300005336 | Bacteria | 2092 |
| 41 | Ga0070680_100225514 | 3300005336 | Bacteria | 1582 |
| 42 | Ga0070680_100839583 | 3300005336 | Unclassified | 792 |
| 43 | Ga0070682_100000209 | 3300005337 | Bacteria | 42875 |
| 44 | Ga0070682_100073891 | 3300005337 | Bacteria | 2188 |
| 45 | Ga0068868_100032409 | 3300005338 | Bacteria | 4020 |
| 46 | Ga0068868_100046065 | 3300005338 | Bacteria | 3413 |
| 47 | Ga0068868_100060686 | 3300005338 | Bacteria | 2995 |
| 48 | Ga0068868_100264744 | 3300005338 | Bacteria | 1451 |
| 49 | Ga0068868_100510108 | 3300005338 | Bacteria | 1054 |
| 50 | Ga0068868_100991643 | 3300005338 | Bacteria | 768 |
| 51 | Ga0070660_100000889 | 3300005339 | Bacteria | 19987 |
| 52 | Ga0070660_100013668 | 3300005339 | Bacteria | 5834 |
| 53 | Ga0070660_100014726 | 3300005339 | Bacteria | 5640 |
| 54 | Ga0070660_100016306 | 3300005339 | Bacteria | 5390 |
| 55 | Ga0070660_100137344 | 3300005339 | Bacteria | 1959 |
| 56 | Ga0070660_100259726 | 3300005339 | Bacteria | 1418 |
| 57 | Ga0070660_100386210 | 3300005339 | Bacteria | 1156 |
| 58 | Ga0070689_100003287 | 3300005340 | Bacteria | 10735 |
| 59 | Ga0070689_100039663 | 3300005340 | Bacteria | 3607 |
| 60 | Ga0070691_10002304 | 3300005341 | Bacteria | 8459 |
| 61 | Ga0070691_10013614 | 3300005341 | Bacteria | 3728 |
| 62 | Ga0070691_10022152 | 3300005341 | Bacteria | 2945 |
| 63 | Ga0070691_10041158 | 3300005341 | Bacteria | 2184 |
| 64 | Ga0070687_100012799 | 3300005343 | Bacteria | 3717 |
| 65 | Ga0070687_100057605 | 3300005343 | Bacteria | 2038 |
| 66 | Ga0070661_100001130 | 3300005344 | Bacteria | 18750 |
| 67 | Ga0070661_100003662 | 3300005344 | Bacteria | 10586 |
| 68 | Ga0070661_100003923 | 3300005344 | Bacteria | 10234 |
| 69 | Ga0070661_100036065 | 3300005344 | Bacteria | 3594 |
| 70 | Ga0070661_100118886 | 3300005344 | Bacteria | 1978 |
| 71 | Ga0070661_100298623 | 3300005344 | Unclassified | 1253 |
| 72 | Ga0070692_10026870 | 3300005345 | Bacteria | 2849 |
| 73 | Ga0070692_10434360 | 3300005345 | Bacteria | 837 |
| 74 | Ga0070668_100000778 | 3300005347 | Bacteria | 22004 |
| 75 | Ga0070668_100034113 | 3300005347 | Bacteria | 3878 |
| 76 | Ga0070668_100524225 | 3300005347 | Bacteria | 1028 |
| 77 | Ga0070668_100615401 | 3300005347 | Bacteria | 951 |
| 78 | Ga0070669_100046924 | 3300005353 | Bacteria | 3150 |
| 79 | Ga0070669_100051294 | 3300005353 | Bacteria | 3015 |
| 80 | Ga0070669_100118130 | 3300005353 | Bacteria | 2019 |
| 81 | Ga0070669_100406294 | 3300005353 | Bacteria | 1115 |
| 82 | Ga0070675_100001434 | 3300005354 | Bacteria | 17497 |
| 83 | Ga0070675_100224738 | 3300005354 | Bacteria | 1636 |
| 84 | Ga0070675_100290245 | 3300005354 | Bacteria | 1439 |
| 85 | Ga0070671_100004648 | 3300005355 | Bacteria | 10886 |
| 86 | Ga0070671_100007996 | 3300005355 | Bacteria | 8464 |
| 87 | Ga0070671_100016036 | 3300005355 | Bacteria | 6054 |
| 88 | Ga0070671_100149641 | 3300005355 | Bacteria | 1971 |
| 89 | Ga0070671_100371028 | 3300005355 | Bacteria | 1222 |
| 90 | Ga0070671_100488709 | 3300005355 | Bacteria | 1058 |
| 91 | Ga0070674_100005317 | 3300005356 | Bacteria | 7424 |
| 92 | Ga0070673_100020192 | 3300005364 | Bacteria | 4801 |
| 93 | Ga0070673_100025653 | 3300005364 | Bacteria | 4342 |
| 94 | Ga0070673_100092534 | 3300005364 | Unclassified | 2474 |
| 95 | Ga0070673_100261209 | 3300005364 | Bacteria | 1513 |
| 96 | Ga0070673_101270356 | 3300005364 | Bacteria | 691 |
| 97 | Ga0070688_100009130 | 3300005365 | Bacteria | 5408 |
| 98 | Ga0070688_100079782 | 3300005365 | Bacteria | 2115 |
| 99 | Ga0070659_100001542 | 3300005366 | Bacteria | 16598 |
| 100 | Ga0070659_100016264 | 3300005366 | Bacteria | 5584 |
| 101 | Ga0070659_100017263 | 3300005366 | Bacteria | 5426 |
| 102 | Ga0070659_100136460 | 3300005366 | Bacteria | 1995 |
| 103 | Ga0070659_100139150 | 3300005366 | Unclassified | 1976 |
| 104 | Ga0070659_101080195 | 3300005366 | Bacteria | 707 |
| 105 | Ga0070667_100005929 | 3300005367 | Bacteria | 10171 |
| 106 | Ga0070667_100013482 | 3300005367 | Bacteria | 6754 |
| 107 | Ga0070667_100058210 | 3300005367 | Bacteria | 3267 |
| 108 | Ga0070667_100903175 | 3300005367 | Bacteria | 822 |
| 109 | Ga0070703_10003177 | 3300005406 | Bacteria | 4692 |
| 110 | Ga0070703_10137759 | 3300005406 | Bacteria | 904 |
| 111 | Ga0070709_10009566 | 3300005434 | Bacteria | 5350 |
| 112 | Ga0070709_10256779 | 3300005434 | Bacteria | 1261 |
| 113 | Ga0070714_100004618 | 3300005435 | Bacteria | 10389 |
| 114 | Ga0070714_100005142 | 3300005435 | Bacteria | 9957 |
| 115 | Ga0070714_100101958 | 3300005435 | Bacteria | 2530 |
| 116 | Ga0070714_100114010 | 3300005435 | Bacteria | 2397 |
| 117 | Ga0070713_100039795 | 3300005436 | Bacteria | 3818 |
| 118 | Ga0070713_100118171 | 3300005436 | Bacteria | 2321 |
| 119 | Ga0070713_100723332 | 3300005436 | Unclassified | 951 |
| 120 | Ga0070713_100862267 | 3300005436 | Bacteria | 870 |
| 121 | Ga0070710_10087565 | 3300005437 | Unclassified | 1830 |
| 122 | Ga0070701_10102945 | 3300005438 | Bacteria | 1584 |
| 123 | Ga0070701_10198902 | 3300005438 | Bacteria | 1183 |
| 124 | Ga0070711_100047490 | 3300005439 | Bacteria | 2931 |
| 125 | Ga0070711_100131700 | 3300005439 | Bacteria | 1863 |
| 126 | Ga0070711_100175909 | 3300005439 | Bacteria | 1635 |
| 127 | Ga0070711_100382090 | 3300005439 | Bacteria | 1139 |
| 128 | Ga0070705_100001521 | 3300005440 | Bacteria | 12211 |
| 129 | Ga0070705_100074276 | 3300005440 | Bacteria | 2066 |
| 130 | Ga0070705_100157765 | 3300005440 | Bacteria | 1513 |
| 131 | Ga0070700_100008896 | 3300005441 | Bacteria | 5490 |
| 132 | Ga0070694_100007217 | 3300005444 | Bacteria | 6767 |
| 133 | Ga0070694_100013711 | 3300005444 | Bacteria | 5065 |
| 134 | Ga0070694_100019794 | 3300005444 | Bacteria | 4284 |
| 135 | Ga0070694_100074208 | 3300005444 | Bacteria | 2351 |
| 136 | Ga0070694_100269437 | 3300005444 | Bacteria | 1294 |
| 137 | Ga0070708_100025889 | 3300005445 | Bacteria | 5017 |
| 138 | Ga0070708_100459853 | 3300005445 | Bacteria | 1201 |
| 139 | Ga0070663_100003280 | 3300005455 | Bacteria | 9317 |
| 140 | Ga0070663_100006386 | 3300005455 | Bacteria | 7085 |
| 141 | Ga0070663_100103914 | 3300005455 | Bacteria | 2124 |
| 142 | Ga0070663_100681230 | 3300005455 | Bacteria | 872 |
| 143 | Ga0070678_100002807 | 3300005456 | Bacteria | 9625 |
| 144 | Ga0070678_100003443 | 3300005456 | Bacteria | 8823 |
| 145 | Ga0070678_100118829 | 3300005456 | Bacteria | 2081 |
| 146 | Ga0070662_100007409 | 3300005457 | Bacteria | 7114 |
| 147 | Ga0070662_100110177 | 3300005457 | Bacteria | 2096 |
| 148 | Ga0070662_100199672 | 3300005457 | Bacteria | 1586 |
| 149 | Ga0070662_100238473 | 3300005457 | Unclassified | 1457 |
| 150 | Ga0070662_100477734 | 3300005457 | Bacteria | 1037 |
| 151 | Ga0070662_100783246 | 3300005457 | Bacteria | 810 |
| 152 | Ga0070681_10001116 | 3300005458 | Bacteria | 23001 |
| 153 | Ga0070681_10093264 | 3300005458 | Unclassified | 2960 |
| 154 | Ga0070681_10128202 | 3300005458 | Bacteria | 2470 |
| 155 | Ga0070681_10392778 | 3300005458 | Bacteria | 1298 |
| 156 | Ga0070681_11418634 | 3300005458 | Unclassified | 618 |
| 157 | Ga0068867_100003313 | 3300005459 | Bacteria | 11344 |
| 158 | Ga0068867_100011652 | 3300005459 | Bacteria | 6208 |
| 159 | Ga0068867_100013453 | 3300005459 | Bacteria | 5796 |
| 160 | Ga0068867_100036868 | 3300005459 | Bacteria | 3552 |
| 161 | Ga0068867_100051129 | 3300005459 | Bacteria | 3047 |
| 162 | Ga0068867_100066562 | 3300005459 | Bacteria | 2684 |
| 163 | Ga0070685_10017843 | 3300005466 | Bacteria | 3806 |
| 164 | Ga0070706_100006859 | 3300005467 | Bacteria | 10754 |
| 165 | Ga0070707_100177283 | 3300005468 | Unclassified | 2078 |
| 166 | Ga0070707_100249637 | 3300005468 | Bacteria | 1727 |
| 167 | Ga0070698_100002697 | 3300005471 | Bacteria | 19514 |
| 168 | Ga0070698_100068689 | 3300005471 | Bacteria | 3560 |
| 169 | Ga0070699_100003652 | 3300005518 | Bacteria | 13624 |
| 170 | Ga0070699_100011108 | 3300005518 | Bacteria | 7783 |
| 171 | Ga0070699_100011594 | 3300005518 | Bacteria | 7611 |
| 172 | Ga0070699_100011655 | 3300005518 | Bacteria | 7589 |
| 173 | Ga0070699_100515757 | 3300005518 | Bacteria | 1086 |
| 174 | Ga0070699_100522079 | 3300005518 | Bacteria | 1080 |
| 175 | Ga0070679_100008557 | 3300005530 | Bacteria | 9639 |
| 176 | Ga0070679_100022804 | 3300005530 | Bacteria | 6122 |
| 177 | Ga0070679_100026039 | 3300005530 | Bacteria | 5741 |
| 178 | Ga0070679_100041482 | 3300005530 | Bacteria | 4579 |
| 179 | Ga0070679_100090027 | 3300005530 | Bacteria | 3056 |
| 180 | Ga0070679_100214459 | 3300005530 | Bacteria | 1888 |
| 181 | Ga0070684_100024805 | 3300005535 | Bacteria | 5033 |
| 182 | Ga0070684_100080873 | 3300005535 | Bacteria | 2875 |
| 183 | Ga0070684_100152396 | 3300005535 | Unclassified | 2095 |
| 184 | Ga0070684_100184876 | 3300005535 | Bacteria | 1895 |
| 185 | Ga0070684_100201450 | 3300005535 | Unclassified | 1813 |
| 186 | Ga0070684_100203074 | 3300005535 | Bacteria | 1805 |
| 187 | Ga0070697_100007797 | 3300005536 | Bacteria | 8333 |
| 188 | Ga0070697_100014344 | 3300005536 | Bacteria | 6226 |
| 189 | Ga0070697_100051472 | 3300005536 | Bacteria | 3346 |
| 190 | Ga0070697_100175058 | 3300005536 | Unclassified | 1817 |
| 191 | Ga0068853_100000779 | 3300005539 | Bacteria | 22116 |
| 192 | Ga0068853_100002843 | 3300005539 | Bacteria | 13120 |
| 193 | Ga0068853_100005617 | 3300005539 | Bacteria | 9850 |
| 194 | Ga0068853_100044947 | 3300005539 | Bacteria | 3782 |
| 195 | Ga0068853_100209326 | 3300005539 | Bacteria | 1777 |
| 196 | Ga0068853_100742439 | 3300005539 | Bacteria | 938 |
| 197 | Ga0070672_100001083 | 3300005543 | Bacteria | 16582 |
| 198 | Ga0070672_100003576 | 3300005543 | Bacteria | 10068 |
| 199 | Ga0070672_100066527 | 3300005543 | Bacteria | 2854 |
| 200 | Ga0070672_100082505 | 3300005543 | Bacteria | 2579 |
| 201 | Ga0070672_100288367 | 3300005543 | Bacteria | 1389 |
| 202 | Ga0070686_100017578 | 3300005544 | Bacteria | 4180 |
| 203 | Ga0070686_101027010 | 3300005544 | Bacteria | 677 |
| 204 | Ga0070695_100000594 | 3300005545 | Bacteria | 19125 |
| 205 | Ga0070695_100000882 | 3300005545 | Bacteria | 16166 |
| 206 | Ga0070695_100006122 | 3300005545 | Bacteria | 7109 |
| 207 | Ga0070695_100071420 | 3300005545 | Bacteria | 2273 |
| 208 | Ga0070696_100001696 | 3300005546 | Bacteria | 14450 |
| 209 | Ga0070696_100001788 | 3300005546 | Bacteria | 14090 |
| 210 | Ga0070696_100054730 | 3300005546 | Bacteria | 2781 |
| 211 | Ga0070696_100084137 | 3300005546 | Bacteria | 2257 |
| 212 | Ga0070696_100576237 | 3300005546 | Bacteria | 905 |
| 213 | Ga0070693_100003967 | 3300005547 | Bacteria | 6947 |
| 214 | Ga0070693_100027267 | 3300005547 | Bacteria | 3094 |
| 215 | Ga0070693_100085957 | 3300005547 | Bacteria | 1886 |
| 216 | Ga0070693_100168907 | 3300005547 | Bacteria | 1399 |
| 217 | Ga0070693_100296427 | 3300005547 | Bacteria | 1088 |
| 218 | Ga0070693_100511877 | 3300005547 | Bacteria | 853 |
| 219 | Ga0070693_100544599 | 3300005547 | Bacteria | 830 |
| 220 | Ga0070665_100005305 | 3300005548 | Bacteria | 13313 |
| 221 | Ga0070665_100025298 | 3300005548 | Bacteria | 5981 |
| 222 | Ga0070665_100220354 | 3300005548 | Bacteria | 1898 |
| 223 | Ga0070704_100003393 | 3300005549 | Bacteria | 9131 |
| 224 | Ga0070704_100043884 | 3300005549 | Bacteria | 3103 |
| 225 | Ga0070704_100217212 | 3300005549 | Bacteria | 1552 |
| 226 | Ga0070704_100218194 | 3300005549 | Bacteria | 1549 |
| 227 | Ga0068855_100002986 | 3300005563 | Bacteria | 20675 |
| 228 | Ga0068855_100006496 | 3300005563 | Bacteria | 14217 |
| 229 | Ga0068855_100019088 | 3300005563 | Bacteria | 8240 |
| 230 | Ga0068855_100100956 | 3300005563 | Bacteria | 3321 |
| 231 | Ga0068855_101439633 | 3300005563 | Bacteria | 709 |
| 232 | Ga0070664_100001830 | 3300005564 | Bacteria | 17031 |
| 233 | Ga0070664_100017750 | 3300005564 | Bacteria | 5846 |
| 234 | Ga0070664_100018607 | 3300005564 | Bacteria | 5710 |
| 235 | Ga0070664_100027492 | 3300005564 | Bacteria | 4727 |
| 236 | Ga0070664_100062029 | 3300005564 | Unclassified | 3186 |
| 237 | Ga0070664_100095386 | 3300005564 | Bacteria | 2580 |
| 238 | Ga0070664_100103207 | 3300005564 | Bacteria | 2482 |
| 239 | Ga0070664_100189800 | 3300005564 | Bacteria | 1830 |
| 240 | Ga0070664_100211040 | 3300005564 | Unclassified | 1735 |
| 241 | Ga0070664_100609625 | 3300005564 | Bacteria | 1013 |
| 242 | Ga0068857_100002228 | 3300005577 | Bacteria | 15793 |
| 243 | Ga0068857_100012218 | 3300005577 | Bacteria | 7470 |
| 244 | Ga0068857_100077812 | 3300005577 | Bacteria | 2960 |
| 245 | Ga0068857_100220596 | 3300005577 | Bacteria | 1732 |
| 246 | Ga0068857_100493940 | 3300005577 | Bacteria | 1148 |
| 247 | Ga0068854_100000604 | 3300005578 | Bacteria | 21347 |
| 248 | Ga0068854_100001268 | 3300005578 | Bacteria | 15172 |
| 249 | Ga0068854_100002881 | 3300005578 | Bacteria | 10704 |
| 250 | Ga0068854_100032779 | 3300005578 | Bacteria | 3617 |
| 251 | Ga0068854_100047917 | 3300005578 | Bacteria | 3047 |
| 252 | Ga0068854_100336285 | 3300005578 | Bacteria | 1232 |
| 253 | Ga0068854_100630093 | 3300005578 | Bacteria | 918 |
| 254 | Ga0068856_100000353 | 3300005614 | Bacteria | 50137 |
| 255 | Ga0068856_100009521 | 3300005614 | Bacteria | 9438 |
| 256 | Ga0068856_100010100 | 3300005614 | Bacteria | 9174 |
| 257 | Ga0068856_100012499 | 3300005614 | Bacteria | 8219 |
| 258 | Ga0068856_100014195 | 3300005614 | Bacteria | 7699 |
| 259 | Ga0068856_100049192 | 3300005614 | Bacteria | 4155 |
| 260 | Ga0068856_100346149 | 3300005614 | Bacteria | 1505 |
| 261 | Ga0068856_100563198 | 3300005614 | Bacteria | 1161 |
| 262 | Ga0070702_100015693 | 3300005615 | Bacteria | 3873 |
| 263 | Ga0070702_100045073 | 3300005615 | Bacteria | 2493 |
| 264 | Ga0070702_100159055 | 3300005615 | Bacteria | 1458 |
| 265 | Ga0068852_100000747 | 3300005616 | Bacteria | 21360 |
| 266 | Ga0068852_100011476 | 3300005616 | Bacteria | 6671 |
| 267 | Ga0068852_100036571 | 3300005616 | Bacteria | 4110 |
| 268 | Ga0068852_100084656 | 3300005616 | Bacteria | 2823 |
| 269 | Ga0068852_100338096 | 3300005616 | Bacteria | 1467 |
| 270 | Ga0068852_100421758 | 3300005616 | Bacteria | 1316 |
| 271 | Ga0068852_100659279 | 3300005616 | Bacteria | 1054 |
| 272 | Ga0068852_101909201 | 3300005616 | Unclassified | 616 |
| 273 | Ga0068859_100012248 | 3300005617 | Bacteria | 8626 |
| 274 | Ga0068859_100034976 | 3300005617 | Bacteria | 5040 |
| 275 | Ga0068859_100329033 | 3300005617 | Bacteria | 1622 |
| 276 | Ga0068864_100007420 | 3300005618 | Bacteria | 9028 |
| 277 | Ga0068864_100014561 | 3300005618 | Bacteria | 6535 |
| 278 | Ga0068864_100129351 | 3300005618 | Bacteria | 2266 |
| 279 | Ga0068864_100299156 | 3300005618 | Bacteria | 1506 |
| 280 | Ga0068866_10006272 | 3300005718 | Bacteria | 4948 |
| 281 | Ga0068866_10226763 | 3300005718 | Bacteria | 1131 |
| 282 | Ga0068866_10242238 | 3300005718 | Bacteria | 1099 |
| 283 | Ga0068861_100001021 | 3300005719 | Bacteria | 17112 |
| 284 | Ga0068861_100222727 | 3300005719 | Bacteria | 1595 |
| 285 | Ga0068861_100297204 | 3300005719 | Bacteria | 1397 |
| 286 | Ga0068861_100427632 | 3300005719 | Bacteria | 1181 |
| 287 | Ga0068851_10001339 | 3300005834 | Bacteria | 10757 |
| 288 | Ga0068851_10003076 | 3300005834 | Bacteria | 7384 |
| 289 | Ga0068851_10022933 | 3300005834 | Bacteria | 3047 |
| 290 | Ga0068851_10240977 | 3300005834 | Bacteria | 1022 |
| 291 | Ga0068851_10283158 | 3300005834 | Unclassified | 948 |
| 292 | Ga0068870_10000325 | 3300005840 | Bacteria | 17741 |
| 293 | Ga0068870_10000678 | 3300005840 | Bacteria | 12989 |
| 294 | Ga0068870_10010445 | 3300005840 | Bacteria | 4269 |
| 295 | Ga0068870_10033198 | 3300005840 | Bacteria | 2632 |
| 296 | Ga0068863_100015023 | 3300005841 | Bacteria | 7438 |
| 297 | Ga0068863_100019520 | 3300005841 | Bacteria | 6484 |
| 298 | Ga0068863_101084809 | 3300005841 | Bacteria | 805 |
| 299 | Ga0068858_100032627 | 3300005842 | Bacteria | 4835 |
| 300 | Ga0068858_100087650 | 3300005842 | Bacteria | 2895 |
| 301 | Ga0068858_100546656 | 3300005842 | Bacteria | 1121 |
| 302 | Ga0068860_100029370 | 3300005843 | Bacteria | 5287 |
| 303 | Ga0068860_100117230 | 3300005843 | Bacteria | 2548 |
| 304 | Ga0068860_100206727 | 3300005843 | Bacteria | 1904 |
| 305 | Ga0068860_100565845 | 3300005843 | Unclassified | 1140 |
| 306 | Ga0068860_101409600 | 3300005843 | Unclassified | 718 |
| 307 | Ga0068862_100001824 | 3300005844 | Bacteria | 19303 |
| 308 | Ga0068862_100003606 | 3300005844 | Bacteria | 13255 |
| 309 | Ga0068862_100037063 | 3300005844 | Bacteria | 4133 |
| 310 | Ga0068862_100239584 | 3300005844 | Bacteria | 1649 |
| 311 | Ga0081455_10006171 | 3300005937 | Bacteria | 12923 |
| 312 | Ga0081455_10092443 | 3300005937 | Bacteria | 2448 |
| 313 | Ga0081538_10003462 | 3300005981 | Bacteria | 14908 |
| 314 | Ga0081539_10061466 | 3300005985 | Bacteria | 2057 |
| 315 | Ga0070717_10847925 | 3300006028 | Unclassified | 831 |
| 316 | Ga0075365_10015607 | 3300006038 | Bacteria | 4598 |
| 317 | Ga0070716_100010263 | 3300006173 | Bacteria | 4693 |
| 318 | Ga0070716_100240703 | 3300006173 | Bacteria | 1227 |
| 319 | Ga0070712_100006588 | 3300006175 | Bacteria | 7213 |
| 320 | Ga0070712_100228820 | 3300006175 | Bacteria | 1476 |
| 321 | Ga0070712_100573222 | 3300006175 | Bacteria | 953 |
| 322 | Ga0070712_100954940 | 3300006175 | Unclassified | 741 |
| 323 | Ga0097621_100025558 | 3300006237 | Bacteria | 4621 |
| 324 | Ga0097621_100563292 | 3300006237 | Bacteria | 1038 |
| 325 | Ga0097621_100895782 | 3300006237 | Bacteria | 826 |
| 326 | Ga0068871_100045202 | 3300006358 | Bacteria | 3543 |
| 327 | Ga0068871_100401217 | 3300006358 | Bacteria | 1221 |
| 328 | Ga0075428_100012305 | 3300006844 | Bacteria | 9517 |
| 329 | Ga0075428_100020783 | 3300006844 | Bacteria | 7268 |
| 330 | Ga0075428_100033229 | 3300006844 | Bacteria | 5697 |
| 331 | Ga0075428_100086460 | 3300006844 | Unclassified | 3420 |
| 332 | Ga0075428_100254200 | 3300006844 | Bacteria | 1893 |
| 333 | Ga0075428_100411522 | 3300006844 | Bacteria | 1449 |
| 334 | Ga0075430_100057085 | 3300006846 | Unclassified | 3284 |
| 335 | Ga0075430_100164931 | 3300006846 | Bacteria | 1844 |
| 336 | Ga0075430_100187853 | 3300006846 | Bacteria | 1718 |
| 337 | Ga0075430_100284047 | 3300006846 | Unclassified | 1369 |
| 338 | Ga0075430_100320676 | 3300006846 | Bacteria | 1281 |
| 339 | Ga0075431_100008102 | 3300006847 | Bacteria | 10489 |
| 340 | Ga0075431_100064366 | 3300006847 | Unclassified | 3786 |
| 341 | Ga0075431_100181196 | 3300006847 | Bacteria | 2162 |
| 342 | Ga0075431_100226808 | 3300006847 | Bacteria | 1904 |
| 343 | Ga0075431_100253341 | 3300006847 | Bacteria | 1788 |
| 344 | Ga0075431_100268718 | 3300006847 | Unclassified | 1729 |
| 345 | Ga0075431_100767044 | 3300006847 | Bacteria | 939 |
| 346 | Ga0075431_101111231 | 3300006847 | Bacteria | 755 |
| 347 | Ga0075433_10005680 | 3300006852 | Bacteria | 9803 |
| 348 | Ga0075433_10025395 | 3300006852 | Bacteria | 5008 |
| 349 | Ga0075433_10037782 | 3300006852 | Bacteria | 4167 |
| 350 | Ga0075433_10118908 | 3300006852 | Bacteria | 2345 |
| 351 | Ga0075433_10250297 | 3300006852 | Bacteria | 1572 |
| 352 | Ga0075434_100010644 | 3300006871 | Bacteria | 8632 |
| 353 | Ga0075434_100026038 | 3300006871 | Bacteria | 5727 |
| 354 | Ga0075434_100042224 | 3300006871 | Bacteria | 4520 |
| 355 | Ga0075434_100078418 | 3300006871 | Bacteria | 3299 |
| 356 | Ga0075434_100081019 | 3300006871 | Bacteria | 3243 |
| 357 | Ga0075434_101170390 | 3300006871 | Unclassified | 781 |
| 358 | Ga0075429_100000527 | 3300006880 | Bacteria | 29058 |
| 359 | Ga0075429_100020558 | 3300006880 | Bacteria | 5729 |
| 360 | Ga0075429_100028268 | 3300006880 | Bacteria | 4869 |
| 361 | Ga0075429_100222627 | 3300006880 | Bacteria | 1653 |
| 362 | Ga0068865_100005637 | 3300006881 | Bacteria | 7600 |
| 363 | Ga0068865_100100061 | 3300006881 | Bacteria | 2120 |
| 364 | Ga0075436_100009591 | 3300006914 | Bacteria | 6626 |
| 365 | Ga0075436_100016340 | 3300006914 | Bacteria | 5080 |
| 366 | Ga0075436_100019815 | 3300006914 | Bacteria | 4613 |
| 367 | Ga0075436_100250758 | 3300006914 | Bacteria | 1260 |
| 368 | Ga0097620_100012249 | 3300006931 | Bacteria | 8626 |
| 369 | Ga0097620_100034970 | 3300006931 | Bacteria | 5040 |
| 370 | Ga0097620_100329028 | 3300006931 | Bacteria | 1622 |
| 371 | Ga0075435_100069915 | 3300007076 | Bacteria | 2864 |
| 372 | Ga0075435_100152531 | 3300007076 | Bacteria | 1943 |
| 373 | Ga0075435_100547568 | 3300007076 | Bacteria | 1002 |
| 374 | Ga0105240_10041920 | 3300009093 | Bacteria | 5837 |
| 375 | Ga0111539_10000623 | 3300009094 | Bacteria | 45950 |
| 376 | Ga0111539_10014858 | 3300009094 | Bacteria | 9708 |
| 377 | Ga0111539_10225476 | 3300009094 | Bacteria | 2183 |
| 378 | Ga0111539_10402846 | 3300009094 | Bacteria | 1593 |
| 379 | Ga0111539_11502315 | 3300009094 | Bacteria | 781 |
| 380 | Ga0105245_10435567 | 3300009098 | Bacteria | 1317 |
| 381 | Ga0105247_10044278 | 3300009101 | Bacteria | 2729 |
| 382 | Ga0105247_10150638 | 3300009101 | Bacteria | 1532 |
| 383 | Ga0114129_10007645 | 3300009147 | Bacteria | 15385 |
| 384 | Ga0114129_10095368 | 3300009147 | Bacteria | 4120 |
| 385 | Ga0114129_10095647 | 3300009147 | Bacteria | 4114 |
| 386 | Ga0114129_10176906 | 3300009147 | Bacteria | 2906 |
| 387 | Ga0114129_10203940 | 3300009147 | Bacteria | 2677 |
| 388 | Ga0114129_10221636 | 3300009147 | Bacteria | 2551 |
| 389 | Ga0114129_10298158 | 3300009147 | Bacteria | 2150 |
| 390 | Ga0114129_10375576 | 3300009147 | Bacteria | 1878 |
| 391 | Ga0114129_10499665 | 3300009147 | Bacteria | 1589 |
| 392 | Ga0114129_10585945 | 3300009147 | Bacteria | 1447 |
| 393 | Ga0114129_10599013 | 3300009147 | Bacteria | 1428 |
| 394 | Ga0114129_11747182 | 3300009147 | Bacteria | 758 |
| 395 | Ga0105243_10173183 | 3300009148 | Bacteria | 1871 |
| 396 | Ga0105241_10000214 | 3300009174 | Bacteria | 43488 |
| 397 | Ga0105241_10002568 | 3300009174 | Bacteria | 13623 |
| 398 | Ga0105241_10057563 | 3300009174 | Bacteria | 2982 |
| 399 | Ga0105241_10494390 | 3300009174 | Bacteria | 1089 |
| 400 | Ga0105242_10059699 | 3300009176 | Bacteria | 3130 |
| 401 | Ga0105248_10005276 | 3300009177 | Bacteria | 14221 |
| 402 | Ga0105237_10068892 | 3300009545 | Bacteria | 3532 |
| 403 | Ga0105238_10000203 | 3300009551 | Bacteria | 65825 |
| 404 | Ga0105238_10180454 | 3300009551 | Bacteria | 2088 |
| 405 | Ga0105238_11056367 | 3300009551 | Bacteria | 834 |
| 406 | Ga0105249_10059017 | 3300009553 | Bacteria | 3518 |
| 407 | Ga0105249_10293761 | 3300009553 | Bacteria | 1627 |
| 408 | Ga0105249_10888467 | 3300009553 | Bacteria | 958 |
| 409 | Ga0105239_10022008 | 3300010375 | Bacteria | 7028 |
| 410 | Ga0105239_10122686 | 3300010375 | Bacteria | 2887 |
| 411 | Ga0105246_10133326 | 3300011119 | Bacteria | 1858 |
| 412 | Ga0105246_11291555 | 3300011119 | Bacteria | 676 |
| 413 | Ga0157327_1022151 | 3300012512 | Unclassified | 727 |
| 414 | Ga0157373_10003556 | 3300013100 | Bacteria | 11773 |
| 415 | Ga0157373_10009243 | 3300013100 | Bacteria | 7287 |
| 416 | Ga0157373_10066925 | 3300013100 | Bacteria | 2540 |
| 417 | Ga0157373_10493094 | 3300013100 | Bacteria | 884 |
| 418 | Ga0157371_10036153 | 3300013102 | Bacteria | 3537 |
| 419 | Ga0157371_10121909 | 3300013102 | Bacteria | 1854 |
| 420 | Ga0157371_10188164 | 3300013102 | Bacteria | 1478 |
| 421 | Ga0157371_10255959 | 3300013102 | Bacteria | 1261 |
| 422 | Ga0157370_10002318 | 3300013104 | Bacteria | 23048 |
| 423 | Ga0157370_10008678 | 3300013104 | Bacteria | 10936 |
| 424 | Ga0157370_10023441 | 3300013104 | Bacteria | 6126 |
| 425 | Ga0157370_10028348 | 3300013104 | Bacteria | 5510 |
| 426 | Ga0157370_10042276 | 3300013104 | Bacteria | 4393 |
| 427 | Ga0157370_10139526 | 3300013104 | Bacteria | 2259 |
| 428 | Ga0157370_10442643 | 3300013104 | Bacteria | 1195 |
| 429 | Ga0157370_10973106 | 3300013104 | Bacteria | 769 |
| 430 | Ga0157369_10002800 | 3300013105 | Bacteria | 20812 |
| 431 | Ga0157369_10018175 | 3300013105 | Bacteria | 7886 |
| 432 | Ga0157369_10036003 | 3300013105 | Bacteria | 5425 |
| 433 | Ga0157369_10113198 | 3300013105 | Bacteria | 2883 |
| 434 | Ga0157369_10124564 | 3300013105 | Bacteria | 2733 |
| 435 | Ga0157369_10287993 | 3300013105 | Bacteria | 1710 |
| 436 | Ga0157374_10004010 | 3300013296 | Bacteria | 12377 |
| 437 | Ga0157374_10014918 | 3300013296 | Bacteria | 6809 |
| 438 | Ga0157374_10083135 | 3300013296 | Bacteria | 3041 |
| 439 | Ga0157374_10150613 | 3300013296 | Bacteria | 2262 |
| 440 | Ga0157378_10032854 | 3300013297 | Bacteria | 4586 |
| 441 | Ga0157378_10335292 | 3300013297 | Bacteria | 1473 |
| 442 | Ga0163162_10074800 | 3300013306 | Bacteria | 3447 |
| 443 | Ga0163162_10155135 | 3300013306 | Bacteria | 2409 |
| 444 | Ga0163162_10241078 | 3300013306 | Bacteria | 1939 |
| 445 | Ga0163162_10307320 | 3300013306 | Bacteria | 1718 |
| 446 | Ga0157372_10000063 | 3300013307 | Bacteria | 119595 |
| 447 | Ga0157372_10012621 | 3300013307 | Bacteria | 8998 |
| 448 | Ga0157372_10013023 | 3300013307 | Bacteria | 8870 |
| 449 | Ga0157372_10017319 | 3300013307 | Bacteria | 7736 |
| 450 | Ga0157372_10039295 | 3300013307 | Bacteria | 5222 |
| 451 | Ga0157372_10169384 | 3300013307 | Bacteria | 2527 |
| 452 | Ga0157372_10170167 | 3300013307 | Bacteria | 2520 |
| 453 | Ga0157372_10255733 | 3300013307 | Bacteria | 2033 |
| 454 | Ga0157372_10288023 | 3300013307 | Bacteria | 1910 |
| 455 | Ga0157372_10310763 | 3300013307 | Bacteria | 1834 |
| 456 | Ga0157372_10411628 | 3300013307 | Bacteria | 1576 |
| 457 | Ga0157372_10504758 | 3300013307 | Unclassified | 1410 |
| 458 | Ga0157372_11108016 | 3300013307 | Bacteria | 916 |
| 459 | Ga0157372_11706998 | 3300013307 | Unclassified | 724 |
| 460 | Ga0157375_10025278 | 3300013308 | Bacteria | 5514 |
| 461 | Ga0157375_10060397 | 3300013308 | Bacteria | 3759 |
| 462 | Ga0157375_10071917 | 3300013308 | Bacteria | 3473 |
| 463 | Ga0157375_10130446 | 3300013308 | Unclassified | 2632 |
| 464 | Ga0163163_10030635 | 3300014325 | Bacteria | 5185 |
| 465 | Ga0163163_10074237 | 3300014325 | Bacteria | 3392 |
| 466 | Ga0163163_10219107 | 3300014325 | Bacteria | 1952 |
| 467 | Ga0157380_10030772 | 3300014326 | Bacteria | 4113 |
| 468 | Ga0157380_10277178 | 3300014326 | Bacteria | 1532 |
| 469 | Ga0157377_10001980 | 3300014745 | Bacteria | 8968 |
| 470 | Ga0157379_10005870 | 3300014968 | Bacteria | 10563 |
| 471 | Ga0157379_10008248 | 3300014968 | Bacteria | 9049 |
| 472 | Ga0157379_10623796 | 3300014968 | Bacteria | 1008 |
| 473 | Ga0157376_10017980 | 3300014969 | Bacteria | 5408 |
| 474 | Ga0157376_10103274 | 3300014969 | Bacteria | 2495 |
| 475 | Ga0182007_10070690 | 3300015262 | Bacteria | 1143 |
| 476 | Ga0163161_10039466 | 3300017792 | Bacteria | 3390 |
| 477 | Ga0206353_10401628 | 3300020082 | Bacteria | 856 |
| 478 | Ga0213872_10002894 | 3300021361 | Bacteria | 9767 |
| 479 | Ga0213876_10407639 | 3300021384 | Bacteria | 723 |
| 480 | Ga0213875_10157511 | 3300021388 | Bacteria | 1065 |
| 481 | Ga0207666_1002421 | 3300025271 | Bacteria | 2247 |
| 482 | Ga0207673_1026557 | 3300025290 | Bacteria | 794 |
| 483 | Ga0207697_10000014 | 3300025315 | Bacteria | 59917 |
| 484 | Ga0207656_10002066 | 3300025321 | Bacteria | 6703 |
| 485 | Ga0207656_10013641 | 3300025321 | Bacteria | 3111 |
| 486 | Ga0207656_10023993 | 3300025321 | Bacteria | 2462 |
| 487 | Ga0207656_10100921 | 3300025321 | Bacteria | 1323 |
| 488 | Ga0207656_10178101 | 3300025321 | Unclassified | 1019 |
| 489 | Ga0207653_10005718 | 3300025885 | Bacteria | 3877 |
| 490 | Ga0207682_10000063 | 3300025893 | Bacteria | 46817 |
| 491 | Ga0207682_10000095 | 3300025893 | Bacteria | 41132 |
| 492 | Ga0207692_10003191 | 3300025898 | Bacteria | 6371 |
| 493 | Ga0207688_10003261 | 3300025901 | Bacteria | 8865 |
| 494 | Ga0207688_10007982 | 3300025901 | Bacteria | 5758 |
| 495 | Ga0207680_10031208 | 3300025903 | Bacteria | 3016 |
| 496 | Ga0207680_10051183 | 3300025903 | Unclassified | 2469 |
| 497 | Ga0207680_10274899 | 3300025903 | Unclassified | 1169 |
| 498 | Ga0207647_10086553 | 3300025904 | Bacteria | 1873 |
| 499 | Ga0207699_10002304 | 3300025906 | Bacteria | 9025 |
| 500 | Ga0207699_10094487 | 3300025906 | Bacteria | 1883 |
| 501 | Ga0207699_10107559 | 3300025906 | Bacteria | 1782 |
| 502 | Ga0207699_10395103 | 3300025906 | Bacteria | 984 |
| 503 | Ga0207645_10000195 | 3300025907 | Bacteria | 49424 |
| 504 | Ga0207645_10000272 | 3300025907 | Bacteria | 42718 |
| 505 | Ga0207645_10002500 | 3300025907 | Bacteria | 14429 |
| 506 | Ga0207645_10145452 | 3300025907 | Bacteria | 1545 |
| 507 | Ga0207643_10001502 | 3300025908 | Bacteria | 13354 |
| 508 | Ga0207643_10009435 | 3300025908 | Bacteria | 5245 |
| 509 | Ga0207705_10022293 | 3300025909 | Bacteria | 4516 |
| 510 | Ga0207705_10057701 | 3300025909 | Bacteria | 2800 |
| 511 | Ga0207705_10069083 | 3300025909 | Bacteria | 2558 |
| 512 | Ga0207705_10139359 | 3300025909 | Unclassified | 1810 |
| 513 | Ga0207705_10204525 | 3300025909 | Bacteria | 1496 |
| 514 | Ga0207684_10004793 | 3300025910 | Bacteria | 12670 |
| 515 | Ga0207684_10013658 | 3300025910 | Bacteria | 7016 |
| 516 | Ga0207684_10026821 | 3300025910 | Bacteria | 4912 |
| 517 | Ga0207684_11058135 | 3300025910 | Bacteria | 677 |
| 518 | Ga0207654_10020053 | 3300025911 | Bacteria | 3538 |
| 519 | Ga0207654_10028499 | 3300025911 | Bacteria | 3044 |
| 520 | Ga0207654_10643619 | 3300025911 | Bacteria | 759 |
| 521 | Ga0207707_10000429 | 3300025912 | Bacteria | 43692 |
| 522 | Ga0207707_10012269 | 3300025912 | Bacteria | 7449 |
| 523 | Ga0207707_10020894 | 3300025912 | Bacteria | 5718 |
| 524 | Ga0207707_10307715 | 3300025912 | Bacteria | 1370 |
| 525 | Ga0207707_10508745 | 3300025912 | Bacteria | 1026 |
| 526 | Ga0207695_10016660 | 3300025913 | Bacteria | 8588 |
| 527 | Ga0207695_10018465 | 3300025913 | Bacteria | 8065 |
| 528 | Ga0207695_10346066 | 3300025913 | Bacteria | 1374 |
| 529 | Ga0207671_10097438 | 3300025914 | Bacteria | 2223 |
| 530 | Ga0207693_10082708 | 3300025915 | Bacteria | 2514 |
| 531 | Ga0207693_10142232 | 3300025915 | Bacteria | 1886 |
| 532 | Ga0207693_10664248 | 3300025915 | Unclassified | 809 |
| 533 | Ga0207663_10190513 | 3300025916 | Bacteria | 1472 |
| 534 | Ga0207663_10214823 | 3300025916 | Bacteria | 1396 |
| 535 | Ga0207663_10326310 | 3300025916 | Bacteria | 1155 |
| 536 | Ga0207663_10343973 | 3300025916 | Bacteria | 1127 |
| 537 | Ga0207660_10000191 | 3300025917 | Bacteria | 38989 |
| 538 | Ga0207660_10008619 | 3300025917 | Bacteria | 6595 |
| 539 | Ga0207660_10121282 | 3300025917 | Bacteria | 1980 |
| 540 | Ga0207660_10213887 | 3300025917 | Unclassified | 1511 |
| 541 | Ga0207660_10300501 | 3300025917 | Bacteria | 1278 |
| 542 | Ga0207662_10000912 | 3300025918 | Bacteria | 13678 |
| 543 | Ga0207662_10062534 | 3300025918 | Bacteria | 2237 |
| 544 | Ga0207657_10000075 | 3300025919 | Bacteria | 93163 |
| 545 | Ga0207657_10000586 | 3300025919 | Bacteria | 38661 |
| 546 | Ga0207657_10004987 | 3300025919 | Bacteria | 13958 |
| 547 | Ga0207657_10012259 | 3300025919 | Bacteria | 8468 |
| 548 | Ga0207657_10022831 | 3300025919 | Bacteria | 5841 |
| 549 | Ga0207657_10198589 | 3300025919 | Bacteria | 1615 |
| 550 | Ga0207657_10236341 | 3300025919 | Bacteria | 1460 |
| 551 | Ga0207657_10486797 | 3300025919 | Bacteria | 967 |
| 552 | Ga0207649_10004639 | 3300025920 | Bacteria | 7442 |
| 553 | Ga0207649_10009816 | 3300025920 | Bacteria | 5245 |
| 554 | Ga0207649_10025686 | 3300025920 | Bacteria | 3436 |
| 555 | Ga0207649_10119404 | 3300025920 | Bacteria | 1775 |
| 556 | Ga0207649_10201175 | 3300025920 | Bacteria | 1407 |
| 557 | Ga0207649_10248626 | 3300025920 | Unclassified | 1280 |
| 558 | Ga0207652_10000511 | 3300025921 | Bacteria | 39295 |
| 559 | Ga0207652_10006954 | 3300025921 | Bacteria | 9114 |
| 560 | Ga0207652_10015332 | 3300025921 | Bacteria | 6223 |
| 561 | Ga0207652_10052382 | 3300025921 | Bacteria | 3502 |
| 562 | Ga0207652_10119511 | 3300025921 | Bacteria | 2344 |
| 563 | Ga0207646_10002098 | 3300025922 | Bacteria | 23902 |
| 564 | Ga0207646_10136091 | 3300025922 | Bacteria | 2212 |
| 565 | Ga0207681_10161113 | 3300025923 | Bacteria | 1691 |
| 566 | Ga0207681_10226804 | 3300025923 | Bacteria | 1448 |
| 567 | Ga0207681_10420197 | 3300025923 | Bacteria | 1083 |
| 568 | Ga0207681_10459190 | 3300025923 | Bacteria | 1037 |
| 569 | Ga0207694_10038700 | 3300025924 | Bacteria | 3667 |
| 570 | Ga0207650_10001076 | 3300025925 | Bacteria | 20302 |
| 571 | Ga0207650_10004666 | 3300025925 | Bacteria | 9371 |
| 572 | Ga0207650_10021897 | 3300025925 | Bacteria | 4523 |
| 573 | Ga0207650_10022444 | 3300025925 | Bacteria | 4467 |
| 574 | Ga0207650_10312521 | 3300025925 | Bacteria | 1286 |
| 575 | Ga0207659_10066317 | 3300025926 | Bacteria | 2619 |
| 576 | Ga0207659_10110814 | 3300025926 | Bacteria | 2086 |
| 577 | Ga0207687_10108514 | 3300025927 | Bacteria | 2055 |
| 578 | Ga0207700_10316617 | 3300025928 | Unclassified | 1351 |
| 579 | Ga0207700_10894649 | 3300025928 | Bacteria | 794 |
| 580 | Ga0207664_10015354 | 3300025929 | Bacteria | 5554 |
| 581 | Ga0207664_10029527 | 3300025929 | Bacteria | 4177 |
| 582 | Ga0207664_10072150 | 3300025929 | Bacteria | 2783 |
| 583 | Ga0207664_10409657 | 3300025929 | Bacteria | 1207 |
| 584 | Ga0207664_10598374 | 3300025929 | Bacteria | 990 |
| 585 | Ga0207644_10002250 | 3300025931 | Bacteria | 12527 |
| 586 | Ga0207644_10035859 | 3300025931 | Bacteria | 3478 |
| 587 | Ga0207644_10062600 | 3300025931 | Bacteria | 2699 |
| 588 | Ga0207644_10069954 | 3300025931 | Bacteria | 2564 |
| 589 | Ga0207644_10089814 | 3300025931 | Bacteria | 2287 |
| 590 | Ga0207644_10228080 | 3300025931 | Bacteria | 1479 |
| 591 | Ga0207644_10353499 | 3300025931 | Bacteria | 1194 |
| 592 | Ga0207690_10001528 | 3300025932 | Bacteria | 14473 |
| 593 | Ga0207690_10007791 | 3300025932 | Bacteria | 6358 |
| 594 | Ga0207690_10039530 | 3300025932 | Bacteria | 3078 |
| 595 | Ga0207690_10181577 | 3300025932 | Bacteria | 1585 |
| 596 | Ga0207690_10418345 | 3300025932 | Bacteria | 1072 |
| 597 | Ga0207706_10003208 | 3300025933 | Bacteria | 15702 |
| 598 | Ga0207706_10014942 | 3300025933 | Bacteria | 7030 |
| 599 | Ga0207706_10041599 | 3300025933 | Bacteria | 4073 |
| 600 | Ga0207706_10071958 | 3300025933 | Unclassified | 3041 |
| 601 | Ga0207706_10102055 | 3300025933 | Unclassified | 2524 |
| 602 | Ga0207706_10206712 | 3300025933 | Bacteria | 1721 |
| 603 | Ga0207706_10217143 | 3300025933 | Bacteria | 1675 |
| 604 | Ga0207706_10502493 | 3300025933 | Bacteria | 1046 |
| 605 | Ga0207686_10047342 | 3300025934 | Bacteria | 2658 |
| 606 | Ga0207686_11070506 | 3300025934 | Bacteria | 656 |
| 607 | Ga0207709_10040893 | 3300025935 | Bacteria | 2779 |
| 608 | Ga0207670_10027509 | 3300025936 | Bacteria | 3596 |
| 609 | Ga0207670_10719440 | 3300025936 | Bacteria | 827 |
| 610 | Ga0207669_10331376 | 3300025937 | Bacteria | 1168 |
| 611 | Ga0207669_10424313 | 3300025937 | Bacteria | 1047 |
| 612 | Ga0207704_10028126 | 3300025938 | Bacteria | 3114 |
| 613 | Ga0207704_10140063 | 3300025938 | Bacteria | 1691 |
| 614 | Ga0207704_10283973 | 3300025938 | Bacteria | 1260 |
| 615 | Ga0207665_10011234 | 3300025939 | Bacteria | 5877 |
| 616 | Ga0207665_10224128 | 3300025939 | Bacteria | 1379 |
| 617 | Ga0207665_10279197 | 3300025939 | Bacteria | 1243 |
| 618 | Ga0207691_10000370 | 3300025940 | Bacteria | 45317 |
| 619 | Ga0207691_10007916 | 3300025940 | Bacteria | 10231 |
| 620 | Ga0207691_10020908 | 3300025940 | Bacteria | 6183 |
| 621 | Ga0207691_10089828 | 3300025940 | Bacteria | 2754 |
| 622 | Ga0207691_10157952 | 3300025940 | Bacteria | 1990 |
| 623 | Ga0207691_10200838 | 3300025940 | Bacteria | 1735 |
| 624 | Ga0207711_10048744 | 3300025941 | Bacteria | 3624 |
| 625 | Ga0207711_10060669 | 3300025941 | Unclassified | 3259 |
| 626 | Ga0207711_10173840 | 3300025941 | Bacteria | 1956 |
| 627 | Ga0207689_10000765 | 3300025942 | Bacteria | 30859 |
| 628 | Ga0207689_10006609 | 3300025942 | Bacteria | 10229 |
| 629 | Ga0207689_10024121 | 3300025942 | Bacteria | 5103 |
| 630 | Ga0207689_10032390 | 3300025942 | Bacteria | 4349 |
| 631 | Ga0207689_10091063 | 3300025942 | Bacteria | 2506 |
| 632 | Ga0207661_10018687 | 3300025944 | Bacteria | 5154 |
| 633 | Ga0207661_10038291 | 3300025944 | Bacteria | 3757 |
| 634 | Ga0207661_10073347 | 3300025944 | Bacteria | 2803 |
| 635 | Ga0207661_10073793 | 3300025944 | Bacteria | 2795 |
| 636 | Ga0207661_11202417 | 3300025944 | Bacteria | 697 |
| 637 | Ga0207679_10000932 | 3300025945 | Bacteria | 18689 |
| 638 | Ga0207679_10036494 | 3300025945 | Bacteria | 3486 |
| 639 | Ga0207679_10043134 | 3300025945 | Bacteria | 3246 |
| 640 | Ga0207679_10060342 | 3300025945 | Bacteria | 2817 |
| 641 | Ga0207679_10156336 | 3300025945 | Unclassified | 1862 |
| 642 | Ga0207667_10000425 | 3300025949 | Bacteria | 56804 |
| 643 | Ga0207667_10004119 | 3300025949 | Bacteria | 17860 |
| 644 | Ga0207667_10019734 | 3300025949 | Bacteria | 7514 |
| 645 | Ga0207667_10062236 | 3300025949 | Bacteria | 3903 |
| 646 | Ga0207667_10097341 | 3300025949 | Unclassified | 3037 |
| 647 | Ga0207667_10114813 | 3300025949 | Bacteria | 2775 |
| 648 | Ga0207667_10506389 | 3300025949 | Bacteria | 1224 |
| 649 | Ga0207651_10030929 | 3300025960 | Bacteria | 3415 |
| 650 | Ga0207651_10075662 | 3300025960 | Bacteria | 2403 |
| 651 | Ga0207651_10868711 | 3300025960 | Bacteria | 802 |
| 652 | Ga0207712_10425023 | 3300025961 | Bacteria | 1122 |
| 653 | Ga0207712_10532160 | 3300025961 | Bacteria | 1009 |
| 654 | Ga0207668_10078492 | 3300025972 | Bacteria | 2384 |
| 655 | Ga0207668_10127133 | 3300025972 | Bacteria | 1940 |
| 656 | Ga0207668_10706775 | 3300025972 | Bacteria | 886 |
| 657 | Ga0207640_10002253 | 3300025981 | Bacteria | 10392 |
| 658 | Ga0207640_10003350 | 3300025981 | Bacteria | 8631 |
| 659 | Ga0207640_10027491 | 3300025981 | Bacteria | 3467 |
| 660 | Ga0207640_10048929 | 3300025981 | Bacteria | 2735 |
| 661 | Ga0207640_10645080 | 3300025981 | Bacteria | 901 |
| 662 | Ga0207640_10678971 | 3300025981 | Bacteria | 881 |
| 663 | Ga0207658_10017007 | 3300025986 | Bacteria | 5006 |
| 664 | Ga0207658_10076248 | 3300025986 | Bacteria | 2553 |
| 665 | Ga0207658_10159504 | 3300025986 | Bacteria | 1847 |
| 666 | Ga0207658_10213822 | 3300025986 | Bacteria | 1618 |
| 667 | Ga0207658_10286565 | 3300025986 | Bacteria | 1414 |
| 668 | Ga0207658_10817705 | 3300025986 | Bacteria | 846 |
| 669 | Ga0207677_10024810 | 3300026023 | Bacteria | 3731 |
| 670 | Ga0207677_10035978 | 3300026023 | Bacteria | 3221 |
| 671 | Ga0207677_10236597 | 3300026023 | Unclassified | 1475 |
| 672 | Ga0207677_10451734 | 3300026023 | Bacteria | 1101 |
| 673 | Ga0207703_10012702 | 3300026035 | Bacteria | 6566 |
| 674 | Ga0207703_10072589 | 3300026035 | Bacteria | 2845 |
| 675 | Ga0207703_10158271 | 3300026035 | Bacteria | 1982 |
| 676 | Ga0207639_10000841 | 3300026041 | Bacteria | 20841 |
| 677 | Ga0207639_10021665 | 3300026041 | Bacteria | 4620 |
| 678 | Ga0207639_10155242 | 3300026041 | Bacteria | 1922 |
| 679 | Ga0207639_10585384 | 3300026041 | Bacteria | 1028 |
| 680 | Ga0207639_10770883 | 3300026041 | Bacteria | 895 |
| 681 | Ga0207678_10000668 | 3300026067 | Bacteria | 31472 |
| 682 | Ga0207678_10001520 | 3300026067 | Bacteria | 21261 |
| 683 | Ga0207678_10001630 | 3300026067 | Bacteria | 20581 |
| 684 | Ga0207678_10008011 | 3300026067 | Bacteria | 9317 |
| 685 | Ga0207678_10898481 | 3300026067 | Bacteria | 783 |
| 686 | Ga0207708_10000766 | 3300026075 | Bacteria | 24175 |
| 687 | Ga0207708_10139414 | 3300026075 | Bacteria | 1901 |
| 688 | Ga0207702_10001971 | 3300026078 | Bacteria | 19966 |
| 689 | Ga0207702_10003131 | 3300026078 | Bacteria | 15341 |
| 690 | Ga0207702_10024909 | 3300026078 | Bacteria | 4965 |
| 691 | Ga0207702_10126442 | 3300026078 | Bacteria | 2296 |
| 692 | Ga0207702_10151402 | 3300026078 | Bacteria | 2110 |
| 693 | Ga0207702_10223165 | 3300026078 | Bacteria | 1757 |
| 694 | Ga0207702_10376831 | 3300026078 | Bacteria | 1364 |
| 695 | Ga0207641_10088036 | 3300026088 | Bacteria | 2710 |
| 696 | Ga0207641_10203598 | 3300026088 | Bacteria | 1826 |
| 697 | Ga0207641_10609563 | 3300026088 | Bacteria | 1069 |
| 698 | Ga0207648_10001587 | 3300026089 | Bacteria | 24915 |
| 699 | Ga0207648_10009913 | 3300026089 | Bacteria | 9080 |
| 700 | Ga0207648_10021411 | 3300026089 | Bacteria | 5812 |
| 701 | Ga0207648_10053658 | 3300026089 | Bacteria | 3523 |
| 702 | Ga0207648_10086510 | 3300026089 | Bacteria | 2735 |
| 703 | Ga0207648_10161472 | 3300026089 | Bacteria | 1979 |
| 704 | Ga0207676_10013574 | 3300026095 | Bacteria | 5847 |
| 705 | Ga0207676_10022855 | 3300026095 | Bacteria | 4604 |
| 706 | Ga0207676_10545614 | 3300026095 | Bacteria | 1107 |
| 707 | Ga0207676_11334250 | 3300026095 | Bacteria | 712 |
| 708 | Ga0207674_10000045 | 3300026116 | Bacteria | 122251 |
| 709 | Ga0207674_10000380 | 3300026116 | Bacteria | 57884 |
| 710 | Ga0207674_10002124 | 3300026116 | Bacteria | 25051 |
| 711 | Ga0207674_10008066 | 3300026116 | Bacteria | 12209 |
| 712 | Ga0207674_10372930 | 3300026116 | Bacteria | 1379 |
| 713 | Ga0207674_10460460 | 3300026116 | Bacteria | 1229 |
| 714 | Ga0207675_100000630 | 3300026118 | Bacteria | 34562 |
| 715 | Ga0207675_100034669 | 3300026118 | Bacteria | 4707 |
| 716 | Ga0207675_100132847 | 3300026118 | Bacteria | 2360 |
| 717 | Ga0207675_100213736 | 3300026118 | Bacteria | 1856 |
| 718 | Ga0207675_100416790 | 3300026118 | Unclassified | 1326 |
| 719 | Ga0207683_10000009 | 3300026121 | Bacteria | 150281 |
| 720 | Ga0207683_10020012 | 3300026121 | Bacteria | 5718 |
| 721 | Ga0207698_10004215 | 3300026142 | Bacteria | 8744 |
| 722 | Ga0207698_10004799 | 3300026142 | Bacteria | 8276 |
| 723 | Ga0207698_10064043 | 3300026142 | Bacteria | 2880 |
| 724 | Ga0207698_10145280 | 3300026142 | Bacteria | 2050 |
| 725 | Ga0207698_10701601 | 3300026142 | Bacteria | 1007 |
| 726 | Ga0209973_1042982 | 3300027252 | Bacteria | 666 |
| 727 | Ga0209969_1017871 | 3300027360 | Bacteria | 1046 |
| 728 | Ga0209996_1007246 | 3300027395 | Bacteria | 1442 |
| 729 | Ga0210000_1022425 | 3300027462 | Bacteria | 969 |
| 730 | Ga0209995_1000849 | 3300027471 | Bacteria | 4741 |
| 731 | Ga0209968_1001912 | 3300027526 | Bacteria | 3163 |
| 732 | Ga0209999_1005431 | 3300027543 | Bacteria | 2293 |
| 733 | Ga0209970_1002132 | 3300027614 | Bacteria | 3392 |
| 734 | Ga0209983_1000844 | 3300027665 | Bacteria | 6723 |
| 735 | Ga0209971_1000041 | 3300027682 | Bacteria | 41543 |
| 736 | Ga0209966_1000241 | 3300027695 | Bacteria | 20361 |
| 737 | Ga0209998_10000028 | 3300027717 | Bacteria | 60458 |
| 738 | Ga0207428_10000063 | 3300027907 | Bacteria | 151868 |
| 739 | Ga0207428_10000091 | 3300027907 | Bacteria | 125388 |
| 740 | Ga0207428_10137186 | 3300027907 | Bacteria | 1870 |
| 741 | Ga0207428_10185394 | 3300027907 | Bacteria | 1570 |
| 742 | Ga0268266_10033290 | 3300028379 | Bacteria | 4381 |
| 743 | Ga0268266_10057199 | 3300028379 | Bacteria | 3355 |
| 744 | Ga0268266_10124588 | 3300028379 | Bacteria | 2297 |
| 745 | Ga0268266_10371045 | 3300028379 | Bacteria | 1348 |
| 746 | Ga0268265_10034748 | 3300028380 | Bacteria | 3677 |
| 747 | Ga0268265_10120257 | 3300028380 | Bacteria | 2162 |
| 748 | Ga0268265_10195912 | 3300028380 | Bacteria | 1748 |
| 749 | Ga0268264_10018459 | 3300028381 | Bacteria | 5704 |
| 750 | Ga0268264_10162960 | 3300028381 | Bacteria | 2010 |
| 751 | Ga0268264_10175563 | 3300028381 | Bacteria | 1941 |
| 752 | Ga0268264_10321554 | 3300028381 | Bacteria | 1463 |
| 753 | Ga0265326_10030725 | 3300028558 | Bacteria | 1530 |
| 754 | Ga0265323_10003068 | 3300028653 | Bacteria | 7438 |
| 755 | Ga0265336_10000859 | 3300028666 | Bacteria | 15784 |
| 756 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 757 | Ga0265324_10038793 | 3300029957 | Bacteria | 1652 |
| 758 | Ga0265339_10001605 | 3300031249 | Bacteria | 16732 |
| 759 | Ga0265327_10106184 | 3300031251 | Unclassified | 1348 |
| 760 | Ga0307509_10262646 | 3300031507 | Bacteria | 1500 |
| 761 | Ga0307408_100068463 | 3300031548 | Bacteria | 2614 |
| 762 | Ga0307408_100714362 | 3300031548 | Bacteria | 902 |
| 763 | Ga0265313_10002595 | 3300031595 | Bacteria | 15390 |
| 764 | Ga0265342_10170364 | 3300031712 | Bacteria | 1198 |
| 765 | Ga0307410_10845312 | 3300031852 | Unclassified | 781 |
| 766 | Ga0307406_10223561 | 3300031901 | Unclassified | 1401 |
| 767 | Ga0307409_100401652 | 3300031995 | Unclassified | 1309 |
| 768 | Ga0307409_100588622 | 3300031995 | Bacteria | 1098 |
| 769 | Ga0307416_100251664 | 3300032002 | Bacteria | 1720 |
| 770 | Ga0307416_100878028 | 3300032002 | Bacteria | 996 |
| 771 | Ga0307414_10740192 | 3300032004 | Unclassified | 893 |
| 772 | Ga0307415_100473468 | 3300032126 | Bacteria | 1089 |
| 773 | Ga0307415_100532054 | 3300032126 | Unclassified | 1034 |
| 774 | Ga0373948_0007185 | 3300034817 | Bacteria | 1865 |
| 775 | Ga0373948_0014536 | 3300034817 | Bacteria | 1435 |
| 776 | Ga0373958_0073829 | 3300034819 | Bacteria | 761 |
| 777 | Ga0373940_0085817 | 3300035088 | Bacteria | 937 |
| 778 | Ga0373940_0119911 | 3300035088 | Bacteria | 815 |
| 779 | Ga0373951_0002679 | 3300035091 | Bacteria | 4460 |
| 780 | Ga0373951_0115099 | 3300035091 | Bacteria | 727 |
| 781 | Ga0373923_0020158 | 3300035111 | Bacteria | 2588 |
| 782 | Ga0373932_0036708 | 3300035112 | Unclassified | 1393 |
| 783 | Ga0373932_0120889 | 3300035112 | Bacteria | 873 |
| 784 | Ga0373939_0110456 | 3300035114 | Bacteria | 957 |
| 785 | Ga0373945_0081893 | 3300035116 | Bacteria | 1238 |
| 786 | Ga0373953_0096997 | 3300035117 | Bacteria | 1238 |
| 787 | Ga0373957_0025593 | 3300035120 | Bacteria | 2128 |
| 788 | Ga0373960_0066137 | 3300035121 | Bacteria | 1107 |
| 789 | Ga0373943_0381469 | 3300035170 | Bacteria | 812 |
| 790 | Ga0373946_0134604 | 3300035171 | Unclassified | 1140 |
| 791 | Ga0373955_0150885 | 3300035172 | Bacteria | 1368 |
| 792 | Ga0373961_0012064 | 3300035241 | Bacteria | 2156 |
| 793 | Ga0373931_0075470 | 3300035691 | Bacteria | 1849 |
| 794 | Ga0373927_0041304 | 3300035695 | Bacteria | 2992 |
| 795 | Ga0373937_0033053 | 3300036401 | Bacteria | 4695 |
| 796 | Ga0373925_1467844 | 3300037068 | Unclassified | 558 |
| 797 | Ga0395900_0146643 | 3300037418 | Bacteria | 2413 |
| 798 | Ga0395900_0361380 | 3300037418 | Bacteria | 1423 |
| 799 | Ga0395898_0228371 | 3300037466 | Bacteria | 1775 |
| 800 | Ga0395905_0733702 | 3300037471 | Bacteria | 890 |
| 801 | Ga0395905_0977154 | 3300037471 | Bacteria | 750 |
| 802 | Ga0436364_0347944 | 3300037853 | Bacteria | 1120 |
| 803 | Ga0395901_0016161 | 3300038443 | Bacteria | 7602 |
| 804 | Ga0242420_007801 | 3300038996 | Unclassified | 1726 |
| 805 | Ga0436365_0010487 | 3300039437 | Bacteria | 1678 |
| 806 | Ga0436361_0180955 | 3300039447 | Bacteria | 14534 |
| 807 | Ga0439441_038356 | 3300042001 | Bacteria | 952 |
| 808 | Ga0439455_0032706 | 3300042012 | Bacteria | 1301 |
| 809 | Ga0450905_023594 | 3300042142 | Bacteria | 919 |
| 810 | Ga0439458_0052104 | 3300042157 | Bacteria | 1011 |
| 811 | Ga0439464_0036832 | 3300042439 | Bacteria | 1385 |
| 812 | Ga0439460_0116503 | 3300042461 | Bacteria | 871 |
| 813 | Ga0451577_0004206 | 3300042876 | Bacteria | 15349 |
| 814 | Ga0451577_0141303 | 3300042876 | Bacteria | 2163 |
| 815 | Ga0451577_0181831 | 3300042876 | Bacteria | 1896 |
| 816 | Ga0451577_0213877 | 3300042876 | Bacteria | 1742 |
| 817 | Ga0453683_0063593 | 3300044673 | Bacteria | 2307 |
| 818 | Ga0453683_0458888 | 3300044673 | Bacteria | 824 |
| 819 | Ga0466964_0076773 | 3300044706 | Bacteria | 1425 |
| 820 | Ga0453684_0114034 | 3300044712 | Bacteria | 3277 |
| 821 | Ga0453684_0118670 | 3300044712 | Bacteria | 3199 |
| 822 | Ga0453684_0129133 | 3300044712 | Bacteria | 3035 |
| 823 | Ga0451576_0006062 | 3300045051 | Bacteria | 14919 |
| 824 | Ga0451576_0022358 | 3300045051 | Bacteria | 6858 |
| 825 | Ga0451576_0023475 | 3300045051 | Bacteria | 6677 |
| 826 | Ga0451576_0072590 | 3300045051 | Bacteria | 3581 |
| 827 | Ga0451576_0113317 | 3300045051 | Bacteria | 2823 |
| 828 | Ga0466958_0313827 | 3300045836 | Bacteria | 1007 |
| 829 | Ga0466958_0594032 | 3300045836 | Bacteria | 720 |
| 830 | Ga0466967_0007594 | 3300045976 | Bacteria | 7840 |
| 831 | Ga0495603_0010676 | 3300046455 | Bacteria | 5569 |
| 832 | Ga0495580_0032388 | 3300046472 | Bacteria | 3773 |
| 833 | Ga0495584_0263679 | 3300046491 | Bacteria | 876 |
| 834 | Ga0495621_0020372 | 3300046539 | Bacteria | 2176 |
| 835 | Ga0495633_0293237 | 3300046558 | Bacteria | 739 |
| 836 | Ga0495659_0260381 | 3300046664 | Bacteria | 725 |
| 837 | Ga0495647_0456153 | 3300046681 | Bacteria | 592 |
| 838 | Ga0495669_0041526 | 3300046684 | Bacteria | 2043 |
| 839 | Ga0495669_0319132 | 3300046684 | Bacteria | 750 |
| 840 | Ga0495636_0403132 | 3300047318 | Unclassified | 652 |
| 841 | Ga0495614_0093351 | 3300048089 | Bacteria | 1311 |
| 842 | Ga0496100_0010409 | 3300048903 | Bacteria | 5263 |
| 843 | Ga0496101_0025506 | 3300048904 | Bacteria | 4103 |
| 844 | Ga0496101_0612530 | 3300048904 | Unclassified | 861 |
| 845 | Ga0496102_0007253 | 3300048905 | Bacteria | 9463 |
| 846 | Ga0496102_0017659 | 3300048905 | Bacteria | 6252 |
| 847 | Ga0496102_0125550 | 3300048905 | Bacteria | 2398 |
| 848 | Ga0496102_1165984 | 3300048905 | Unclassified | 690 |
| 849 | Ga0496103_0034172 | 3300048906 | Bacteria | 3109 |
| 850 | Ga0496103_0633643 | 3300048906 | Unclassified | 680 |
| 851 | Ga0496104_0032530 | 3300048907 | Bacteria | 4855 |
| 852 | Ga0496104_1051436 | 3300048907 | Bacteria | 718 |
| 853 | Ga0496104_1206065 | 3300048907 | Unclassified | 660 |
| 854 | Ga0496105_0027850 | 3300048908 | Bacteria | 4620 |
| 855 | Ga0496105_0520203 | 3300048908 | Bacteria | 932 |
| 856 | Ga0496106_0011061 | 3300048909 | Bacteria | 6670 |
| 857 | Ga0496106_0020112 | 3300048909 | Bacteria | 4952 |
| 858 | Ga0496106_0331847 | 3300048909 | Bacteria | 1221 |
| 859 | Ga0496106_0552112 | 3300048909 | Unclassified | 924 |
| 860 | Ga0496107_0000272 | 3300048910 | Bacteria | 27458 |
| 861 | Ga0496108_0005015 | 3300048911 | Bacteria | 10695 |
| 862 | Ga0496108_0058966 | 3300048911 | Bacteria | 3227 |
| 863 | Ga0496108_0259968 | 3300048911 | Unclassified | 1511 |
| 864 | Ga0496108_0869702 | 3300048911 | Bacteria | 775 |
| 865 | Ga0496109_0006657 | 3300048912 | Bacteria | 9729 |
| 866 | Ga0496109_0046471 | 3300048912 | Bacteria | 3943 |
| 867 | Ga0496109_0297332 | 3300048912 | Unclassified | 1522 |
| 868 | Ga0496110_0053145 | 3300048913 | Bacteria | 3560 |
| 869 | Ga0496110_0087087 | 3300048913 | Bacteria | 2789 |
| 870 | Ga0496110_0424644 | 3300048913 | Bacteria | 1212 |
| 871 | Ga0496110_0681096 | 3300048913 | Bacteria | 929 |
| 872 | Ga0496111_0120130 | 3300048914 | Bacteria | 1941 |
| 873 | Ga0496111_0129251 | 3300048914 | Bacteria | 1868 |
| 874 | Ga0496111_0157848 | 3300048914 | Bacteria | 1683 |
| 875 | Ga0496112_0002079 | 3300048915 | Bacteria | 15874 |
| 876 | Ga0496112_0017849 | 3300048915 | Bacteria | 6678 |
| 877 | Ga0496112_0094577 | 3300048915 | Bacteria | 2959 |
| 878 | Ga0496112_0127831 | 3300048915 | Bacteria | 2512 |
| 879 | Ga0496114_0034583 | 3300048917 | Bacteria | 4170 |
| 880 | Ga0496114_0645144 | 3300048917 | Unclassified | 931 |
| 881 | Ga0496115_0049745 | 3300048918 | Bacteria | 3356 |
| 882 | Ga0496126_0225961 | 3300048929 | Bacteria | 1570 |
| 883 | Ga0501031_0261706 | 3300049568 | Bacteria | 1124 |
| 884 | Ga0501031_0402856 | 3300049568 | Unclassified | 885 |
| 885 | Ga0501032_0078429 | 3300049569 | Bacteria | 2199 |
| 886 | Ga0501033_0093095 | 3300049570 | Bacteria | 2204 |
| 887 | Ga0501033_0200147 | 3300049570 | Bacteria | 1427 |
| 888 | Ga0501033_0435360 | 3300049570 | Bacteria | 912 |
| 889 | Ga0501034_0001247 | 3300049571 | Bacteria | 34598 |
| 890 | Ga0501034_0355476 | 3300049571 | Bacteria | 1393 |
| 891 | Ga0501034_0364455 | 3300049571 | Bacteria | 1372 |
| 892 | Ga0501036_0049952 | 3300049572 | Bacteria | 3543 |
| 893 | Ga0501036_0177814 | 3300049572 | Bacteria | 1792 |
| 894 | Ga0501036_0229255 | 3300049572 | Bacteria | 1559 |
| 895 | Ga0501036_1338677 | 3300049572 | Bacteria | 581 |
| 896 | Ga0501036_1463159 | 3300049572 | Bacteria | 553 |
| 897 | Ga0501037_0203868 | 3300049573 | Bacteria | 1397 |
| 898 | Ga0501038_0113920 | 3300049574 | Bacteria | 2237 |
| 899 | Ga0501038_0991828 | 3300049574 | Unclassified | 617 |
| 900 | Ga0501039_0115578 | 3300049575 | Bacteria | 2100 |
| 901 | Ga0501039_0155044 | 3300049575 | Bacteria | 1799 |
| 902 | Ga0501039_0197414 | 3300049575 | Bacteria | 1582 |
| 903 | Ga0501039_0550539 | 3300049575 | Bacteria | 905 |
| 904 | Ga0501040_0022018 | 3300049576 | Bacteria | 4262 |
| 905 | Ga0501040_0025494 | 3300049576 | Bacteria | 3975 |
| 906 | Ga0501040_0160656 | 3300049576 | Bacteria | 1588 |
| 907 | Ga0501040_0310488 | 3300049576 | Bacteria | 1127 |
| 908 | Ga0501041_0007834 | 3300049577 | Bacteria | 6276 |
| 909 | Ga0501041_0035756 | 3300049577 | Bacteria | 3010 |
| 910 | Ga0501041_0537460 | 3300049577 | Bacteria | 744 |
| 911 | Ga0501041_0602198 | 3300049577 | Bacteria | 701 |
| 912 | Ga0501042_0004444 | 3300049578 | Bacteria | 8943 |
| 913 | Ga0501042_0021696 | 3300049578 | Bacteria | 4478 |
| 914 | Ga0501042_0074858 | 3300049578 | Bacteria | 2423 |
| 915 | Ga0501043_0079429 | 3300049579 | Bacteria | 2578 |
| 916 | Ga0501043_0132021 | 3300049579 | Bacteria | 1957 |
| 917 | Ga0501043_0221325 | 3300049579 | Bacteria | 1464 |
| 918 | Ga0501046_0009589 | 3300049580 | Bacteria | 8353 |
| 919 | Ga0501046_0018263 | 3300049580 | Bacteria | 5838 |
| 920 | Ga0501046_0077004 | 3300049580 | Unclassified | 2583 |
| 921 | Ga0501046_0292500 | 3300049580 | Unclassified | 1191 |
| 922 | Ga0501047_0137098 | 3300049581 | Bacteria | 2327 |
| 923 | Ga0501048_0044521 | 3300049582 | Bacteria | 3173 |
| 924 | Ga0501048_0125699 | 3300049582 | Bacteria | 1813 |
| 925 | Ga0501048_0174247 | 3300049582 | Bacteria | 1524 |
| 926 | Ga0501048_0209057 | 3300049582 | Bacteria | 1384 |
| 927 | Ga0501067_0003432 | 3300049583 | Bacteria | 8721 |
| 928 | Ga0501068_0026139 | 3300049584 | Bacteria | 3438 |
| 929 | Ga0501068_0158963 | 3300049584 | Bacteria | 1424 |
| 930 | Ga0501069_0029079 | 3300049585 | Bacteria | 3032 |
| 931 | Ga0501069_0088242 | 3300049585 | Bacteria | 1752 |
| 932 | Ga0501069_0239738 | 3300049585 | Bacteria | 1056 |
| 933 | Ga0501069_0401951 | 3300049585 | Bacteria | 811 |
| 934 | Ga0501070_0002665 | 3300049586 | Bacteria | 15579 |
| 935 | Ga0501070_0039669 | 3300049586 | Bacteria | 3926 |
| 936 | Ga0501070_0055099 | 3300049586 | Bacteria | 3296 |
| 937 | Ga0501070_0693259 | 3300049586 | Bacteria | 806 |
| 938 | Ga0501071_0095044 | 3300049587 | Bacteria | 2193 |
| 939 | Ga0501071_0845715 | 3300049587 | Unclassified | 706 |
| 940 | Ga0501072_0042136 | 3300049588 | Bacteria | 3586 |
| 941 | Ga0501072_0049204 | 3300049588 | Bacteria | 3318 |
| 942 | Ga0501072_0113650 | 3300049588 | Bacteria | 2156 |
| 943 | Ga0501072_0167596 | 3300049588 | Bacteria | 1752 |
| 944 | Ga0501072_0173571 | 3300049588 | Bacteria | 1720 |
| 945 | Ga0501072_0252292 | 3300049588 | Bacteria | 1405 |
| 946 | Ga0501073_0498208 | 3300049589 | Bacteria | 842 |
| 947 | Ga0501074_0032485 | 3300049590 | Bacteria | 3781 |
| 948 | Ga0501074_0048711 | 3300049590 | Unclassified | 3061 |
| 949 | Ga0501074_0150830 | 3300049590 | Bacteria | 1662 |
| 950 | Ga0501075_0005480 | 3300049591 | Bacteria | 8679 |
| 951 | Ga0501075_0030585 | 3300049591 | Bacteria | 3989 |
| 952 | Ga0501075_0051837 | 3300049591 | Bacteria | 3086 |
| 953 | Ga0501075_0086117 | 3300049591 | Bacteria | 2380 |
| 954 | Ga0501075_0092151 | 3300049591 | Bacteria | 2300 |
| 955 | Ga0501075_0140854 | 3300049591 | Bacteria | 1838 |
| 956 | Ga0501075_0207093 | 3300049591 | Bacteria | 1496 |
| 957 | Ga0501075_0631854 | 3300049591 | Bacteria | 816 |
| 958 | Ga0501076_0010476 | 3300049592 | Bacteria | 6881 |
| 959 | Ga0501076_0027554 | 3300049592 | Bacteria | 4406 |
| 960 | Ga0501076_0043398 | 3300049592 | Bacteria | 3543 |
| 961 | Ga0501076_0051062 | 3300049592 | Bacteria | 3272 |
| 962 | Ga0501076_0070246 | 3300049592 | Bacteria | 2799 |
| 963 | Ga0501076_0230790 | 3300049592 | Bacteria | 1513 |
| 964 | Ga0501077_0008603 | 3300049593 | Bacteria | 6330 |
| 965 | Ga0501077_0013393 | 3300049593 | Bacteria | 5143 |
| 966 | Ga0501077_0030299 | 3300049593 | Bacteria | 3443 |
| 967 | Ga0501077_0054330 | 3300049593 | Bacteria | 2544 |
| 968 | Ga0501077_0075869 | 3300049593 | Bacteria | 2129 |
| 969 | Ga0501077_0226240 | 3300049593 | Bacteria | 1189 |
| 970 | Ga0501079_0000663 | 3300049741 | Bacteria | 23038 |
| 971 | Ga0501079_0017738 | 3300049741 | Bacteria | 5438 |
| 972 | Ga0501079_0022716 | 3300049741 | Bacteria | 4813 |
| 973 | Ga0501079_0073043 | 3300049741 | Bacteria | 2651 |
| 974 | Ga0501079_0201948 | 3300049741 | Bacteria | 1553 |
| 975 | Ga0501080_0078245 | 3300049742 | Bacteria | 3076 |
| 976 | Ga0501080_0344192 | 3300049742 | Bacteria | 1347 |
| 977 | Ga0501080_0379319 | 3300049742 | Bacteria | 1274 |
| 978 | Ga0501080_0496364 | 3300049742 | Unclassified | 1091 |
| 979 | Ga0501080_0601530 | 3300049742 | Bacteria | 976 |
| 980 | Ga0501080_0625352 | 3300049742 | Unclassified | 954 |
| 981 | Ga0501081_0002102 | 3300049743 | Bacteria | 12447 |
| 982 | Ga0501081_0006548 | 3300049743 | Bacteria | 7569 |
| 983 | Ga0501081_0010781 | 3300049743 | Bacteria | 5968 |
| 984 | Ga0501081_0016390 | 3300049743 | Bacteria | 4898 |
| 985 | Ga0501081_0110605 | 3300049743 | Bacteria | 1949 |
| 986 | Ga0501081_0129670 | 3300049743 | Bacteria | 1801 |
| 987 | Ga0501081_0584595 | 3300049743 | Unclassified | 835 |
| 988 | Ga0501083_0062789 | 3300049744 | Bacteria | 2478 |
| 989 | Ga0501035_0004131 | 3300049822 | Bacteria | 13799 |
| 990 | Ga0501035_1422043 | 3300049822 | Bacteria | 531 |
| 991 | Ga0501044_0017975 | 3300049823 | Bacteria | 7580 |
| 992 | Ga0501044_0203182 | 3300049823 | Bacteria | 1939 |
| 993 | Ga0501044_0606121 | 3300049823 | Bacteria | 988 |
| 994 | Ga0501045_0010792 | 3300049824 | Bacteria | 6402 |
| 995 | Ga0501045_0183676 | 3300049824 | Bacteria | 1558 |
| 996 | Ga0501045_0309621 | 3300049824 | Bacteria | 1175 |
| 997 | Ga0501045_0423676 | 3300049824 | Unclassified | 990 |
| 998 | Ga0501045_0490471 | 3300049824 | Bacteria | 912 |
| 999 | nmdc:mga00v17_14189_c1 | 3300050491 | Bacteria | 4441 |
| 1000 | nmdc:mga0yw44_14604_c1 | 3300050492 | Bacteria | 4176 |
| 1001 | nmdc:mga05p37_146056_c1 | 3300050507 | Bacteria | 2896 |
| 1002 | nmdc:mga05p37_148953_c1 | 3300050507 | Unclassified | 2864 |
| 1003 | nmdc:mga05p37_1552193_c1 | 3300050507 | Unclassified | 656 |
| 1004 | nmdc:mga05p37_44130_c1 | 3300050507 | Bacteria | 5485 |
| 1005 | nmdc:mga05p37_500358_c1 | 3300050507 | Bacteria | 1395 |
| 1006 | nmdc:mga05p37_707721_c1 | 3300050507 | Bacteria | 1118 |
| 1007 | nmdc:mga05p37_86942_c1 | 3300050507 | Bacteria | 1439 |
| 1008 | nmdc:mga09592_1722_c1 | 3300050508 | Bacteria | 17611 |
| 1009 | nmdc:mga09592_268500_c1 | 3300050508 | Bacteria | 1480 |
| 1010 | nmdc:mga09592_37825_c1 | 3300050508 | Bacteria | 4049 |
| 1011 | nmdc:mga09592_606819_c1 | 3300050508 | Bacteria | 937 |
| 1012 | nmdc:mga0qj67_228308_c1 | 3300050509 | Bacteria | 1511 |
| 1013 | nmdc:mga0qj67_31634_c1 | 3300050509 | Bacteria | 4123 |
| 1014 | nmdc:mga0qj67_896498_c1 | 3300050509 | Unclassified | 699 |
| 1015 | nmdc:mga06r32_100395_c2 | 3300050510 | Bacteria | 2198 |
| 1016 | nmdc:mga06r32_154117_c1 | 3300050510 | Bacteria | 2277 |
| 1017 | nmdc:mga06r32_294241_c1 | 3300050510 | Unclassified | 1610 |
| 1018 | nmdc:mga06r32_361246_c1 | 3300050510 | Unclassified | 1436 |
| 1019 | nmdc:mga06r32_3966_c1 | 3300050510 | Bacteria | 13267 |
| 1020 | nmdc:mga06r32_42070_c1 | 3300050510 | Bacteria | 4343 |
| 1021 | nmdc:mga06r32_52644_c1 | 3300050510 | Unclassified | 3899 |
| 1022 | nmdc:mga08y16_129884_c1 | 3300050511 | Bacteria | 2621 |
| 1023 | nmdc:mga08y16_13167_c1 | 3300050511 | Bacteria | 8700 |
| 1024 | nmdc:mga08y16_18487_c1 | 3300050511 | Bacteria | 7343 |
| 1025 | nmdc:mga0n895_10798_c1 | 3300050512 | Bacteria | 8103 |
| 1026 | nmdc:mga0n895_18719_c1 | 3300050512 | Bacteria | 6417 |
| 1027 | nmdc:mga0n895_23631_c1 | 3300050512 | Bacteria | 5781 |
| 1028 | nmdc:mga0n895_23956_c1 | 3300050512 | Bacteria | 5746 |
| 1029 | nmdc:mga0n895_49270_c1 | 3300050512 | Bacteria | 4126 |
| 1030 | nmdc:mga0n895_943816_c1 | 3300050512 | Unclassified | 846 |
| 1031 | nmdc:mga0rr50_238845_c1 | 3300050513 | Bacteria | 1506 |
| 1032 | nmdc:mga0rr50_30044_c1 | 3300050513 | Bacteria | 3842 |
| 1033 | nmdc:mga0rr50_60240_c1 | 3300050513 | Bacteria | 2855 |
| 1034 | nmdc:mga08x19_128108_c1 | 3300050514 | Bacteria | 1706 |
| 1035 | nmdc:mga08x19_2610_c1 | 3300050514 | Bacteria | 10933 |
| 1036 | nmdc:mga08x19_309252_c1 | 3300050514 | Bacteria | 1098 |
| 1037 | nmdc:mga08x19_46300_c1 | 3300050514 | Bacteria | 2781 |
| 1038 | nmdc:mga08x19_77155_c1 | 3300050514 | Bacteria | 2182 |
| 1039 | nmdc:mga08x19_85137_c1 | 3300050514 | Bacteria | 2080 |
| 1040 | nmdc:mga0a205_10327_c1 | 3300050515 | Bacteria | 8582 |
| 1041 | nmdc:mga0a205_11833_c1 | 3300050515 | Bacteria | 8053 |
| 1042 | nmdc:mga0a205_30942_c1 | 3300050515 | Bacteria | 5127 |
| 1043 | nmdc:mga0a205_366378_c1 | 3300050515 | Bacteria | 1307 |
| 1044 | nmdc:mga0a205_4199_c1 | 3300050515 | Bacteria | 12917 |
| 1045 | nmdc:mga0a205_68614_c1 | 3300050515 | Bacteria | 3424 |
| 1046 | Ga0495619_0107073 | 3300053085 | Bacteria | 1907 |
| 1047 | Ga0500572_097851 | 3300053111 | Bacteria | 936 |
| 1048 | Ga0500619_293598 | 3300053154 | Bacteria | 526 |
| 1049 | Ga0500657_163216 | 3300053728 | Bacteria | 804 |
| 1050 | Ga0500596_080236 | 3300053735 | Bacteria | 567 |
| 1051 | Ga0501084_0003622 | 3300054114 | Bacteria | 12547 |
| 1052 | Ga0501084_0005631 | 3300054114 | Bacteria | 10288 |
| 1053 | Ga0501084_0008407 | 3300054114 | Bacteria | 8527 |
| 1054 | Ga0501084_0069909 | 3300054114 | Bacteria | 2940 |
| 1055 | Ga0501084_0139897 | 3300054114 | Bacteria | 2038 |
| 1056 | Ga0501084_0394671 | 3300054114 | Bacteria | 1169 |
| 1057 | Ga0501084_0465679 | 3300054114 | Bacteria | 1068 |
| 1058 | Ga0501082_0029591 | 3300060353 | Bacteria | 4718 |
| 1059 | Ga0501082_0032846 | 3300060353 | Bacteria | 4476 |
| 1060 | Ga0501082_0036066 | 3300060353 | Bacteria | 4261 |
| 1061 | Ga0501082_0045047 | 3300060353 | Bacteria | 3804 |
| 1062 | Ga0501082_0201408 | 3300060353 | Bacteria | 1732 |
| 1063 | Ga0466962_0390531 | 3300061719 | Bacteria | 696 |
| 1064 | Ga0530510_0033749 | 3300061734 | Bacteria | 3684 |
| 1065 | Ga0530510_0056773 | 3300061734 | Bacteria | 2829 |
| 1066 | Ga0530510_0080189 | 3300061734 | Bacteria | 2375 |
| 1067 | Ga0530510_0224603 | 3300061734 | Bacteria | 1396 |
| 1068 | Ga0530510_0743898 | 3300061734 | Bacteria | 748 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006038 | Ga0075365_10015607 | Ga0075365_100156072 | 138 |
| 2 | 3300006844 | Ga0075428_100033229 | Ga0075428_1000332293 | 138 |
| 3 | 3300006846 | Ga0075430_100164931 | Ga0075430_1001649312 | 138 |
| 4 | 3300006847 | Ga0075431_100226808 | Ga0075431_1002268082 | 138 |
| 5 | 3300006880 | Ga0075429_100222627 | Ga0075429_1002226272 | 138 |
| 6 | 3300050491 | nmdc:mga00v17_14189_c1 | nmdc:mga00v17_14189_c1_2183_2719 | 138 |
| 7 | 3300050492 | nmdc:mga0yw44_14604_c1 | nmdc:mga0yw44_14604_c1_861_1397 | 138 |
| 8 | 3300050510 | nmdc:mga06r32_100395_c2 | nmdc:mga06r32_100395_c2_361_897 | 138 |
| 9 | 3300009147 | Ga0114129_10298158 | Ga0114129_102981582 | 139 |
| 10 | 3300050507 | nmdc:mga05p37_146056_c1 | nmdc:mga05p37_146056_c1_751_1281 | 139 |
| 11 | 3300049572 | Ga0501036_1463159 | Ga0501036_1463159_91_528 | 142 |
| 12 | 3300049586 | Ga0501070_0693259 | Ga0501070_0693259_66_503 | 142 |
| 13 | 3300049589 | Ga0501073_0498208 | Ga0501073_0498208_346_783 | 142 |
| 14 | 3300060353 | Ga0501082_0029591 | Ga0501082_0029591_4251_4688 | 142 |
| 15 | 3300006846 | Ga0075430_100284047 | Ga0075430_1002840473 | 143 |
| 16 | 3300006847 | Ga0075431_100008102 | Ga0075431_1000081024 | 143 |
| 17 | 3300042461 | Ga0439460_0116503 | Ga0439460_0116503_168_692 | 143 |
| 18 | 3300050509 | nmdc:mga0qj67_896498_c1 | nmdc:mga0qj67_896498_c1_108_629 | 143 |
| 19 | 3300050510 | nmdc:mga06r32_3966_c1 | nmdc:mga06r32_3966_c1_41_562 | 143 |
| 20 | 3300049572 | Ga0501036_1338677 | Ga0501036_1338677_15_452 | 145 |
| 21 | 3300049822 | Ga0501035_1422043 | Ga0501035_1422043_14_451 | 145 |
| 22 | 3300049824 | Ga0501045_0490471 | Ga0501045_0490471_10_447 | 145 |
| 23 | 3300005937 | Ga0081455_10092443 | Ga0081455_100924432 | 146 |
| 24 | 3300046684 | Ga0495669_0319132 | Ga0495669_0319132_33_536 | 146 |
| 25 | 3300049592 | Ga0501076_0051062 | Ga0501076_0051062_207_710 | 146 |
| 26 | 3300049741 | Ga0501079_0022716 | Ga0501079_0022716_2836_3339 | 146 |
| 27 | 3300005981 | Ga0081538_10003462 | Ga0081538_1000346213 | 150 |
| 28 | 3300049577 | Ga0501041_0602198 | Ga0501041_0602198_13_480 | 152 |
| 29 | 3300005339 | Ga0070660_100386210 | Ga0070660_1003862102 | 154 |
| 30 | 3300006847 | Ga0075431_100268718 | Ga0075431_1002687183 | 154 |
| 31 | 3300025919 | Ga0207657_10198589 | Ga0207657_101985893 | 154 |
| 32 | 3300050510 | nmdc:mga06r32_294241_c1 | nmdc:mga06r32_294241_c1_463_978 | 154 |
| 33 | 3300049572 | Ga0501036_0177814 | Ga0501036_0177814_543_1046 | 155 |
| 34 | 3300049573 | Ga0501037_0203868 | Ga0501037_0203868_545_1048 | 155 |
| 35 | 3300049576 | Ga0501040_0160656 | Ga0501040_0160656_1042_1545 | 155 |
| 36 | 3300049577 | Ga0501041_0537460 | Ga0501041_0537460_30_533 | 155 |
| 37 | 3300049580 | Ga0501046_0077004 | Ga0501046_0077004_1926_2429 | 155 |
| 38 | 3300049582 | Ga0501048_0174247 | Ga0501048_0174247_447_950 | 155 |
| 39 | 3300049591 | Ga0501075_0030585 | Ga0501075_0030585_658_1161 | 155 |
| 40 | 3300049593 | Ga0501077_0013393 | Ga0501077_0013393_2857_3360 | 155 |
| 41 | 3300049743 | Ga0501081_0010781 | Ga0501081_0010781_2455_2958 | 155 |
| 42 | 3300049824 | Ga0501045_0183676 | Ga0501045_0183676_667_1170 | 155 |
| 43 | 3300054114 | Ga0501084_0003622 | Ga0501084_0003622_5139_5642 | 155 |
| 44 | 3300060353 | Ga0501082_0032846 | Ga0501082_0032846_922_1425 | 155 |
| 45 | 3300061734 | Ga0530510_0056773 | Ga0530510_0056773_1651_2154 | 155 |
| 46 | 3300031249 | Ga0265339_10001605 | Ga0265339_1000160513 | 156 |
| 47 | 3300031595 | Ga0265313_10002595 | Ga0265313_1000259513 | 156 |
| 48 | 3300031712 | Ga0265342_10170364 | Ga0265342_101703642 | 156 |
| 49 | 3300032002 | Ga0307416_100878028 | Ga0307416_1008780281 | 156 |
| 50 | 3300032126 | Ga0307415_100473468 | Ga0307415_1004734682 | 156 |
| 51 | 3300031548 | Ga0307408_100068463 | Ga0307408_1000684633 | 157 |
| 52 | 3300049569 | Ga0501032_0078429 | Ga0501032_0078429_830_1381 | 159 |
| 53 | 3300049571 | Ga0501034_0364455 | Ga0501034_0364455_694_1245 | 159 |
| 54 | 3300049579 | Ga0501043_0132021 | Ga0501043_0132021_627_1178 | 159 |
| 55 | 3300049586 | Ga0501070_0039669 | Ga0501070_0039669_1378_1929 | 159 |
| 56 | 3300049742 | Ga0501080_0078245 | Ga0501080_0078245_342_893 | 159 |
| 57 | 3300049823 | Ga0501044_0017975 | Ga0501044_0017975_4034_4585 | 159 |
| 58 | 3300045836 | Ga0466958_0313827 | Ga0466958_0313827_412_942 | 160 |
| 59 | 3300049571 | Ga0501034_0355476 | Ga0501034_0355476_196_729 | 160 |
| 60 | 3300053154 | Ga0500619_293598 | Ga0500619_293598_25_507 | 160 |
| 61 | 3300053735 | Ga0500596_080236 | Ga0500596_080236_71_553 | 160 |
| 62 | 3300005330 | Ga0070690_100071123 | Ga0070690_1000711232 | 161 |
| 63 | 3300005331 | Ga0070670_100008422 | Ga0070670_1000084229 | 161 |
| 64 | 3300005334 | Ga0068869_100000633 | Ga0068869_10000063315 | 161 |
| 65 | 3300005336 | Ga0070680_100002607 | Ga0070680_1000026076 | 161 |
| 66 | 3300005337 | Ga0070682_100000209 | Ga0070682_10000020935 | 161 |
| 67 | 3300005338 | Ga0068868_100264744 | Ga0068868_1002647442 | 161 |
| 68 | 3300005339 | Ga0070660_100000889 | Ga0070660_10000088915 | 161 |
| 69 | 3300005340 | Ga0070689_100039663 | Ga0070689_1000396632 | 161 |
| 70 | 3300005341 | Ga0070691_10013614 | Ga0070691_100136142 | 161 |
| 71 | 3300005343 | Ga0070687_100057605 | Ga0070687_1000576053 | 161 |
| 72 | 3300005344 | Ga0070661_100001130 | Ga0070661_10000113014 | 161 |
| 73 | 3300005347 | Ga0070668_100524225 | Ga0070668_1005242251 | 161 |
| 74 | 3300005353 | Ga0070669_100046924 | Ga0070669_1000469243 | 161 |
| 75 | 3300005354 | Ga0070675_100224738 | Ga0070675_1002247382 | 161 |
| 76 | 3300005364 | Ga0070673_100020192 | Ga0070673_1000201926 | 161 |
| 77 | 3300005366 | Ga0070659_100001542 | Ga0070659_10000154213 | 161 |
| 78 | 3300005367 | Ga0070667_100903175 | Ga0070667_1009031751 | 161 |
| 79 | 3300005406 | Ga0070703_10003177 | Ga0070703_100031773 | 161 |
| 80 | 3300005438 | Ga0070701_10198902 | Ga0070701_101989022 | 161 |
| 81 | 3300005440 | Ga0070705_100001521 | Ga0070705_1000015217 | 161 |
| 82 | 3300005444 | Ga0070694_100007217 | Ga0070694_1000072173 | 161 |
| 83 | 3300005455 | Ga0070663_100003280 | Ga0070663_1000032805 | 161 |
| 84 | 3300005457 | Ga0070662_100007409 | Ga0070662_1000074098 | 161 |
| 85 | 3300005459 | Ga0068867_100003313 | Ga0068867_1000033139 | 161 |
| 86 | 3300005530 | Ga0070679_100008557 | Ga0070679_1000085576 | 161 |
| 87 | 3300005535 | Ga0070684_100184876 | Ga0070684_1001848763 | 161 |
| 88 | 3300005539 | Ga0068853_100000779 | Ga0068853_10000077910 | 161 |
| 89 | 3300005543 | Ga0070672_100288367 | Ga0070672_1002883672 | 161 |
| 90 | 3300005544 | Ga0070686_101027010 | Ga0070686_1010270101 | 161 |
| 91 | 3300005545 | Ga0070695_100006122 | Ga0070695_1000061226 | 161 |
| 92 | 3300005546 | Ga0070696_100001788 | Ga0070696_10000178815 | 161 |
| 93 | 3300005547 | Ga0070693_100003967 | Ga0070693_1000039674 | 161 |
| 94 | 3300005549 | Ga0070704_100003393 | Ga0070704_1000033937 | 161 |
| 95 | 3300005563 | Ga0068855_100006496 | Ga0068855_10000649613 | 161 |
| 96 | 3300005564 | Ga0070664_100001830 | Ga0070664_10000183013 | 161 |
| 97 | 3300005577 | Ga0068857_100012218 | Ga0068857_1000122185 | 161 |
| 98 | 3300005578 | Ga0068854_100000604 | Ga0068854_10000060416 | 161 |
| 99 | 3300005614 | Ga0068856_100000353 | Ga0068856_10000035338 | 161 |
| 100 | 3300005615 | Ga0070702_100015693 | Ga0070702_1000156934 | 161 |
| 101 | 3300005616 | Ga0068852_100421758 | Ga0068852_1004217582 | 161 |
| 102 | 3300005617 | Ga0068859_100012248 | Ga0068859_1000122488 | 161 |
| 103 | 3300005618 | Ga0068864_100014561 | Ga0068864_1000145613 | 161 |
| 104 | 3300005718 | Ga0068866_10242238 | Ga0068866_102422382 | 161 |
| 105 | 3300005719 | Ga0068861_100001021 | Ga0068861_10000102122 | 161 |
| 106 | 3300005840 | Ga0068870_10000325 | Ga0068870_1000032510 | 161 |
| 107 | 3300005843 | Ga0068860_100206727 | Ga0068860_1002067271 | 161 |
| 108 | 3300005844 | Ga0068862_100001824 | Ga0068862_1000018241 | 161 |
| 109 | 3300006237 | Ga0097621_100563292 | Ga0097621_1005632922 | 161 |
| 110 | 3300006847 | Ga0075431_100767044 | Ga0075431_1007670441 | 161 |
| 111 | 3300006871 | Ga0075434_100081019 | Ga0075434_1000810192 | 161 |
| 112 | 3300006914 | Ga0075436_100009591 | Ga0075436_1000095917 | 161 |
| 113 | 3300006931 | Ga0097620_100012249 | Ga0097620_1000122493 | 161 |
| 114 | 3300007076 | Ga0075435_100069915 | Ga0075435_1000699152 | 161 |
| 115 | 3300009147 | Ga0114129_10585945 | Ga0114129_105859451 | 161 |
| 116 | 3300009174 | Ga0105241_10000214 | Ga0105241_1000021444 | 161 |
| 117 | 3300011119 | Ga0105246_11291555 | Ga0105246_112915551 | 161 |
| 118 | 3300013100 | Ga0157373_10003556 | Ga0157373_100035568 | 161 |
| 119 | 3300013102 | Ga0157371_10036153 | Ga0157371_100361533 | 161 |
| 120 | 3300013105 | Ga0157369_10018175 | Ga0157369_100181758 | 161 |
| 121 | 3300013307 | Ga0157372_10000063 | Ga0157372_1000006344 | 161 |
| 122 | 3300013308 | Ga0157375_10025278 | Ga0157375_100252785 | 161 |
| 123 | 3300014325 | Ga0163163_10030635 | Ga0163163_100306353 | 161 |
| 124 | 3300015262 | Ga0182007_10070690 | Ga0182007_100706902 | 161 |
| 125 | 3300025885 | Ga0207653_10005718 | Ga0207653_100057183 | 161 |
| 126 | 3300025901 | Ga0207688_10007982 | Ga0207688_100079824 | 161 |
| 127 | 3300025904 | Ga0207647_10086553 | Ga0207647_100865532 | 161 |
| 128 | 3300025907 | Ga0207645_10002500 | Ga0207645_100025009 | 161 |
| 129 | 3300025908 | Ga0207643_10001502 | Ga0207643_100015028 | 161 |
| 130 | 3300025911 | Ga0207654_10028499 | Ga0207654_100284993 | 161 |
| 131 | 3300025912 | Ga0207707_10000429 | Ga0207707_1000042944 | 161 |
| 132 | 3300025917 | Ga0207660_10000191 | Ga0207660_100001918 | 161 |
| 133 | 3300025918 | Ga0207662_10062534 | Ga0207662_100625344 | 161 |
| 134 | 3300025919 | Ga0207657_10000075 | Ga0207657_1000007561 | 161 |
| 135 | 3300025920 | Ga0207649_10004639 | Ga0207649_100046397 | 161 |
| 136 | 3300025921 | Ga0207652_10000511 | Ga0207652_1000051145 | 161 |
| 137 | 3300025923 | Ga0207681_10459190 | Ga0207681_104591902 | 161 |
| 138 | 3300025925 | Ga0207650_10004666 | Ga0207650_100046662 | 161 |
| 139 | 3300025932 | Ga0207690_10001528 | Ga0207690_100015289 | 161 |
| 140 | 3300025933 | Ga0207706_10014942 | Ga0207706_100149428 | 161 |
| 141 | 3300025936 | Ga0207670_10719440 | Ga0207670_107194401 | 161 |
| 142 | 3300025940 | Ga0207691_10200838 | Ga0207691_102008382 | 161 |
| 143 | 3300025942 | Ga0207689_10000765 | Ga0207689_1000076529 | 161 |
| 144 | 3300025944 | Ga0207661_11202417 | Ga0207661_112024171 | 161 |
| 145 | 3300025945 | Ga0207679_10000932 | Ga0207679_100009328 | 161 |
| 146 | 3300025949 | Ga0207667_10004119 | Ga0207667_1000411916 | 161 |
| 147 | 3300025960 | Ga0207651_10075662 | Ga0207651_100756623 | 161 |
| 148 | 3300025972 | Ga0207668_10706775 | Ga0207668_107067752 | 161 |
| 149 | 3300025981 | Ga0207640_10002253 | Ga0207640_1000225311 | 161 |
| 150 | 3300025986 | Ga0207658_10817705 | Ga0207658_108177051 | 161 |
| 151 | 3300026023 | Ga0207677_10024810 | Ga0207677_100248102 | 161 |
| 152 | 3300026041 | Ga0207639_10000841 | Ga0207639_1000084115 | 161 |
| 153 | 3300026067 | Ga0207678_10008011 | Ga0207678_100080116 | 161 |
| 154 | 3300026075 | Ga0207708_10139414 | Ga0207708_101394143 | 161 |
| 155 | 3300026078 | Ga0207702_10001971 | Ga0207702_1000197114 | 161 |
| 156 | 3300026089 | Ga0207648_10021411 | Ga0207648_100214113 | 161 |
| 157 | 3300026095 | Ga0207676_10013574 | Ga0207676_100135742 | 161 |
| 158 | 3300026116 | Ga0207674_10008066 | Ga0207674_100080667 | 161 |
| 159 | 3300026118 | Ga0207675_100000630 | Ga0207675_10000063035 | 161 |
| 160 | 3300028380 | Ga0268265_10195912 | Ga0268265_101959121 | 161 |
| 161 | 3300028381 | Ga0268264_10018459 | Ga0268264_100184597 | 161 |
| 162 | 3300031995 | Ga0307409_100588622 | Ga0307409_1005886222 | 161 |
| 163 | 3300034817 | Ga0373948_0014536 | Ga0373948_0014536_850_1371 | 161 |
| 164 | 3300034819 | Ga0373958_0073829 | Ga0373958_0073829_227_748 | 161 |
| 165 | 3300035091 | Ga0373951_0002679 | Ga0373951_0002679_478_999 | 161 |
| 166 | 3300035121 | Ga0373960_0066137 | Ga0373960_0066137_227_748 | 161 |
| 167 | 3300035241 | Ga0373961_0012064 | Ga0373961_0012064_191_712 | 161 |
| 168 | 3300035691 | Ga0373931_0075470 | Ga0373931_0075470_645_1166 | 161 |
| 169 | 3300042012 | Ga0439455_0032706 | Ga0439455_0032706_233_754 | 161 |
| 170 | 3300042157 | Ga0439458_0052104 | Ga0439458_0052104_250_771 | 161 |
| 171 | 3300042876 | Ga0451577_0141303 | Ga0451577_0141303_280_801 | 161 |
| 172 | 3300044712 | Ga0453684_0129133 | Ga0453684_0129133_1152_1673 | 161 |
| 173 | 3300045051 | Ga0451576_0006062 | Ga0451576_0006062_12114_12635 | 161 |
| 174 | 3300048905 | Ga0496102_0007253 | Ga0496102_0007253_1108_1629 | 161 |
| 175 | 3300048915 | Ga0496112_0127831 | Ga0496112_0127831_14_535 | 161 |
| 176 | 3300050507 | nmdc:mga05p37_86942_c1 | nmdc:mga05p37_86942_c1_27_548 | 161 |
| 177 | 3300050510 | nmdc:mga06r32_154117_c1 | nmdc:mga06r32_154117_c1_1580_2101 | 161 |
| 178 | 3300050512 | nmdc:mga0n895_49270_c1 | nmdc:mga0n895_49270_c1_1636_2157 | 161 |
| 179 | 3300050513 | nmdc:mga0rr50_238845_c1 | nmdc:mga0rr50_238845_c1_811_1332 | 161 |
| 180 | 3300050515 | nmdc:mga0a205_68614_c1 | nmdc:mga0a205_68614_c1_368_889 | 161 |
| 181 | 3300031852 | Ga0307410_10845312 | Ga0307410_108453122 | 163 |
| 182 | 3300032004 | Ga0307414_10740192 | Ga0307414_107401922 | 163 |
| 183 | 3300005536 | Ga0070697_100051472 | Ga0070697_1000514725 | 164 |
| 184 | 3300006880 | Ga0075429_100028268 | Ga0075429_1000282684 | 164 |
| 185 | 3300050507 | nmdc:mga05p37_148953_c1 | nmdc:mga05p37_148953_c1_700_1203 | 164 |
| 186 | 3300050508 | nmdc:mga09592_1722_c1 | nmdc:mga09592_1722_c1_12216_12719 | 164 |
| 187 | 3300050508 | nmdc:mga09592_268500_c1 | nmdc:mga09592_268500_c1_463_966 | 164 |
| 188 | 3300050509 | nmdc:mga0qj67_228308_c1 | nmdc:mga0qj67_228308_c1_665_1168 | 164 |
| 189 | 3300050509 | nmdc:mga0qj67_31634_c1 | nmdc:mga0qj67_31634_c1_3230_3733 | 164 |
| 190 | 3300050510 | nmdc:mga06r32_42070_c1 | nmdc:mga06r32_42070_c1_3442_3945 | 164 |
| 191 | 3300050510 | nmdc:mga06r32_52644_c1 | nmdc:mga06r32_52644_c1_1557_2060 | 164 |
| 192 | 3300005328 | Ga0070676_10139983 | Ga0070676_101399832 | 165 |
| 193 | 3300005330 | Ga0070690_100827243 | Ga0070690_1008272431 | 165 |
| 194 | 3300005338 | Ga0068868_100032409 | Ga0068868_1000324094 | 165 |
| 195 | 3300005355 | Ga0070671_100371028 | Ga0070671_1003710282 | 165 |
| 196 | 3300005364 | Ga0070673_100261209 | Ga0070673_1002612092 | 165 |
| 197 | 3300005367 | Ga0070667_100013482 | Ga0070667_1000134828 | 165 |
| 198 | 3300005456 | Ga0070678_100003443 | Ga0070678_1000034434 | 165 |
| 199 | 3300005459 | Ga0068867_100036868 | Ga0068867_1000368682 | 165 |
| 200 | 3300005543 | Ga0070672_100066527 | Ga0070672_1000665273 | 165 |
| 201 | 3300005548 | Ga0070665_100005305 | Ga0070665_10000530514 | 165 |
| 202 | 3300009553 | Ga0105249_10888467 | Ga0105249_108884671 | 165 |
| 203 | 3300014969 | Ga0157376_10017980 | Ga0157376_100179803 | 165 |
| 204 | 3300009147 | Ga0114129_10176906 | Ga0114129_101769063 | 166 |
| 205 | 3300025907 | Ga0207645_10145452 | Ga0207645_101454522 | 166 |
| 206 | 3300025931 | Ga0207644_10069954 | Ga0207644_100699543 | 166 |
| 207 | 3300025940 | Ga0207691_10089828 | Ga0207691_100898283 | 166 |
| 208 | 3300025986 | Ga0207658_10159504 | Ga0207658_101595043 | 166 |
| 209 | 3300026089 | Ga0207648_10161472 | Ga0207648_101614722 | 166 |
| 210 | 3300026121 | Ga0207683_10020012 | Ga0207683_100200127 | 166 |
| 211 | 3300028379 | Ga0268266_10124588 | Ga0268266_101245882 | 166 |
| 212 | 3300005336 | Ga0070680_100839583 | Ga0070680_1008395831 | 167 |
| 213 | 3300005434 | Ga0070709_10009566 | Ga0070709_100095663 | 167 |
| 214 | 3300005435 | Ga0070714_100114010 | Ga0070714_1001140104 | 167 |
| 215 | 3300005436 | Ga0070713_100039795 | Ga0070713_1000397952 | 167 |
| 216 | 3300005437 | Ga0070710_10087565 | Ga0070710_100875653 | 167 |
| 217 | 3300005439 | Ga0070711_100047490 | Ga0070711_1000474902 | 167 |
| 218 | 3300005518 | Ga0070699_100003652 | Ga0070699_10000365212 | 167 |
| 219 | 3300005530 | Ga0070679_100041482 | Ga0070679_1000414821 | 167 |
| 220 | 3300005546 | Ga0070696_100001696 | Ga0070696_10000169611 | 167 |
| 221 | 3300005563 | Ga0068855_101439633 | Ga0068855_1014396331 | 167 |
| 222 | 3300005842 | Ga0068858_100032627 | Ga0068858_1000326276 | 167 |
| 223 | 3300009101 | Ga0105247_10044278 | Ga0105247_100442783 | 167 |
| 224 | 3300013104 | Ga0157370_10008678 | Ga0157370_100086782 | 167 |
| 225 | 3300013307 | Ga0157372_10039295 | Ga0157372_100392953 | 167 |
| 226 | 3300014968 | Ga0157379_10005870 | Ga0157379_100058706 | 167 |
| 227 | 3300025898 | Ga0207692_10003191 | Ga0207692_100031914 | 167 |
| 228 | 3300025906 | Ga0207699_10002304 | Ga0207699_100023045 | 167 |
| 229 | 3300025912 | Ga0207707_10508745 | Ga0207707_105087452 | 167 |
| 230 | 3300025913 | Ga0207695_10018465 | Ga0207695_100184654 | 167 |
| 231 | 3300025916 | Ga0207663_10214823 | Ga0207663_102148232 | 167 |
| 232 | 3300025921 | Ga0207652_10052382 | Ga0207652_100523822 | 167 |
| 233 | 3300025928 | Ga0207700_10316617 | Ga0207700_103166172 | 167 |
| 234 | 3300025929 | Ga0207664_10072150 | Ga0207664_100721503 | 167 |
| 235 | 3300025949 | Ga0207667_10019734 | Ga0207667_100197348 | 167 |
| 236 | 3300028558 | Ga0265326_10030725 | Ga0265326_100307252 | 167 |
| 237 | 3300028653 | Ga0265323_10003068 | Ga0265323_100030686 | 167 |
| 238 | 3300028666 | Ga0265336_10000859 | Ga0265336_1000085917 | 167 |
| 239 | 3300028800 | Ga0265338_10000013 | Ga0265338_10000013374 | 167 |
| 240 | 3300029957 | Ga0265324_10038793 | Ga0265324_100387933 | 167 |
| 241 | 3300005440 | Ga0070705_100157765 | Ga0070705_1001577651 | 168 |
| 242 | 3300006871 | Ga0075434_100010644 | Ga0075434_1000106446 | 168 |
| 243 | 3300005336 | Ga0070680_100061476 | Ga0070680_1000614763 | 169 |
| 244 | 3300005341 | Ga0070691_10002304 | Ga0070691_100023047 | 169 |
| 245 | 3300005345 | Ga0070692_10026870 | Ga0070692_100268701 | 169 |
| 246 | 3300005406 | Ga0070703_10137759 | Ga0070703_101377592 | 169 |
| 247 | 3300005440 | Ga0070705_100074276 | Ga0070705_1000742763 | 169 |
| 248 | 3300005444 | Ga0070694_100269437 | Ga0070694_1002694372 | 169 |
| 249 | 3300005445 | Ga0070708_100459853 | Ga0070708_1004598532 | 169 |
| 250 | 3300005459 | Ga0068867_100013453 | Ga0068867_1000134536 | 169 |
| 251 | 3300005468 | Ga0070707_100249637 | Ga0070707_1002496372 | 169 |
| 252 | 3300005518 | Ga0070699_100011108 | Ga0070699_1000111083 | 169 |
| 253 | 3300005518 | Ga0070699_100011655 | Ga0070699_1000116558 | 169 |
| 254 | 3300005518 | Ga0070699_100522079 | Ga0070699_1005220792 | 169 |
| 255 | 3300005536 | Ga0070697_100014344 | Ga0070697_1000143443 | 169 |
| 256 | 3300005545 | Ga0070695_100071420 | Ga0070695_1000714203 | 169 |
| 257 | 3300005546 | Ga0070696_100054730 | Ga0070696_1000547302 | 169 |
| 258 | 3300005546 | Ga0070696_100084137 | Ga0070696_1000841373 | 169 |
| 259 | 3300005547 | Ga0070693_100544599 | Ga0070693_1005445992 | 169 |
| 260 | 3300005549 | Ga0070704_100217212 | Ga0070704_1002172122 | 169 |
| 261 | 3300005577 | Ga0068857_100493940 | Ga0068857_1004939402 | 169 |
| 262 | 3300005840 | Ga0068870_10033198 | Ga0068870_100331984 | 169 |
| 263 | 3300005844 | Ga0068862_100239584 | Ga0068862_1002395842 | 169 |
| 264 | 3300006173 | Ga0070716_100240703 | Ga0070716_1002407031 | 169 |
| 265 | 3300006844 | Ga0075428_100254200 | Ga0075428_1002542002 | 169 |
| 266 | 3300006846 | Ga0075430_100320676 | Ga0075430_1003206762 | 169 |
| 267 | 3300006852 | Ga0075433_10005680 | Ga0075433_100056809 | 169 |
| 268 | 3300006852 | Ga0075433_10118908 | Ga0075433_101189082 | 169 |
| 269 | 3300006871 | Ga0075434_100042224 | Ga0075434_1000422246 | 169 |
| 270 | 3300006880 | Ga0075429_100020558 | Ga0075429_1000205587 | 169 |
| 271 | 3300006914 | Ga0075436_100016340 | Ga0075436_1000163406 | 169 |
| 272 | 3300009094 | Ga0111539_10000623 | Ga0111539_1000062347 | 169 |
| 273 | 3300009094 | Ga0111539_10402846 | Ga0111539_104028462 | 169 |
| 274 | 3300009094 | Ga0111539_11502315 | Ga0111539_115023152 | 169 |
| 275 | 3300009147 | Ga0114129_10499665 | Ga0114129_104996653 | 169 |
| 276 | 3300009148 | Ga0105243_10173183 | Ga0105243_101731833 | 169 |
| 277 | 3300009174 | Ga0105241_10494390 | Ga0105241_104943902 | 169 |
| 278 | 3300009176 | Ga0105242_10059699 | Ga0105242_100596993 | 169 |
| 279 | 3300009553 | Ga0105249_10293761 | Ga0105249_102937613 | 169 |
| 280 | 3300013307 | Ga0157372_10169384 | Ga0157372_101693841 | 169 |
| 281 | 3300013307 | Ga0157372_10310763 | Ga0157372_103107633 | 169 |
| 282 | 3300025908 | Ga0207643_10009435 | Ga0207643_100094354 | 169 |
| 283 | 3300025910 | Ga0207684_11058135 | Ga0207684_110581351 | 169 |
| 284 | 3300025911 | Ga0207654_10643619 | Ga0207654_106436192 | 169 |
| 285 | 3300025917 | Ga0207660_10008619 | Ga0207660_100086197 | 169 |
| 286 | 3300025934 | Ga0207686_10047342 | Ga0207686_100473423 | 169 |
| 287 | 3300025939 | Ga0207665_10279197 | Ga0207665_102791971 | 169 |
| 288 | 3300025942 | Ga0207689_10024121 | Ga0207689_100241212 | 169 |
| 289 | 3300025961 | Ga0207712_10532160 | Ga0207712_105321601 | 169 |
| 290 | 3300026089 | Ga0207648_10053658 | Ga0207648_100536583 | 169 |
| 291 | 3300026116 | Ga0207674_10460460 | Ga0207674_104604602 | 169 |
| 292 | 3300027907 | Ga0207428_10185394 | Ga0207428_101853942 | 169 |
| 293 | 3300028381 | Ga0268264_10175563 | Ga0268264_101755632 | 169 |
| 294 | 3300047318 | Ga0495636_0403132 | Ga0495636_0403132_35_550 | 169 |
| 295 | 3300049585 | Ga0501069_0401951 | Ga0501069_0401951_30_539 | 169 |
| 296 | 3300050508 | nmdc:mga09592_37825_c1 | nmdc:mga09592_37825_c1_189_707 | 169 |
| 297 | 3300050511 | nmdc:mga08y16_129884_c1 | nmdc:mga08y16_129884_c1_1417_1932 | 169 |
| 298 | 3300050512 | nmdc:mga0n895_23956_c1 | nmdc:mga0n895_23956_c1_1410_1925 | 169 |
| 299 | 3300050515 | nmdc:mga0a205_11833_c1 | nmdc:mga0a205_11833_c1_4581_5096 | 169 |
| 300 | 3300003349 | JGI26129J50193_1000527 | JGI26129J50193_10005273 | 170 |
| 301 | 3300005327 | Ga0070658_10027372 | Ga0070658_100273724 | 170 |
| 302 | 3300005329 | Ga0070683_100002119 | Ga0070683_10000211911 | 170 |
| 303 | 3300005334 | Ga0068869_100003623 | Ga0068869_1000036231 | 170 |
| 304 | 3300005336 | Ga0070680_100078180 | Ga0070680_1000781803 | 170 |
| 305 | 3300005336 | Ga0070680_100225514 | Ga0070680_1002255142 | 170 |
| 306 | 3300005337 | Ga0070682_100073891 | Ga0070682_1000738912 | 170 |
| 307 | 3300005339 | Ga0070660_100137344 | Ga0070660_1001373442 | 170 |
| 308 | 3300005341 | Ga0070691_10022152 | Ga0070691_100221523 | 170 |
| 309 | 3300005341 | Ga0070691_10041158 | Ga0070691_100411582 | 170 |
| 310 | 3300005344 | Ga0070661_100036065 | Ga0070661_1000360653 | 170 |
| 311 | 3300005353 | Ga0070669_100406294 | Ga0070669_1004062941 | 170 |
| 312 | 3300005366 | Ga0070659_100017263 | Ga0070659_1000172636 | 170 |
| 313 | 3300005367 | Ga0070667_100058210 | Ga0070667_1000582103 | 170 |
| 314 | 3300005434 | Ga0070709_10256779 | Ga0070709_102567792 | 170 |
| 315 | 3300005435 | Ga0070714_100004618 | Ga0070714_1000046185 | 170 |
| 316 | 3300005436 | Ga0070713_100723332 | Ga0070713_1007233322 | 170 |
| 317 | 3300005439 | Ga0070711_100175909 | Ga0070711_1001759092 | 170 |
| 318 | 3300005444 | Ga0070694_100013711 | Ga0070694_1000137112 | 170 |
| 319 | 3300005444 | Ga0070694_100019794 | Ga0070694_1000197943 | 170 |
| 320 | 3300005444 | Ga0070694_100074208 | Ga0070694_1000742083 | 170 |
| 321 | 3300005445 | Ga0070708_100025889 | Ga0070708_1000258893 | 170 |
| 322 | 3300005455 | Ga0070663_100006386 | Ga0070663_1000063863 | 170 |
| 323 | 3300005457 | Ga0070662_100110177 | Ga0070662_1001101772 | 170 |
| 324 | 3300005457 | Ga0070662_100199672 | Ga0070662_1001996722 | 170 |
| 325 | 3300005458 | Ga0070681_10392778 | Ga0070681_103927782 | 170 |
| 326 | 3300005459 | Ga0068867_100066562 | Ga0068867_1000665622 | 170 |
| 327 | 3300005467 | Ga0070706_100006859 | Ga0070706_1000068594 | 170 |
| 328 | 3300005468 | Ga0070707_100177283 | Ga0070707_1001772834 | 170 |
| 329 | 3300005471 | Ga0070698_100002697 | Ga0070698_1000026973 | 170 |
| 330 | 3300005471 | Ga0070698_100068689 | Ga0070698_1000686894 | 170 |
| 331 | 3300005518 | Ga0070699_100011594 | Ga0070699_1000115942 | 170 |
| 332 | 3300005518 | Ga0070699_100515757 | Ga0070699_1005157571 | 170 |
| 333 | 3300005530 | Ga0070679_100090027 | Ga0070679_1000900274 | 170 |
| 334 | 3300005530 | Ga0070679_100214459 | Ga0070679_1002144593 | 170 |
| 335 | 3300005535 | Ga0070684_100203074 | Ga0070684_1002030742 | 170 |
| 336 | 3300005536 | Ga0070697_100007797 | Ga0070697_1000077973 | 170 |
| 337 | 3300005536 | Ga0070697_100175058 | Ga0070697_1001750582 | 170 |
| 338 | 3300005539 | Ga0068853_100005617 | Ga0068853_1000056178 | 170 |
| 339 | 3300005539 | Ga0068853_100742439 | Ga0068853_1007424391 | 170 |
| 340 | 3300005545 | Ga0070695_100000594 | Ga0070695_1000005948 | 170 |
| 341 | 3300005545 | Ga0070695_100000882 | Ga0070695_10000088210 | 170 |
| 342 | 3300005546 | Ga0070696_100576237 | Ga0070696_1005762372 | 170 |
| 343 | 3300005547 | Ga0070693_100296427 | Ga0070693_1002964271 | 170 |
| 344 | 3300005549 | Ga0070704_100043884 | Ga0070704_1000438843 | 170 |
| 345 | 3300005549 | Ga0070704_100218194 | Ga0070704_1002181941 | 170 |
| 346 | 3300005564 | Ga0070664_100018607 | Ga0070664_1000186074 | 170 |
| 347 | 3300005578 | Ga0068854_100002881 | Ga0068854_10000288111 | 170 |
| 348 | 3300005614 | Ga0068856_100012499 | Ga0068856_1000124994 | 170 |
| 349 | 3300005719 | Ga0068861_100427632 | Ga0068861_1004276322 | 170 |
| 350 | 3300005834 | Ga0068851_10003076 | Ga0068851_100030763 | 170 |
| 351 | 3300005841 | Ga0068863_100019520 | Ga0068863_1000195206 | 170 |
| 352 | 3300005844 | Ga0068862_100003606 | Ga0068862_1000036069 | 170 |
| 353 | 3300005844 | Ga0068862_100037063 | Ga0068862_1000370634 | 170 |
| 354 | 3300005937 | Ga0081455_10006171 | Ga0081455_1000617111 | 170 |
| 355 | 3300006173 | Ga0070716_100010263 | Ga0070716_1000102634 | 170 |
| 356 | 3300006175 | Ga0070712_100954940 | Ga0070712_1009549402 | 170 |
| 357 | 3300006844 | Ga0075428_100020783 | Ga0075428_1000207832 | 170 |
| 358 | 3300006844 | Ga0075428_100086460 | Ga0075428_1000864603 | 170 |
| 359 | 3300006844 | Ga0075428_100411522 | Ga0075428_1004115222 | 170 |
| 360 | 3300006846 | Ga0075430_100057085 | Ga0075430_1000570852 | 170 |
| 361 | 3300006846 | Ga0075430_100187853 | Ga0075430_1001878532 | 170 |
| 362 | 3300006847 | Ga0075431_100064366 | Ga0075431_1000643663 | 170 |
| 363 | 3300006847 | Ga0075431_100181196 | Ga0075431_1001811962 | 170 |
| 364 | 3300006847 | Ga0075431_101111231 | Ga0075431_1011112311 | 170 |
| 365 | 3300006852 | Ga0075433_10025395 | Ga0075433_100253955 | 170 |
| 366 | 3300006852 | Ga0075433_10037782 | Ga0075433_100377822 | 170 |
| 367 | 3300006852 | Ga0075433_10250297 | Ga0075433_102502972 | 170 |
| 368 | 3300006871 | Ga0075434_100026038 | Ga0075434_1000260383 | 170 |
| 369 | 3300006871 | Ga0075434_100078418 | Ga0075434_1000784185 | 170 |
| 370 | 3300006880 | Ga0075429_100000527 | Ga0075429_10000052722 | 170 |
| 371 | 3300006914 | Ga0075436_100250758 | Ga0075436_1002507582 | 170 |
| 372 | 3300007076 | Ga0075435_100152531 | Ga0075435_1001525313 | 170 |
| 373 | 3300009147 | Ga0114129_10007645 | Ga0114129_100076456 | 170 |
| 374 | 3300009147 | Ga0114129_10095647 | Ga0114129_100956472 | 170 |
| 375 | 3300009147 | Ga0114129_10203940 | Ga0114129_102039402 | 170 |
| 376 | 3300009147 | Ga0114129_10221636 | Ga0114129_102216364 | 170 |
| 377 | 3300009147 | Ga0114129_10375576 | Ga0114129_103755763 | 170 |
| 378 | 3300009147 | Ga0114129_10599013 | Ga0114129_105990132 | 170 |
| 379 | 3300009174 | Ga0105241_10002568 | Ga0105241_100025688 | 170 |
| 380 | 3300009545 | Ga0105237_10068892 | Ga0105237_100688924 | 170 |
| 381 | 3300009551 | Ga0105238_10180454 | Ga0105238_101804542 | 170 |
| 382 | 3300010375 | Ga0105239_10022008 | Ga0105239_100220088 | 170 |
| 383 | 3300013100 | Ga0157373_10009243 | Ga0157373_100092433 | 170 |
| 384 | 3300013102 | Ga0157371_10255959 | Ga0157371_102559592 | 170 |
| 385 | 3300013104 | Ga0157370_10139526 | Ga0157370_101395263 | 170 |
| 386 | 3300013306 | Ga0163162_10307320 | Ga0163162_103073203 | 170 |
| 387 | 3300013307 | Ga0157372_10255733 | Ga0157372_102557332 | 170 |
| 388 | 3300013307 | Ga0157372_10411628 | Ga0157372_104116281 | 170 |
| 389 | 3300013308 | Ga0157375_10130446 | Ga0157375_101304463 | 170 |
| 390 | 3300014326 | Ga0157380_10277178 | Ga0157380_102771783 | 170 |
| 391 | 3300020082 | Ga0206353_10401628 | Ga0206353_104016282 | 170 |
| 392 | 3300025321 | Ga0207656_10023993 | Ga0207656_100239934 | 170 |
| 393 | 3300025906 | Ga0207699_10094487 | Ga0207699_100944873 | 170 |
| 394 | 3300025909 | Ga0207705_10022293 | Ga0207705_100222936 | 170 |
| 395 | 3300025910 | Ga0207684_10004793 | Ga0207684_1000479315 | 170 |
| 396 | 3300025910 | Ga0207684_10013658 | Ga0207684_100136587 | 170 |
| 397 | 3300025910 | Ga0207684_10026821 | Ga0207684_100268213 | 170 |
| 398 | 3300025911 | Ga0207654_10020053 | Ga0207654_100200534 | 170 |
| 399 | 3300025912 | Ga0207707_10012269 | Ga0207707_100122693 | 170 |
| 400 | 3300025912 | Ga0207707_10307715 | Ga0207707_103077152 | 170 |
| 401 | 3300025913 | Ga0207695_10016660 | Ga0207695_100166608 | 170 |
| 402 | 3300025914 | Ga0207671_10097438 | Ga0207671_100974383 | 170 |
| 403 | 3300025916 | Ga0207663_10343973 | Ga0207663_103439731 | 170 |
| 404 | 3300025917 | Ga0207660_10121282 | Ga0207660_101212823 | 170 |
| 405 | 3300025917 | Ga0207660_10300501 | Ga0207660_103005011 | 170 |
| 406 | 3300025919 | Ga0207657_10000586 | Ga0207657_1000058631 | 170 |
| 407 | 3300025920 | Ga0207649_10119404 | Ga0207649_101194042 | 170 |
| 408 | 3300025921 | Ga0207652_10006954 | Ga0207652_100069542 | 170 |
| 409 | 3300025922 | Ga0207646_10002098 | Ga0207646_1000209810 | 170 |
| 410 | 3300025922 | Ga0207646_10136091 | Ga0207646_101360913 | 170 |
| 411 | 3300025923 | Ga0207681_10161113 | Ga0207681_101611132 | 170 |
| 412 | 3300025924 | Ga0207694_10038700 | Ga0207694_100387002 | 170 |
| 413 | 3300025927 | Ga0207687_10108514 | Ga0207687_101085142 | 170 |
| 414 | 3300025929 | Ga0207664_10598374 | Ga0207664_105983742 | 170 |
| 415 | 3300025932 | Ga0207690_10007791 | Ga0207690_100077913 | 170 |
| 416 | 3300025933 | Ga0207706_10041599 | Ga0207706_100415996 | 170 |
| 417 | 3300025933 | Ga0207706_10206712 | Ga0207706_102067123 | 170 |
| 418 | 3300025939 | Ga0207665_10011234 | Ga0207665_100112346 | 170 |
| 419 | 3300025942 | Ga0207689_10006609 | Ga0207689_100066099 | 170 |
| 420 | 3300025944 | Ga0207661_10073793 | Ga0207661_100737934 | 170 |
| 421 | 3300025949 | Ga0207667_10000425 | Ga0207667_1000042546 | 170 |
| 422 | 3300025981 | Ga0207640_10003350 | Ga0207640_100033502 | 170 |
| 423 | 3300025981 | Ga0207640_10678971 | Ga0207640_106789712 | 170 |
| 424 | 3300026041 | Ga0207639_10585384 | Ga0207639_105853842 | 170 |
| 425 | 3300026067 | Ga0207678_10000668 | Ga0207678_1000066810 | 170 |
| 426 | 3300026078 | Ga0207702_10151402 | Ga0207702_101514022 | 170 |
| 427 | 3300026088 | Ga0207641_10203598 | Ga0207641_102035982 | 170 |
| 428 | 3300026089 | Ga0207648_10086510 | Ga0207648_100865102 | 170 |
| 429 | 3300026116 | Ga0207674_10000045 | Ga0207674_10000045115 | 170 |
| 430 | 3300026118 | Ga0207675_100213736 | Ga0207675_1002137362 | 170 |
| 431 | 3300026142 | Ga0207698_10004215 | Ga0207698_100042155 | 170 |
| 432 | 3300027252 | Ga0209973_1042982 | Ga0209973_10429821 | 170 |
| 433 | 3300027360 | Ga0209969_1017871 | Ga0209969_10178712 | 170 |
| 434 | 3300027395 | Ga0209996_1007246 | Ga0209996_10072462 | 170 |
| 435 | 3300027462 | Ga0210000_1022425 | Ga0210000_10224251 | 170 |
| 436 | 3300027471 | Ga0209995_1000849 | Ga0209995_10008496 | 170 |
| 437 | 3300027526 | Ga0209968_1001912 | Ga0209968_10019122 | 170 |
| 438 | 3300027543 | Ga0209999_1005431 | Ga0209999_10054312 | 170 |
| 439 | 3300027614 | Ga0209970_1002132 | Ga0209970_10021322 | 170 |
| 440 | 3300027665 | Ga0209983_1000844 | Ga0209983_10008446 | 170 |
| 441 | 3300027682 | Ga0209971_1000041 | Ga0209971_100004137 | 170 |
| 442 | 3300027695 | Ga0209966_1000241 | Ga0209966_100024110 | 170 |
| 443 | 3300027717 | Ga0209998_10000028 | Ga0209998_1000002857 | 170 |
| 444 | 3300027907 | Ga0207428_10000063 | Ga0207428_1000006397 | 170 |
| 445 | 3300027907 | Ga0207428_10000091 | Ga0207428_1000009175 | 170 |
| 446 | 3300028380 | Ga0268265_10034748 | Ga0268265_100347482 | 170 |
| 447 | 3300031548 | Ga0307408_100714362 | Ga0307408_1007143622 | 170 |
| 448 | 3300031901 | Ga0307406_10223561 | Ga0307406_102235612 | 170 |
| 449 | 3300031995 | Ga0307409_100401652 | Ga0307409_1004016523 | 170 |
| 450 | 3300032002 | Ga0307416_100251664 | Ga0307416_1002516642 | 170 |
| 451 | 3300032126 | Ga0307415_100532054 | Ga0307415_1005320542 | 170 |
| 452 | 3300034817 | Ga0373948_0007185 | Ga0373948_0007185_423_944 | 170 |
| 453 | 3300035088 | Ga0373940_0085817 | Ga0373940_0085817_128_649 | 170 |
| 454 | 3300042001 | Ga0439441_038356 | Ga0439441_038356_126_647 | 170 |
| 455 | 3300042142 | Ga0450905_023594 | Ga0450905_023594_63_584 | 170 |
| 456 | 3300042439 | Ga0439464_0036832 | Ga0439464_0036832_829_1353 | 170 |
| 457 | 3300042876 | Ga0451577_0004206 | Ga0451577_0004206_9175_9693 | 170 |
| 458 | 3300042876 | Ga0451577_0213877 | Ga0451577_0213877_870_1391 | 170 |
| 459 | 3300044673 | Ga0453683_0063593 | Ga0453683_0063593_1561_2079 | 170 |
| 460 | 3300044673 | Ga0453683_0458888 | Ga0453683_0458888_216_737 | 170 |
| 461 | 3300044712 | Ga0453684_0114034 | Ga0453684_0114034_962_1480 | 170 |
| 462 | 3300044712 | Ga0453684_0118670 | Ga0453684_0118670_612_1133 | 170 |
| 463 | 3300045051 | Ga0451576_0022358 | Ga0451576_0022358_2840_3361 | 170 |
| 464 | 3300045051 | Ga0451576_0023475 | Ga0451576_0023475_548_1066 | 170 |
| 465 | 3300045051 | Ga0451576_0072590 | Ga0451576_0072590_2625_3146 | 170 |
| 466 | 3300045051 | Ga0451576_0113317 | Ga0451576_0113317_496_1017 | 170 |
| 467 | 3300046472 | Ga0495580_0032388 | Ga0495580_0032388_1664_2185 | 170 |
| 468 | 3300046491 | Ga0495584_0263679 | Ga0495584_0263679_266_787 | 170 |
| 469 | 3300048089 | Ga0495614_0093351 | Ga0495614_0093351_604_1125 | 170 |
| 470 | 3300049568 | Ga0501031_0261706 | Ga0501031_0261706_547_1068 | 170 |
| 471 | 3300049568 | Ga0501031_0402856 | Ga0501031_0402856_314_835 | 170 |
| 472 | 3300049570 | Ga0501033_0093095 | Ga0501033_0093095_228_749 | 170 |
| 473 | 3300049570 | Ga0501033_0200147 | Ga0501033_0200147_546_1067 | 170 |
| 474 | 3300049570 | Ga0501033_0435360 | Ga0501033_0435360_262_783 | 170 |
| 475 | 3300049572 | Ga0501036_0049952 | Ga0501036_0049952_500_1021 | 170 |
| 476 | 3300049574 | Ga0501038_0113920 | Ga0501038_0113920_840_1361 | 170 |
| 477 | 3300049574 | Ga0501038_0991828 | Ga0501038_0991828_31_552 | 170 |
| 478 | 3300049575 | Ga0501039_0155044 | Ga0501039_0155044_66_587 | 170 |
| 479 | 3300049575 | Ga0501039_0197414 | Ga0501039_0197414_928_1449 | 170 |
| 480 | 3300049575 | Ga0501039_0550539 | Ga0501039_0550539_60_581 | 170 |
| 481 | 3300049576 | Ga0501040_0022018 | Ga0501040_0022018_2754_3275 | 170 |
| 482 | 3300049576 | Ga0501040_0025494 | Ga0501040_0025494_1265_1786 | 170 |
| 483 | 3300049576 | Ga0501040_0310488 | Ga0501040_0310488_584_1105 | 170 |
| 484 | 3300049577 | Ga0501041_0007834 | Ga0501041_0007834_4472_4993 | 170 |
| 485 | 3300049577 | Ga0501041_0035756 | Ga0501041_0035756_282_803 | 170 |
| 486 | 3300049578 | Ga0501042_0004444 | Ga0501042_0004444_6236_6757 | 170 |
| 487 | 3300049578 | Ga0501042_0021696 | Ga0501042_0021696_1414_1935 | 170 |
| 488 | 3300049578 | Ga0501042_0074858 | Ga0501042_0074858_1213_1734 | 170 |
| 489 | 3300049579 | Ga0501043_0079429 | Ga0501043_0079429_319_840 | 170 |
| 490 | 3300049579 | Ga0501043_0221325 | Ga0501043_0221325_707_1228 | 170 |
| 491 | 3300049580 | Ga0501046_0009589 | Ga0501046_0009589_7285_7806 | 170 |
| 492 | 3300049580 | Ga0501046_0018263 | Ga0501046_0018263_1755_2276 | 170 |
| 493 | 3300049580 | Ga0501046_0292500 | Ga0501046_0292500_175_696 | 170 |
| 494 | 3300049581 | Ga0501047_0137098 | Ga0501047_0137098_443_964 | 170 |
| 495 | 3300049582 | Ga0501048_0044521 | Ga0501048_0044521_1981_2502 | 170 |
| 496 | 3300049582 | Ga0501048_0125699 | Ga0501048_0125699_94_615 | 170 |
| 497 | 3300049582 | Ga0501048_0209057 | Ga0501048_0209057_120_641 | 170 |
| 498 | 3300049583 | Ga0501067_0003432 | Ga0501067_0003432_3858_4379 | 170 |
| 499 | 3300049584 | Ga0501068_0026139 | Ga0501068_0026139_450_971 | 170 |
| 500 | 3300049584 | Ga0501068_0158963 | Ga0501068_0158963_763_1284 | 170 |
| 501 | 3300049585 | Ga0501069_0029079 | Ga0501069_0029079_280_801 | 170 |
| 502 | 3300049587 | Ga0501071_0095044 | Ga0501071_0095044_343_864 | 170 |
| 503 | 3300049588 | Ga0501072_0042136 | Ga0501072_0042136_610_1134 | 170 |
| 504 | 3300049588 | Ga0501072_0049204 | Ga0501072_0049204_646_1167 | 170 |
| 505 | 3300049588 | Ga0501072_0113650 | Ga0501072_0113650_897_1418 | 170 |
| 506 | 3300049588 | Ga0501072_0173571 | Ga0501072_0173571_64_585 | 170 |
| 507 | 3300049588 | Ga0501072_0252292 | Ga0501072_0252292_536_1057 | 170 |
| 508 | 3300049590 | Ga0501074_0032485 | Ga0501074_0032485_2365_2886 | 170 |
| 509 | 3300049590 | Ga0501074_0048711 | Ga0501074_0048711_90_611 | 170 |
| 510 | 3300049591 | Ga0501075_0005480 | Ga0501075_0005480_7521_8042 | 170 |
| 511 | 3300049591 | Ga0501075_0051837 | Ga0501075_0051837_1241_1762 | 170 |
| 512 | 3300049591 | Ga0501075_0086117 | Ga0501075_0086117_412_933 | 170 |
| 513 | 3300049591 | Ga0501075_0092151 | Ga0501075_0092151_1769_2290 | 170 |
| 514 | 3300049591 | Ga0501075_0631854 | Ga0501075_0631854_228_749 | 170 |
| 515 | 3300049592 | Ga0501076_0010476 | Ga0501076_0010476_2409_2930 | 170 |
| 516 | 3300049592 | Ga0501076_0027554 | Ga0501076_0027554_1076_1597 | 170 |
| 517 | 3300049592 | Ga0501076_0070246 | Ga0501076_0070246_952_1473 | 170 |
| 518 | 3300049593 | Ga0501077_0008603 | Ga0501077_0008603_5478_5999 | 170 |
| 519 | 3300049593 | Ga0501077_0030299 | Ga0501077_0030299_874_1395 | 170 |
| 520 | 3300049593 | Ga0501077_0054330 | Ga0501077_0054330_1474_1995 | 170 |
| 521 | 3300049593 | Ga0501077_0075869 | Ga0501077_0075869_1119_1640 | 170 |
| 522 | 3300049593 | Ga0501077_0226240 | Ga0501077_0226240_322_843 | 170 |
| 523 | 3300049741 | Ga0501079_0000663 | Ga0501079_0000663_4184_4705 | 170 |
| 524 | 3300049741 | Ga0501079_0017738 | Ga0501079_0017738_394_915 | 170 |
| 525 | 3300049741 | Ga0501079_0073043 | Ga0501079_0073043_442_963 | 170 |
| 526 | 3300049741 | Ga0501079_0201948 | Ga0501079_0201948_814_1335 | 170 |
| 527 | 3300049742 | Ga0501080_0379319 | Ga0501080_0379319_25_546 | 170 |
| 528 | 3300049742 | Ga0501080_0496364 | Ga0501080_0496364_319_840 | 170 |
| 529 | 3300049742 | Ga0501080_0601530 | Ga0501080_0601530_432_953 | 170 |
| 530 | 3300049743 | Ga0501081_0002102 | Ga0501081_0002102_6924_7445 | 170 |
| 531 | 3300049743 | Ga0501081_0006548 | Ga0501081_0006548_702_1223 | 170 |
| 532 | 3300049743 | Ga0501081_0110605 | Ga0501081_0110605_952_1473 | 170 |
| 533 | 3300049743 | Ga0501081_0129670 | Ga0501081_0129670_537_1058 | 170 |
| 534 | 3300049743 | Ga0501081_0584595 | Ga0501081_0584595_48_569 | 170 |
| 535 | 3300049744 | Ga0501083_0062789 | Ga0501083_0062789_633_1154 | 170 |
| 536 | 3300049824 | Ga0501045_0010792 | Ga0501045_0010792_569_1090 | 170 |
| 537 | 3300049824 | Ga0501045_0309621 | Ga0501045_0309621_381_902 | 170 |
| 538 | 3300050507 | nmdc:mga05p37_1552193_c1 | nmdc:mga05p37_1552193_c1_119_640 | 170 |
| 539 | 3300050507 | nmdc:mga05p37_44130_c1 | nmdc:mga05p37_44130_c1_2584_3105 | 170 |
| 540 | 3300050507 | nmdc:mga05p37_500358_c1 | nmdc:mga05p37_500358_c1_389_910 | 170 |
| 541 | 3300050507 | nmdc:mga05p37_707721_c1 | nmdc:mga05p37_707721_c1_279_800 | 170 |
| 542 | 3300050508 | nmdc:mga09592_606819_c1 | nmdc:mga09592_606819_c1_283_801 | 170 |
| 543 | 3300050510 | nmdc:mga06r32_361246_c1 | nmdc:mga06r32_361246_c1_625_1146 | 170 |
| 544 | 3300050511 | nmdc:mga08y16_13167_c1 | nmdc:mga08y16_13167_c1_2171_2689 | 170 |
| 545 | 3300050512 | nmdc:mga0n895_10798_c1 | nmdc:mga0n895_10798_c1_3220_3738 | 170 |
| 546 | 3300050512 | nmdc:mga0n895_18719_c1 | nmdc:mga0n895_18719_c1_3201_3725 | 170 |
| 547 | 3300050513 | nmdc:mga0rr50_30044_c1 | nmdc:mga0rr50_30044_c1_1084_1608 | 170 |
| 548 | 3300050513 | nmdc:mga0rr50_60240_c1 | nmdc:mga0rr50_60240_c1_1378_1899 | 170 |
| 549 | 3300050514 | nmdc:mga08x19_128108_c1 | nmdc:mga08x19_128108_c1_332_853 | 170 |
| 550 | 3300050514 | nmdc:mga08x19_46300_c1 | nmdc:mga08x19_46300_c1_574_1095 | 170 |
| 551 | 3300050514 | nmdc:mga08x19_77155_c1 | nmdc:mga08x19_77155_c1_380_904 | 170 |
| 552 | 3300050515 | nmdc:mga0a205_10327_c1 | nmdc:mga0a205_10327_c1_5300_5824 | 170 |
| 553 | 3300050515 | nmdc:mga0a205_366378_c1 | nmdc:mga0a205_366378_c1_136_657 | 170 |
| 554 | 3300050515 | nmdc:mga0a205_4199_c1 | nmdc:mga0a205_4199_c1_9160_9678 | 170 |
| 555 | 3300054114 | Ga0501084_0005631 | Ga0501084_0005631_9661_10182 | 170 |
| 556 | 3300054114 | Ga0501084_0008407 | Ga0501084_0008407_652_1173 | 170 |
| 557 | 3300054114 | Ga0501084_0069909 | Ga0501084_0069909_1122_1643 | 170 |
| 558 | 3300054114 | Ga0501084_0139897 | Ga0501084_0139897_319_840 | 170 |
| 559 | 3300054114 | Ga0501084_0465679 | Ga0501084_0465679_71_592 | 170 |
| 560 | 3300060353 | Ga0501082_0036066 | Ga0501082_0036066_3199_3720 | 170 |
| 561 | 3300060353 | Ga0501082_0045047 | Ga0501082_0045047_2927_3448 | 170 |
| 562 | 3300060353 | Ga0501082_0201408 | Ga0501082_0201408_602_1123 | 170 |
| 563 | 3300061734 | Ga0530510_0033749 | Ga0530510_0033749_373_894 | 170 |
| 564 | 3300061734 | Ga0530510_0080189 | Ga0530510_0080189_1121_1642 | 170 |
| 565 | 3300061734 | Ga0530510_0743898 | Ga0530510_0743898_15_536 | 170 |
| 566 | 3300013297 | Ga0157378_10335292 | Ga0157378_103352922 | 171 |
| 567 | 3300045836 | Ga0466958_0594032 | Ga0466958_0594032_14_562 | 171 |
| 568 | 3300005718 | Ga0068866_10226763 | Ga0068866_102267632 | 172 |
| 569 | 3300005843 | Ga0068860_100565845 | Ga0068860_1005658451 | 172 |
| 570 | 3300025934 | Ga0207686_11070506 | Ga0207686_110705061 | 172 |
| 571 | 3300035088 | Ga0373940_0119911 | Ga0373940_0119911_11_532 | 172 |
| 572 | 3300044706 | Ga0466964_0076773 | Ga0466964_0076773_644_1162 | 172 |
| 573 | 3300046455 | Ga0495603_0010676 | Ga0495603_0010676_4140_4676 | 172 |
| 574 | 3300046558 | Ga0495633_0293237 | Ga0495633_0293237_76_597 | 172 |
| 575 | 3300046664 | Ga0495659_0260381 | Ga0495659_0260381_30_551 | 172 |
| 576 | 3300046684 | Ga0495669_0041526 | Ga0495669_0041526_1335_1856 | 172 |
| 577 | 3300049591 | Ga0501075_0140854 | Ga0501075_0140854_291_821 | 172 |
| 578 | 3300049592 | Ga0501076_0230790 | Ga0501076_0230790_285_815 | 172 |
| 579 | 3300049742 | Ga0501080_0344192 | Ga0501080_0344192_466_996 | 172 |
| 580 | 3300054114 | Ga0501084_0394671 | Ga0501084_0394671_485_1015 | 172 |
| 581 | 3300061719 | Ga0466962_0390531 | Ga0466962_0390531_125_643 | 172 |
| 582 | 3300061734 | Ga0530510_0224603 | Ga0530510_0224603_474_1004 | 172 |
| 583 | 3300005436 | Ga0070713_100118171 | Ga0070713_1001181713 | 173 |
| 584 | 3300005564 | Ga0070664_100609625 | Ga0070664_1006096252 | 173 |
| 585 | 3300006914 | Ga0075436_100019815 | Ga0075436_1000198156 | 173 |
| 586 | 3300009147 | Ga0114129_10095368 | Ga0114129_100953683 | 173 |
| 587 | 3300009147 | Ga0114129_11747182 | Ga0114129_117471821 | 173 |
| 588 | 3300021361 | Ga0213872_10002894 | Ga0213872_100028947 | 173 |
| 589 | 3300025939 | Ga0207665_10224128 | Ga0207665_102241283 | 173 |
| 590 | 3300035112 | Ga0373932_0036708 | Ga0373932_0036708_136_657 | 173 |
| 591 | 3300039447 | Ga0436361_0180955 | Ga0436361_0180955_3175_3699 | 173 |
| 592 | 3300050512 | nmdc:mga0n895_23631_c1 | nmdc:mga0n895_23631_c1_1833_2354 | 173 |
| 593 | 3300050514 | nmdc:mga08x19_2610_c1 | nmdc:mga08x19_2610_c1_233_754 | 173 |
| 594 | 3300050514 | nmdc:mga08x19_309252_c1 | nmdc:mga08x19_309252_c1_423_944 | 173 |
| 595 | 3300050514 | nmdc:mga08x19_85137_c1 | nmdc:mga08x19_85137_c1_1154_1675 | 173 |
| 596 | 3300050515 | nmdc:mga0a205_30942_c1 | nmdc:mga0a205_30942_c1_3884_4405 | 173 |
| 597 | 3300005564 | Ga0070664_100103207 | Ga0070664_1001032074 | 174 |
| 598 | 3300005618 | Ga0068864_100299156 | Ga0068864_1002991562 | 174 |
| 599 | 3300025919 | Ga0207657_10486797 | Ga0207657_104867972 | 174 |
| 600 | 3300026095 | Ga0207676_10545614 | Ga0207676_105456142 | 174 |
| 601 | 3300031251 | Ga0265327_10106184 | Ga0265327_101061842 | 174 |
| 602 | 3300048911 | Ga0496108_0869702 | Ga0496108_0869702_80_622 | 174 |
| 603 | 3300005335 | Ga0070666_10057555 | Ga0070666_100575553 | 175 |
| 604 | 3300005355 | Ga0070671_100007996 | Ga0070671_1000079963 | 175 |
| 605 | 3300005364 | Ga0070673_100092534 | Ga0070673_1000925343 | 175 |
| 606 | 3300005457 | Ga0070662_100238473 | Ga0070662_1002384732 | 175 |
| 607 | 3300005543 | Ga0070672_100003576 | Ga0070672_1000035768 | 175 |
| 608 | 3300005614 | Ga0068856_100049192 | Ga0068856_1000491923 | 175 |
| 609 | 3300005615 | Ga0070702_100159055 | Ga0070702_1001590553 | 175 |
| 610 | 3300006237 | Ga0097621_100895782 | Ga0097621_1008957822 | 175 |
| 611 | 3300006358 | Ga0068871_100401217 | Ga0068871_1004012171 | 175 |
| 612 | 3300006871 | Ga0075434_101170390 | Ga0075434_1011703901 | 175 |
| 613 | 3300009101 | Ga0105247_10150638 | Ga0105247_101506382 | 175 |
| 614 | 3300009177 | Ga0105248_10005276 | Ga0105248_1000527614 | 175 |
| 615 | 3300013306 | Ga0163162_10074800 | Ga0163162_100748005 | 175 |
| 616 | 3300013307 | Ga0157372_11108016 | Ga0157372_111080162 | 175 |
| 617 | 3300025903 | Ga0207680_10051183 | Ga0207680_100511832 | 175 |
| 618 | 3300025923 | Ga0207681_10226804 | Ga0207681_102268042 | 175 |
| 619 | 3300025931 | Ga0207644_10002250 | Ga0207644_1000225013 | 175 |
| 620 | 3300025931 | Ga0207644_10353499 | Ga0207644_103534992 | 175 |
| 621 | 3300025933 | Ga0207706_10071958 | Ga0207706_100719582 | 175 |
| 622 | 3300025933 | Ga0207706_10102055 | Ga0207706_101020553 | 175 |
| 623 | 3300025940 | Ga0207691_10020908 | Ga0207691_100209088 | 175 |
| 624 | 3300025941 | Ga0207711_10060669 | Ga0207711_100606694 | 175 |
| 625 | 3300025986 | Ga0207658_10286565 | Ga0207658_102865652 | 175 |
| 626 | 3300026023 | Ga0207677_10236597 | Ga0207677_102365972 | 175 |
| 627 | 3300026118 | Ga0207675_100416790 | Ga0207675_1004167902 | 175 |
| 628 | 3300048904 | Ga0496101_0612530 | Ga0496101_0612530_193_720 | 175 |
| 629 | 3300048905 | Ga0496102_0017659 | Ga0496102_0017659_1851_2378 | 175 |
| 630 | 3300048906 | Ga0496103_0034172 | Ga0496103_0034172_2481_3008 | 175 |
| 631 | 3300048906 | Ga0496103_0633643 | Ga0496103_0633643_74_601 | 175 |
| 632 | 3300048907 | Ga0496104_1206065 | Ga0496104_1206065_14_541 | 175 |
| 633 | 3300048909 | Ga0496106_0011061 | Ga0496106_0011061_6107_6634 | 175 |
| 634 | 3300048909 | Ga0496106_0331847 | Ga0496106_0331847_240_767 | 175 |
| 635 | 3300048910 | Ga0496107_0000272 | Ga0496107_0000272_25998_26525 | 175 |
| 636 | 3300048911 | Ga0496108_0058966 | Ga0496108_0058966_1061_1588 | 175 |
| 637 | 3300048912 | Ga0496109_0046471 | Ga0496109_0046471_2991_3518 | 175 |
| 638 | 3300048912 | Ga0496109_0297332 | Ga0496109_0297332_762_1289 | 175 |
| 639 | 3300048913 | Ga0496110_0087087 | Ga0496110_0087087_1723_2250 | 175 |
| 640 | 3300048913 | Ga0496110_0681096 | Ga0496110_0681096_42_569 | 175 |
| 641 | 3300048914 | Ga0496111_0157848 | Ga0496111_0157848_527_1054 | 175 |
| 642 | 3300048915 | Ga0496112_0002079 | Ga0496112_0002079_4121_4666 | 175 |
| 643 | 3300048915 | Ga0496112_0017849 | Ga0496112_0017849_5036_5563 | 175 |
| 644 | 3300048918 | Ga0496115_0049745 | Ga0496115_0049745_813_1340 | 175 |
| 645 | 3300049571 | Ga0501034_0001247 | Ga0501034_0001247_29303_29887 | 175 |
| 646 | 3300049585 | Ga0501069_0088242 | Ga0501069_0088242_410_952 | 175 |
| 647 | 3300049585 | Ga0501069_0239738 | Ga0501069_0239738_396_938 | 175 |
| 648 | 3300049586 | Ga0501070_0002665 | Ga0501070_0002665_5938_6522 | 175 |
| 649 | 3300049586 | Ga0501070_0055099 | Ga0501070_0055099_858_1400 | 175 |
| 650 | 3300049822 | Ga0501035_0004131 | Ga0501035_0004131_753_1295 | 175 |
| 651 | 3300049823 | Ga0501044_0203182 | Ga0501044_0203182_941_1483 | 175 |
| 652 | 3300049824 | Ga0501045_0423676 | Ga0501045_0423676_439_966 | 175 |
| 653 | 3300050512 | nmdc:mga0n895_943816_c1 | nmdc:mga0n895_943816_c1_99_626 | 175 |
| 654 | 3300001978 | JGI24747J21853_1003747 | JGI24747J21853_10037472 | 176 |
| 655 | 3300001991 | JGI24743J22301_10000948 | JGI24743J22301_100009482 | 176 |
| 656 | 3300002070 | JGI24750J21931_1009036 | JGI24750J21931_10090362 | 176 |
| 657 | 3300002077 | JGI24744J21845_10010950 | JGI24744J21845_100109502 | 176 |
| 658 | 3300002244 | JGI24742J22300_10040166 | JGI24742J22300_100401661 | 176 |
| 659 | 3300005290 | Ga0065712_10168995 | Ga0065712_101689952 | 176 |
| 660 | 3300005293 | Ga0065715_10199194 | Ga0065715_101991942 | 176 |
| 661 | 3300005327 | Ga0070658_10007688 | Ga0070658_100076882 | 176 |
| 662 | 3300005327 | Ga0070658_10020016 | Ga0070658_100200164 | 176 |
| 663 | 3300005327 | Ga0070658_10738398 | Ga0070658_107383981 | 176 |
| 664 | 3300005328 | Ga0070676_10002688 | Ga0070676_100026888 | 176 |
| 665 | 3300005328 | Ga0070676_10076893 | Ga0070676_100768932 | 176 |
| 666 | 3300005328 | Ga0070676_10388611 | Ga0070676_103886112 | 176 |
| 667 | 3300005329 | Ga0070683_100083329 | Ga0070683_1000833292 | 176 |
| 668 | 3300005329 | Ga0070683_100180934 | Ga0070683_1001809342 | 176 |
| 669 | 3300005329 | Ga0070683_100484853 | Ga0070683_1004848532 | 176 |
| 670 | 3300005329 | Ga0070683_100667335 | Ga0070683_1006673351 | 176 |
| 671 | 3300005330 | Ga0070690_100053313 | Ga0070690_1000533132 | 176 |
| 672 | 3300005331 | Ga0070670_100093415 | Ga0070670_1000934152 | 176 |
| 673 | 3300005331 | Ga0070670_100196862 | Ga0070670_1001968622 | 176 |
| 674 | 3300005331 | Ga0070670_100395061 | Ga0070670_1003950612 | 176 |
| 675 | 3300005333 | Ga0070677_10004173 | Ga0070677_100041733 | 176 |
| 676 | 3300005334 | Ga0068869_100019678 | Ga0068869_1000196783 | 176 |
| 677 | 3300005334 | Ga0068869_100078266 | Ga0068869_1000782663 | 176 |
| 678 | 3300005335 | Ga0070666_10022816 | Ga0070666_100228163 | 176 |
| 679 | 3300005335 | Ga0070666_10026528 | Ga0070666_100265282 | 176 |
| 680 | 3300005336 | Ga0070680_100131706 | Ga0070680_1001317062 | 176 |
| 681 | 3300005338 | Ga0068868_100046065 | Ga0068868_1000460653 | 176 |
| 682 | 3300005338 | Ga0068868_100060686 | Ga0068868_1000606863 | 176 |
| 683 | 3300005338 | Ga0068868_100510108 | Ga0068868_1005101082 | 176 |
| 684 | 3300005338 | Ga0068868_100991643 | Ga0068868_1009916431 | 176 |
| 685 | 3300005339 | Ga0070660_100013668 | Ga0070660_1000136686 | 176 |
| 686 | 3300005339 | Ga0070660_100014726 | Ga0070660_1000147268 | 176 |
| 687 | 3300005339 | Ga0070660_100016306 | Ga0070660_1000163067 | 176 |
| 688 | 3300005339 | Ga0070660_100259726 | Ga0070660_1002597262 | 176 |
| 689 | 3300005340 | Ga0070689_100003287 | Ga0070689_1000032876 | 176 |
| 690 | 3300005343 | Ga0070687_100012799 | Ga0070687_1000127994 | 176 |
| 691 | 3300005344 | Ga0070661_100003662 | Ga0070661_1000036626 | 176 |
| 692 | 3300005344 | Ga0070661_100003923 | Ga0070661_1000039239 | 176 |
| 693 | 3300005344 | Ga0070661_100118886 | Ga0070661_1001188862 | 176 |
| 694 | 3300005344 | Ga0070661_100298623 | Ga0070661_1002986232 | 176 |
| 695 | 3300005345 | Ga0070692_10434360 | Ga0070692_104343601 | 176 |
| 696 | 3300005347 | Ga0070668_100000778 | Ga0070668_1000007789 | 176 |
| 697 | 3300005347 | Ga0070668_100034113 | Ga0070668_1000341133 | 176 |
| 698 | 3300005347 | Ga0070668_100615401 | Ga0070668_1006154011 | 176 |
| 699 | 3300005353 | Ga0070669_100051294 | Ga0070669_1000512943 | 176 |
| 700 | 3300005353 | Ga0070669_100118130 | Ga0070669_1001181303 | 176 |
| 701 | 3300005354 | Ga0070675_100001434 | Ga0070675_1000014349 | 176 |
| 702 | 3300005354 | Ga0070675_100290245 | Ga0070675_1002902452 | 176 |
| 703 | 3300005355 | Ga0070671_100004648 | Ga0070671_1000046483 | 176 |
| 704 | 3300005355 | Ga0070671_100016036 | Ga0070671_1000160364 | 176 |
| 705 | 3300005355 | Ga0070671_100149641 | Ga0070671_1001496412 | 176 |
| 706 | 3300005355 | Ga0070671_100488709 | Ga0070671_1004887092 | 176 |
| 707 | 3300005356 | Ga0070674_100005317 | Ga0070674_1000053178 | 176 |
| 708 | 3300005364 | Ga0070673_100025653 | Ga0070673_1000256533 | 176 |
| 709 | 3300005364 | Ga0070673_101270356 | Ga0070673_1012703561 | 176 |
| 710 | 3300005365 | Ga0070688_100009130 | Ga0070688_1000091304 | 176 |
| 711 | 3300005365 | Ga0070688_100079782 | Ga0070688_1000797823 | 176 |
| 712 | 3300005366 | Ga0070659_100016264 | Ga0070659_1000162642 | 176 |
| 713 | 3300005366 | Ga0070659_100136460 | Ga0070659_1001364603 | 176 |
| 714 | 3300005366 | Ga0070659_100139150 | Ga0070659_1001391502 | 176 |
| 715 | 3300005366 | Ga0070659_101080195 | Ga0070659_1010801951 | 176 |
| 716 | 3300005367 | Ga0070667_100005929 | Ga0070667_10000592913 | 176 |
| 717 | 3300005435 | Ga0070714_100005142 | Ga0070714_1000051423 | 176 |
| 718 | 3300005435 | Ga0070714_100101958 | Ga0070714_1001019582 | 176 |
| 719 | 3300005436 | Ga0070713_100862267 | Ga0070713_1008622672 | 176 |
| 720 | 3300005438 | Ga0070701_10102945 | Ga0070701_101029451 | 176 |
| 721 | 3300005439 | Ga0070711_100131700 | Ga0070711_1001317002 | 176 |
| 722 | 3300005439 | Ga0070711_100382090 | Ga0070711_1003820902 | 176 |
| 723 | 3300005441 | Ga0070700_100008896 | Ga0070700_1000088962 | 176 |
| 724 | 3300005455 | Ga0070663_100103914 | Ga0070663_1001039142 | 176 |
| 725 | 3300005455 | Ga0070663_100681230 | Ga0070663_1006812301 | 176 |
| 726 | 3300005456 | Ga0070678_100002807 | Ga0070678_1000028072 | 176 |
| 727 | 3300005456 | Ga0070678_100118829 | Ga0070678_1001188292 | 176 |
| 728 | 3300005457 | Ga0070662_100477734 | Ga0070662_1004777342 | 176 |
| 729 | 3300005457 | Ga0070662_100783246 | Ga0070662_1007832461 | 176 |
| 730 | 3300005458 | Ga0070681_10001116 | Ga0070681_1000111615 | 176 |
| 731 | 3300005458 | Ga0070681_10093264 | Ga0070681_100932644 | 176 |
| 732 | 3300005458 | Ga0070681_10128202 | Ga0070681_101282023 | 176 |
| 733 | 3300005458 | Ga0070681_11418634 | Ga0070681_114186341 | 176 |
| 734 | 3300005459 | Ga0068867_100011652 | Ga0068867_1000116527 | 176 |
| 735 | 3300005459 | Ga0068867_100051129 | Ga0068867_1000511292 | 176 |
| 736 | 3300005466 | Ga0070685_10017843 | Ga0070685_100178432 | 176 |
| 737 | 3300005530 | Ga0070679_100022804 | Ga0070679_1000228044 | 176 |
| 738 | 3300005530 | Ga0070679_100026039 | Ga0070679_1000260392 | 176 |
| 739 | 3300005535 | Ga0070684_100024805 | Ga0070684_1000248053 | 176 |
| 740 | 3300005535 | Ga0070684_100080873 | Ga0070684_1000808733 | 176 |
| 741 | 3300005535 | Ga0070684_100152396 | Ga0070684_1001523963 | 176 |
| 742 | 3300005535 | Ga0070684_100201450 | Ga0070684_1002014503 | 176 |
| 743 | 3300005539 | Ga0068853_100002843 | Ga0068853_1000028434 | 176 |
| 744 | 3300005539 | Ga0068853_100044947 | Ga0068853_1000449475 | 176 |
| 745 | 3300005539 | Ga0068853_100209326 | Ga0068853_1002093262 | 176 |
| 746 | 3300005543 | Ga0070672_100001083 | Ga0070672_10000108318 | 176 |
| 747 | 3300005543 | Ga0070672_100082505 | Ga0070672_1000825052 | 176 |
| 748 | 3300005544 | Ga0070686_100017578 | Ga0070686_1000175784 | 176 |
| 749 | 3300005547 | Ga0070693_100027267 | Ga0070693_1000272672 | 176 |
| 750 | 3300005547 | Ga0070693_100085957 | Ga0070693_1000859573 | 176 |
| 751 | 3300005547 | Ga0070693_100168907 | Ga0070693_1001689072 | 176 |
| 752 | 3300005547 | Ga0070693_100511877 | Ga0070693_1005118772 | 176 |
| 753 | 3300005548 | Ga0070665_100025298 | Ga0070665_1000252985 | 176 |
| 754 | 3300005548 | Ga0070665_100220354 | Ga0070665_1002203543 | 176 |
| 755 | 3300005563 | Ga0068855_100002986 | Ga0068855_10000298612 | 176 |
| 756 | 3300005563 | Ga0068855_100019088 | Ga0068855_1000190887 | 176 |
| 757 | 3300005563 | Ga0068855_100100956 | Ga0068855_1001009562 | 176 |
| 758 | 3300005564 | Ga0070664_100017750 | Ga0070664_1000177502 | 176 |
| 759 | 3300005564 | Ga0070664_100027492 | Ga0070664_1000274924 | 176 |
| 760 | 3300005564 | Ga0070664_100062029 | Ga0070664_1000620295 | 176 |
| 761 | 3300005564 | Ga0070664_100095386 | Ga0070664_1000953862 | 176 |
| 762 | 3300005564 | Ga0070664_100189800 | Ga0070664_1001898002 | 176 |
| 763 | 3300005564 | Ga0070664_100211040 | Ga0070664_1002110402 | 176 |
| 764 | 3300005577 | Ga0068857_100002228 | Ga0068857_10000222814 | 176 |
| 765 | 3300005577 | Ga0068857_100077812 | Ga0068857_1000778123 | 176 |
| 766 | 3300005577 | Ga0068857_100220596 | Ga0068857_1002205962 | 176 |
| 767 | 3300005578 | Ga0068854_100001268 | Ga0068854_1000012684 | 176 |
| 768 | 3300005578 | Ga0068854_100032779 | Ga0068854_1000327793 | 176 |
| 769 | 3300005578 | Ga0068854_100047917 | Ga0068854_1000479173 | 176 |
| 770 | 3300005578 | Ga0068854_100336285 | Ga0068854_1003362852 | 176 |
| 771 | 3300005578 | Ga0068854_100630093 | Ga0068854_1006300932 | 176 |
| 772 | 3300005614 | Ga0068856_100009521 | Ga0068856_1000095214 | 176 |
| 773 | 3300005614 | Ga0068856_100010100 | Ga0068856_1000101003 | 176 |
| 774 | 3300005614 | Ga0068856_100014195 | Ga0068856_1000141954 | 176 |
| 775 | 3300005614 | Ga0068856_100346149 | Ga0068856_1003461492 | 176 |
| 776 | 3300005614 | Ga0068856_100563198 | Ga0068856_1005631982 | 176 |
| 777 | 3300005615 | Ga0070702_100045073 | Ga0070702_1000450733 | 176 |
| 778 | 3300005616 | Ga0068852_100000747 | Ga0068852_10000074710 | 176 |
| 779 | 3300005616 | Ga0068852_100011476 | Ga0068852_1000114763 | 176 |
| 780 | 3300005616 | Ga0068852_100036571 | Ga0068852_1000365714 | 176 |
| 781 | 3300005616 | Ga0068852_100084656 | Ga0068852_1000846562 | 176 |
| 782 | 3300005616 | Ga0068852_100338096 | Ga0068852_1003380962 | 176 |
| 783 | 3300005616 | Ga0068852_100659279 | Ga0068852_1006592792 | 176 |
| 784 | 3300005616 | Ga0068852_101909201 | Ga0068852_1019092011 | 176 |
| 785 | 3300005617 | Ga0068859_100034976 | Ga0068859_1000349766 | 176 |
| 786 | 3300005617 | Ga0068859_100329033 | Ga0068859_1003290332 | 176 |
| 787 | 3300005618 | Ga0068864_100007420 | Ga0068864_1000074204 | 176 |
| 788 | 3300005618 | Ga0068864_100129351 | Ga0068864_1001293513 | 176 |
| 789 | 3300005718 | Ga0068866_10006272 | Ga0068866_100062724 | 176 |
| 790 | 3300005719 | Ga0068861_100222727 | Ga0068861_1002227273 | 176 |
| 791 | 3300005719 | Ga0068861_100297204 | Ga0068861_1002972042 | 176 |
| 792 | 3300005834 | Ga0068851_10001339 | Ga0068851_100013396 | 176 |
| 793 | 3300005834 | Ga0068851_10022933 | Ga0068851_100229332 | 176 |
| 794 | 3300005834 | Ga0068851_10240977 | Ga0068851_102409772 | 176 |
| 795 | 3300005834 | Ga0068851_10283158 | Ga0068851_102831582 | 176 |
| 796 | 3300005840 | Ga0068870_10000678 | Ga0068870_100006789 | 176 |
| 797 | 3300005840 | Ga0068870_10010445 | Ga0068870_100104456 | 176 |
| 798 | 3300005841 | Ga0068863_100015023 | Ga0068863_1000150237 | 176 |
| 799 | 3300005841 | Ga0068863_101084809 | Ga0068863_1010848092 | 176 |
| 800 | 3300005842 | Ga0068858_100087650 | Ga0068858_1000876503 | 176 |
| 801 | 3300005842 | Ga0068858_100546656 | Ga0068858_1005466562 | 176 |
| 802 | 3300005843 | Ga0068860_100029370 | Ga0068860_1000293706 | 176 |
| 803 | 3300005843 | Ga0068860_100117230 | Ga0068860_1001172302 | 176 |
| 804 | 3300005843 | Ga0068860_101409600 | Ga0068860_1014096001 | 176 |
| 805 | 3300005985 | Ga0081539_10061466 | Ga0081539_100614662 | 176 |
| 806 | 3300006028 | Ga0070717_10847925 | Ga0070717_108479252 | 176 |
| 807 | 3300006175 | Ga0070712_100006588 | Ga0070712_1000065882 | 176 |
| 808 | 3300006175 | Ga0070712_100228820 | Ga0070712_1002288201 | 176 |
| 809 | 3300006175 | Ga0070712_100573222 | Ga0070712_1005732222 | 176 |
| 810 | 3300006237 | Ga0097621_100025558 | Ga0097621_1000255583 | 176 |
| 811 | 3300006358 | Ga0068871_100045202 | Ga0068871_1000452025 | 176 |
| 812 | 3300006844 | Ga0075428_100012305 | Ga0075428_10001230513 | 176 |
| 813 | 3300006847 | Ga0075431_100253341 | Ga0075431_1002533413 | 176 |
| 814 | 3300006881 | Ga0068865_100005637 | Ga0068865_1000056373 | 176 |
| 815 | 3300006881 | Ga0068865_100100061 | Ga0068865_1001000614 | 176 |
| 816 | 3300006931 | Ga0097620_100034970 | Ga0097620_1000349702 | 176 |
| 817 | 3300006931 | Ga0097620_100329028 | Ga0097620_1003290282 | 176 |
| 818 | 3300007076 | Ga0075435_100547568 | Ga0075435_1005475682 | 176 |
| 819 | 3300009093 | Ga0105240_10041920 | Ga0105240_100419202 | 176 |
| 820 | 3300009094 | Ga0111539_10014858 | Ga0111539_100148585 | 176 |
| 821 | 3300009094 | Ga0111539_10225476 | Ga0111539_102254762 | 176 |
| 822 | 3300009098 | Ga0105245_10435567 | Ga0105245_104355672 | 176 |
| 823 | 3300009174 | Ga0105241_10057563 | Ga0105241_100575633 | 176 |
| 824 | 3300009551 | Ga0105238_10000203 | Ga0105238_100002039 | 176 |
| 825 | 3300009551 | Ga0105238_11056367 | Ga0105238_110563672 | 176 |
| 826 | 3300009553 | Ga0105249_10059017 | Ga0105249_100590174 | 176 |
| 827 | 3300010375 | Ga0105239_10122686 | Ga0105239_101226863 | 176 |
| 828 | 3300011119 | Ga0105246_10133326 | Ga0105246_101333262 | 176 |
| 829 | 3300012512 | Ga0157327_1022151 | Ga0157327_10221511 | 176 |
| 830 | 3300013100 | Ga0157373_10066925 | Ga0157373_100669253 | 176 |
| 831 | 3300013100 | Ga0157373_10493094 | Ga0157373_104930942 | 176 |
| 832 | 3300013102 | Ga0157371_10121909 | Ga0157371_101219092 | 176 |
| 833 | 3300013102 | Ga0157371_10188164 | Ga0157371_101881641 | 176 |
| 834 | 3300013104 | Ga0157370_10002318 | Ga0157370_1000231820 | 176 |
| 835 | 3300013104 | Ga0157370_10023441 | Ga0157370_100234412 | 176 |
| 836 | 3300013104 | Ga0157370_10028348 | Ga0157370_100283484 | 176 |
| 837 | 3300013104 | Ga0157370_10042276 | Ga0157370_100422765 | 176 |
| 838 | 3300013104 | Ga0157370_10442643 | Ga0157370_104426432 | 176 |
| 839 | 3300013104 | Ga0157370_10973106 | Ga0157370_109731062 | 176 |
| 840 | 3300013105 | Ga0157369_10002800 | Ga0157369_1000280016 | 176 |
| 841 | 3300013105 | Ga0157369_10036003 | Ga0157369_100360031 | 176 |
| 842 | 3300013105 | Ga0157369_10113198 | Ga0157369_101131983 | 176 |
| 843 | 3300013105 | Ga0157369_10124564 | Ga0157369_101245642 | 176 |
| 844 | 3300013105 | Ga0157369_10287993 | Ga0157369_102879932 | 176 |
| 845 | 3300013296 | Ga0157374_10004010 | Ga0157374_100040108 | 176 |
| 846 | 3300013296 | Ga0157374_10014918 | Ga0157374_100149188 | 176 |
| 847 | 3300013296 | Ga0157374_10083135 | Ga0157374_100831353 | 176 |
| 848 | 3300013296 | Ga0157374_10150613 | Ga0157374_101506132 | 176 |
| 849 | 3300013297 | Ga0157378_10032854 | Ga0157378_100328544 | 176 |
| 850 | 3300013306 | Ga0163162_10155135 | Ga0163162_101551353 | 176 |
| 851 | 3300013306 | Ga0163162_10241078 | Ga0163162_102410784 | 176 |
| 852 | 3300013307 | Ga0157372_10012621 | Ga0157372_100126213 | 176 |
| 853 | 3300013307 | Ga0157372_10013023 | Ga0157372_100130238 | 176 |
| 854 | 3300013307 | Ga0157372_10017319 | Ga0157372_100173198 | 176 |
| 855 | 3300013307 | Ga0157372_10170167 | Ga0157372_101701673 | 176 |
| 856 | 3300013307 | Ga0157372_10288023 | Ga0157372_102880232 | 176 |
| 857 | 3300013307 | Ga0157372_10504758 | Ga0157372_105047581 | 176 |
| 858 | 3300013307 | Ga0157372_11706998 | Ga0157372_117069981 | 176 |
| 859 | 3300013308 | Ga0157375_10060397 | Ga0157375_100603973 | 176 |
| 860 | 3300013308 | Ga0157375_10071917 | Ga0157375_100719174 | 176 |
| 861 | 3300014325 | Ga0163163_10074237 | Ga0163163_100742372 | 176 |
| 862 | 3300014325 | Ga0163163_10219107 | Ga0163163_102191073 | 176 |
| 863 | 3300014326 | Ga0157380_10030772 | Ga0157380_100307724 | 176 |
| 864 | 3300014745 | Ga0157377_10001980 | Ga0157377_100019806 | 176 |
| 865 | 3300014968 | Ga0157379_10008248 | Ga0157379_100082489 | 176 |
| 866 | 3300014968 | Ga0157379_10623796 | Ga0157379_106237961 | 176 |
| 867 | 3300014969 | Ga0157376_10103274 | Ga0157376_101032742 | 176 |
| 868 | 3300017792 | Ga0163161_10039466 | Ga0163161_100394664 | 176 |
| 869 | 3300021384 | Ga0213876_10407639 | Ga0213876_104076392 | 176 |
| 870 | 3300021388 | Ga0213875_10157511 | Ga0213875_101575112 | 176 |
| 871 | 3300025271 | Ga0207666_1002421 | Ga0207666_10024213 | 176 |
| 872 | 3300025290 | Ga0207673_1026557 | Ga0207673_10265571 | 176 |
| 873 | 3300025315 | Ga0207697_10000014 | Ga0207697_1000001414 | 176 |
| 874 | 3300025321 | Ga0207656_10002066 | Ga0207656_100020669 | 176 |
| 875 | 3300025321 | Ga0207656_10013641 | Ga0207656_100136413 | 176 |
| 876 | 3300025321 | Ga0207656_10100921 | Ga0207656_101009212 | 176 |
| 877 | 3300025321 | Ga0207656_10178101 | Ga0207656_101781012 | 176 |
| 878 | 3300025893 | Ga0207682_10000063 | Ga0207682_1000006333 | 176 |
| 879 | 3300025893 | Ga0207682_10000095 | Ga0207682_1000009514 | 176 |
| 880 | 3300025901 | Ga0207688_10003261 | Ga0207688_100032614 | 176 |
| 881 | 3300025903 | Ga0207680_10031208 | Ga0207680_100312081 | 176 |
| 882 | 3300025903 | Ga0207680_10274899 | Ga0207680_102748992 | 176 |
| 883 | 3300025906 | Ga0207699_10107559 | Ga0207699_101075591 | 176 |
| 884 | 3300025906 | Ga0207699_10395103 | Ga0207699_103951032 | 176 |
| 885 | 3300025907 | Ga0207645_10000195 | Ga0207645_100001958 | 176 |
| 886 | 3300025907 | Ga0207645_10000272 | Ga0207645_1000027215 | 176 |
| 887 | 3300025909 | Ga0207705_10057701 | Ga0207705_100577013 | 176 |
| 888 | 3300025909 | Ga0207705_10069083 | Ga0207705_100690832 | 176 |
| 889 | 3300025909 | Ga0207705_10139359 | Ga0207705_101393593 | 176 |
| 890 | 3300025909 | Ga0207705_10204525 | Ga0207705_102045252 | 176 |
| 891 | 3300025912 | Ga0207707_10020894 | Ga0207707_100208947 | 176 |
| 892 | 3300025913 | Ga0207695_10346066 | Ga0207695_103460662 | 176 |
| 893 | 3300025915 | Ga0207693_10082708 | Ga0207693_100827082 | 176 |
| 894 | 3300025915 | Ga0207693_10142232 | Ga0207693_101422322 | 176 |
| 895 | 3300025915 | Ga0207693_10664248 | Ga0207693_106642482 | 176 |
| 896 | 3300025916 | Ga0207663_10190513 | Ga0207663_101905132 | 176 |
| 897 | 3300025916 | Ga0207663_10326310 | Ga0207663_103263101 | 176 |
| 898 | 3300025917 | Ga0207660_10213887 | Ga0207660_102138873 | 176 |
| 899 | 3300025918 | Ga0207662_10000912 | Ga0207662_1000091212 | 176 |
| 900 | 3300025919 | Ga0207657_10004987 | Ga0207657_1000498711 | 176 |
| 901 | 3300025919 | Ga0207657_10012259 | Ga0207657_100122593 | 176 |
| 902 | 3300025919 | Ga0207657_10022831 | Ga0207657_100228316 | 176 |
| 903 | 3300025919 | Ga0207657_10236341 | Ga0207657_102363412 | 176 |
| 904 | 3300025920 | Ga0207649_10009816 | Ga0207649_100098162 | 176 |
| 905 | 3300025920 | Ga0207649_10025686 | Ga0207649_100256863 | 176 |
| 906 | 3300025920 | Ga0207649_10201175 | Ga0207649_102011752 | 176 |
| 907 | 3300025920 | Ga0207649_10248626 | Ga0207649_102486262 | 176 |
| 908 | 3300025921 | Ga0207652_10015332 | Ga0207652_100153326 | 176 |
| 909 | 3300025921 | Ga0207652_10119511 | Ga0207652_101195112 | 176 |
| 910 | 3300025923 | Ga0207681_10420197 | Ga0207681_104201972 | 176 |
| 911 | 3300025925 | Ga0207650_10001076 | Ga0207650_100010766 | 176 |
| 912 | 3300025925 | Ga0207650_10021897 | Ga0207650_100218974 | 176 |
| 913 | 3300025925 | Ga0207650_10022444 | Ga0207650_100224446 | 176 |
| 914 | 3300025925 | Ga0207650_10312521 | Ga0207650_103125212 | 176 |
| 915 | 3300025926 | Ga0207659_10066317 | Ga0207659_100663174 | 176 |
| 916 | 3300025926 | Ga0207659_10110814 | Ga0207659_101108143 | 176 |
| 917 | 3300025928 | Ga0207700_10894649 | Ga0207700_108946492 | 176 |
| 918 | 3300025929 | Ga0207664_10015354 | Ga0207664_100153542 | 176 |
| 919 | 3300025929 | Ga0207664_10029527 | Ga0207664_100295274 | 176 |
| 920 | 3300025929 | Ga0207664_10409657 | Ga0207664_104096571 | 176 |
| 921 | 3300025931 | Ga0207644_10035859 | Ga0207644_100358593 | 176 |
| 922 | 3300025931 | Ga0207644_10062600 | Ga0207644_100626003 | 176 |
| 923 | 3300025931 | Ga0207644_10089814 | Ga0207644_100898142 | 176 |
| 924 | 3300025931 | Ga0207644_10228080 | Ga0207644_102280803 | 176 |
| 925 | 3300025932 | Ga0207690_10039530 | Ga0207690_100395303 | 176 |
| 926 | 3300025932 | Ga0207690_10181577 | Ga0207690_101815772 | 176 |
| 927 | 3300025932 | Ga0207690_10418345 | Ga0207690_104183451 | 176 |
| 928 | 3300025933 | Ga0207706_10003208 | Ga0207706_100032088 | 176 |
| 929 | 3300025933 | Ga0207706_10217143 | Ga0207706_102171433 | 176 |
| 930 | 3300025933 | Ga0207706_10502493 | Ga0207706_105024932 | 176 |
| 931 | 3300025935 | Ga0207709_10040893 | Ga0207709_100408933 | 176 |
| 932 | 3300025936 | Ga0207670_10027509 | Ga0207670_100275093 | 176 |
| 933 | 3300025937 | Ga0207669_10331376 | Ga0207669_103313762 | 176 |
| 934 | 3300025937 | Ga0207669_10424313 | Ga0207669_104243132 | 176 |
| 935 | 3300025938 | Ga0207704_10028126 | Ga0207704_100281264 | 176 |
| 936 | 3300025938 | Ga0207704_10140063 | Ga0207704_101400632 | 176 |
| 937 | 3300025938 | Ga0207704_10283973 | Ga0207704_102839732 | 176 |
| 938 | 3300025940 | Ga0207691_10000370 | Ga0207691_1000037025 | 176 |
| 939 | 3300025940 | Ga0207691_10007916 | Ga0207691_100079168 | 176 |
| 940 | 3300025940 | Ga0207691_10157952 | Ga0207691_101579521 | 176 |
| 941 | 3300025941 | Ga0207711_10048744 | Ga0207711_100487443 | 176 |
| 942 | 3300025941 | Ga0207711_10173840 | Ga0207711_101738403 | 176 |
| 943 | 3300025942 | Ga0207689_10032390 | Ga0207689_100323903 | 176 |
| 944 | 3300025942 | Ga0207689_10091063 | Ga0207689_100910633 | 176 |
| 945 | 3300025944 | Ga0207661_10018687 | Ga0207661_100186872 | 176 |
| 946 | 3300025944 | Ga0207661_10038291 | Ga0207661_100382914 | 176 |
| 947 | 3300025944 | Ga0207661_10073347 | Ga0207661_100733474 | 176 |
| 948 | 3300025945 | Ga0207679_10036494 | Ga0207679_100364944 | 176 |
| 949 | 3300025945 | Ga0207679_10043134 | Ga0207679_100431342 | 176 |
| 950 | 3300025945 | Ga0207679_10060342 | Ga0207679_100603422 | 176 |
| 951 | 3300025945 | Ga0207679_10156336 | Ga0207679_101563362 | 176 |
| 952 | 3300025949 | Ga0207667_10062236 | Ga0207667_100622364 | 176 |
| 953 | 3300025949 | Ga0207667_10097341 | Ga0207667_100973414 | 176 |
| 954 | 3300025949 | Ga0207667_10114813 | Ga0207667_101148134 | 176 |
| 955 | 3300025949 | Ga0207667_10506389 | Ga0207667_105063891 | 176 |
| 956 | 3300025960 | Ga0207651_10030929 | Ga0207651_100309293 | 176 |
| 957 | 3300025960 | Ga0207651_10868711 | Ga0207651_108687112 | 176 |
| 958 | 3300025961 | Ga0207712_10425023 | Ga0207712_104250232 | 176 |
| 959 | 3300025972 | Ga0207668_10078492 | Ga0207668_100784924 | 176 |
| 960 | 3300025972 | Ga0207668_10127133 | Ga0207668_101271333 | 176 |
| 961 | 3300025981 | Ga0207640_10027491 | Ga0207640_100274913 | 176 |
| 962 | 3300025981 | Ga0207640_10048929 | Ga0207640_100489292 | 176 |
| 963 | 3300025981 | Ga0207640_10645080 | Ga0207640_106450802 | 176 |
| 964 | 3300025986 | Ga0207658_10017007 | Ga0207658_100170077 | 176 |
| 965 | 3300025986 | Ga0207658_10076248 | Ga0207658_100762483 | 176 |
| 966 | 3300025986 | Ga0207658_10213822 | Ga0207658_102138223 | 176 |
| 967 | 3300026023 | Ga0207677_10035978 | Ga0207677_100359784 | 176 |
| 968 | 3300026023 | Ga0207677_10451734 | Ga0207677_104517342 | 176 |
| 969 | 3300026035 | Ga0207703_10012702 | Ga0207703_100127029 | 176 |
| 970 | 3300026035 | Ga0207703_10072589 | Ga0207703_100725893 | 176 |
| 971 | 3300026035 | Ga0207703_10158271 | Ga0207703_101582712 | 176 |
| 972 | 3300026041 | Ga0207639_10021665 | Ga0207639_100216657 | 176 |
| 973 | 3300026041 | Ga0207639_10155242 | Ga0207639_101552423 | 176 |
| 974 | 3300026041 | Ga0207639_10770883 | Ga0207639_107708832 | 176 |
| 975 | 3300026067 | Ga0207678_10001520 | Ga0207678_1000152010 | 176 |
| 976 | 3300026067 | Ga0207678_10001630 | Ga0207678_100016303 | 176 |
| 977 | 3300026067 | Ga0207678_10898481 | Ga0207678_108984811 | 176 |
| 978 | 3300026075 | Ga0207708_10000766 | Ga0207708_100007666 | 176 |
| 979 | 3300026078 | Ga0207702_10003131 | Ga0207702_100031312 | 176 |
| 980 | 3300026078 | Ga0207702_10024909 | Ga0207702_100249092 | 176 |
| 981 | 3300026078 | Ga0207702_10126442 | Ga0207702_101264423 | 176 |
| 982 | 3300026078 | Ga0207702_10223165 | Ga0207702_102231652 | 176 |
| 983 | 3300026078 | Ga0207702_10376831 | Ga0207702_103768312 | 176 |
| 984 | 3300026088 | Ga0207641_10088036 | Ga0207641_100880363 | 176 |
| 985 | 3300026088 | Ga0207641_10609563 | Ga0207641_106095632 | 176 |
| 986 | 3300026089 | Ga0207648_10001587 | Ga0207648_100015878 | 176 |
| 987 | 3300026089 | Ga0207648_10009913 | Ga0207648_100099137 | 176 |
| 988 | 3300026095 | Ga0207676_10022855 | Ga0207676_100228552 | 176 |
| 989 | 3300026095 | Ga0207676_11334250 | Ga0207676_113342501 | 176 |
| 990 | 3300026116 | Ga0207674_10000380 | Ga0207674_1000038027 | 176 |
| 991 | 3300026116 | Ga0207674_10002124 | Ga0207674_100021243 | 176 |
| 992 | 3300026116 | Ga0207674_10372930 | Ga0207674_103729302 | 176 |
| 993 | 3300026118 | Ga0207675_100034669 | Ga0207675_1000346696 | 176 |
| 994 | 3300026118 | Ga0207675_100132847 | Ga0207675_1001328472 | 176 |
| 995 | 3300026121 | Ga0207683_10000009 | Ga0207683_100000093 | 176 |
| 996 | 3300026142 | Ga0207698_10004799 | Ga0207698_100047998 | 176 |
| 997 | 3300026142 | Ga0207698_10064043 | Ga0207698_100640433 | 176 |
| 998 | 3300026142 | Ga0207698_10145280 | Ga0207698_101452802 | 176 |
| 999 | 3300026142 | Ga0207698_10701601 | Ga0207698_107016012 | 176 |
| 1000 | 3300027907 | Ga0207428_10137186 | Ga0207428_101371862 | 176 |
| 1001 | 3300028379 | Ga0268266_10033290 | Ga0268266_100332903 | 176 |
| 1002 | 3300028379 | Ga0268266_10057199 | Ga0268266_100571994 | 176 |
| 1003 | 3300028379 | Ga0268266_10371045 | Ga0268266_103710452 | 176 |
| 1004 | 3300028380 | Ga0268265_10120257 | Ga0268265_101202573 | 176 |
| 1005 | 3300028381 | Ga0268264_10162960 | Ga0268264_101629603 | 176 |
| 1006 | 3300028381 | Ga0268264_10321554 | Ga0268264_103215542 | 176 |
| 1007 | 3300031507 | Ga0307509_10262646 | Ga0307509_102626462 | 176 |
| 1008 | 3300035091 | Ga0373951_0115099 | Ga0373951_0115099_162_692 | 176 |
| 1009 | 3300035111 | Ga0373923_0020158 | Ga0373923_0020158_1048_1578 | 176 |
| 1010 | 3300035112 | Ga0373932_0120889 | Ga0373932_0120889_60_590 | 176 |
| 1011 | 3300035114 | Ga0373939_0110456 | Ga0373939_0110456_233_763 | 176 |
| 1012 | 3300035116 | Ga0373945_0081893 | Ga0373945_0081893_16_546 | 176 |
| 1013 | 3300035117 | Ga0373953_0096997 | Ga0373953_0096997_654_1184 | 176 |
| 1014 | 3300035120 | Ga0373957_0025593 | Ga0373957_0025593_1245_1775 | 176 |
| 1015 | 3300035170 | Ga0373943_0381469 | Ga0373943_0381469_48_578 | 176 |
| 1016 | 3300035171 | Ga0373946_0134604 | Ga0373946_0134604_539_1069 | 176 |
| 1017 | 3300035172 | Ga0373955_0150885 | Ga0373955_0150885_671_1201 | 176 |
| 1018 | 3300035695 | Ga0373927_0041304 | Ga0373927_0041304_2078_2608 | 176 |
| 1019 | 3300036401 | Ga0373937_0033053 | Ga0373937_0033053_3164_3694 | 176 |
| 1020 | 3300037068 | Ga0373925_1467844 | Ga0373925_1467844_12_542 | 176 |
| 1021 | 3300037418 | Ga0395900_0146643 | Ga0395900_0146643_786_1322 | 176 |
| 1022 | 3300037418 | Ga0395900_0361380 | Ga0395900_0361380_99_632 | 176 |
| 1023 | 3300037466 | Ga0395898_0228371 | Ga0395898_0228371_1045_1581 | 176 |
| 1024 | 3300037471 | Ga0395905_0733702 | Ga0395905_0733702_106_639 | 176 |
| 1025 | 3300037471 | Ga0395905_0977154 | Ga0395905_0977154_20_556 | 176 |
| 1026 | 3300037853 | Ga0436364_0347944 | Ga0436364_0347944_164_697 | 176 |
| 1027 | 3300038443 | Ga0395901_0016161 | Ga0395901_0016161_5322_5858 | 176 |
| 1028 | 3300038996 | Ga0242420_007801 | Ga0242420_007801_171_704 | 176 |
| 1029 | 3300039437 | Ga0436365_0010487 | Ga0436365_0010487_167_700 | 176 |
| 1030 | 3300042876 | Ga0451577_0181831 | Ga0451577_0181831_318_851 | 176 |
| 1031 | 3300045976 | Ga0466967_0007594 | Ga0466967_0007594_5735_6268 | 176 |
| 1032 | 3300046539 | Ga0495621_0020372 | Ga0495621_0020372_329_859 | 176 |
| 1033 | 3300046681 | Ga0495647_0456153 | Ga0495647_0456153_18_548 | 176 |
| 1034 | 3300048903 | Ga0496100_0010409 | Ga0496100_0010409_3764_4294 | 176 |
| 1035 | 3300048904 | Ga0496101_0025506 | Ga0496101_0025506_1922_2452 | 176 |
| 1036 | 3300048905 | Ga0496102_0125550 | Ga0496102_0125550_1477_2007 | 176 |
| 1037 | 3300048905 | Ga0496102_1165984 | Ga0496102_1165984_18_584 | 176 |
| 1038 | 3300048907 | Ga0496104_0032530 | Ga0496104_0032530_441_971 | 176 |
| 1039 | 3300048907 | Ga0496104_1051436 | Ga0496104_1051436_134_667 | 176 |
| 1040 | 3300048908 | Ga0496105_0027850 | Ga0496105_0027850_1698_2228 | 176 |
| 1041 | 3300048908 | Ga0496105_0520203 | Ga0496105_0520203_171_704 | 176 |
| 1042 | 3300048909 | Ga0496106_0020112 | Ga0496106_0020112_3139_3669 | 176 |
| 1043 | 3300048909 | Ga0496106_0552112 | Ga0496106_0552112_31_576 | 176 |
| 1044 | 3300048911 | Ga0496108_0005015 | Ga0496108_0005015_6818_7348 | 176 |
| 1045 | 3300048911 | Ga0496108_0259968 | Ga0496108_0259968_234_779 | 176 |
| 1046 | 3300048912 | Ga0496109_0006657 | Ga0496109_0006657_6863_7393 | 176 |
| 1047 | 3300048913 | Ga0496110_0053145 | Ga0496110_0053145_749_1279 | 176 |
| 1048 | 3300048913 | Ga0496110_0424644 | Ga0496110_0424644_567_1100 | 176 |
| 1049 | 3300048914 | Ga0496111_0120130 | Ga0496111_0120130_86_619 | 176 |
| 1050 | 3300048914 | Ga0496111_0129251 | Ga0496111_0129251_658_1188 | 176 |
| 1051 | 3300048915 | Ga0496112_0094577 | Ga0496112_0094577_1098_1631 | 176 |
| 1052 | 3300048917 | Ga0496114_0034583 | Ga0496114_0034583_1458_1988 | 176 |
| 1053 | 3300048917 | Ga0496114_0645144 | Ga0496114_0645144_81_626 | 176 |
| 1054 | 3300048929 | Ga0496126_0225961 | Ga0496126_0225961_92_625 | 176 |
| 1055 | 3300049572 | Ga0501036_0229255 | Ga0501036_0229255_850_1383 | 176 |
| 1056 | 3300049575 | Ga0501039_0115578 | Ga0501039_0115578_1119_1664 | 176 |
| 1057 | 3300049587 | Ga0501071_0845715 | Ga0501071_0845715_149_682 | 176 |
| 1058 | 3300049588 | Ga0501072_0167596 | Ga0501072_0167596_1001_1534 | 176 |
| 1059 | 3300049590 | Ga0501074_0150830 | Ga0501074_0150830_943_1476 | 176 |
| 1060 | 3300049591 | Ga0501075_0207093 | Ga0501075_0207093_154_699 | 176 |
| 1061 | 3300049592 | Ga0501076_0043398 | Ga0501076_0043398_1304_1837 | 176 |
| 1062 | 3300049742 | Ga0501080_0625352 | Ga0501080_0625352_242_775 | 176 |
| 1063 | 3300049743 | Ga0501081_0016390 | Ga0501081_0016390_2165_2698 | 176 |
| 1064 | 3300049823 | Ga0501044_0606121 | Ga0501044_0606121_117_650 | 176 |
| 1065 | 3300050511 | nmdc:mga08y16_18487_c1 | nmdc:mga08y16_18487_c1_1055_1585 | 176 |
| 1066 | 3300053085 | Ga0495619_0107073 | Ga0495619_0107073_394_924 | 176 |
| 1067 | 3300053111 | Ga0500572_097851 | Ga0500572_097851_86_622 | 176 |
| 1068 | 3300053728 | Ga0500657_163216 | Ga0500657_163216_165_698 | 176 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ks5-assembly1.cif.gz_A | structure of the c-terminal helical repeat domain of elongation factor 2 kinase | 0.3126 | 41 | 96 |
| 8hlm-assembly1.cif.gz_B | crystal structure of p53/bcl2 fusion complex (complex 2) | 0.288 | 5 | 116 |
| 8iql-assembly2.cif.gz_A | structural basis of the specificity and interaction mechanism of bmf binding to pro-survival proteins | 0.2742 | 9 | 116 |
| 1h8h-assembly1.cif.gz_G | bovine mitochondrial f1-atpase crystallised in the presence of 5mm amppnp | 0.2657 | 5 | 126 |
| 5fig-assembly1.cif.gz_D | apo-csp3 (copper storage protein 3) from bacillus subtilis | 0.2632 | 4 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7KG28_154_219_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.3857 | 32 | 92 | 1.25.40.10 |
| af_K7KG28_154_219_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.3594 | 32 | 92 | 1.25.40.10 |
| af_P69801_5_237_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.3559 | 14 | 171 | 1.10.1760.20 |
| af_O06539_1_164_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.3501 | 9 | 96 | 1.20.120.1630 |
| af_Q7T366_1_120_1.20.58.90 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.3499 | 3 | 108 | 1.20.58.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J5V7S9-F1-model_v4 | Chromate transporter | 0.9417 | 7 | 95 |
GO:0005886
GO:0015109 |
| AF-A0A6I7NH68-F1-model_v4 | Chromate transporter | 0.9375 | 7 | 174 |
GO:0005886
GO:0015109 |
| AF-A0A857EJ66-F1-model_v4 | deleted | 0.9369 | 4 | 173 |
|
| AF-A0A7X0DLP4-F1-model_v4 | Chromate transporter | 0.9363 | 1 | 173 |
GO:0005886
GO:0015109 |
| AF-A0A1H4R8G3-F1-model_v4 | Chromate transporter | 0.9354 | 3 | 171 |
GO:0005886
GO:0015109 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar