F489404
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1066 | 378 | 1066 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100280122|Ga0307408_1002801221 |
| Length | 132 |
| Sequence | MAYVDGFLLPVPKKNLPRYRSIARRAGKVWMEHGALEYRESVADDLGKMSRGFGQGVRIKGGEVAMFSWIVYRSKRDRDRINRLVLKDPRILALMTPSNQIFDDKRMAYGGFRTIVDLAIKGTGHRAKAKKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 123 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300025227 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 207 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 208 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 209 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 212 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 213 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 214 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 215 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 218 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 222 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 229 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 230 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 238 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 245 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 246 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 247 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 248 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 249 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 250 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 251 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 254 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 255 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 298 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 299 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 300 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 301 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 302 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 305 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 306 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 307 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 308 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 309 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 310 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 311 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 312 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 313 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 314 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 315 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 316 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 317 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 318 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 320 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 352 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 353 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 354 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 356 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 370 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 374 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 376 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.94 |
| Nodule | 0 |
| Rhizoplane | 4.13 |
| Rhizosphere | 89.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_442106 | 2162886007 | Bacteria | 1269 |
| 2 | SwRhRL2b_contig_844195 | 2162886007 | Bacteria | 2972 |
| 3 | JGI24746J21847_1031565 | 3300001977 | Bacteria | 730 |
| 4 | JGI24739J22299_10162950 | 3300001989 | Bacteria | 658 |
| 5 | JGI24737J22298_10022369 | 3300001990 | Bacteria | 2010 |
| 6 | JGI24743J22301_10000289 | 3300001991 | Bacteria | 5445 |
| 7 | JGI24750J21931_1002677 | 3300002070 | Bacteria | 2137 |
| 8 | JGI24748J21848_1044144 | 3300002074 | Bacteria | 572 |
| 9 | JGI24738J21930_10156264 | 3300002075 | Bacteria | 509 |
| 10 | JGI24744J21845_10001142 | 3300002077 | Bacteria | 5162 |
| 11 | JGI24744J21845_10101059 | 3300002077 | Unclassified | 532 |
| 12 | JGI24033J26618_1003370 | 3300002155 | Bacteria | 1683 |
| 13 | JGI24742J22300_10043033 | 3300002244 | Bacteria | 807 |
| 14 | JGI24742J22300_10085329 | 3300002244 | Bacteria | 600 |
| 15 | JGI24751J29686_10003925 | 3300002459 | Bacteria | 3004 |
| 16 | rootH2_10015358 | 3300003320 | Bacteria | 34751 |
| 17 | rootH1_10157129 | 3300003323 | Bacteria | 5023 |
| 18 | JGI25407J50210_10147166 | 3300003373 | Bacteria | 580 |
| 19 | Ga0065715_10759263 | 3300005293 | Bacteria | 626 |
| 20 | Ga0065707_10349446 | 3300005295 | Bacteria | 921 |
| 21 | Ga0065707_10546411 | 3300005295 | Bacteria | 724 |
| 22 | Ga0065707_10598815 | 3300005295 | Bacteria | 681 |
| 23 | Ga0065707_10636514 | 3300005295 | Bacteria | 670 |
| 24 | Ga0065707_10800179 | 3300005295 | Bacteria | 599 |
| 25 | Ga0070676_10129134 | 3300005328 | Bacteria | 1596 |
| 26 | Ga0070676_10397834 | 3300005328 | Bacteria | 958 |
| 27 | Ga0070676_10575923 | 3300005328 | Bacteria | 809 |
| 28 | Ga0070683_102086620 | 3300005329 | Bacteria | 544 |
| 29 | Ga0070690_100009413 | 3300005330 | Bacteria | 5658 |
| 30 | Ga0070690_100041690 | 3300005330 | Bacteria | 2906 |
| 31 | Ga0070690_100612470 | 3300005330 | Bacteria | 828 |
| 32 | Ga0070690_100716923 | 3300005330 | Bacteria | 769 |
| 33 | Ga0070670_100173351 | 3300005331 | Bacteria | 1871 |
| 34 | Ga0070670_100812416 | 3300005331 | Bacteria | 845 |
| 35 | Ga0070677_10016023 | 3300005333 | Bacteria | 2663 |
| 36 | Ga0070677_10042171 | 3300005333 | Bacteria | 1805 |
| 37 | Ga0070677_10179249 | 3300005333 | Bacteria | 1008 |
| 38 | Ga0070677_10211260 | 3300005333 | Bacteria | 942 |
| 39 | Ga0068869_100039936 | 3300005334 | Bacteria | 3353 |
| 40 | Ga0068869_100104321 | 3300005334 | Bacteria | 2149 |
| 41 | Ga0068869_100703600 | 3300005334 | Bacteria | 862 |
| 42 | Ga0068869_101000833 | 3300005334 | Unclassified | 728 |
| 43 | Ga0068869_101492468 | 3300005334 | Bacteria | 600 |
| 44 | Ga0068869_101741194 | 3300005334 | Bacteria | 557 |
| 45 | Ga0070666_10411434 | 3300005335 | Bacteria | 973 |
| 46 | Ga0070680_100339665 | 3300005336 | Bacteria | 1276 |
| 47 | Ga0068868_100058792 | 3300005338 | Bacteria | 3039 |
| 48 | Ga0070660_100112452 | 3300005339 | Bacteria | 2168 |
| 49 | Ga0070689_100027085 | 3300005340 | Bacteria | 4319 |
| 50 | Ga0070689_100276349 | 3300005340 | Bacteria | 1392 |
| 51 | Ga0070689_100403657 | 3300005340 | Bacteria | 1156 |
| 52 | Ga0070689_100587071 | 3300005340 | Bacteria | 964 |
| 53 | Ga0070689_100587204 | 3300005340 | Bacteria | 964 |
| 54 | Ga0070691_10062475 | 3300005341 | Bacteria | 1794 |
| 55 | Ga0070691_10382175 | 3300005341 | Bacteria | 789 |
| 56 | Ga0070691_10556161 | 3300005341 | Bacteria | 671 |
| 57 | Ga0070687_100013616 | 3300005343 | Bacteria | 3629 |
| 58 | Ga0070687_100332283 | 3300005343 | Bacteria | 975 |
| 59 | Ga0070687_100879638 | 3300005343 | Bacteria | 641 |
| 60 | Ga0070661_100974151 | 3300005344 | Bacteria | 703 |
| 61 | Ga0070692_10055110 | 3300005345 | Bacteria | 2078 |
| 62 | Ga0070692_10274115 | 3300005345 | Bacteria | 1020 |
| 63 | Ga0070692_10340976 | 3300005345 | Bacteria | 928 |
| 64 | Ga0070668_100071393 | 3300005347 | Bacteria | 2704 |
| 65 | Ga0070668_100163900 | 3300005347 | Bacteria | 1805 |
| 66 | Ga0070668_100165081 | 3300005347 | Bacteria | 1799 |
| 67 | Ga0070668_100421980 | 3300005347 | Bacteria | 1142 |
| 68 | Ga0070668_100499828 | 3300005347 | Bacteria | 1052 |
| 69 | Ga0070668_100781846 | 3300005347 | Bacteria | 847 |
| 70 | Ga0070668_101021219 | 3300005347 | Bacteria | 744 |
| 71 | Ga0070669_100024281 | 3300005353 | Bacteria | 4347 |
| 72 | Ga0070669_100032969 | 3300005353 | Bacteria | 3744 |
| 73 | Ga0070669_100076141 | 3300005353 | Bacteria | 2490 |
| 74 | Ga0070669_101767839 | 3300005353 | Bacteria | 539 |
| 75 | Ga0070675_100021110 | 3300005354 | Bacteria | 5201 |
| 76 | Ga0070675_100195145 | 3300005354 | Bacteria | 1756 |
| 77 | Ga0070675_100474882 | 3300005354 | Bacteria | 1124 |
| 78 | Ga0070675_100490600 | 3300005354 | Bacteria | 1106 |
| 79 | Ga0070674_100008010 | 3300005356 | Bacteria | 6262 |
| 80 | Ga0070674_100013939 | 3300005356 | Bacteria | 4984 |
| 81 | Ga0070674_100019263 | 3300005356 | Bacteria | 4333 |
| 82 | Ga0070674_100039433 | 3300005356 | Bacteria | 3189 |
| 83 | Ga0070674_100308610 | 3300005356 | Bacteria | 1264 |
| 84 | Ga0070674_100793274 | 3300005356 | Bacteria | 817 |
| 85 | Ga0070673_100034287 | 3300005364 | Bacteria | 3839 |
| 86 | Ga0070673_100051856 | 3300005364 | Bacteria | 3216 |
| 87 | Ga0070673_100290422 | 3300005364 | Bacteria | 1437 |
| 88 | Ga0070673_100578887 | 3300005364 | Bacteria | 1022 |
| 89 | Ga0070673_100607969 | 3300005364 | Bacteria | 998 |
| 90 | Ga0070673_100855410 | 3300005364 | Bacteria | 842 |
| 91 | Ga0070673_101019821 | 3300005364 | Bacteria | 771 |
| 92 | Ga0070673_101234034 | 3300005364 | Bacteria | 701 |
| 93 | Ga0070673_101347997 | 3300005364 | Bacteria | 671 |
| 94 | Ga0070688_100006679 | 3300005365 | Bacteria | 6182 |
| 95 | Ga0070688_100030550 | 3300005365 | Bacteria | 3235 |
| 96 | Ga0070688_100066185 | 3300005365 | Bacteria | 2299 |
| 97 | Ga0070688_100093546 | 3300005365 | Bacteria | 1969 |
| 98 | Ga0070688_100176158 | 3300005365 | Bacteria | 1480 |
| 99 | Ga0070688_100221112 | 3300005365 | Bacteria | 1334 |
| 100 | Ga0070659_100006061 | 3300005366 | Bacteria | 8721 |
| 101 | Ga0070659_100151620 | 3300005366 | Bacteria | 1891 |
| 102 | Ga0070659_101051100 | 3300005366 | Bacteria | 716 |
| 103 | Ga0070667_100042351 | 3300005367 | Bacteria | 3821 |
| 104 | Ga0070667_100353143 | 3300005367 | Bacteria | 1331 |
| 105 | Ga0070667_100429111 | 3300005367 | Bacteria | 1206 |
| 106 | Ga0070667_101581259 | 3300005367 | Bacteria | 616 |
| 107 | Ga0070703_10070998 | 3300005406 | Bacteria | 1163 |
| 108 | Ga0070701_10011428 | 3300005438 | Bacteria | 3969 |
| 109 | Ga0070701_10108626 | 3300005438 | Bacteria | 1547 |
| 110 | Ga0070701_10147202 | 3300005438 | Bacteria | 1353 |
| 111 | Ga0070701_10612076 | 3300005438 | Bacteria | 723 |
| 112 | Ga0070701_10815755 | 3300005438 | Bacteria | 638 |
| 113 | Ga0070711_101013505 | 3300005439 | Bacteria | 713 |
| 114 | Ga0070705_100013904 | 3300005440 | Bacteria | 4128 |
| 115 | Ga0070705_100081424 | 3300005440 | Bacteria | 1989 |
| 116 | Ga0070705_100115279 | 3300005440 | Bacteria | 1725 |
| 117 | Ga0070705_100123176 | 3300005440 | Bacteria | 1678 |
| 118 | Ga0070705_100891852 | 3300005440 | Bacteria | 714 |
| 119 | Ga0070700_100001831 | 3300005441 | Bacteria | 10735 |
| 120 | Ga0070700_100024645 | 3300005441 | Bacteria | 3535 |
| 121 | Ga0070700_100213204 | 3300005441 | Bacteria | 1364 |
| 122 | Ga0070700_100272249 | 3300005441 | Bacteria | 1224 |
| 123 | Ga0070700_100354636 | 3300005441 | Bacteria | 1089 |
| 124 | Ga0070700_100425144 | 3300005441 | Bacteria | 1005 |
| 125 | Ga0070700_100570968 | 3300005441 | Bacteria | 882 |
| 126 | Ga0070694_100067189 | 3300005444 | Bacteria | 2461 |
| 127 | Ga0070694_100120415 | 3300005444 | Bacteria | 1882 |
| 128 | Ga0070694_100227034 | 3300005444 | Bacteria | 1403 |
| 129 | Ga0070694_100276844 | 3300005444 | Unclassified | 1278 |
| 130 | Ga0070694_100506881 | 3300005444 | Bacteria | 961 |
| 131 | Ga0070694_100898372 | 3300005444 | Bacteria | 731 |
| 132 | Ga0070694_100934547 | 3300005444 | Bacteria | 717 |
| 133 | Ga0070663_100034544 | 3300005455 | Bacteria | 3502 |
| 134 | Ga0070663_100042205 | 3300005455 | Bacteria | 3204 |
| 135 | Ga0070663_100192677 | 3300005455 | Bacteria | 1587 |
| 136 | Ga0070678_100051594 | 3300005456 | Bacteria | 2982 |
| 137 | Ga0070678_100147121 | 3300005456 | Bacteria | 1893 |
| 138 | Ga0070678_100285946 | 3300005456 | Bacteria | 1396 |
| 139 | Ga0070678_100536330 | 3300005456 | Bacteria | 1037 |
| 140 | Ga0070678_100611740 | 3300005456 | Bacteria | 974 |
| 141 | Ga0070662_100039586 | 3300005457 | Bacteria | 3352 |
| 142 | Ga0070662_100181707 | 3300005457 | Bacteria | 1658 |
| 143 | Ga0070662_100639693 | 3300005457 | Bacteria | 897 |
| 144 | Ga0070662_100779514 | 3300005457 | Bacteria | 812 |
| 145 | Ga0070662_100795103 | 3300005457 | Bacteria | 804 |
| 146 | Ga0070662_101620786 | 3300005457 | Bacteria | 559 |
| 147 | Ga0070681_10066648 | 3300005458 | Bacteria | 3569 |
| 148 | Ga0070681_11166494 | 3300005458 | Bacteria | 692 |
| 149 | Ga0068867_100026934 | 3300005459 | Bacteria | 4131 |
| 150 | Ga0068867_100062864 | 3300005459 | Bacteria | 2759 |
| 151 | Ga0068867_100185720 | 3300005459 | Bacteria | 1656 |
| 152 | Ga0068867_100437315 | 3300005459 | Bacteria | 1112 |
| 153 | Ga0068867_100483201 | 3300005459 | Bacteria | 1062 |
| 154 | Ga0070685_10002826 | 3300005466 | Bacteria | 8871 |
| 155 | Ga0070685_10152406 | 3300005466 | Bacteria | 1466 |
| 156 | Ga0070685_10524535 | 3300005466 | Bacteria | 842 |
| 157 | Ga0070707_100282148 | 3300005468 | Unclassified | 1614 |
| 158 | Ga0070707_101845867 | 3300005468 | Unclassified | 572 |
| 159 | Ga0070698_100020375 | 3300005471 | Bacteria | 6950 |
| 160 | Ga0070698_101671845 | 3300005471 | Unclassified | 589 |
| 161 | Ga0070699_100000012 | 3300005518 | Bacteria | 246521 |
| 162 | Ga0070699_100246708 | 3300005518 | Bacteria | 1595 |
| 163 | Ga0070699_100451974 | 3300005518 | Bacteria | 1165 |
| 164 | Ga0070679_100053571 | 3300005530 | Bacteria | 4016 |
| 165 | Ga0070684_100153697 | 3300005535 | Bacteria | 2086 |
| 166 | Ga0070697_100323693 | 3300005536 | Unclassified | 1328 |
| 167 | Ga0070697_100803916 | 3300005536 | Bacteria | 832 |
| 168 | Ga0070697_101005284 | 3300005536 | Unclassified | 741 |
| 169 | Ga0070697_101961306 | 3300005536 | Unclassified | 524 |
| 170 | Ga0068853_100197108 | 3300005539 | Bacteria | 1832 |
| 171 | Ga0068853_100545824 | 3300005539 | Bacteria | 1098 |
| 172 | Ga0070672_100011114 | 3300005543 | Bacteria | 6270 |
| 173 | Ga0070672_100093329 | 3300005543 | Bacteria | 2431 |
| 174 | Ga0070672_100369918 | 3300005543 | Bacteria | 1224 |
| 175 | Ga0070672_100654130 | 3300005543 | Bacteria | 918 |
| 176 | Ga0070672_101071472 | 3300005543 | Bacteria | 716 |
| 177 | Ga0070686_100009432 | 3300005544 | Bacteria | 5487 |
| 178 | Ga0070686_100037119 | 3300005544 | Bacteria | 3021 |
| 179 | Ga0070686_100948792 | 3300005544 | Unclassified | 703 |
| 180 | Ga0070695_100011470 | 3300005545 | Bacteria | 5300 |
| 181 | Ga0070695_100103183 | 3300005545 | Bacteria | 1924 |
| 182 | Ga0070695_100300607 | 3300005545 | Bacteria | 1186 |
| 183 | Ga0070695_101528312 | 3300005545 | Bacteria | 556 |
| 184 | Ga0070696_100009053 | 3300005546 | Bacteria | 6667 |
| 185 | Ga0070696_100166438 | 3300005546 | Bacteria | 1627 |
| 186 | Ga0070693_100006310 | 3300005547 | Bacteria | 5747 |
| 187 | Ga0070693_100658952 | 3300005547 | Bacteria | 762 |
| 188 | Ga0070665_100048285 | 3300005548 | Bacteria | 4274 |
| 189 | Ga0070665_100095945 | 3300005548 | Bacteria | 2970 |
| 190 | Ga0070665_100258146 | 3300005548 | Bacteria | 1744 |
| 191 | Ga0070665_100496069 | 3300005548 | Bacteria | 1232 |
| 192 | Ga0070665_101185842 | 3300005548 | Bacteria | 774 |
| 193 | Ga0070704_100054091 | 3300005549 | Bacteria | 2840 |
| 194 | Ga0070704_100179392 | 3300005549 | Bacteria | 1692 |
| 195 | Ga0070704_100374703 | 3300005549 | Bacteria | 1208 |
| 196 | Ga0070664_100258165 | 3300005564 | Bacteria | 1567 |
| 197 | Ga0070664_100336652 | 3300005564 | Bacteria | 1370 |
| 198 | Ga0070664_101889046 | 3300005564 | Unclassified | 566 |
| 199 | Ga0068857_100024296 | 3300005577 | Bacteria | 5333 |
| 200 | Ga0068857_100249292 | 3300005577 | Bacteria | 1627 |
| 201 | Ga0068857_100501143 | 3300005577 | Bacteria | 1140 |
| 202 | Ga0068857_100523862 | 3300005577 | Bacteria | 1114 |
| 203 | Ga0068854_100088893 | 3300005578 | Bacteria | 2295 |
| 204 | Ga0068854_100758180 | 3300005578 | Bacteria | 842 |
| 205 | Ga0068854_100832597 | 3300005578 | Bacteria | 806 |
| 206 | Ga0068854_101260940 | 3300005578 | Bacteria | 664 |
| 207 | Ga0068854_101853022 | 3300005578 | Bacteria | 554 |
| 208 | Ga0070702_100011472 | 3300005615 | Bacteria | 4408 |
| 209 | Ga0070702_100020816 | 3300005615 | Bacteria | 3442 |
| 210 | Ga0070702_100276643 | 3300005615 | Bacteria | 1151 |
| 211 | Ga0070702_100386439 | 3300005615 | Bacteria | 997 |
| 212 | Ga0068852_100162491 | 3300005616 | Bacteria | 2086 |
| 213 | Ga0068852_102268943 | 3300005616 | Bacteria | 564 |
| 214 | Ga0068859_100139957 | 3300005617 | Bacteria | 2494 |
| 215 | Ga0068859_100392249 | 3300005617 | Bacteria | 1484 |
| 216 | Ga0068859_100503115 | 3300005617 | Bacteria | 1307 |
| 217 | Ga0068859_100620354 | 3300005617 | Bacteria | 1174 |
| 218 | Ga0068859_100691468 | 3300005617 | Bacteria | 1111 |
| 219 | Ga0068859_100896314 | 3300005617 | Bacteria | 972 |
| 220 | Ga0068859_100905409 | 3300005617 | Bacteria | 967 |
| 221 | Ga0068859_102107141 | 3300005617 | Bacteria | 623 |
| 222 | Ga0068864_100019800 | 3300005618 | Bacteria | 5626 |
| 223 | Ga0068864_100053857 | 3300005618 | Bacteria | 3472 |
| 224 | Ga0068864_100228708 | 3300005618 | Bacteria | 1719 |
| 225 | Ga0068864_101373641 | 3300005618 | Bacteria | 708 |
| 226 | Ga0068866_10036038 | 3300005718 | Bacteria | 2421 |
| 227 | Ga0068866_10110477 | 3300005718 | Bacteria | 1533 |
| 228 | Ga0068866_10675756 | 3300005718 | Bacteria | 706 |
| 229 | Ga0068866_10726436 | 3300005718 | Bacteria | 684 |
| 230 | Ga0068861_100009091 | 3300005719 | Bacteria | 6850 |
| 231 | Ga0068861_100033722 | 3300005719 | Bacteria | 3780 |
| 232 | Ga0068861_100034292 | 3300005719 | Bacteria | 3752 |
| 233 | Ga0068861_100133863 | 3300005719 | Bacteria | 2015 |
| 234 | Ga0068861_100140301 | 3300005719 | Bacteria | 1972 |
| 235 | Ga0068861_100173354 | 3300005719 | Bacteria | 1789 |
| 236 | Ga0068861_100296339 | 3300005719 | Bacteria | 1399 |
| 237 | Ga0068861_100424974 | 3300005719 | Bacteria | 1185 |
| 238 | Ga0068861_100693384 | 3300005719 | Bacteria | 945 |
| 239 | Ga0068870_10002310 | 3300005840 | Bacteria | 7924 |
| 240 | Ga0068870_10044675 | 3300005840 | Bacteria | 2316 |
| 241 | Ga0068870_10053710 | 3300005840 | Bacteria | 2140 |
| 242 | Ga0068870_10462106 | 3300005840 | Bacteria | 839 |
| 243 | Ga0068870_10477476 | 3300005840 | Bacteria | 827 |
| 244 | Ga0068863_100113905 | 3300005841 | Bacteria | 2576 |
| 245 | Ga0068863_100292468 | 3300005841 | Bacteria | 1579 |
| 246 | Ga0068863_100964527 | 3300005841 | Bacteria | 854 |
| 247 | Ga0068863_101106419 | 3300005841 | Bacteria | 797 |
| 248 | Ga0068863_101143695 | 3300005841 | Unclassified | 783 |
| 249 | Ga0068863_101946318 | 3300005841 | Bacteria | 598 |
| 250 | Ga0068863_102642931 | 3300005841 | Bacteria | 511 |
| 251 | Ga0068858_100005836 | 3300005842 | Bacteria | 12027 |
| 252 | Ga0068858_100023261 | 3300005842 | Bacteria | 5775 |
| 253 | Ga0068858_100201330 | 3300005842 | Bacteria | 1883 |
| 254 | Ga0068858_100231770 | 3300005842 | Bacteria | 1751 |
| 255 | Ga0068860_100029497 | 3300005843 | Bacteria | 5278 |
| 256 | Ga0068860_100046638 | 3300005843 | Bacteria | 4132 |
| 257 | Ga0068860_100418461 | 3300005843 | Bacteria | 1328 |
| 258 | Ga0068860_100543002 | 3300005843 | Bacteria | 1164 |
| 259 | Ga0068860_100713908 | 3300005843 | Bacteria | 1013 |
| 260 | Ga0068860_100874969 | 3300005843 | Bacteria | 914 |
| 261 | Ga0068860_100904726 | 3300005843 | Bacteria | 899 |
| 262 | Ga0068862_100128197 | 3300005844 | Bacteria | 2242 |
| 263 | Ga0068862_100193183 | 3300005844 | Bacteria | 1833 |
| 264 | Ga0068862_100246388 | 3300005844 | Bacteria | 1627 |
| 265 | Ga0068862_100342701 | 3300005844 | Bacteria | 1385 |
| 266 | Ga0068862_100372681 | 3300005844 | Bacteria | 1329 |
| 267 | Ga0068862_100719449 | 3300005844 | Bacteria | 969 |
| 268 | Ga0068862_101436801 | 3300005844 | Bacteria | 694 |
| 269 | Ga0081455_10004385 | 3300005937 | Bacteria | 15894 |
| 270 | Ga0081455_10006450 | 3300005937 | Bacteria | 12569 |
| 271 | Ga0081538_10015699 | 3300005981 | Bacteria | 5848 |
| 272 | Ga0081538_10036943 | 3300005981 | Bacteria | 3178 |
| 273 | Ga0070717_11119478 | 3300006028 | Bacteria | 717 |
| 274 | Ga0075365_10011977 | 3300006038 | Bacteria | 5125 |
| 275 | Ga0075365_10050444 | 3300006038 | Bacteria | 2745 |
| 276 | Ga0075365_10775439 | 3300006038 | Bacteria | 677 |
| 277 | Ga0075363_100006440 | 3300006048 | Bacteria | 5333 |
| 278 | Ga0075363_100330740 | 3300006048 | Bacteria | 887 |
| 279 | Ga0075364_10173269 | 3300006051 | Bacteria | 1459 |
| 280 | Ga0075432_10552234 | 3300006058 | Bacteria | 520 |
| 281 | Ga0070715_10017981 | 3300006163 | Bacteria | 2686 |
| 282 | Ga0070712_100183080 | 3300006175 | Bacteria | 1634 |
| 283 | Ga0075362_10058135 | 3300006177 | Bacteria | 1744 |
| 284 | Ga0075362_10086876 | 3300006177 | Bacteria | 1448 |
| 285 | Ga0075362_10137611 | 3300006177 | Bacteria | 1166 |
| 286 | Ga0075367_10006406 | 3300006178 | Bacteria | 5945 |
| 287 | Ga0075367_10256038 | 3300006178 | Bacteria | 1098 |
| 288 | Ga0075367_10482339 | 3300006178 | Bacteria | 786 |
| 289 | Ga0075367_10848917 | 3300006178 | Bacteria | 582 |
| 290 | Ga0075369_10096470 | 3300006186 | Bacteria | 1324 |
| 291 | Ga0075369_10480281 | 3300006186 | Bacteria | 590 |
| 292 | Ga0075366_10481327 | 3300006195 | Bacteria | 767 |
| 293 | Ga0097621_100014001 | 3300006237 | Bacteria | 5992 |
| 294 | Ga0097621_100197699 | 3300006237 | Bacteria | 1744 |
| 295 | Ga0097621_100205331 | 3300006237 | Bacteria | 1712 |
| 296 | Ga0097621_100912438 | 3300006237 | Bacteria | 819 |
| 297 | Ga0097621_100966918 | 3300006237 | Unclassified | 795 |
| 298 | Ga0075370_10069593 | 3300006353 | Bacteria | 2011 |
| 299 | Ga0075370_10773796 | 3300006353 | Bacteria | 585 |
| 300 | Ga0068871_100030159 | 3300006358 | Bacteria | 4268 |
| 301 | Ga0068871_100274062 | 3300006358 | Bacteria | 1474 |
| 302 | Ga0068871_100562601 | 3300006358 | Bacteria | 1034 |
| 303 | Ga0068871_100974999 | 3300006358 | Bacteria | 788 |
| 304 | Ga0068871_101588998 | 3300006358 | Bacteria | 619 |
| 305 | Ga0068871_102080032 | 3300006358 | Bacteria | 541 |
| 306 | Ga0075428_100088621 | 3300006844 | Bacteria | 3375 |
| 307 | Ga0075428_100111490 | 3300006844 | Bacteria | 2980 |
| 308 | Ga0075428_100165771 | 3300006844 | Bacteria | 2397 |
| 309 | Ga0075428_100375310 | 3300006844 | Bacteria | 1525 |
| 310 | Ga0075428_100674699 | 3300006844 | Bacteria | 1102 |
| 311 | Ga0075430_100021899 | 3300006846 | Bacteria | 5431 |
| 312 | Ga0075430_100161849 | 3300006846 | Bacteria | 1863 |
| 313 | Ga0075430_100221187 | 3300006846 | Bacteria | 1571 |
| 314 | Ga0075430_100324024 | 3300006846 | Bacteria | 1273 |
| 315 | Ga0075430_101421549 | 3300006846 | Bacteria | 570 |
| 316 | Ga0075431_100020076 | 3300006847 | Bacteria | 6823 |
| 317 | Ga0075431_100024922 | 3300006847 | Bacteria | 6132 |
| 318 | Ga0075431_100063780 | 3300006847 | Bacteria | 3803 |
| 319 | Ga0075431_100102562 | 3300006847 | Bacteria | 2953 |
| 320 | Ga0075431_100366567 | 3300006847 | Bacteria | 1446 |
| 321 | Ga0075433_10072810 | 3300006852 | Bacteria | 3022 |
| 322 | Ga0075434_100112818 | 3300006871 | Bacteria | 2730 |
| 323 | Ga0075434_100278673 | 3300006871 | Bacteria | 1692 |
| 324 | Ga0075434_100629395 | 3300006871 | Bacteria | 1092 |
| 325 | Ga0075434_101053870 | 3300006871 | Bacteria | 827 |
| 326 | Ga0075434_101521405 | 3300006871 | Bacteria | 678 |
| 327 | Ga0075429_100000516 | 3300006880 | Bacteria | 29275 |
| 328 | Ga0075429_100061796 | 3300006880 | Bacteria | 3263 |
| 329 | Ga0075429_101426640 | 3300006880 | Bacteria | 603 |
| 330 | Ga0068865_100101247 | 3300006881 | Bacteria | 2109 |
| 331 | Ga0068865_100344279 | 3300006881 | Bacteria | 1206 |
| 332 | Ga0097620_100139956 | 3300006931 | Bacteria | 2494 |
| 333 | Ga0097620_100392299 | 3300006931 | Bacteria | 1484 |
| 334 | Ga0097620_100503145 | 3300006931 | Bacteria | 1307 |
| 335 | Ga0097620_100620283 | 3300006931 | Bacteria | 1174 |
| 336 | Ga0097620_100691483 | 3300006931 | Bacteria | 1111 |
| 337 | Ga0097620_100896301 | 3300006931 | Bacteria | 972 |
| 338 | Ga0097620_100905368 | 3300006931 | Bacteria | 967 |
| 339 | Ga0097620_102107088 | 3300006931 | Bacteria | 623 |
| 340 | Ga0075435_100095165 | 3300007076 | Bacteria | 2463 |
| 341 | Ga0099795_10000022 | 3300007788 | Bacteria | 52585 |
| 342 | Ga0105250_10035451 | 3300009092 | Bacteria | 2001 |
| 343 | Ga0111539_10025568 | 3300009094 | Bacteria | 7237 |
| 344 | Ga0111539_10091488 | 3300009094 | Bacteria | 3574 |
| 345 | Ga0111539_10470432 | 3300009094 | Bacteria | 1464 |
| 346 | Ga0111539_10613229 | 3300009094 | Bacteria | 1267 |
| 347 | Ga0111539_10717690 | 3300009094 | Bacteria | 1164 |
| 348 | Ga0111539_10766076 | 3300009094 | Bacteria | 1123 |
| 349 | Ga0111539_11158669 | 3300009094 | Bacteria | 898 |
| 350 | Ga0111539_11981300 | 3300009094 | Bacteria | 675 |
| 351 | Ga0105245_10138958 | 3300009098 | Bacteria | 2286 |
| 352 | Ga0105247_10002316 | 3300009101 | Bacteria | 13011 |
| 353 | Ga0105247_10017387 | 3300009101 | Bacteria | 4318 |
| 354 | Ga0114129_10006246 | 3300009147 | Bacteria | 16890 |
| 355 | Ga0114129_10040767 | 3300009147 | Bacteria | 6545 |
| 356 | Ga0114129_10206847 | 3300009147 | Bacteria | 2655 |
| 357 | Ga0114129_10373351 | 3300009147 | Bacteria | 1885 |
| 358 | Ga0114129_10452513 | 3300009147 | Bacteria | 1684 |
| 359 | Ga0114129_10779165 | 3300009147 | Bacteria | 1222 |
| 360 | Ga0114129_11124000 | 3300009147 | Bacteria | 982 |
| 361 | Ga0114129_11149003 | 3300009147 | Bacteria | 970 |
| 362 | Ga0114129_11712671 | 3300009147 | Bacteria | 767 |
| 363 | Ga0105243_10046925 | 3300009148 | Bacteria | 3400 |
| 364 | Ga0105243_10300094 | 3300009148 | Bacteria | 1455 |
| 365 | Ga0105243_10390765 | 3300009148 | Bacteria | 1289 |
| 366 | Ga0105243_10762726 | 3300009148 | Bacteria | 950 |
| 367 | Ga0105243_10834875 | 3300009148 | Bacteria | 911 |
| 368 | Ga0105241_10411180 | 3300009174 | Bacteria | 1189 |
| 369 | Ga0105241_10712673 | 3300009174 | Bacteria | 917 |
| 370 | Ga0105242_10015964 | 3300009176 | Bacteria | 5836 |
| 371 | Ga0105242_10261036 | 3300009176 | Bacteria | 1565 |
| 372 | Ga0105242_13157271 | 3300009176 | Bacteria | 511 |
| 373 | Ga0105248_10013593 | 3300009177 | Bacteria | 8961 |
| 374 | Ga0105248_10031395 | 3300009177 | Bacteria | 5938 |
| 375 | Ga0105248_10310970 | 3300009177 | Bacteria | 1774 |
| 376 | Ga0105248_10373142 | 3300009177 | Bacteria | 1606 |
| 377 | Ga0105248_10849747 | 3300009177 | Bacteria | 1030 |
| 378 | Ga0105237_10157318 | 3300009545 | Bacteria | 2270 |
| 379 | Ga0105237_11227353 | 3300009545 | Bacteria | 756 |
| 380 | Ga0105238_10216685 | 3300009551 | Bacteria | 1890 |
| 381 | Ga0105238_10315895 | 3300009551 | Bacteria | 1548 |
| 382 | Ga0105238_10516766 | 3300009551 | Bacteria | 1196 |
| 383 | Ga0105238_11734471 | 3300009551 | Unclassified | 656 |
| 384 | Ga0105249_10046617 | 3300009553 | Bacteria | 3945 |
| 385 | Ga0105249_10058640 | 3300009553 | Bacteria | 3529 |
| 386 | Ga0105249_10572772 | 3300009553 | Bacteria | 1182 |
| 387 | Ga0105249_10597082 | 3300009553 | Bacteria | 1158 |
| 388 | Ga0105249_10773384 | 3300009553 | Bacteria | 1023 |
| 389 | Ga0099796_10000153 | 3300010159 | Bacteria | 10219 |
| 390 | Ga0105239_10926368 | 3300010375 | Bacteria | 1000 |
| 391 | Ga0105246_10012857 | 3300011119 | Bacteria | 5234 |
| 392 | Ga0105246_10147417 | 3300011119 | Bacteria | 1777 |
| 393 | Ga0157341_1003637 | 3300012494 | Bacteria | 1085 |
| 394 | Ga0157326_1010374 | 3300012513 | Bacteria | 1038 |
| 395 | Ga0157326_1034287 | 3300012513 | Bacteria | 686 |
| 396 | Ga0157373_10028056 | 3300013100 | Bacteria | 4062 |
| 397 | Ga0157371_10448916 | 3300013102 | Bacteria | 948 |
| 398 | Ga0157371_10716731 | 3300013102 | Bacteria | 750 |
| 399 | Ga0157371_11025873 | 3300013102 | Unclassified | 630 |
| 400 | Ga0157374_10484621 | 3300013296 | Bacteria | 1240 |
| 401 | Ga0157374_12731598 | 3300013296 | Bacteria | 521 |
| 402 | Ga0157378_10016082 | 3300013297 | Bacteria | 6553 |
| 403 | Ga0157378_10242931 | 3300013297 | Bacteria | 1721 |
| 404 | Ga0157378_11397435 | 3300013297 | Bacteria | 743 |
| 405 | Ga0157378_12078554 | 3300013297 | Bacteria | 618 |
| 406 | Ga0163162_10044564 | 3300013306 | Bacteria | 4443 |
| 407 | Ga0163162_10057411 | 3300013306 | Bacteria | 3920 |
| 408 | Ga0163162_11160413 | 3300013306 | Bacteria | 876 |
| 409 | Ga0163162_11379610 | 3300013306 | Bacteria | 802 |
| 410 | Ga0163162_11828480 | 3300013306 | Bacteria | 695 |
| 411 | Ga0163162_11866294 | 3300013306 | Bacteria | 688 |
| 412 | Ga0157372_10007051 | 3300013307 | Bacteria | 11969 |
| 413 | Ga0157372_10888523 | 3300013307 | Bacteria | 1034 |
| 414 | Ga0157375_10102597 | 3300013308 | Bacteria | 2946 |
| 415 | Ga0157375_10972892 | 3300013308 | Unclassified | 989 |
| 416 | Ga0157375_11274581 | 3300013308 | Bacteria | 863 |
| 417 | Ga0157375_13115047 | 3300013308 | Bacteria | 553 |
| 418 | Ga0163163_10267597 | 3300014325 | Bacteria | 1760 |
| 419 | Ga0163163_10271568 | 3300014325 | Bacteria | 1747 |
| 420 | Ga0163163_10891707 | 3300014325 | Bacteria | 953 |
| 421 | Ga0157380_10053038 | 3300014326 | Bacteria | 3213 |
| 422 | Ga0157380_10099751 | 3300014326 | Bacteria | 2416 |
| 423 | Ga0157380_10121023 | 3300014326 | Bacteria | 2217 |
| 424 | Ga0157380_10171516 | 3300014326 | Bacteria | 1896 |
| 425 | Ga0157380_10343883 | 3300014326 | Bacteria | 1393 |
| 426 | Ga0157380_10422125 | 3300014326 | Bacteria | 1272 |
| 427 | Ga0157380_10510970 | 3300014326 | Bacteria | 1169 |
| 428 | Ga0157380_10863907 | 3300014326 | Bacteria | 928 |
| 429 | Ga0157380_10869019 | 3300014326 | Bacteria | 925 |
| 430 | Ga0157380_11203236 | 3300014326 | Bacteria | 801 |
| 431 | Ga0157380_11254780 | 3300014326 | Bacteria | 787 |
| 432 | Ga0157380_11878385 | 3300014326 | Bacteria | 659 |
| 433 | Ga0182008_10088724 | 3300014497 | Bacteria | 1524 |
| 434 | Ga0182008_10192751 | 3300014497 | Bacteria | 1035 |
| 435 | Ga0157377_10060707 | 3300014745 | Bacteria | 2159 |
| 436 | Ga0157377_10078011 | 3300014745 | Bacteria | 1930 |
| 437 | Ga0157379_10013529 | 3300014968 | Bacteria | 7151 |
| 438 | Ga0157379_10053782 | 3300014968 | Unclassified | 3597 |
| 439 | Ga0157379_10347170 | 3300014968 | Bacteria | 1358 |
| 440 | Ga0157379_10561869 | 3300014968 | Unclassified | 1062 |
| 441 | Ga0157379_10643133 | 3300014968 | Bacteria | 992 |
| 442 | Ga0157379_10666387 | 3300014968 | Bacteria | 975 |
| 443 | Ga0157379_11296301 | 3300014968 | Unclassified | 703 |
| 444 | Ga0157379_12498597 | 3300014968 | Bacteria | 516 |
| 445 | Ga0157376_10028966 | 3300014969 | Bacteria | 4408 |
| 446 | Ga0157376_10045197 | 3300014969 | Bacteria | 3624 |
| 447 | Ga0157376_10460957 | 3300014969 | Bacteria | 1242 |
| 448 | Ga0157376_10507449 | 3300014969 | Unclassified | 1186 |
| 449 | Ga0157376_11985290 | 3300014969 | Unclassified | 619 |
| 450 | Ga0182006_1071938 | 3300015261 | Bacteria | 1280 |
| 451 | Ga0182007_10045579 | 3300015262 | Bacteria | 1453 |
| 452 | Ga0182007_10047438 | 3300015262 | Bacteria | 1421 |
| 453 | Ga0182007_10151356 | 3300015262 | Bacteria | 789 |
| 454 | Ga0163161_10035357 | 3300017792 | Bacteria | 3576 |
| 455 | Ga0163161_10089587 | 3300017792 | Bacteria | 2276 |
| 456 | Ga0163161_10261797 | 3300017792 | Bacteria | 1351 |
| 457 | Ga0163161_10767451 | 3300017792 | Unclassified | 808 |
| 458 | Ga0207638_1003840 | 3300025227 | Bacteria | 610 |
| 459 | Ga0209758_1018310 | 3300025297 | Bacteria | 3441 |
| 460 | Ga0207697_10548945 | 3300025315 | Bacteria | 508 |
| 461 | Ga0207682_10003239 | 3300025893 | Bacteria | 7121 |
| 462 | Ga0207682_10023027 | 3300025893 | Bacteria | 2458 |
| 463 | Ga0207642_10036811 | 3300025899 | Bacteria | 2103 |
| 464 | Ga0207642_10216771 | 3300025899 | Bacteria | 1067 |
| 465 | Ga0207642_10325115 | 3300025899 | Bacteria | 899 |
| 466 | Ga0207642_10494725 | 3300025899 | Bacteria | 748 |
| 467 | Ga0207710_10074811 | 3300025900 | Bacteria | 1560 |
| 468 | Ga0207688_10000283 | 3300025901 | Bacteria | 23210 |
| 469 | Ga0207688_10133948 | 3300025901 | Bacteria | 1454 |
| 470 | Ga0207680_10088104 | 3300025903 | Bacteria | 1967 |
| 471 | Ga0207680_10312532 | 3300025903 | Bacteria | 1097 |
| 472 | Ga0207647_10008609 | 3300025904 | Bacteria | 7303 |
| 473 | Ga0207647_10288886 | 3300025904 | Bacteria | 935 |
| 474 | Ga0207685_10011195 | 3300025905 | Bacteria | 2685 |
| 475 | Ga0207645_10004284 | 3300025907 | Bacteria | 10588 |
| 476 | Ga0207645_10075319 | 3300025907 | Bacteria | 2160 |
| 477 | Ga0207645_10149060 | 3300025907 | Bacteria | 1526 |
| 478 | Ga0207645_10374439 | 3300025907 | Bacteria | 955 |
| 479 | Ga0207645_10858230 | 3300025907 | Bacteria | 617 |
| 480 | Ga0207643_10000615 | 3300025908 | Bacteria | 22480 |
| 481 | Ga0207643_10038281 | 3300025908 | Bacteria | 2693 |
| 482 | Ga0207643_10089816 | 3300025908 | Bacteria | 1790 |
| 483 | Ga0207643_10110027 | 3300025908 | Bacteria | 1623 |
| 484 | Ga0207643_10713642 | 3300025908 | Bacteria | 648 |
| 485 | Ga0207707_10099173 | 3300025912 | Bacteria | 2546 |
| 486 | Ga0207671_10481807 | 3300025914 | Bacteria | 989 |
| 487 | Ga0207671_10731091 | 3300025914 | Bacteria | 786 |
| 488 | Ga0207663_10197530 | 3300025916 | Bacteria | 1449 |
| 489 | Ga0207662_10002182 | 3300025918 | Bacteria | 9762 |
| 490 | Ga0207662_10019443 | 3300025918 | Bacteria | 3865 |
| 491 | Ga0207662_10157989 | 3300025918 | Bacteria | 1447 |
| 492 | Ga0207662_10267689 | 3300025918 | Unclassified | 1127 |
| 493 | Ga0207657_10111144 | 3300025919 | Bacteria | 2263 |
| 494 | Ga0207657_10816507 | 3300025919 | Bacteria | 720 |
| 495 | Ga0207649_10974225 | 3300025920 | Bacteria | 667 |
| 496 | Ga0207649_11129601 | 3300025920 | Bacteria | 618 |
| 497 | Ga0207652_10089380 | 3300025921 | Bacteria | 2705 |
| 498 | Ga0207652_11197203 | 3300025921 | Bacteria | 661 |
| 499 | Ga0207646_10935093 | 3300025922 | Unclassified | 768 |
| 500 | Ga0207681_10019540 | 3300025923 | Bacteria | 4282 |
| 501 | Ga0207681_10032108 | 3300025923 | Bacteria | 3436 |
| 502 | Ga0207681_10103416 | 3300025923 | Bacteria | 2058 |
| 503 | Ga0207681_10339484 | 3300025923 | Bacteria | 1199 |
| 504 | Ga0207681_10691224 | 3300025923 | Bacteria | 848 |
| 505 | Ga0207681_10701050 | 3300025923 | Bacteria | 842 |
| 506 | Ga0207694_10557457 | 3300025924 | Bacteria | 962 |
| 507 | Ga0207694_10613141 | 3300025924 | Bacteria | 915 |
| 508 | Ga0207694_10954270 | 3300025924 | Bacteria | 725 |
| 509 | Ga0207694_11052464 | 3300025924 | Bacteria | 689 |
| 510 | Ga0207650_10043430 | 3300025925 | Bacteria | 3299 |
| 511 | Ga0207650_10144074 | 3300025925 | Bacteria | 1875 |
| 512 | Ga0207650_10163106 | 3300025925 | Bacteria | 1767 |
| 513 | Ga0207659_10160130 | 3300025926 | Bacteria | 1766 |
| 514 | Ga0207659_10509646 | 3300025926 | Bacteria | 1019 |
| 515 | Ga0207659_11630553 | 3300025926 | Bacteria | 550 |
| 516 | Ga0207659_11729908 | 3300025926 | Unclassified | 532 |
| 517 | Ga0207690_10015285 | 3300025932 | Bacteria | 4647 |
| 518 | Ga0207690_10024268 | 3300025932 | Bacteria | 3796 |
| 519 | Ga0207690_10313276 | 3300025932 | Bacteria | 1231 |
| 520 | Ga0207690_10409627 | 3300025932 | Bacteria | 1083 |
| 521 | Ga0207706_10011257 | 3300025933 | Bacteria | 8155 |
| 522 | Ga0207706_10025823 | 3300025933 | Bacteria | 5261 |
| 523 | Ga0207706_10083579 | 3300025933 | Bacteria | 2807 |
| 524 | Ga0207706_10097236 | 3300025933 | Bacteria | 2589 |
| 525 | Ga0207706_10192645 | 3300025933 | Bacteria | 1789 |
| 526 | Ga0207706_10232699 | 3300025933 | Bacteria | 1612 |
| 527 | Ga0207706_10371654 | 3300025933 | Bacteria | 1241 |
| 528 | Ga0207706_10489218 | 3300025933 | Bacteria | 1062 |
| 529 | Ga0207706_10939280 | 3300025933 | Bacteria | 729 |
| 530 | Ga0207706_11690729 | 3300025933 | Unclassified | 510 |
| 531 | Ga0207686_10025970 | 3300025934 | Bacteria | 3414 |
| 532 | Ga0207686_10802782 | 3300025934 | Bacteria | 754 |
| 533 | Ga0207709_10039886 | 3300025935 | Bacteria | 2808 |
| 534 | Ga0207709_10258863 | 3300025935 | Bacteria | 1275 |
| 535 | Ga0207709_10259269 | 3300025935 | Bacteria | 1274 |
| 536 | Ga0207709_11378050 | 3300025935 | Bacteria | 584 |
| 537 | Ga0207670_10040465 | 3300025936 | Bacteria | 3059 |
| 538 | Ga0207670_10091205 | 3300025936 | Bacteria | 2154 |
| 539 | Ga0207670_10136471 | 3300025936 | Bacteria | 1804 |
| 540 | Ga0207670_10203833 | 3300025936 | Bacteria | 1504 |
| 541 | Ga0207669_10008898 | 3300025937 | Bacteria | 4743 |
| 542 | Ga0207669_10033296 | 3300025937 | Bacteria | 2906 |
| 543 | Ga0207669_10124508 | 3300025937 | Bacteria | 1758 |
| 544 | Ga0207669_10818753 | 3300025937 | Bacteria | 773 |
| 545 | Ga0207669_11571520 | 3300025937 | Bacteria | 561 |
| 546 | Ga0207704_10009089 | 3300025938 | Bacteria | 4778 |
| 547 | Ga0207704_10071029 | 3300025938 | Bacteria | 2207 |
| 548 | Ga0207704_10156445 | 3300025938 | Bacteria | 1616 |
| 549 | Ga0207704_10362465 | 3300025938 | Bacteria | 1132 |
| 550 | Ga0207704_10417450 | 3300025938 | Bacteria | 1063 |
| 551 | Ga0207704_10480390 | 3300025938 | Bacteria | 997 |
| 552 | Ga0207704_10935495 | 3300025938 | Unclassified | 730 |
| 553 | Ga0207665_10123760 | 3300025939 | Bacteria | 1829 |
| 554 | Ga0207691_10001340 | 3300025940 | Bacteria | 24566 |
| 555 | Ga0207691_10005505 | 3300025940 | Bacteria | 12237 |
| 556 | Ga0207691_10008332 | 3300025940 | Bacteria | 9956 |
| 557 | Ga0207691_10009993 | 3300025940 | Bacteria | 9113 |
| 558 | Ga0207691_10072598 | 3300025940 | Bacteria | 3104 |
| 559 | Ga0207691_10170907 | 3300025940 | Bacteria | 1903 |
| 560 | Ga0207691_10367487 | 3300025940 | Bacteria | 1229 |
| 561 | Ga0207691_10440963 | 3300025940 | Bacteria | 1109 |
| 562 | Ga0207691_10444171 | 3300025940 | Bacteria | 1104 |
| 563 | Ga0207711_10046436 | 3300025941 | Bacteria | 3711 |
| 564 | Ga0207711_10053060 | 3300025941 | Bacteria | 3477 |
| 565 | Ga0207711_10132630 | 3300025941 | Bacteria | 2235 |
| 566 | Ga0207711_10289652 | 3300025941 | Bacteria | 1509 |
| 567 | Ga0207711_10577632 | 3300025941 | Bacteria | 1048 |
| 568 | Ga0207711_10981813 | 3300025941 | Bacteria | 784 |
| 569 | Ga0207689_10009385 | 3300025942 | Bacteria | 8452 |
| 570 | Ga0207689_10087974 | 3300025942 | Bacteria | 2552 |
| 571 | Ga0207689_11537481 | 3300025942 | Unclassified | 555 |
| 572 | Ga0207689_11744840 | 3300025942 | Unclassified | 515 |
| 573 | Ga0207679_10959545 | 3300025945 | Bacteria | 783 |
| 574 | Ga0207679_11140419 | 3300025945 | Bacteria | 715 |
| 575 | Ga0207651_10008440 | 3300025960 | Bacteria | 5565 |
| 576 | Ga0207651_10168645 | 3300025960 | Bacteria | 1724 |
| 577 | Ga0207651_10224327 | 3300025960 | Bacteria | 1521 |
| 578 | Ga0207651_10572169 | 3300025960 | Bacteria | 985 |
| 579 | Ga0207651_10661013 | 3300025960 | Bacteria | 918 |
| 580 | Ga0207651_10919728 | 3300025960 | Bacteria | 779 |
| 581 | Ga0207712_10060130 | 3300025961 | Bacteria | 2692 |
| 582 | Ga0207712_10112492 | 3300025961 | Bacteria | 2044 |
| 583 | Ga0207712_10121386 | 3300025961 | Bacteria | 1978 |
| 584 | Ga0207712_11519808 | 3300025961 | Bacteria | 600 |
| 585 | Ga0207668_10009499 | 3300025972 | Bacteria | 5835 |
| 586 | Ga0207668_10070567 | 3300025972 | Bacteria | 2492 |
| 587 | Ga0207668_10235326 | 3300025972 | Bacteria | 1479 |
| 588 | Ga0207668_10648104 | 3300025972 | Bacteria | 924 |
| 589 | Ga0207668_10871932 | 3300025972 | Bacteria | 800 |
| 590 | Ga0207668_11036018 | 3300025972 | Bacteria | 734 |
| 591 | Ga0207668_11165618 | 3300025972 | Bacteria | 692 |
| 592 | Ga0207640_10085407 | 3300025981 | Bacteria | 2170 |
| 593 | Ga0207640_10101516 | 3300025981 | Bacteria | 2019 |
| 594 | Ga0207640_10327720 | 3300025981 | Bacteria | 1222 |
| 595 | Ga0207640_10734150 | 3300025981 | Bacteria | 850 |
| 596 | Ga0207640_10761161 | 3300025981 | Bacteria | 836 |
| 597 | Ga0207640_10954915 | 3300025981 | Bacteria | 752 |
| 598 | Ga0207658_10000197 | 3300025986 | Bacteria | 63743 |
| 599 | Ga0207658_10734154 | 3300025986 | Bacteria | 894 |
| 600 | Ga0207677_10154074 | 3300026023 | Bacteria | 1777 |
| 601 | Ga0207677_10704384 | 3300026023 | Bacteria | 896 |
| 602 | Ga0207677_12016001 | 3300026023 | Unclassified | 536 |
| 603 | Ga0207703_10096065 | 3300026035 | Bacteria | 2501 |
| 604 | Ga0207703_10167161 | 3300026035 | Bacteria | 1931 |
| 605 | Ga0207703_10422123 | 3300026035 | Bacteria | 1241 |
| 606 | Ga0207703_11054795 | 3300026035 | Bacteria | 780 |
| 607 | Ga0207703_11380736 | 3300026035 | Bacteria | 678 |
| 608 | Ga0207678_10246095 | 3300026067 | Bacteria | 1531 |
| 609 | Ga0207678_10512222 | 3300026067 | Bacteria | 1047 |
| 610 | Ga0207708_10003436 | 3300026075 | Bacteria | 11669 |
| 611 | Ga0207708_10029898 | 3300026075 | Bacteria | 4131 |
| 612 | Ga0207708_10091093 | 3300026075 | Bacteria | 2351 |
| 613 | Ga0207708_10132218 | 3300026075 | Bacteria | 1952 |
| 614 | Ga0207708_10180197 | 3300026075 | Bacteria | 1677 |
| 615 | Ga0207702_10189450 | 3300026078 | Bacteria | 1899 |
| 616 | Ga0207641_10017045 | 3300026088 | Bacteria | 5945 |
| 617 | Ga0207641_10183121 | 3300026088 | Bacteria | 1920 |
| 618 | Ga0207641_10254176 | 3300026088 | Bacteria | 1642 |
| 619 | Ga0207641_10859732 | 3300026088 | Bacteria | 899 |
| 620 | Ga0207641_11307783 | 3300026088 | Bacteria | 725 |
| 621 | Ga0207648_10006798 | 3300026089 | Bacteria | 11340 |
| 622 | Ga0207648_10010221 | 3300026089 | Bacteria | 8921 |
| 623 | Ga0207648_10022150 | 3300026089 | Bacteria | 5708 |
| 624 | Ga0207648_10065638 | 3300026089 | Bacteria | 3164 |
| 625 | Ga0207648_10125085 | 3300026089 | Bacteria | 2261 |
| 626 | Ga0207648_10208303 | 3300026089 | Bacteria | 1735 |
| 627 | Ga0207648_10641701 | 3300026089 | Bacteria | 981 |
| 628 | Ga0207676_10023885 | 3300026095 | Bacteria | 4518 |
| 629 | Ga0207676_10298808 | 3300026095 | Bacteria | 1469 |
| 630 | Ga0207676_10365983 | 3300026095 | Bacteria | 1338 |
| 631 | Ga0207674_10063658 | 3300026116 | Bacteria | 3723 |
| 632 | Ga0207674_10094187 | 3300026116 | Bacteria | 2982 |
| 633 | Ga0207674_10923396 | 3300026116 | Bacteria | 841 |
| 634 | Ga0207675_100006775 | 3300026118 | Bacteria | 10836 |
| 635 | Ga0207675_100018555 | 3300026118 | Bacteria | 6490 |
| 636 | Ga0207675_100028532 | 3300026118 | Bacteria | 5197 |
| 637 | Ga0207675_100055390 | 3300026118 | Bacteria | 3699 |
| 638 | Ga0207675_100070045 | 3300026118 | Bacteria | 3278 |
| 639 | Ga0207675_100096188 | 3300026118 | Bacteria | 2788 |
| 640 | Ga0207675_100187573 | 3300026118 | Bacteria | 1982 |
| 641 | Ga0207675_100494449 | 3300026118 | Bacteria | 1217 |
| 642 | Ga0207675_102019977 | 3300026118 | Bacteria | 594 |
| 643 | Ga0207683_10028583 | 3300026121 | Bacteria | 4823 |
| 644 | Ga0207683_10059345 | 3300026121 | Bacteria | 3361 |
| 645 | Ga0207683_10206023 | 3300026121 | Bacteria | 1789 |
| 646 | Ga0207683_10214207 | 3300026121 | Bacteria | 1754 |
| 647 | Ga0207683_10394443 | 3300026121 | Bacteria | 1273 |
| 648 | Ga0207683_10524950 | 3300026121 | Bacteria | 1094 |
| 649 | Ga0207683_11035767 | 3300026121 | Bacteria | 762 |
| 650 | Ga0207683_11589114 | 3300026121 | Bacteria | 603 |
| 651 | Ga0207698_10513602 | 3300026142 | Bacteria | 1168 |
| 652 | Ga0207698_11103328 | 3300026142 | Bacteria | 806 |
| 653 | Ga0207698_12312798 | 3300026142 | Bacteria | 549 |
| 654 | Ga0210000_1016949 | 3300027462 | Bacteria | 1102 |
| 655 | Ga0209968_1054170 | 3300027526 | Bacteria | 700 |
| 656 | Ga0209970_1007302 | 3300027614 | Bacteria | 1811 |
| 657 | Ga0210002_1018709 | 3300027617 | Bacteria | 1109 |
| 658 | Ga0209971_1008263 | 3300027682 | Bacteria | 2467 |
| 659 | Ga0209971_1072879 | 3300027682 | Bacteria | 834 |
| 660 | Ga0209966_1015446 | 3300027695 | Bacteria | 1434 |
| 661 | Ga0209966_1064389 | 3300027695 | Bacteria | 796 |
| 662 | Ga0209998_10007799 | 3300027717 | Bacteria | 2222 |
| 663 | Ga0209974_10042439 | 3300027876 | Bacteria | 1514 |
| 664 | Ga0209974_10128081 | 3300027876 | Bacteria | 904 |
| 665 | Ga0207428_10156321 | 3300027907 | Bacteria | 1734 |
| 666 | Ga0207428_10221566 | 3300027907 | Bacteria | 1418 |
| 667 | Ga0207428_10326338 | 3300027907 | Bacteria | 1133 |
| 668 | Ga0268266_10080203 | 3300028379 | Bacteria | 2843 |
| 669 | Ga0268266_10237482 | 3300028379 | Bacteria | 1681 |
| 670 | Ga0268266_10472430 | 3300028379 | Bacteria | 1194 |
| 671 | Ga0268266_11790717 | 3300028379 | Bacteria | 589 |
| 672 | Ga0268265_10073416 | 3300028380 | Bacteria | 2672 |
| 673 | Ga0268265_10087869 | 3300028380 | Bacteria | 2475 |
| 674 | Ga0268265_10485084 | 3300028380 | Bacteria | 1162 |
| 675 | Ga0268265_10498585 | 3300028380 | Bacteria | 1147 |
| 676 | Ga0268265_10531940 | 3300028380 | Bacteria | 1113 |
| 677 | Ga0268265_10717636 | 3300028380 | Bacteria | 967 |
| 678 | Ga0268265_12095664 | 3300028380 | Bacteria | 573 |
| 679 | Ga0268264_10019390 | 3300028381 | Bacteria | 5559 |
| 680 | Ga0268264_10084470 | 3300028381 | Bacteria | 2722 |
| 681 | Ga0268264_10133590 | 3300028381 | Bacteria | 2204 |
| 682 | Ga0265336_10076650 | 3300028666 | Bacteria | 999 |
| 683 | Ga0307517_10228870 | 3300028786 | Bacteria | 1119 |
| 684 | Ga0307515_10000358 | 3300028794 | Bacteria | 112133 |
| 685 | Ga0307515_10293201 | 3300028794 | Bacteria | 1320 |
| 686 | Ga0307511_10344090 | 3300030521 | Bacteria | 645 |
| 687 | Ga0307513_10031619 | 3300031456 | Bacteria | 5991 |
| 688 | Ga0307513_10076534 | 3300031456 | Bacteria | 3470 |
| 689 | Ga0307408_100041613 | 3300031548 | Bacteria | 3258 |
| 690 | Ga0307408_100050815 | 3300031548 | Bacteria | 2983 |
| 691 | Ga0307408_100280122 | 3300031548 | Unclassified | 1388 |
| 692 | Ga0307408_101174283 | 3300031548 | Bacteria | 715 |
| 693 | Ga0316575_10054229 | 3300031665 | Bacteria | 1597 |
| 694 | Ga0316579_10046748 | 3300031691 | Bacteria | 2020 |
| 695 | Ga0316576_10167592 | 3300031727 | Bacteria | 1657 |
| 696 | Ga0316578_10072822 | 3300031728 | Bacteria | 2035 |
| 697 | Ga0307516_10824918 | 3300031730 | Bacteria | 590 |
| 698 | Ga0307405_10112123 | 3300031731 | Bacteria | 1850 |
| 699 | Ga0307405_10112223 | 3300031731 | Bacteria | 1849 |
| 700 | Ga0307405_10314844 | 3300031731 | Bacteria | 1193 |
| 701 | Ga0307405_11443449 | 3300031731 | Bacteria | 603 |
| 702 | Ga0316577_10016044 | 3300031733 | Bacteria | 4123 |
| 703 | Ga0307413_10009445 | 3300031824 | Bacteria | 4670 |
| 704 | Ga0307413_10147138 | 3300031824 | Bacteria | 1636 |
| 705 | Ga0307410_10027077 | 3300031852 | Bacteria | 3619 |
| 706 | Ga0307410_11196331 | 3300031852 | Unclassified | 662 |
| 707 | Ga0307406_10011667 | 3300031901 | Bacteria | 4988 |
| 708 | Ga0307406_10310814 | 3300031901 | Unclassified | 1215 |
| 709 | Ga0307406_12021221 | 3300031901 | Bacteria | 515 |
| 710 | Ga0307407_10012375 | 3300031903 | Bacteria | 4098 |
| 711 | Ga0307407_10205972 | 3300031903 | Bacteria | 1321 |
| 712 | Ga0307407_10338632 | 3300031903 | Unclassified | 1061 |
| 713 | Ga0307412_10109505 | 3300031911 | Bacteria | 1969 |
| 714 | Ga0307412_10343604 | 3300031911 | Unclassified | 1195 |
| 715 | Ga0307412_11011721 | 3300031911 | Bacteria | 735 |
| 716 | Ga0307412_11738684 | 3300031911 | Bacteria | 572 |
| 717 | Ga0307409_100030472 | 3300031995 | Bacteria | 3876 |
| 718 | Ga0307409_100072272 | 3300031995 | Bacteria | 2746 |
| 719 | Ga0307409_100094227 | 3300031995 | Bacteria | 2463 |
| 720 | Ga0307416_100007315 | 3300032002 | Bacteria | 7006 |
| 721 | Ga0307416_100094520 | 3300032002 | Unclassified | 2578 |
| 722 | Ga0307416_100446731 | 3300032002 | Bacteria | 1344 |
| 723 | Ga0307414_10497157 | 3300032004 | Bacteria | 1078 |
| 724 | Ga0307414_10906003 | 3300032004 | Unclassified | 809 |
| 725 | Ga0307411_10009093 | 3300032005 | Bacteria | 5199 |
| 726 | Ga0307411_10081837 | 3300032005 | Bacteria | 2225 |
| 727 | Ga0307411_10314037 | 3300032005 | Bacteria | 1262 |
| 728 | Ga0307411_10385597 | 3300032005 | Bacteria | 1154 |
| 729 | Ga0307411_10742234 | 3300032005 | Bacteria | 859 |
| 730 | Ga0307415_100025640 | 3300032126 | Bacteria | 3704 |
| 731 | Ga0307415_100748194 | 3300032126 | Bacteria | 887 |
| 732 | Ga0307415_101938870 | 3300032126 | Bacteria | 572 |
| 733 | Ga0316585_10010265 | 3300032137 | Bacteria | 2746 |
| 734 | Ga0316580_10049611 | 3300032139 | Bacteria | 1293 |
| 735 | Ga0373958_0191400 | 3300034819 | Bacteria | 532 |
| 736 | Ga0373928_0150689 | 3300035084 | Bacteria | 644 |
| 737 | Ga0373961_0182157 | 3300035241 | Bacteria | 732 |
| 738 | Ga0316574_0079917 | 3300035398 | Bacteria | 2074 |
| 739 | Ga0373931_0357414 | 3300035691 | Bacteria | 916 |
| 740 | Ga0373931_0452931 | 3300035691 | Bacteria | 821 |
| 741 | Ga0316584_0229151 | 3300036712 | Bacteria | 1362 |
| 742 | Ga0373925_0463292 | 3300037068 | Bacteria | 1039 |
| 743 | Ga0439465_0281421 | 3300041413 | Bacteria | 620 |
| 744 | Ga0451791_0408146 | 3300041451 | Bacteria | 2761 |
| 745 | Ga0451791_1109250 | 3300041451 | Bacteria | 1818 |
| 746 | Ga0451793_1139976 | 3300041452 | Unclassified | 573 |
| 747 | Ga0451793_1266290 | 3300041452 | Bacteria | 964 |
| 748 | Ga0451797_1322930 | 3300041453 | Bacteria | 2125 |
| 749 | Ga0451800_0205198 | 3300041459 | Bacteria | 1169 |
| 750 | Ga0451802_0332107 | 3300041460 | Bacteria | 1238 |
| 751 | Ga0451807_0568058 | 3300041486 | Bacteria | 2713 |
| 752 | Ga0451807_2422974 | 3300041486 | Bacteria | 929 |
| 753 | Ga0451807_2604943 | 3300041486 | Bacteria | 1053 |
| 754 | Ga0451837_1029966 | 3300041494 | Bacteria | 3320 |
| 755 | Ga0451853_2805711 | 3300041512 | Unclassified | 543 |
| 756 | Ga0451853_3090388 | 3300041512 | Bacteria | 597 |
| 757 | Ga0451853_3458144 | 3300041512 | Bacteria | 1738 |
| 758 | Ga0451853_3968423 | 3300041512 | Bacteria | 1138 |
| 759 | Ga0439441_002708 | 3300042001 | Bacteria | 2524 |
| 760 | Ga0439445_0057312 | 3300042004 | Unclassified | 1060 |
| 761 | Ga0439434_0122921 | 3300042435 | Bacteria | 847 |
| 762 | Ga0439444_0086875 | 3300042437 | Bacteria | 692 |
| 763 | Ga0439459_0195351 | 3300042438 | Bacteria | 550 |
| 764 | Ga0439460_0087242 | 3300042461 | Bacteria | 987 |
| 765 | Ga0451577_0120548 | 3300042876 | Bacteria | 2349 |
| 766 | Ga0451577_0141480 | 3300042876 | Unclassified | 2162 |
| 767 | Ga0453684_0121922 | 3300044712 | Bacteria | 3146 |
| 768 | Ga0453684_1138063 | 3300044712 | Unclassified | 823 |
| 769 | Ga0453684_2369017 | 3300044712 | Bacteria | 526 |
| 770 | Ga0451576_0732517 | 3300045051 | Bacteria | 1039 |
| 771 | Ga0451576_1684726 | 3300045051 | Bacteria | 657 |
| 772 | Ga0495627_215332 | 3300046453 | Bacteria | 528 |
| 773 | Ga0495592_0567717 | 3300046454 | Bacteria | 696 |
| 774 | Ga0495590_0005899 | 3300046457 | Bacteria | 4806 |
| 775 | Ga0495638_0031603 | 3300046460 | Bacteria | 3401 |
| 776 | Ga0495641_0296405 | 3300046461 | Bacteria | 729 |
| 777 | Ga0495650_0087027 | 3300046471 | Bacteria | 1195 |
| 778 | Ga0495580_0398656 | 3300046472 | Bacteria | 928 |
| 779 | Ga0495639_0047934 | 3300046475 | Bacteria | 1937 |
| 780 | Ga0495584_0711558 | 3300046491 | Bacteria | 512 |
| 781 | Ga0495585_0080608 | 3300046492 | Bacteria | 1764 |
| 782 | Ga0495585_0105295 | 3300046492 | Bacteria | 1505 |
| 783 | Ga0495585_0360636 | 3300046492 | Bacteria | 705 |
| 784 | Ga0495616_0156341 | 3300046513 | Bacteria | 1028 |
| 785 | Ga0495618_0118886 | 3300046514 | Bacteria | 1693 |
| 786 | Ga0495620_0129520 | 3300046515 | Bacteria | 991 |
| 787 | Ga0495628_0229858 | 3300046516 | Bacteria | 1391 |
| 788 | Ga0495632_0088149 | 3300046519 | Bacteria | 1474 |
| 789 | Ga0495632_0273994 | 3300046519 | Bacteria | 752 |
| 790 | Ga0495637_0017363 | 3300046520 | Bacteria | 3355 |
| 791 | Ga0495644_0345835 | 3300046523 | Bacteria | 585 |
| 792 | Ga0495663_0037513 | 3300046525 | Bacteria | 1462 |
| 793 | Ga0495652_0186082 | 3300046529 | Bacteria | 1589 |
| 794 | Ga0495640_0574015 | 3300046533 | Bacteria | 683 |
| 795 | Ga0495587_0169715 | 3300046536 | Bacteria | 1240 |
| 796 | Ga0495587_0394923 | 3300046536 | Bacteria | 769 |
| 797 | Ga0495621_0002870 | 3300046539 | Bacteria | 4694 |
| 798 | Ga0495621_0153108 | 3300046539 | Bacteria | 908 |
| 799 | Ga0495621_0275249 | 3300046539 | Bacteria | 693 |
| 800 | Ga0495667_0155994 | 3300046559 | Bacteria | 1469 |
| 801 | Ga0495656_0075175 | 3300046615 | Bacteria | 1511 |
| 802 | Ga0495656_0087629 | 3300046615 | Bacteria | 1418 |
| 803 | Ga0495668_0374095 | 3300046616 | Bacteria | 782 |
| 804 | Ga0495611_0338941 | 3300046648 | Bacteria | 691 |
| 805 | Ga0495625_0060202 | 3300046660 | Bacteria | 2691 |
| 806 | Ga0495625_0077317 | 3300046660 | Bacteria | 2326 |
| 807 | Ga0495625_0081023 | 3300046660 | Bacteria | 2260 |
| 808 | Ga0495635_0362707 | 3300046663 | Bacteria | 966 |
| 809 | Ga0495659_0107385 | 3300046664 | Bacteria | 1087 |
| 810 | Ga0495661_0214993 | 3300046665 | Bacteria | 999 |
| 811 | Ga0495599_0237946 | 3300046678 | Bacteria | 1111 |
| 812 | Ga0495599_0420483 | 3300046678 | Bacteria | 794 |
| 813 | Ga0495670_0435474 | 3300046691 | Bacteria | 710 |
| 814 | Ga0495649_0506525 | 3300046694 | Bacteria | 600 |
| 815 | Ga0495649_0537546 | 3300046694 | Bacteria | 579 |
| 816 | Ga0495581_0820107 | 3300047315 | Bacteria | 533 |
| 817 | Ga0495604_0119888 | 3300047317 | Bacteria | 1906 |
| 818 | Ga0495604_0771887 | 3300047317 | Bacteria | 607 |
| 819 | Ga0495685_019324 | 3300047447 | Bacteria | 2341 |
| 820 | Ga0495684_0817617 | 3300047471 | Bacteria | 607 |
| 821 | Ga0495602_0368870 | 3300048088 | Bacteria | 1031 |
| 822 | Ga0495615_0047193 | 3300048090 | Bacteria | 1097 |
| 823 | Ga0495626_0116094 | 3300048091 | Bacteria | 1155 |
| 824 | Ga0496100_0004400 | 3300048903 | Bacteria | 7463 |
| 825 | Ga0496100_0182201 | 3300048903 | Bacteria | 1519 |
| 826 | Ga0496102_0095979 | 3300048905 | Bacteria | 2748 |
| 827 | Ga0496102_1275242 | 3300048905 | Bacteria | 654 |
| 828 | Ga0496103_0026288 | 3300048906 | Bacteria | 3523 |
| 829 | Ga0496103_0991334 | 3300048906 | Bacteria | 523 |
| 830 | Ga0496104_0004927 | 3300048907 | Bacteria | 11647 |
| 831 | Ga0496104_0090195 | 3300048907 | Bacteria | 2929 |
| 832 | Ga0496104_0294739 | 3300048907 | Bacteria | 1535 |
| 833 | Ga0496105_0010453 | 3300048908 | Bacteria | 7296 |
| 834 | Ga0496105_0219291 | 3300048908 | Bacteria | 1549 |
| 835 | Ga0496105_0721191 | 3300048908 | Bacteria | 764 |
| 836 | Ga0496106_0018018 | 3300048909 | Bacteria | 5221 |
| 837 | Ga0496106_0073320 | 3300048909 | Bacteria | 2619 |
| 838 | Ga0496107_0001216 | 3300048910 | Bacteria | 15691 |
| 839 | Ga0496107_0122677 | 3300048910 | Bacteria | 1914 |
| 840 | Ga0496108_0001982 | 3300048911 | Bacteria | 16387 |
| 841 | Ga0496109_0000633 | 3300048912 | Bacteria | 29328 |
| 842 | Ga0496109_0111219 | 3300048912 | Bacteria | 2547 |
| 843 | Ga0496109_0923270 | 3300048912 | Bacteria | 811 |
| 844 | Ga0496110_0007585 | 3300048913 | Bacteria | 8669 |
| 845 | Ga0496110_0682383 | 3300048913 | Bacteria | 928 |
| 846 | Ga0496111_0006790 | 3300048914 | Bacteria | 7459 |
| 847 | Ga0496111_0097382 | 3300048914 | Bacteria | 2159 |
| 848 | Ga0496112_0000400 | 3300048915 | Bacteria | 28343 |
| 849 | Ga0496112_0612154 | 3300048915 | Bacteria | 1020 |
| 850 | Ga0496112_1148832 | 3300048915 | Bacteria | 694 |
| 851 | Ga0496113_0005600 | 3300048916 | Bacteria | 7856 |
| 852 | Ga0496113_0051586 | 3300048916 | Bacteria | 3070 |
| 853 | Ga0496114_0204233 | 3300048917 | Bacteria | 1731 |
| 854 | Ga0496114_0272876 | 3300048917 | Bacteria | 1490 |
| 855 | Ga0496114_0274173 | 3300048917 | Bacteria | 1487 |
| 856 | Ga0496114_0874533 | 3300048917 | Bacteria | 779 |
| 857 | Ga0496115_0022318 | 3300048918 | Bacteria | 4902 |
| 858 | Ga0496116_0152320 | 3300048919 | Bacteria | 1282 |
| 859 | Ga0496117_0316061 | 3300048920 | Bacteria | 820 |
| 860 | Ga0496118_0018464 | 3300048921 | Bacteria | 6293 |
| 861 | Ga0496121_0105333 | 3300048924 | Bacteria | 2165 |
| 862 | Ga0496122_0096002 | 3300048925 | Bacteria | 2001 |
| 863 | Ga0496123_0100612 | 3300048926 | Bacteria | 1683 |
| 864 | Ga0496124_0151279 | 3300048927 | Bacteria | 1820 |
| 865 | Ga0496125_0000164 | 3300048928 | Bacteria | 147789 |
| 866 | Ga0495678_163843 | 3300049459 | Bacteria | 709 |
| 867 | Ga0501297_075804 | 3300049520 | Unclassified | 538 |
| 868 | Ga0501031_0274551 | 3300049568 | Bacteria | 1094 |
| 869 | Ga0501032_0014842 | 3300049569 | Bacteria | 5513 |
| 870 | Ga0501032_0978080 | 3300049569 | Bacteria | 532 |
| 871 | Ga0501033_0021211 | 3300049570 | Bacteria | 4901 |
| 872 | Ga0501033_0179021 | 3300049570 | Bacteria | 1520 |
| 873 | Ga0501033_0848342 | 3300049570 | Bacteria | 616 |
| 874 | Ga0501036_0015220 | 3300049572 | Bacteria | 6423 |
| 875 | Ga0501036_0041878 | 3300049572 | Bacteria | 3876 |
| 876 | Ga0501036_0504276 | 3300049572 | Bacteria | 1007 |
| 877 | Ga0501036_0521226 | 3300049572 | Bacteria | 988 |
| 878 | Ga0501036_0922313 | 3300049572 | Bacteria | 716 |
| 879 | Ga0501036_1068057 | 3300049572 | Bacteria | 660 |
| 880 | Ga0501036_1086425 | 3300049572 | Bacteria | 654 |
| 881 | Ga0501036_1267287 | 3300049572 | Bacteria | 600 |
| 882 | Ga0501037_0796547 | 3300049573 | Bacteria | 624 |
| 883 | Ga0501038_0020300 | 3300049574 | Bacteria | 5976 |
| 884 | Ga0501038_0169293 | 3300049574 | Bacteria | 1770 |
| 885 | Ga0501038_1221805 | 3300049574 | Bacteria | 545 |
| 886 | Ga0501039_0058792 | 3300049575 | Bacteria | 2978 |
| 887 | Ga0501039_0120483 | 3300049575 | Bacteria | 2056 |
| 888 | Ga0501039_0527053 | 3300049575 | Bacteria | 927 |
| 889 | Ga0501039_1028680 | 3300049575 | Bacteria | 639 |
| 890 | Ga0501039_1317651 | 3300049575 | Bacteria | 557 |
| 891 | Ga0501040_0010290 | 3300049576 | Bacteria | 6117 |
| 892 | Ga0501040_0070046 | 3300049576 | Bacteria | 2420 |
| 893 | Ga0501040_1041791 | 3300049576 | Bacteria | 593 |
| 894 | Ga0501040_1347065 | 3300049576 | Bacteria | 518 |
| 895 | Ga0501041_0033240 | 3300049577 | Bacteria | 3120 |
| 896 | Ga0501041_0033891 | 3300049577 | Bacteria | 3090 |
| 897 | Ga0501041_0429632 | 3300049577 | Bacteria | 838 |
| 898 | Ga0501041_0447645 | 3300049577 | Bacteria | 820 |
| 899 | Ga0501042_0035033 | 3300049578 | Bacteria | 3561 |
| 900 | Ga0501042_0051674 | 3300049578 | Bacteria | 2932 |
| 901 | Ga0501042_0519598 | 3300049578 | Bacteria | 865 |
| 902 | Ga0501042_0600514 | 3300049578 | Bacteria | 800 |
| 903 | Ga0501042_0601326 | 3300049578 | Bacteria | 800 |
| 904 | Ga0501042_0606226 | 3300049578 | Bacteria | 796 |
| 905 | Ga0501042_1055765 | 3300049578 | Bacteria | 592 |
| 906 | Ga0501043_0259897 | 3300049579 | Bacteria | 1336 |
| 907 | Ga0501043_0753301 | 3300049579 | Bacteria | 708 |
| 908 | Ga0501046_0154988 | 3300049580 | Bacteria | 1726 |
| 909 | Ga0501046_0166832 | 3300049580 | Bacteria | 1654 |
| 910 | Ga0501046_0257553 | 3300049580 | Bacteria | 1283 |
| 911 | Ga0501048_0058949 | 3300049582 | Bacteria | 2720 |
| 912 | Ga0501048_0227922 | 3300049582 | Bacteria | 1322 |
| 913 | Ga0501067_0173646 | 3300049583 | Bacteria | 1200 |
| 914 | Ga0501068_0025220 | 3300049584 | Bacteria | 3497 |
| 915 | Ga0501068_0046874 | 3300049584 | Bacteria | 2606 |
| 916 | Ga0501068_0253447 | 3300049584 | Bacteria | 1122 |
| 917 | Ga0501068_0668236 | 3300049584 | Bacteria | 679 |
| 918 | Ga0501069_0017872 | 3300049585 | Bacteria | 3824 |
| 919 | Ga0501069_0130668 | 3300049585 | Bacteria | 1438 |
| 920 | Ga0501070_0084140 | 3300049586 | Bacteria | 2634 |
| 921 | Ga0501070_0314163 | 3300049586 | Bacteria | 1275 |
| 922 | Ga0501071_0038731 | 3300049587 | Bacteria | 3407 |
| 923 | Ga0501071_0085395 | 3300049587 | Bacteria | 2314 |
| 924 | Ga0501071_0392564 | 3300049587 | Bacteria | 1059 |
| 925 | Ga0501072_0003174 | 3300049588 | Bacteria | 12358 |
| 926 | Ga0501072_0197503 | 3300049588 | Bacteria | 1604 |
| 927 | Ga0501072_0244921 | 3300049588 | Bacteria | 1428 |
| 928 | Ga0501072_0300167 | 3300049588 | Bacteria | 1277 |
| 929 | Ga0501072_0301214 | 3300049588 | Bacteria | 1274 |
| 930 | Ga0501073_0062627 | 3300049589 | Bacteria | 2594 |
| 931 | Ga0501073_0162868 | 3300049589 | Bacteria | 1545 |
| 932 | Ga0501073_0408892 | 3300049589 | Bacteria | 938 |
| 933 | Ga0501074_0055255 | 3300049590 | Bacteria | 2862 |
| 934 | Ga0501074_0119587 | 3300049590 | Bacteria | 1884 |
| 935 | Ga0501074_0285423 | 3300049590 | Bacteria | 1173 |
| 936 | Ga0501074_0379355 | 3300049590 | Bacteria | 1003 |
| 937 | Ga0501074_0543277 | 3300049590 | Bacteria | 823 |
| 938 | Ga0501074_1141699 | 3300049590 | Bacteria | 547 |
| 939 | Ga0501075_0008080 | 3300049591 | Bacteria | 7317 |
| 940 | Ga0501075_0102482 | 3300049591 | Bacteria | 2174 |
| 941 | Ga0501075_0129719 | 3300049591 | Bacteria | 1921 |
| 942 | Ga0501075_0150567 | 3300049591 | Bacteria | 1774 |
| 943 | Ga0501075_0279702 | 3300049591 | Bacteria | 1272 |
| 944 | Ga0501075_0310909 | 3300049591 | Bacteria | 1201 |
| 945 | Ga0501075_0498458 | 3300049591 | Bacteria | 929 |
| 946 | Ga0501075_0661431 | 3300049591 | Bacteria | 796 |
| 947 | Ga0501075_1122258 | 3300049591 | Bacteria | 597 |
| 948 | Ga0501075_1311480 | 3300049591 | Bacteria | 549 |
| 949 | Ga0501076_0037327 | 3300049592 | Bacteria | 3809 |
| 950 | Ga0501076_0045487 | 3300049592 | Bacteria | 3466 |
| 951 | Ga0501076_0057885 | 3300049592 | Bacteria | 3079 |
| 952 | Ga0501076_0247013 | 3300049592 | Bacteria | 1460 |
| 953 | Ga0501076_0362875 | 3300049592 | Bacteria | 1190 |
| 954 | Ga0501076_0483046 | 3300049592 | Bacteria | 1021 |
| 955 | Ga0501076_0543079 | 3300049592 | Bacteria | 958 |
| 956 | Ga0501076_0959496 | 3300049592 | Bacteria | 705 |
| 957 | Ga0501076_0990532 | 3300049592 | Bacteria | 692 |
| 958 | Ga0501077_0009972 | 3300049593 | Bacteria | 5912 |
| 959 | Ga0501077_0061225 | 3300049593 | Bacteria | 2388 |
| 960 | Ga0501077_0226965 | 3300049593 | Bacteria | 1187 |
| 961 | Ga0501077_0280574 | 3300049593 | Bacteria | 1060 |
| 962 | Ga0501077_0305632 | 3300049593 | Bacteria | 1013 |
| 963 | Ga0501077_0386524 | 3300049593 | Bacteria | 894 |
| 964 | Ga0501077_0452288 | 3300049593 | Bacteria | 822 |
| 965 | Ga0501079_0106401 | 3300049741 | Bacteria | 2177 |
| 966 | Ga0501079_0252495 | 3300049741 | Bacteria | 1378 |
| 967 | Ga0501079_0317593 | 3300049741 | Bacteria | 1219 |
| 968 | Ga0501079_0462419 | 3300049741 | Bacteria | 996 |
| 969 | Ga0501079_0468376 | 3300049741 | Bacteria | 990 |
| 970 | Ga0501079_0567044 | 3300049741 | Bacteria | 893 |
| 971 | Ga0501079_1041991 | 3300049741 | Bacteria | 644 |
| 972 | Ga0501080_0192894 | 3300049742 | Bacteria | 1872 |
| 973 | Ga0501080_0442922 | 3300049742 | Bacteria | 1165 |
| 974 | Ga0501080_1323437 | 3300049742 | Bacteria | 616 |
| 975 | Ga0501081_0088873 | 3300049743 | Bacteria | 2171 |
| 976 | Ga0501081_0294962 | 3300049743 | Bacteria | 1189 |
| 977 | Ga0501081_0324108 | 3300049743 | Bacteria | 1133 |
| 978 | Ga0501081_1000567 | 3300049743 | Bacteria | 632 |
| 979 | Ga0501081_1077780 | 3300049743 | Bacteria | 608 |
| 980 | Ga0501081_1295789 | 3300049743 | Bacteria | 552 |
| 981 | Ga0501083_0130949 | 3300049744 | Bacteria | 1644 |
| 982 | Ga0501035_0156134 | 3300049822 | Bacteria | 1978 |
| 983 | Ga0501035_0191060 | 3300049822 | Bacteria | 1760 |
| 984 | Ga0501044_1171247 | 3300049823 | Bacteria | 637 |
| 985 | Ga0501044_1236664 | 3300049823 | Bacteria | 614 |
| 986 | Ga0501045_0054894 | 3300049824 | Bacteria | 2913 |
| 987 | Ga0501045_0056579 | 3300049824 | Bacteria | 2869 |
| 988 | Ga0501045_0177568 | 3300049824 | Bacteria | 1586 |
| 989 | nmdc:mga03683_39084_c1 | 3300050489 | Bacteria | 1941 |
| 990 | nmdc:mga03683_61999_c1 | 3300050489 | Bacteria | 1583 |
| 991 | nmdc:mga03683_78013_c1 | 3300050489 | Bacteria | 858 |
| 992 | nmdc:mga03n38_1178_c1 | 3300050490 | Bacteria | 7287 |
| 993 | nmdc:mga03n38_194356_c1 | 3300050490 | Bacteria | 1047 |
| 994 | nmdc:mga03n38_961607_c1 | 3300050490 | Bacteria | 504 |
| 995 | nmdc:mga00v17_397260_c1 | 3300050491 | Bacteria | 896 |
| 996 | nmdc:mga0yw44_10029_c1 | 3300050492 | Bacteria | 4819 |
| 997 | nmdc:mga0yw44_212548_c1 | 3300050492 | Bacteria | 1280 |
| 998 | nmdc:mga0yw44_29263_c2 | 3300050492 | Bacteria | 1024 |
| 999 | nmdc:mga0yw44_832033_c1 | 3300050492 | Bacteria | 627 |
| 1000 | nmdc:mga06z11_136192_c1 | 3300050494 | Bacteria | 1384 |
| 1001 | nmdc:mga06z11_206027_c1 | 3300050494 | Bacteria | 1144 |
| 1002 | nmdc:mga06z11_224408_c1 | 3300050494 | Bacteria | 1099 |
| 1003 | nmdc:mga06z11_3732_c1 | 3300050494 | Bacteria | 5919 |
| 1004 | nmdc:mga06z11_459846_c1 | 3300050494 | Bacteria | 769 |
| 1005 | nmdc:mga07m45_134146_c1 | 3300050496 | Bacteria | 1433 |
| 1006 | nmdc:mga07m45_1587_c1 | 3300050496 | Bacteria | 10470 |
| 1007 | nmdc:mga05p37_102920_c1 | 3300050507 | Bacteria | 3516 |
| 1008 | nmdc:mga05p37_1501614_c1 | 3300050507 | Bacteria | 671 |
| 1009 | nmdc:mga05p37_1689629_c1 | 3300050507 | Bacteria | 618 |
| 1010 | nmdc:mga05p37_176990_c1 | 3300050507 | Bacteria | 2598 |
| 1011 | nmdc:mga05p37_2192820_c1 | 3300050507 | Bacteria | 513 |
| 1012 | nmdc:mga05p37_348_c1 | 3300050507 | Bacteria | 49472 |
| 1013 | nmdc:mga05p37_448926_c1 | 3300050507 | Bacteria | 1493 |
| 1014 | nmdc:mga05p37_468372_c1 | 3300050507 | Bacteria | 1454 |
| 1015 | nmdc:mga09592_1260904_c1 | 3300050508 | Bacteria | 609 |
| 1016 | nmdc:mga09592_151652_c1 | 3300050508 | Bacteria | 2000 |
| 1017 | nmdc:mga09592_5_c1 | 3300050508 | Bacteria | 130353 |
| 1018 | nmdc:mga0qj67_1273265_c1 | 3300050509 | Bacteria | 570 |
| 1019 | nmdc:mga0qj67_45509_c1 | 3300050509 | Bacteria | 3463 |
| 1020 | nmdc:mga06r32_102295_c1 | 3300050510 | Bacteria | 2812 |
| 1021 | nmdc:mga06r32_11679_c1 | 3300050510 | Bacteria | 7904 |
| 1022 | nmdc:mga06r32_191709_c1 | 3300050510 | Bacteria | 2031 |
| 1023 | nmdc:mga06r32_314673_c1 | 3300050510 | Bacteria | 1551 |
| 1024 | nmdc:mga06r32_950258_c1 | 3300050510 | Bacteria | 814 |
| 1025 | nmdc:mga06r32_96986_c1 | 3300050510 | Bacteria | 941 |
| 1026 | nmdc:mga08y16_221905_c1 | 3300050511 | Bacteria | 1956 |
| 1027 | nmdc:mga08y16_230263_c1 | 3300050511 | Bacteria | 1916 |
| 1028 | nmdc:mga08y16_2349_c1 | 3300050511 | Bacteria | 19391 |
| 1029 | nmdc:mga08y16_30230_c1 | 3300050511 | Bacteria | 5702 |
| 1030 | nmdc:mga08y16_399159_c1 | 3300050511 | Bacteria | 1408 |
| 1031 | nmdc:mga08y16_405778_c1 | 3300050511 | Bacteria | 1394 |
| 1032 | nmdc:mga08y16_50531_c1 | 3300050511 | Bacteria | 4351 |
| 1033 | nmdc:mga08y16_955334_c1 | 3300050511 | Bacteria | 840 |
| 1034 | nmdc:mga0n895_409720_c1 | 3300050512 | Bacteria | 1371 |
| 1035 | nmdc:mga0n895_413112_c1 | 3300050512 | Bacteria | 1364 |
| 1036 | nmdc:mga0n895_42972_c1 | 3300050512 | Bacteria | 4401 |
| 1037 | nmdc:mga0n895_473758_c1 | 3300050512 | Bacteria | 1263 |
| 1038 | nmdc:mga0rr50_1077155_c1 | 3300050513 | Bacteria | 684 |
| 1039 | nmdc:mga08x19_153055_c1 | 3300050514 | Bacteria | 1563 |
| 1040 | nmdc:mga0a205_29717_c2 | 3300050515 | Bacteria | 3178 |
| 1041 | nmdc:mga0a205_506359_c1 | 3300050515 | Bacteria | 1064 |
| 1042 | nmdc:mga0a205_779377_c1 | 3300050515 | Bacteria | 804 |
| 1043 | nmdc:mga0sz30_62707_c1 | 3300050516 | Bacteria | 1590 |
| 1044 | Ga0495601_0013981 | 3300053077 | Bacteria | 4833 |
| 1045 | Ga0495612_0094096 | 3300053078 | Bacteria | 1272 |
| 1046 | Ga0500635_0102332 | 3300053080 | Bacteria | 1055 |
| 1047 | Ga0495655_0000628 | 3300053083 | Bacteria | 5741 |
| 1048 | Ga0495595_0155983 | 3300053084 | Bacteria | 1125 |
| 1049 | Ga0495619_0380483 | 3300053085 | Bacteria | 975 |
| 1050 | Ga0500607_259147 | 3300053121 | Bacteria | 683 |
| 1051 | Ga0500618_005777 | 3300053125 | Bacteria | 3720 |
| 1052 | Ga0500567_043907 | 3300053723 | Bacteria | 2073 |
| 1053 | Ga0501084_0033695 | 3300054114 | Bacteria | 4284 |
| 1054 | Ga0501084_0073208 | 3300054114 | Bacteria | 2869 |
| 1055 | Ga0501084_0073995 | 3300054114 | Bacteria | 2853 |
| 1056 | Ga0501084_0147187 | 3300054114 | Bacteria | 1984 |
| 1057 | Ga0501084_1618901 | 3300054114 | Bacteria | 541 |
| 1058 | Ga0501082_0006177 | 3300060353 | Bacteria | 10398 |
| 1059 | Ga0501082_0180677 | 3300060353 | Bacteria | 1835 |
| 1060 | Ga0501082_0182537 | 3300060353 | Bacteria | 1825 |
| 1061 | Ga0501082_0251458 | 3300060353 | Bacteria | 1538 |
| 1062 | Ga0501082_0294415 | 3300060353 | Bacteria | 1413 |
| 1063 | Ga0501082_1646562 | 3300060353 | Bacteria | 560 |
| 1064 | Ga0530510_0008431 | 3300061734 | Bacteria | 7184 |
| 1065 | Ga0530510_0040315 | 3300061734 | Bacteria | 3370 |
| 1066 | Ga0530510_0363112 | 3300061734 | Bacteria | 1089 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046519 | Ga0495632_0088149 | Ga0495632_0088149_199_618 | 105 |
| 2 | 3300009545 | Ga0105237_10157318 | Ga0105237_101573184 | 109 |
| 3 | 3300025914 | Ga0207671_10481807 | Ga0207671_104818072 | 109 |
| 4 | 3300035084 | Ga0373928_0150689 | Ga0373928_0150689_181_546 | 109 |
| 5 | 3300031824 | Ga0307413_10147138 | Ga0307413_101471382 | 113 |
| 6 | 3300031852 | Ga0307410_10027077 | Ga0307410_100270773 | 113 |
| 7 | 3300031903 | Ga0307407_10012375 | Ga0307407_100123754 | 113 |
| 8 | 3300031995 | Ga0307409_100094227 | Ga0307409_1000942272 | 113 |
| 9 | 3300032005 | Ga0307411_10314037 | Ga0307411_103140372 | 113 |
| 10 | 3300046648 | Ga0495611_0338941 | Ga0495611_0338941_144_503 | 114 |
| 11 | 3300002077 | JGI24744J21845_10101059 | JGI24744J21845_101010591 | 117 |
| 12 | 3300002244 | JGI24742J22300_10043033 | JGI24742J22300_100430332 | 117 |
| 13 | 3300005293 | Ga0065715_10759263 | Ga0065715_107592632 | 117 |
| 14 | 3300005328 | Ga0070676_10397834 | Ga0070676_103978342 | 117 |
| 15 | 3300005333 | Ga0070677_10042171 | Ga0070677_100421712 | 117 |
| 16 | 3300005334 | Ga0068869_100104321 | Ga0068869_1001043212 | 117 |
| 17 | 3300005334 | Ga0068869_101000833 | Ga0068869_1010008332 | 117 |
| 18 | 3300005356 | Ga0070674_100039433 | Ga0070674_1000394333 | 117 |
| 19 | 3300005364 | Ga0070673_100290422 | Ga0070673_1002904222 | 117 |
| 20 | 3300005367 | Ga0070667_100429111 | Ga0070667_1004291112 | 117 |
| 21 | 3300005438 | Ga0070701_10612076 | Ga0070701_106120762 | 117 |
| 22 | 3300005455 | Ga0070663_100042205 | Ga0070663_1000422052 | 117 |
| 23 | 3300005456 | Ga0070678_100051594 | Ga0070678_1000515942 | 117 |
| 24 | 3300005457 | Ga0070662_100639693 | Ga0070662_1006396931 | 117 |
| 25 | 3300005459 | Ga0068867_100437315 | Ga0068867_1004373152 | 117 |
| 26 | 3300005543 | Ga0070672_100011114 | Ga0070672_1000111144 | 117 |
| 27 | 3300005548 | Ga0070665_100258146 | Ga0070665_1002581462 | 117 |
| 28 | 3300005615 | Ga0070702_100386439 | Ga0070702_1003864391 | 117 |
| 29 | 3300005719 | Ga0068861_100424974 | Ga0068861_1004249742 | 117 |
| 30 | 3300005840 | Ga0068870_10477476 | Ga0068870_104774762 | 117 |
| 31 | 3300005841 | Ga0068863_101143695 | Ga0068863_1011436951 | 117 |
| 32 | 3300006237 | Ga0097621_100966918 | Ga0097621_1009669182 | 117 |
| 33 | 3300006358 | Ga0068871_100274062 | Ga0068871_1002740621 | 117 |
| 34 | 3300006358 | Ga0068871_100974999 | Ga0068871_1009749992 | 117 |
| 35 | 3300006871 | Ga0075434_100629395 | Ga0075434_1006293951 | 117 |
| 36 | 3300009148 | Ga0105243_10762726 | Ga0105243_107627261 | 117 |
| 37 | 3300009176 | Ga0105242_10261036 | Ga0105242_102610361 | 117 |
| 38 | 3300013297 | Ga0157378_11397435 | Ga0157378_113974352 | 117 |
| 39 | 3300013306 | Ga0163162_11160413 | Ga0163162_111604132 | 117 |
| 40 | 3300013308 | Ga0157375_10972892 | Ga0157375_109728921 | 117 |
| 41 | 3300014325 | Ga0163163_10891707 | Ga0163163_108917072 | 117 |
| 42 | 3300014968 | Ga0157379_10643133 | Ga0157379_106431332 | 117 |
| 43 | 3300014969 | Ga0157376_10507449 | Ga0157376_105074492 | 117 |
| 44 | 3300017792 | Ga0163161_10767451 | Ga0163161_107674512 | 117 |
| 45 | 3300025893 | Ga0207682_10003239 | Ga0207682_100032397 | 117 |
| 46 | 3300025899 | Ga0207642_10036811 | Ga0207642_100368112 | 117 |
| 47 | 3300025907 | Ga0207645_10075319 | Ga0207645_100753192 | 117 |
| 48 | 3300025908 | Ga0207643_10713642 | Ga0207643_107136421 | 117 |
| 49 | 3300025933 | Ga0207706_10939280 | Ga0207706_109392801 | 117 |
| 50 | 3300025934 | Ga0207686_10802782 | Ga0207686_108027822 | 117 |
| 51 | 3300025935 | Ga0207709_10259269 | Ga0207709_102592692 | 117 |
| 52 | 3300025937 | Ga0207669_10033296 | Ga0207669_100332962 | 117 |
| 53 | 3300025937 | Ga0207669_11571520 | Ga0207669_115715201 | 117 |
| 54 | 3300025938 | Ga0207704_10417450 | Ga0207704_104174502 | 117 |
| 55 | 3300025940 | Ga0207691_10005505 | Ga0207691_100055058 | 117 |
| 56 | 3300025941 | Ga0207711_10289652 | Ga0207711_102896522 | 117 |
| 57 | 3300025942 | Ga0207689_11537481 | Ga0207689_115374812 | 117 |
| 58 | 3300025960 | Ga0207651_10919728 | Ga0207651_109197282 | 117 |
| 59 | 3300026023 | Ga0207677_10704384 | Ga0207677_107043842 | 117 |
| 60 | 3300026067 | Ga0207678_10246095 | Ga0207678_102460952 | 117 |
| 61 | 3300026088 | Ga0207641_11307783 | Ga0207641_113077831 | 117 |
| 62 | 3300026089 | Ga0207648_10022150 | Ga0207648_100221503 | 117 |
| 63 | 3300026121 | Ga0207683_10028583 | Ga0207683_100285833 | 117 |
| 64 | 3300028379 | Ga0268266_10237482 | Ga0268266_102374822 | 117 |
| 65 | 3300028380 | Ga0268265_12095664 | Ga0268265_120956641 | 117 |
| 66 | 3300031548 | Ga0307408_100280122 | Ga0307408_1002801221 | 117 |
| 67 | 3300031901 | Ga0307406_10310814 | Ga0307406_103108141 | 117 |
| 68 | 3300031903 | Ga0307407_10338632 | Ga0307407_103386321 | 117 |
| 69 | 3300031911 | Ga0307412_10343604 | Ga0307412_103436041 | 117 |
| 70 | 3300032002 | Ga0307416_100094520 | Ga0307416_1000945202 | 117 |
| 71 | 3300032004 | Ga0307414_10906003 | Ga0307414_109060032 | 117 |
| 72 | 3300032005 | Ga0307411_10081837 | Ga0307411_100818372 | 117 |
| 73 | 3300041486 | Ga0451807_2604943 | Ga0451807_2604943_381_734 | 117 |
| 74 | 3300042876 | Ga0451577_0120548 | Ga0451577_0120548_1848_2201 | 117 |
| 75 | 3300044712 | Ga0453684_0121922 | Ga0453684_0121922_1230_1583 | 117 |
| 76 | 3300046691 | Ga0495670_0435474 | Ga0495670_0435474_195_548 | 117 |
| 77 | 3300046694 | Ga0495649_0537546 | Ga0495649_0537546_87_440 | 117 |
| 78 | 3300048912 | Ga0496109_0923270 | Ga0496109_0923270_52_405 | 117 |
| 79 | 3300050512 | nmdc:mga0n895_409720_c1 | nmdc:mga0n895_409720_c1_298_651 | 117 |
| 80 | 3300050514 | nmdc:mga08x19_153055_c1 | nmdc:mga08x19_153055_c1_270_623 | 117 |
| 81 | 3300002244 | JGI24742J22300_10085329 | JGI24742J22300_100853291 | 118 |
| 82 | 3300005330 | Ga0070690_100716923 | Ga0070690_1007169231 | 118 |
| 83 | 3300005335 | Ga0070666_10411434 | Ga0070666_104114342 | 118 |
| 84 | 3300005340 | Ga0070689_100276349 | Ga0070689_1002763493 | 118 |
| 85 | 3300005347 | Ga0070668_100499828 | Ga0070668_1004998282 | 118 |
| 86 | 3300005347 | Ga0070668_101021219 | Ga0070668_1010212192 | 118 |
| 87 | 3300005354 | Ga0070675_100490600 | Ga0070675_1004906002 | 118 |
| 88 | 3300005356 | Ga0070674_100008010 | Ga0070674_1000080107 | 118 |
| 89 | 3300005364 | Ga0070673_100578887 | Ga0070673_1005788871 | 118 |
| 90 | 3300005365 | Ga0070688_100066185 | Ga0070688_1000661853 | 118 |
| 91 | 3300005366 | Ga0070659_101051100 | Ga0070659_1010511001 | 118 |
| 92 | 3300005367 | Ga0070667_100042351 | Ga0070667_1000423514 | 118 |
| 93 | 3300005440 | Ga0070705_100891852 | Ga0070705_1008918521 | 118 |
| 94 | 3300005441 | Ga0070700_100570968 | Ga0070700_1005709682 | 118 |
| 95 | 3300005444 | Ga0070694_100506881 | Ga0070694_1005068812 | 118 |
| 96 | 3300005444 | Ga0070694_100898372 | Ga0070694_1008983721 | 118 |
| 97 | 3300005455 | Ga0070663_100192677 | Ga0070663_1001926771 | 118 |
| 98 | 3300005456 | Ga0070678_100536330 | Ga0070678_1005363302 | 118 |
| 99 | 3300005457 | Ga0070662_101620786 | Ga0070662_1016207861 | 118 |
| 100 | 3300005543 | Ga0070672_100654130 | Ga0070672_1006541302 | 118 |
| 101 | 3300005546 | Ga0070696_100166438 | Ga0070696_1001664383 | 118 |
| 102 | 3300005549 | Ga0070704_100179392 | Ga0070704_1001793922 | 118 |
| 103 | 3300005578 | Ga0068854_100832597 | Ga0068854_1008325972 | 118 |
| 104 | 3300005578 | Ga0068854_101260940 | Ga0068854_1012609402 | 118 |
| 105 | 3300005616 | Ga0068852_102268943 | Ga0068852_1022689431 | 118 |
| 106 | 3300005617 | Ga0068859_100503115 | Ga0068859_1005031153 | 118 |
| 107 | 3300005718 | Ga0068866_10675756 | Ga0068866_106757562 | 118 |
| 108 | 3300005718 | Ga0068866_10726436 | Ga0068866_107264361 | 118 |
| 109 | 3300005719 | Ga0068861_100034292 | Ga0068861_1000342922 | 118 |
| 110 | 3300005840 | Ga0068870_10044675 | Ga0068870_100446753 | 118 |
| 111 | 3300005841 | Ga0068863_101946318 | Ga0068863_1019463182 | 118 |
| 112 | 3300005842 | Ga0068858_100201330 | Ga0068858_1002013303 | 118 |
| 113 | 3300005843 | Ga0068860_100904726 | Ga0068860_1009047262 | 118 |
| 114 | 3300005844 | Ga0068862_100128197 | Ga0068862_1001281974 | 118 |
| 115 | 3300006177 | Ga0075362_10058135 | Ga0075362_100581352 | 118 |
| 116 | 3300006237 | Ga0097621_100912438 | Ga0097621_1009124382 | 118 |
| 117 | 3300006846 | Ga0075430_100221187 | Ga0075430_1002211872 | 118 |
| 118 | 3300006852 | Ga0075433_10072810 | Ga0075433_100728102 | 118 |
| 119 | 3300006871 | Ga0075434_100278673 | Ga0075434_1002786732 | 118 |
| 120 | 3300006881 | Ga0068865_100101247 | Ga0068865_1001012473 | 118 |
| 121 | 3300006931 | Ga0097620_100503145 | Ga0097620_1005031453 | 118 |
| 122 | 3300009094 | Ga0111539_10717690 | Ga0111539_107176902 | 118 |
| 123 | 3300009094 | Ga0111539_10766076 | Ga0111539_107660762 | 118 |
| 124 | 3300009147 | Ga0114129_10206847 | Ga0114129_102068472 | 118 |
| 125 | 3300009147 | Ga0114129_11124000 | Ga0114129_111240002 | 118 |
| 126 | 3300009148 | Ga0105243_10046925 | Ga0105243_100469254 | 118 |
| 127 | 3300009553 | Ga0105249_10046617 | Ga0105249_100466173 | 118 |
| 128 | 3300010375 | Ga0105239_10926368 | Ga0105239_109263681 | 118 |
| 129 | 3300011119 | Ga0105246_10147417 | Ga0105246_101474173 | 118 |
| 130 | 3300012494 | Ga0157341_1003637 | Ga0157341_10036372 | 118 |
| 131 | 3300012513 | Ga0157326_1010374 | Ga0157326_10103742 | 118 |
| 132 | 3300013296 | Ga0157374_12731598 | Ga0157374_127315981 | 118 |
| 133 | 3300013306 | Ga0163162_11379610 | Ga0163162_113796102 | 118 |
| 134 | 3300013308 | Ga0157375_10102597 | Ga0157375_101025973 | 118 |
| 135 | 3300013308 | Ga0157375_11274581 | Ga0157375_112745812 | 118 |
| 136 | 3300014325 | Ga0163163_10267597 | Ga0163163_102675972 | 118 |
| 137 | 3300014326 | Ga0157380_10422125 | Ga0157380_104221253 | 118 |
| 138 | 3300014326 | Ga0157380_10863907 | Ga0157380_108639072 | 118 |
| 139 | 3300014969 | Ga0157376_10028966 | Ga0157376_100289663 | 118 |
| 140 | 3300017792 | Ga0163161_10089587 | Ga0163161_100895872 | 118 |
| 141 | 3300025899 | Ga0207642_10325115 | Ga0207642_103251152 | 118 |
| 142 | 3300025899 | Ga0207642_10494725 | Ga0207642_104947252 | 118 |
| 143 | 3300025901 | Ga0207688_10133948 | Ga0207688_101339482 | 118 |
| 144 | 3300025904 | Ga0207647_10288886 | Ga0207647_102888861 | 118 |
| 145 | 3300025908 | Ga0207643_10089816 | Ga0207643_100898162 | 118 |
| 146 | 3300025923 | Ga0207681_10701050 | Ga0207681_107010502 | 118 |
| 147 | 3300025933 | Ga0207706_10489218 | Ga0207706_104892182 | 118 |
| 148 | 3300025935 | Ga0207709_10258863 | Ga0207709_102588632 | 118 |
| 149 | 3300025938 | Ga0207704_10362465 | Ga0207704_103624652 | 118 |
| 150 | 3300025945 | Ga0207679_11140419 | Ga0207679_111404191 | 118 |
| 151 | 3300025961 | Ga0207712_10060130 | Ga0207712_100601302 | 118 |
| 152 | 3300025972 | Ga0207668_10235326 | Ga0207668_102353262 | 118 |
| 153 | 3300025972 | Ga0207668_10871932 | Ga0207668_108719322 | 118 |
| 154 | 3300025981 | Ga0207640_10085407 | Ga0207640_100854073 | 118 |
| 155 | 3300025981 | Ga0207640_10954915 | Ga0207640_109549152 | 118 |
| 156 | 3300026035 | Ga0207703_10167161 | Ga0207703_101671612 | 118 |
| 157 | 3300026067 | Ga0207678_10512222 | Ga0207678_105122222 | 118 |
| 158 | 3300026075 | Ga0207708_10132218 | Ga0207708_101322183 | 118 |
| 159 | 3300026075 | Ga0207708_10180197 | Ga0207708_101801972 | 118 |
| 160 | 3300026089 | Ga0207648_10208303 | Ga0207648_102083032 | 118 |
| 161 | 3300026089 | Ga0207648_10641701 | Ga0207648_106417012 | 118 |
| 162 | 3300026118 | Ga0207675_100018555 | Ga0207675_1000185557 | 118 |
| 163 | 3300026118 | Ga0207675_100494449 | Ga0207675_1004944492 | 118 |
| 164 | 3300026121 | Ga0207683_10524950 | Ga0207683_105249502 | 118 |
| 165 | 3300026142 | Ga0207698_12312798 | Ga0207698_123127981 | 118 |
| 166 | 3300027876 | Ga0209974_10042439 | Ga0209974_100424392 | 118 |
| 167 | 3300028380 | Ga0268265_10717636 | Ga0268265_107176362 | 118 |
| 168 | 3300031901 | Ga0307406_12021221 | Ga0307406_120212212 | 118 |
| 169 | 3300032005 | Ga0307411_10385597 | Ga0307411_103855973 | 118 |
| 170 | 3300041486 | Ga0451807_2422974 | Ga0451807_2422974_126_482 | 118 |
| 171 | 3300041512 | Ga0451853_3968423 | Ga0451853_3968423_516_872 | 118 |
| 172 | 3300042876 | Ga0451577_0141480 | Ga0451577_0141480_59_415 | 118 |
| 173 | 3300044712 | Ga0453684_1138063 | Ga0453684_1138063_397_753 | 118 |
| 174 | 3300045051 | Ga0451576_0732517 | Ga0451576_0732517_46_402 | 118 |
| 175 | 3300046453 | Ga0495627_215332 | Ga0495627_215332_14_370 | 118 |
| 176 | 3300046492 | Ga0495585_0080608 | Ga0495585_0080608_41_397 | 118 |
| 177 | 3300046520 | Ga0495637_0017363 | Ga0495637_0017363_677_1033 | 118 |
| 178 | 3300046523 | Ga0495644_0345835 | Ga0495644_0345835_48_404 | 118 |
| 179 | 3300046525 | Ga0495663_0037513 | Ga0495663_0037513_30_386 | 118 |
| 180 | 3300046615 | Ga0495656_0087629 | Ga0495656_0087629_986_1342 | 118 |
| 181 | 3300046660 | Ga0495625_0077317 | Ga0495625_0077317_832_1188 | 118 |
| 182 | 3300046664 | Ga0495659_0107385 | Ga0495659_0107385_121_477 | 118 |
| 183 | 3300046665 | Ga0495661_0214993 | Ga0495661_0214993_196_552 | 118 |
| 184 | 3300048905 | Ga0496102_1275242 | Ga0496102_1275242_224_580 | 118 |
| 185 | 3300048906 | Ga0496103_0991334 | Ga0496103_0991334_75_431 | 118 |
| 186 | 3300048907 | Ga0496104_0090195 | Ga0496104_0090195_1439_1795 | 118 |
| 187 | 3300048908 | Ga0496105_0219291 | Ga0496105_0219291_985_1341 | 118 |
| 188 | 3300048909 | Ga0496106_0073320 | Ga0496106_0073320_947_1303 | 118 |
| 189 | 3300048910 | Ga0496107_0122677 | Ga0496107_0122677_943_1299 | 118 |
| 190 | 3300048917 | Ga0496114_0274173 | Ga0496114_0274173_342_698 | 118 |
| 191 | 3300049568 | Ga0501031_0274551 | Ga0501031_0274551_231_587 | 118 |
| 192 | 3300049569 | Ga0501032_0014842 | Ga0501032_0014842_4226_4582 | 118 |
| 193 | 3300049569 | Ga0501032_0978080 | Ga0501032_0978080_115_471 | 118 |
| 194 | 3300049570 | Ga0501033_0021211 | Ga0501033_0021211_2054_2410 | 118 |
| 195 | 3300049570 | Ga0501033_0179021 | Ga0501033_0179021_681_1037 | 118 |
| 196 | 3300049572 | Ga0501036_0015220 | Ga0501036_0015220_4274_4630 | 118 |
| 197 | 3300049572 | Ga0501036_0041878 | Ga0501036_0041878_1480_1836 | 118 |
| 198 | 3300049572 | Ga0501036_0504276 | Ga0501036_0504276_516_875 | 118 |
| 199 | 3300049572 | Ga0501036_1267287 | Ga0501036_1267287_145_501 | 118 |
| 200 | 3300049573 | Ga0501037_0796547 | Ga0501037_0796547_233_589 | 118 |
| 201 | 3300049574 | Ga0501038_0020300 | Ga0501038_0020300_396_752 | 118 |
| 202 | 3300049574 | Ga0501038_1221805 | Ga0501038_1221805_178_534 | 118 |
| 203 | 3300049575 | Ga0501039_0058792 | Ga0501039_0058792_1009_1365 | 118 |
| 204 | 3300049575 | Ga0501039_0120483 | Ga0501039_0120483_995_1351 | 118 |
| 205 | 3300049575 | Ga0501039_1028680 | Ga0501039_1028680_215_574 | 118 |
| 206 | 3300049576 | Ga0501040_0010290 | Ga0501040_0010290_472_828 | 118 |
| 207 | 3300049576 | Ga0501040_1347065 | Ga0501040_1347065_135_491 | 118 |
| 208 | 3300049577 | Ga0501041_0033240 | Ga0501041_0033240_2027_2383 | 118 |
| 209 | 3300049577 | Ga0501041_0033891 | Ga0501041_0033891_737_1093 | 118 |
| 210 | 3300049578 | Ga0501042_0035033 | Ga0501042_0035033_2355_2711 | 118 |
| 211 | 3300049578 | Ga0501042_0600514 | Ga0501042_0600514_95_451 | 118 |
| 212 | 3300049578 | Ga0501042_0601326 | Ga0501042_0601326_414_770 | 118 |
| 213 | 3300049579 | Ga0501043_0259897 | Ga0501043_0259897_928_1284 | 118 |
| 214 | 3300049579 | Ga0501043_0753301 | Ga0501043_0753301_64_420 | 118 |
| 215 | 3300049580 | Ga0501046_0154988 | Ga0501046_0154988_655_1011 | 118 |
| 216 | 3300049582 | Ga0501048_0058949 | Ga0501048_0058949_1721_2077 | 118 |
| 217 | 3300049584 | Ga0501068_0046874 | Ga0501068_0046874_1115_1471 | 118 |
| 218 | 3300049584 | Ga0501068_0253447 | Ga0501068_0253447_719_1078 | 118 |
| 219 | 3300049585 | Ga0501069_0017872 | Ga0501069_0017872_1298_1654 | 118 |
| 220 | 3300049586 | Ga0501070_0314163 | Ga0501070_0314163_23_379 | 118 |
| 221 | 3300049587 | Ga0501071_0038731 | Ga0501071_0038731_2358_2714 | 118 |
| 222 | 3300049588 | Ga0501072_0003174 | Ga0501072_0003174_1629_1985 | 118 |
| 223 | 3300049588 | Ga0501072_0197503 | Ga0501072_0197503_907_1263 | 118 |
| 224 | 3300049588 | Ga0501072_0244921 | Ga0501072_0244921_700_1056 | 118 |
| 225 | 3300049588 | Ga0501072_0300167 | Ga0501072_0300167_797_1153 | 118 |
| 226 | 3300049589 | Ga0501073_0162868 | Ga0501073_0162868_1121_1477 | 118 |
| 227 | 3300049590 | Ga0501074_0055255 | Ga0501074_0055255_393_749 | 118 |
| 228 | 3300049590 | Ga0501074_0119587 | Ga0501074_0119587_1382_1738 | 118 |
| 229 | 3300049590 | Ga0501074_0543277 | Ga0501074_0543277_422_781 | 118 |
| 230 | 3300049591 | Ga0501075_0008080 | Ga0501075_0008080_5971_6327 | 118 |
| 231 | 3300049591 | Ga0501075_0102482 | Ga0501075_0102482_1621_1980 | 118 |
| 232 | 3300049591 | Ga0501075_0150567 | Ga0501075_0150567_1047_1406 | 118 |
| 233 | 3300049591 | Ga0501075_0661431 | Ga0501075_0661431_221_577 | 118 |
| 234 | 3300049592 | Ga0501076_0037327 | Ga0501076_0037327_1569_1925 | 118 |
| 235 | 3300049592 | Ga0501076_0057885 | Ga0501076_0057885_2617_2973 | 118 |
| 236 | 3300049592 | Ga0501076_0990532 | Ga0501076_0990532_173_532 | 118 |
| 237 | 3300049593 | Ga0501077_0009972 | Ga0501077_0009972_2864_3220 | 118 |
| 238 | 3300049593 | Ga0501077_0061225 | Ga0501077_0061225_900_1256 | 118 |
| 239 | 3300049593 | Ga0501077_0226965 | Ga0501077_0226965_760_1119 | 118 |
| 240 | 3300049741 | Ga0501079_0317593 | Ga0501079_0317593_19_375 | 118 |
| 241 | 3300049741 | Ga0501079_0462419 | Ga0501079_0462419_86_442 | 118 |
| 242 | 3300049741 | Ga0501079_1041991 | Ga0501079_1041991_146_502 | 118 |
| 243 | 3300049742 | Ga0501080_0192894 | Ga0501080_0192894_824_1180 | 118 |
| 244 | 3300049743 | Ga0501081_1000567 | Ga0501081_1000567_171_527 | 118 |
| 245 | 3300049743 | Ga0501081_1295789 | Ga0501081_1295789_71_430 | 118 |
| 246 | 3300049822 | Ga0501035_0191060 | Ga0501035_0191060_927_1283 | 118 |
| 247 | 3300049823 | Ga0501044_1236664 | Ga0501044_1236664_162_518 | 118 |
| 248 | 3300049824 | Ga0501045_0054894 | Ga0501045_0054894_944_1300 | 118 |
| 249 | 3300049824 | Ga0501045_0056579 | Ga0501045_0056579_535_891 | 118 |
| 250 | 3300049824 | Ga0501045_0177568 | Ga0501045_0177568_1209_1565 | 118 |
| 251 | 3300050494 | nmdc:mga06z11_459846_c1 | nmdc:mga06z11_459846_c1_32_388 | 118 |
| 252 | 3300050507 | nmdc:mga05p37_1501614_c1 | nmdc:mga05p37_1501614_c1_96_452 | 118 |
| 253 | 3300050507 | nmdc:mga05p37_176990_c1 | nmdc:mga05p37_176990_c1_1260_1616 | 118 |
| 254 | 3300050511 | nmdc:mga08y16_2349_c1 | nmdc:mga08y16_2349_c1_10390_10833 | 118 |
| 255 | 3300050511 | nmdc:mga08y16_405778_c1 | nmdc:mga08y16_405778_c1_597_956 | 118 |
| 256 | 3300050512 | nmdc:mga0n895_473758_c1 | nmdc:mga0n895_473758_c1_705_1061 | 118 |
| 257 | 3300050515 | nmdc:mga0a205_29717_c2 | nmdc:mga0a205_29717_c2_1058_1414 | 118 |
| 258 | 3300054114 | Ga0501084_0033695 | Ga0501084_0033695_788_1144 | 118 |
| 259 | 3300054114 | Ga0501084_0147187 | Ga0501084_0147187_328_684 | 118 |
| 260 | 3300060353 | Ga0501082_0006177 | Ga0501082_0006177_7762_8118 | 118 |
| 261 | 3300060353 | Ga0501082_0180677 | Ga0501082_0180677_247_603 | 118 |
| 262 | 3300060353 | Ga0501082_0294415 | Ga0501082_0294415_998_1357 | 118 |
| 263 | 3300060353 | Ga0501082_1646562 | Ga0501082_1646562_58_414 | 118 |
| 264 | 3300061734 | Ga0530510_0008431 | Ga0530510_0008431_4045_4401 | 118 |
| 265 | 3300061734 | Ga0530510_0040315 | Ga0530510_0040315_2523_2882 | 118 |
| 266 | 3300061734 | Ga0530510_0363112 | Ga0530510_0363112_518_874 | 118 |
| 267 | 3300001977 | JGI24746J21847_1031565 | JGI24746J21847_10315652 | 119 |
| 268 | 3300001989 | JGI24739J22299_10162950 | JGI24739J22299_101629501 | 119 |
| 269 | 3300001990 | JGI24737J22298_10022369 | JGI24737J22298_100223692 | 119 |
| 270 | 3300001991 | JGI24743J22301_10000289 | JGI24743J22301_100002896 | 119 |
| 271 | 3300002070 | JGI24750J21931_1002677 | JGI24750J21931_10026773 | 119 |
| 272 | 3300002074 | JGI24748J21848_1044144 | JGI24748J21848_10441442 | 119 |
| 273 | 3300002075 | JGI24738J21930_10156264 | JGI24738J21930_101562641 | 119 |
| 274 | 3300002077 | JGI24744J21845_10001142 | JGI24744J21845_100011424 | 119 |
| 275 | 3300002155 | JGI24033J26618_1003370 | JGI24033J26618_10033704 | 119 |
| 276 | 3300002459 | JGI24751J29686_10003925 | JGI24751J29686_100039252 | 119 |
| 277 | 3300003320 | rootH2_10015358 | rootH2_100153583 | 119 |
| 278 | 3300003323 | rootH1_10157129 | rootH1_101571294 | 119 |
| 279 | 3300003373 | JGI25407J50210_10147166 | JGI25407J50210_101471662 | 119 |
| 280 | 3300005295 | Ga0065707_10598815 | Ga0065707_105988151 | 119 |
| 281 | 3300005295 | Ga0065707_10636514 | Ga0065707_106365141 | 119 |
| 282 | 3300005295 | Ga0065707_10800179 | Ga0065707_108001791 | 119 |
| 283 | 3300005328 | Ga0070676_10129134 | Ga0070676_101291342 | 119 |
| 284 | 3300005328 | Ga0070676_10575923 | Ga0070676_105759231 | 119 |
| 285 | 3300005329 | Ga0070683_102086620 | Ga0070683_1020866201 | 119 |
| 286 | 3300005330 | Ga0070690_100009413 | Ga0070690_1000094136 | 119 |
| 287 | 3300005330 | Ga0070690_100041690 | Ga0070690_1000416901 | 119 |
| 288 | 3300005330 | Ga0070690_100612470 | Ga0070690_1006124702 | 119 |
| 289 | 3300005331 | Ga0070670_100173351 | Ga0070670_1001733513 | 119 |
| 290 | 3300005331 | Ga0070670_100812416 | Ga0070670_1008124161 | 119 |
| 291 | 3300005333 | Ga0070677_10016023 | Ga0070677_100160232 | 119 |
| 292 | 3300005333 | Ga0070677_10179249 | Ga0070677_101792491 | 119 |
| 293 | 3300005333 | Ga0070677_10211260 | Ga0070677_102112601 | 119 |
| 294 | 3300005334 | Ga0068869_100039936 | Ga0068869_1000399364 | 119 |
| 295 | 3300005334 | Ga0068869_100703600 | Ga0068869_1007036002 | 119 |
| 296 | 3300005334 | Ga0068869_101492468 | Ga0068869_1014924682 | 119 |
| 297 | 3300005334 | Ga0068869_101741194 | Ga0068869_1017411941 | 119 |
| 298 | 3300005336 | Ga0070680_100339665 | Ga0070680_1003396652 | 119 |
| 299 | 3300005338 | Ga0068868_100058792 | Ga0068868_1000587924 | 119 |
| 300 | 3300005339 | Ga0070660_100112452 | Ga0070660_1001124521 | 119 |
| 301 | 3300005340 | Ga0070689_100027085 | Ga0070689_1000270852 | 119 |
| 302 | 3300005340 | Ga0070689_100403657 | Ga0070689_1004036572 | 119 |
| 303 | 3300005340 | Ga0070689_100587071 | Ga0070689_1005870712 | 119 |
| 304 | 3300005340 | Ga0070689_100587204 | Ga0070689_1005872042 | 119 |
| 305 | 3300005341 | Ga0070691_10062475 | Ga0070691_100624754 | 119 |
| 306 | 3300005341 | Ga0070691_10382175 | Ga0070691_103821752 | 119 |
| 307 | 3300005341 | Ga0070691_10556161 | Ga0070691_105561611 | 119 |
| 308 | 3300005343 | Ga0070687_100013616 | Ga0070687_1000136165 | 119 |
| 309 | 3300005343 | Ga0070687_100332283 | Ga0070687_1003322832 | 119 |
| 310 | 3300005343 | Ga0070687_100879638 | Ga0070687_1008796381 | 119 |
| 311 | 3300005344 | Ga0070661_100974151 | Ga0070661_1009741512 | 119 |
| 312 | 3300005345 | Ga0070692_10055110 | Ga0070692_100551103 | 119 |
| 313 | 3300005345 | Ga0070692_10274115 | Ga0070692_102741152 | 119 |
| 314 | 3300005345 | Ga0070692_10340976 | Ga0070692_103409762 | 119 |
| 315 | 3300005347 | Ga0070668_100071393 | Ga0070668_1000713933 | 119 |
| 316 | 3300005347 | Ga0070668_100163900 | Ga0070668_1001639003 | 119 |
| 317 | 3300005347 | Ga0070668_100165081 | Ga0070668_1001650812 | 119 |
| 318 | 3300005347 | Ga0070668_100421980 | Ga0070668_1004219802 | 119 |
| 319 | 3300005347 | Ga0070668_100781846 | Ga0070668_1007818462 | 119 |
| 320 | 3300005353 | Ga0070669_100024281 | Ga0070669_1000242814 | 119 |
| 321 | 3300005353 | Ga0070669_100032969 | Ga0070669_1000329694 | 119 |
| 322 | 3300005353 | Ga0070669_100076141 | Ga0070669_1000761412 | 119 |
| 323 | 3300005353 | Ga0070669_101767839 | Ga0070669_1017678391 | 119 |
| 324 | 3300005354 | Ga0070675_100021110 | Ga0070675_1000211102 | 119 |
| 325 | 3300005354 | Ga0070675_100195145 | Ga0070675_1001951452 | 119 |
| 326 | 3300005354 | Ga0070675_100474882 | Ga0070675_1004748822 | 119 |
| 327 | 3300005356 | Ga0070674_100013939 | Ga0070674_1000139394 | 119 |
| 328 | 3300005356 | Ga0070674_100019263 | Ga0070674_1000192633 | 119 |
| 329 | 3300005356 | Ga0070674_100308610 | Ga0070674_1003086102 | 119 |
| 330 | 3300005356 | Ga0070674_100793274 | Ga0070674_1007932741 | 119 |
| 331 | 3300005364 | Ga0070673_100034287 | Ga0070673_1000342873 | 119 |
| 332 | 3300005364 | Ga0070673_100051856 | Ga0070673_1000518563 | 119 |
| 333 | 3300005364 | Ga0070673_100607969 | Ga0070673_1006079692 | 119 |
| 334 | 3300005364 | Ga0070673_100855410 | Ga0070673_1008554101 | 119 |
| 335 | 3300005364 | Ga0070673_101019821 | Ga0070673_1010198211 | 119 |
| 336 | 3300005364 | Ga0070673_101234034 | Ga0070673_1012340341 | 119 |
| 337 | 3300005364 | Ga0070673_101347997 | Ga0070673_1013479972 | 119 |
| 338 | 3300005365 | Ga0070688_100006679 | Ga0070688_1000066794 | 119 |
| 339 | 3300005365 | Ga0070688_100030550 | Ga0070688_1000305504 | 119 |
| 340 | 3300005365 | Ga0070688_100093546 | Ga0070688_1000935462 | 119 |
| 341 | 3300005365 | Ga0070688_100176158 | Ga0070688_1001761582 | 119 |
| 342 | 3300005365 | Ga0070688_100221112 | Ga0070688_1002211123 | 119 |
| 343 | 3300005366 | Ga0070659_100006061 | Ga0070659_1000060616 | 119 |
| 344 | 3300005366 | Ga0070659_100151620 | Ga0070659_1001516203 | 119 |
| 345 | 3300005367 | Ga0070667_100353143 | Ga0070667_1003531431 | 119 |
| 346 | 3300005367 | Ga0070667_101581259 | Ga0070667_1015812591 | 119 |
| 347 | 3300005406 | Ga0070703_10070998 | Ga0070703_100709981 | 119 |
| 348 | 3300005438 | Ga0070701_10011428 | Ga0070701_100114282 | 119 |
| 349 | 3300005438 | Ga0070701_10108626 | Ga0070701_101086262 | 119 |
| 350 | 3300005438 | Ga0070701_10147202 | Ga0070701_101472022 | 119 |
| 351 | 3300005438 | Ga0070701_10815755 | Ga0070701_108157551 | 119 |
| 352 | 3300005439 | Ga0070711_101013505 | Ga0070711_1010135051 | 119 |
| 353 | 3300005440 | Ga0070705_100013904 | Ga0070705_1000139044 | 119 |
| 354 | 3300005440 | Ga0070705_100081424 | Ga0070705_1000814243 | 119 |
| 355 | 3300005440 | Ga0070705_100115279 | Ga0070705_1001152793 | 119 |
| 356 | 3300005440 | Ga0070705_100123176 | Ga0070705_1001231763 | 119 |
| 357 | 3300005441 | Ga0070700_100001831 | Ga0070700_1000018317 | 119 |
| 358 | 3300005441 | Ga0070700_100024645 | Ga0070700_1000246452 | 119 |
| 359 | 3300005441 | Ga0070700_100213204 | Ga0070700_1002132042 | 119 |
| 360 | 3300005441 | Ga0070700_100272249 | Ga0070700_1002722492 | 119 |
| 361 | 3300005441 | Ga0070700_100354636 | Ga0070700_1003546362 | 119 |
| 362 | 3300005441 | Ga0070700_100425144 | Ga0070700_1004251442 | 119 |
| 363 | 3300005444 | Ga0070694_100067189 | Ga0070694_1000671892 | 119 |
| 364 | 3300005444 | Ga0070694_100120415 | Ga0070694_1001204153 | 119 |
| 365 | 3300005444 | Ga0070694_100227034 | Ga0070694_1002270343 | 119 |
| 366 | 3300005444 | Ga0070694_100934547 | Ga0070694_1009345472 | 119 |
| 367 | 3300005455 | Ga0070663_100034544 | Ga0070663_1000345445 | 119 |
| 368 | 3300005456 | Ga0070678_100147121 | Ga0070678_1001471212 | 119 |
| 369 | 3300005456 | Ga0070678_100285946 | Ga0070678_1002859462 | 119 |
| 370 | 3300005456 | Ga0070678_100611740 | Ga0070678_1006117402 | 119 |
| 371 | 3300005457 | Ga0070662_100039586 | Ga0070662_1000395862 | 119 |
| 372 | 3300005457 | Ga0070662_100181707 | Ga0070662_1001817072 | 119 |
| 373 | 3300005457 | Ga0070662_100779514 | Ga0070662_1007795141 | 119 |
| 374 | 3300005457 | Ga0070662_100795103 | Ga0070662_1007951032 | 119 |
| 375 | 3300005458 | Ga0070681_10066648 | Ga0070681_100666484 | 119 |
| 376 | 3300005458 | Ga0070681_11166494 | Ga0070681_111664941 | 119 |
| 377 | 3300005459 | Ga0068867_100026934 | Ga0068867_1000269344 | 119 |
| 378 | 3300005459 | Ga0068867_100062864 | Ga0068867_1000628642 | 119 |
| 379 | 3300005459 | Ga0068867_100185720 | Ga0068867_1001857202 | 119 |
| 380 | 3300005459 | Ga0068867_100483201 | Ga0068867_1004832012 | 119 |
| 381 | 3300005466 | Ga0070685_10002826 | Ga0070685_100028262 | 119 |
| 382 | 3300005466 | Ga0070685_10152406 | Ga0070685_101524062 | 119 |
| 383 | 3300005466 | Ga0070685_10524535 | Ga0070685_105245352 | 119 |
| 384 | 3300005468 | Ga0070707_101845867 | Ga0070707_1018458671 | 119 |
| 385 | 3300005471 | Ga0070698_100020375 | Ga0070698_1000203751 | 119 |
| 386 | 3300005518 | Ga0070699_100246708 | Ga0070699_1002467081 | 119 |
| 387 | 3300005518 | Ga0070699_100451974 | Ga0070699_1004519741 | 119 |
| 388 | 3300005530 | Ga0070679_100053571 | Ga0070679_1000535715 | 119 |
| 389 | 3300005535 | Ga0070684_100153697 | Ga0070684_1001536974 | 119 |
| 390 | 3300005536 | Ga0070697_100323693 | Ga0070697_1003236932 | 119 |
| 391 | 3300005536 | Ga0070697_100803916 | Ga0070697_1008039162 | 119 |
| 392 | 3300005536 | Ga0070697_101961306 | Ga0070697_1019613062 | 119 |
| 393 | 3300005539 | Ga0068853_100197108 | Ga0068853_1001971081 | 119 |
| 394 | 3300005539 | Ga0068853_100545824 | Ga0068853_1005458242 | 119 |
| 395 | 3300005543 | Ga0070672_100093329 | Ga0070672_1000933292 | 119 |
| 396 | 3300005543 | Ga0070672_100369918 | Ga0070672_1003699182 | 119 |
| 397 | 3300005543 | Ga0070672_101071472 | Ga0070672_1010714722 | 119 |
| 398 | 3300005544 | Ga0070686_100009432 | Ga0070686_1000094326 | 119 |
| 399 | 3300005544 | Ga0070686_100037119 | Ga0070686_1000371192 | 119 |
| 400 | 3300005544 | Ga0070686_100948792 | Ga0070686_1009487921 | 119 |
| 401 | 3300005545 | Ga0070695_100011470 | Ga0070695_1000114706 | 119 |
| 402 | 3300005545 | Ga0070695_100103183 | Ga0070695_1001031833 | 119 |
| 403 | 3300005545 | Ga0070695_100300607 | Ga0070695_1003006072 | 119 |
| 404 | 3300005545 | Ga0070695_101528312 | Ga0070695_1015283121 | 119 |
| 405 | 3300005546 | Ga0070696_100009053 | Ga0070696_1000090535 | 119 |
| 406 | 3300005547 | Ga0070693_100006310 | Ga0070693_1000063103 | 119 |
| 407 | 3300005547 | Ga0070693_100658952 | Ga0070693_1006589522 | 119 |
| 408 | 3300005548 | Ga0070665_100048285 | Ga0070665_1000482851 | 119 |
| 409 | 3300005548 | Ga0070665_100095945 | Ga0070665_1000959453 | 119 |
| 410 | 3300005548 | Ga0070665_100496069 | Ga0070665_1004960691 | 119 |
| 411 | 3300005548 | Ga0070665_101185842 | Ga0070665_1011858421 | 119 |
| 412 | 3300005549 | Ga0070704_100054091 | Ga0070704_1000540914 | 119 |
| 413 | 3300005549 | Ga0070704_100374703 | Ga0070704_1003747032 | 119 |
| 414 | 3300005564 | Ga0070664_100258165 | Ga0070664_1002581651 | 119 |
| 415 | 3300005564 | Ga0070664_100336652 | Ga0070664_1003366522 | 119 |
| 416 | 3300005564 | Ga0070664_101889046 | Ga0070664_1018890461 | 119 |
| 417 | 3300005577 | Ga0068857_100024296 | Ga0068857_1000242963 | 119 |
| 418 | 3300005577 | Ga0068857_100249292 | Ga0068857_1002492922 | 119 |
| 419 | 3300005577 | Ga0068857_100501143 | Ga0068857_1005011432 | 119 |
| 420 | 3300005577 | Ga0068857_100523862 | Ga0068857_1005238622 | 119 |
| 421 | 3300005578 | Ga0068854_100088893 | Ga0068854_1000888934 | 119 |
| 422 | 3300005578 | Ga0068854_100758180 | Ga0068854_1007581802 | 119 |
| 423 | 3300005578 | Ga0068854_101853022 | Ga0068854_1018530222 | 119 |
| 424 | 3300005615 | Ga0070702_100011472 | Ga0070702_1000114725 | 119 |
| 425 | 3300005615 | Ga0070702_100020816 | Ga0070702_1000208163 | 119 |
| 426 | 3300005615 | Ga0070702_100276643 | Ga0070702_1002766432 | 119 |
| 427 | 3300005616 | Ga0068852_100162491 | Ga0068852_1001624914 | 119 |
| 428 | 3300005617 | Ga0068859_100139957 | Ga0068859_1001399572 | 119 |
| 429 | 3300005617 | Ga0068859_100392249 | Ga0068859_1003922491 | 119 |
| 430 | 3300005617 | Ga0068859_100691468 | Ga0068859_1006914682 | 119 |
| 431 | 3300005617 | Ga0068859_100896314 | Ga0068859_1008963142 | 119 |
| 432 | 3300005617 | Ga0068859_102107141 | Ga0068859_1021071411 | 119 |
| 433 | 3300005618 | Ga0068864_100019800 | Ga0068864_1000198006 | 119 |
| 434 | 3300005618 | Ga0068864_100053857 | Ga0068864_1000538573 | 119 |
| 435 | 3300005618 | Ga0068864_100228708 | Ga0068864_1002287082 | 119 |
| 436 | 3300005618 | Ga0068864_101373641 | Ga0068864_1013736411 | 119 |
| 437 | 3300005718 | Ga0068866_10036038 | Ga0068866_100360381 | 119 |
| 438 | 3300005718 | Ga0068866_10110477 | Ga0068866_101104772 | 119 |
| 439 | 3300005719 | Ga0068861_100009091 | Ga0068861_1000090913 | 119 |
| 440 | 3300005719 | Ga0068861_100033722 | Ga0068861_1000337224 | 119 |
| 441 | 3300005719 | Ga0068861_100133863 | Ga0068861_1001338632 | 119 |
| 442 | 3300005719 | Ga0068861_100140301 | Ga0068861_1001403012 | 119 |
| 443 | 3300005719 | Ga0068861_100173354 | Ga0068861_1001733542 | 119 |
| 444 | 3300005719 | Ga0068861_100296339 | Ga0068861_1002963392 | 119 |
| 445 | 3300005719 | Ga0068861_100693384 | Ga0068861_1006933842 | 119 |
| 446 | 3300005840 | Ga0068870_10002310 | Ga0068870_100023103 | 119 |
| 447 | 3300005840 | Ga0068870_10053710 | Ga0068870_100537102 | 119 |
| 448 | 3300005840 | Ga0068870_10462106 | Ga0068870_104621062 | 119 |
| 449 | 3300005841 | Ga0068863_100292468 | Ga0068863_1002924681 | 119 |
| 450 | 3300005841 | Ga0068863_100964527 | Ga0068863_1009645272 | 119 |
| 451 | 3300005841 | Ga0068863_101106419 | Ga0068863_1011064191 | 119 |
| 452 | 3300005841 | Ga0068863_102642931 | Ga0068863_1026429311 | 119 |
| 453 | 3300005842 | Ga0068858_100023261 | Ga0068858_1000232614 | 119 |
| 454 | 3300005842 | Ga0068858_100231770 | Ga0068858_1002317702 | 119 |
| 455 | 3300005843 | Ga0068860_100029497 | Ga0068860_1000294974 | 119 |
| 456 | 3300005843 | Ga0068860_100046638 | Ga0068860_1000466384 | 119 |
| 457 | 3300005843 | Ga0068860_100418461 | Ga0068860_1004184612 | 119 |
| 458 | 3300005843 | Ga0068860_100713908 | Ga0068860_1007139082 | 119 |
| 459 | 3300005843 | Ga0068860_100874969 | Ga0068860_1008749692 | 119 |
| 460 | 3300005844 | Ga0068862_100193183 | Ga0068862_1001931832 | 119 |
| 461 | 3300005844 | Ga0068862_100246388 | Ga0068862_1002463882 | 119 |
| 462 | 3300005844 | Ga0068862_100342701 | Ga0068862_1003427012 | 119 |
| 463 | 3300005844 | Ga0068862_100372681 | Ga0068862_1003726812 | 119 |
| 464 | 3300005844 | Ga0068862_100719449 | Ga0068862_1007194492 | 119 |
| 465 | 3300005844 | Ga0068862_101436801 | Ga0068862_1014368012 | 119 |
| 466 | 3300005937 | Ga0081455_10004385 | Ga0081455_1000438511 | 119 |
| 467 | 3300005937 | Ga0081455_10006450 | Ga0081455_100064501 | 119 |
| 468 | 3300005981 | Ga0081538_10015699 | Ga0081538_100156996 | 119 |
| 469 | 3300005981 | Ga0081538_10036943 | Ga0081538_100369434 | 119 |
| 470 | 3300006028 | Ga0070717_11119478 | Ga0070717_111194782 | 119 |
| 471 | 3300006038 | Ga0075365_10011977 | Ga0075365_100119773 | 119 |
| 472 | 3300006038 | Ga0075365_10050444 | Ga0075365_100504442 | 119 |
| 473 | 3300006038 | Ga0075365_10775439 | Ga0075365_107754391 | 119 |
| 474 | 3300006048 | Ga0075363_100006440 | Ga0075363_1000064408 | 119 |
| 475 | 3300006048 | Ga0075363_100330740 | Ga0075363_1003307402 | 119 |
| 476 | 3300006051 | Ga0075364_10173269 | Ga0075364_101732692 | 119 |
| 477 | 3300006163 | Ga0070715_10017981 | Ga0070715_100179814 | 119 |
| 478 | 3300006175 | Ga0070712_100183080 | Ga0070712_1001830802 | 119 |
| 479 | 3300006177 | Ga0075362_10086876 | Ga0075362_100868762 | 119 |
| 480 | 3300006177 | Ga0075362_10137611 | Ga0075362_101376112 | 119 |
| 481 | 3300006178 | Ga0075367_10006406 | Ga0075367_100064066 | 119 |
| 482 | 3300006178 | Ga0075367_10256038 | Ga0075367_102560381 | 119 |
| 483 | 3300006178 | Ga0075367_10482339 | Ga0075367_104823391 | 119 |
| 484 | 3300006178 | Ga0075367_10848917 | Ga0075367_108489171 | 119 |
| 485 | 3300006186 | Ga0075369_10096470 | Ga0075369_100964701 | 119 |
| 486 | 3300006186 | Ga0075369_10480281 | Ga0075369_104802811 | 119 |
| 487 | 3300006195 | Ga0075366_10481327 | Ga0075366_104813271 | 119 |
| 488 | 3300006237 | Ga0097621_100014001 | Ga0097621_1000140015 | 119 |
| 489 | 3300006237 | Ga0097621_100197699 | Ga0097621_1001976992 | 119 |
| 490 | 3300006353 | Ga0075370_10069593 | Ga0075370_100695933 | 119 |
| 491 | 3300006353 | Ga0075370_10773796 | Ga0075370_107737962 | 119 |
| 492 | 3300006358 | Ga0068871_100030159 | Ga0068871_1000301594 | 119 |
| 493 | 3300006358 | Ga0068871_100562601 | Ga0068871_1005626012 | 119 |
| 494 | 3300006358 | Ga0068871_101588998 | Ga0068871_1015889982 | 119 |
| 495 | 3300006358 | Ga0068871_102080032 | Ga0068871_1020800321 | 119 |
| 496 | 3300006844 | Ga0075428_100088621 | Ga0075428_1000886212 | 119 |
| 497 | 3300006844 | Ga0075428_100111490 | Ga0075428_1001114902 | 119 |
| 498 | 3300006844 | Ga0075428_100165771 | Ga0075428_1001657713 | 119 |
| 499 | 3300006844 | Ga0075428_100375310 | Ga0075428_1003753102 | 119 |
| 500 | 3300006844 | Ga0075428_100674699 | Ga0075428_1006746991 | 119 |
| 501 | 3300006846 | Ga0075430_100021899 | Ga0075430_1000218992 | 119 |
| 502 | 3300006846 | Ga0075430_100161849 | Ga0075430_1001618492 | 119 |
| 503 | 3300006846 | Ga0075430_100324024 | Ga0075430_1003240242 | 119 |
| 504 | 3300006846 | Ga0075430_101421549 | Ga0075430_1014215491 | 119 |
| 505 | 3300006847 | Ga0075431_100020076 | Ga0075431_1000200764 | 119 |
| 506 | 3300006847 | Ga0075431_100024922 | Ga0075431_1000249224 | 119 |
| 507 | 3300006847 | Ga0075431_100063780 | Ga0075431_1000637802 | 119 |
| 508 | 3300006847 | Ga0075431_100102562 | Ga0075431_1001025622 | 119 |
| 509 | 3300006847 | Ga0075431_100366567 | Ga0075431_1003665672 | 119 |
| 510 | 3300006871 | Ga0075434_100112818 | Ga0075434_1001128182 | 119 |
| 511 | 3300006871 | Ga0075434_101053870 | Ga0075434_1010538702 | 119 |
| 512 | 3300006880 | Ga0075429_100000516 | Ga0075429_1000005165 | 119 |
| 513 | 3300006880 | Ga0075429_100061796 | Ga0075429_1000617962 | 119 |
| 514 | 3300006881 | Ga0068865_100344279 | Ga0068865_1003442791 | 119 |
| 515 | 3300006931 | Ga0097620_100139956 | Ga0097620_1001399562 | 119 |
| 516 | 3300006931 | Ga0097620_100392299 | Ga0097620_1003922991 | 119 |
| 517 | 3300006931 | Ga0097620_100691483 | Ga0097620_1006914832 | 119 |
| 518 | 3300006931 | Ga0097620_100896301 | Ga0097620_1008963012 | 119 |
| 519 | 3300006931 | Ga0097620_102107088 | Ga0097620_1021070882 | 119 |
| 520 | 3300007076 | Ga0075435_100095165 | Ga0075435_1000951653 | 119 |
| 521 | 3300009092 | Ga0105250_10035451 | Ga0105250_100354512 | 119 |
| 522 | 3300009094 | Ga0111539_10091488 | Ga0111539_100914884 | 119 |
| 523 | 3300009094 | Ga0111539_10470432 | Ga0111539_104704321 | 119 |
| 524 | 3300009094 | Ga0111539_10613229 | Ga0111539_106132292 | 119 |
| 525 | 3300009094 | Ga0111539_11158669 | Ga0111539_111586691 | 119 |
| 526 | 3300009094 | Ga0111539_11981300 | Ga0111539_119813001 | 119 |
| 527 | 3300009098 | Ga0105245_10138958 | Ga0105245_101389583 | 119 |
| 528 | 3300009101 | Ga0105247_10017387 | Ga0105247_100173874 | 119 |
| 529 | 3300009147 | Ga0114129_10006246 | Ga0114129_1000624613 | 119 |
| 530 | 3300009147 | Ga0114129_10040767 | Ga0114129_100407677 | 119 |
| 531 | 3300009147 | Ga0114129_10373351 | Ga0114129_103733513 | 119 |
| 532 | 3300009147 | Ga0114129_10779165 | Ga0114129_107791653 | 119 |
| 533 | 3300009147 | Ga0114129_11149003 | Ga0114129_111490032 | 119 |
| 534 | 3300009148 | Ga0105243_10300094 | Ga0105243_103000943 | 119 |
| 535 | 3300009148 | Ga0105243_10390765 | Ga0105243_103907652 | 119 |
| 536 | 3300009148 | Ga0105243_10834875 | Ga0105243_108348752 | 119 |
| 537 | 3300009174 | Ga0105241_10411180 | Ga0105241_104111802 | 119 |
| 538 | 3300009174 | Ga0105241_10712673 | Ga0105241_107126732 | 119 |
| 539 | 3300009176 | Ga0105242_10015964 | Ga0105242_100159642 | 119 |
| 540 | 3300009177 | Ga0105248_10013593 | Ga0105248_100135939 | 119 |
| 541 | 3300009177 | Ga0105248_10373142 | Ga0105248_103731422 | 119 |
| 542 | 3300009177 | Ga0105248_10849747 | Ga0105248_108497471 | 119 |
| 543 | 3300009551 | Ga0105238_10315895 | Ga0105238_103158952 | 119 |
| 544 | 3300009551 | Ga0105238_10516766 | Ga0105238_105167662 | 119 |
| 545 | 3300009551 | Ga0105238_11734471 | Ga0105238_117344711 | 119 |
| 546 | 3300009553 | Ga0105249_10058640 | Ga0105249_100586404 | 119 |
| 547 | 3300009553 | Ga0105249_10572772 | Ga0105249_105727722 | 119 |
| 548 | 3300009553 | Ga0105249_10773384 | Ga0105249_107733841 | 119 |
| 549 | 3300011119 | Ga0105246_10012857 | Ga0105246_100128572 | 119 |
| 550 | 3300012513 | Ga0157326_1034287 | Ga0157326_10342872 | 119 |
| 551 | 3300013100 | Ga0157373_10028056 | Ga0157373_100280564 | 119 |
| 552 | 3300013102 | Ga0157371_10448916 | Ga0157371_104489161 | 119 |
| 553 | 3300013102 | Ga0157371_10716731 | Ga0157371_107167312 | 119 |
| 554 | 3300013102 | Ga0157371_11025873 | Ga0157371_110258732 | 119 |
| 555 | 3300013296 | Ga0157374_10484621 | Ga0157374_104846211 | 119 |
| 556 | 3300013297 | Ga0157378_10016082 | Ga0157378_100160821 | 119 |
| 557 | 3300013297 | Ga0157378_10242931 | Ga0157378_102429313 | 119 |
| 558 | 3300013297 | Ga0157378_12078554 | Ga0157378_120785542 | 119 |
| 559 | 3300013306 | Ga0163162_10044564 | Ga0163162_100445646 | 119 |
| 560 | 3300013306 | Ga0163162_11828480 | Ga0163162_118284802 | 119 |
| 561 | 3300013306 | Ga0163162_11866294 | Ga0163162_118662942 | 119 |
| 562 | 3300013307 | Ga0157372_10007051 | Ga0157372_1000705110 | 119 |
| 563 | 3300013307 | Ga0157372_10888523 | Ga0157372_108885232 | 119 |
| 564 | 3300013308 | Ga0157375_13115047 | Ga0157375_131150471 | 119 |
| 565 | 3300014326 | Ga0157380_10053038 | Ga0157380_100530382 | 119 |
| 566 | 3300014326 | Ga0157380_10099751 | Ga0157380_100997515 | 119 |
| 567 | 3300014326 | Ga0157380_10121023 | Ga0157380_101210232 | 119 |
| 568 | 3300014326 | Ga0157380_10171516 | Ga0157380_101715162 | 119 |
| 569 | 3300014326 | Ga0157380_10343883 | Ga0157380_103438832 | 119 |
| 570 | 3300014326 | Ga0157380_10510970 | Ga0157380_105109702 | 119 |
| 571 | 3300014326 | Ga0157380_10869019 | Ga0157380_108690192 | 119 |
| 572 | 3300014326 | Ga0157380_11203236 | Ga0157380_112032362 | 119 |
| 573 | 3300014326 | Ga0157380_11254780 | Ga0157380_112547801 | 119 |
| 574 | 3300014326 | Ga0157380_11878385 | Ga0157380_118783852 | 119 |
| 575 | 3300014497 | Ga0182008_10088724 | Ga0182008_100887242 | 119 |
| 576 | 3300014497 | Ga0182008_10192751 | Ga0182008_101927512 | 119 |
| 577 | 3300014745 | Ga0157377_10060707 | Ga0157377_100607072 | 119 |
| 578 | 3300014745 | Ga0157377_10078011 | Ga0157377_100780113 | 119 |
| 579 | 3300014968 | Ga0157379_10347170 | Ga0157379_103471701 | 119 |
| 580 | 3300014968 | Ga0157379_10561869 | Ga0157379_105618692 | 119 |
| 581 | 3300014968 | Ga0157379_10666387 | Ga0157379_106663872 | 119 |
| 582 | 3300014968 | Ga0157379_11296301 | Ga0157379_112963011 | 119 |
| 583 | 3300014968 | Ga0157379_12498597 | Ga0157379_124985971 | 119 |
| 584 | 3300014969 | Ga0157376_10045197 | Ga0157376_100451973 | 119 |
| 585 | 3300014969 | Ga0157376_10460957 | Ga0157376_104609572 | 119 |
| 586 | 3300014969 | Ga0157376_11985290 | Ga0157376_119852901 | 119 |
| 587 | 3300015261 | Ga0182006_1071938 | Ga0182006_10719382 | 119 |
| 588 | 3300015262 | Ga0182007_10045579 | Ga0182007_100455792 | 119 |
| 589 | 3300015262 | Ga0182007_10047438 | Ga0182007_100474382 | 119 |
| 590 | 3300015262 | Ga0182007_10151356 | Ga0182007_101513562 | 119 |
| 591 | 3300017792 | Ga0163161_10035357 | Ga0163161_100353573 | 119 |
| 592 | 3300017792 | Ga0163161_10261797 | Ga0163161_102617972 | 119 |
| 593 | 3300025227 | Ga0207638_1003840 | Ga0207638_10038401 | 119 |
| 594 | 3300025297 | Ga0209758_1018310 | Ga0209758_10183102 | 119 |
| 595 | 3300025315 | Ga0207697_10548945 | Ga0207697_105489452 | 119 |
| 596 | 3300025893 | Ga0207682_10023027 | Ga0207682_100230273 | 119 |
| 597 | 3300025899 | Ga0207642_10216771 | Ga0207642_102167711 | 119 |
| 598 | 3300025900 | Ga0207710_10074811 | Ga0207710_100748111 | 119 |
| 599 | 3300025901 | Ga0207688_10000283 | Ga0207688_1000028310 | 119 |
| 600 | 3300025903 | Ga0207680_10088104 | Ga0207680_100881044 | 119 |
| 601 | 3300025904 | Ga0207647_10008609 | Ga0207647_100086096 | 119 |
| 602 | 3300025905 | Ga0207685_10011195 | Ga0207685_100111954 | 119 |
| 603 | 3300025907 | Ga0207645_10004284 | Ga0207645_100042843 | 119 |
| 604 | 3300025907 | Ga0207645_10149060 | Ga0207645_101490602 | 119 |
| 605 | 3300025907 | Ga0207645_10374439 | Ga0207645_103744391 | 119 |
| 606 | 3300025907 | Ga0207645_10858230 | Ga0207645_108582301 | 119 |
| 607 | 3300025908 | Ga0207643_10000615 | Ga0207643_1000061510 | 119 |
| 608 | 3300025908 | Ga0207643_10038281 | Ga0207643_100382813 | 119 |
| 609 | 3300025908 | Ga0207643_10110027 | Ga0207643_101100272 | 119 |
| 610 | 3300025912 | Ga0207707_10099173 | Ga0207707_100991733 | 119 |
| 611 | 3300025916 | Ga0207663_10197530 | Ga0207663_101975302 | 119 |
| 612 | 3300025918 | Ga0207662_10002182 | Ga0207662_100021827 | 119 |
| 613 | 3300025918 | Ga0207662_10019443 | Ga0207662_100194432 | 119 |
| 614 | 3300025918 | Ga0207662_10157989 | Ga0207662_101579892 | 119 |
| 615 | 3300025919 | Ga0207657_10111144 | Ga0207657_101111441 | 119 |
| 616 | 3300025919 | Ga0207657_10816507 | Ga0207657_108165072 | 119 |
| 617 | 3300025920 | Ga0207649_10974225 | Ga0207649_109742251 | 119 |
| 618 | 3300025920 | Ga0207649_11129601 | Ga0207649_111296011 | 119 |
| 619 | 3300025921 | Ga0207652_10089380 | Ga0207652_100893802 | 119 |
| 620 | 3300025921 | Ga0207652_11197203 | Ga0207652_111972031 | 119 |
| 621 | 3300025923 | Ga0207681_10019540 | Ga0207681_100195402 | 119 |
| 622 | 3300025923 | Ga0207681_10032108 | Ga0207681_100321082 | 119 |
| 623 | 3300025923 | Ga0207681_10103416 | Ga0207681_101034162 | 119 |
| 624 | 3300025923 | Ga0207681_10339484 | Ga0207681_103394842 | 119 |
| 625 | 3300025923 | Ga0207681_10691224 | Ga0207681_106912242 | 119 |
| 626 | 3300025924 | Ga0207694_10557457 | Ga0207694_105574571 | 119 |
| 627 | 3300025924 | Ga0207694_11052464 | Ga0207694_110524641 | 119 |
| 628 | 3300025925 | Ga0207650_10043430 | Ga0207650_100434303 | 119 |
| 629 | 3300025925 | Ga0207650_10144074 | Ga0207650_101440742 | 119 |
| 630 | 3300025925 | Ga0207650_10163106 | Ga0207650_101631062 | 119 |
| 631 | 3300025926 | Ga0207659_10160130 | Ga0207659_101601302 | 119 |
| 632 | 3300025926 | Ga0207659_10509646 | Ga0207659_105096462 | 119 |
| 633 | 3300025926 | Ga0207659_11630553 | Ga0207659_116305531 | 119 |
| 634 | 3300025926 | Ga0207659_11729908 | Ga0207659_117299082 | 119 |
| 635 | 3300025932 | Ga0207690_10015285 | Ga0207690_100152853 | 119 |
| 636 | 3300025932 | Ga0207690_10024268 | Ga0207690_100242683 | 119 |
| 637 | 3300025932 | Ga0207690_10313276 | Ga0207690_103132763 | 119 |
| 638 | 3300025932 | Ga0207690_10409627 | Ga0207690_104096271 | 119 |
| 639 | 3300025933 | Ga0207706_10011257 | Ga0207706_100112574 | 119 |
| 640 | 3300025933 | Ga0207706_10025823 | Ga0207706_100258235 | 119 |
| 641 | 3300025933 | Ga0207706_10083579 | Ga0207706_100835793 | 119 |
| 642 | 3300025933 | Ga0207706_10097236 | Ga0207706_100972363 | 119 |
| 643 | 3300025933 | Ga0207706_10232699 | Ga0207706_102326992 | 119 |
| 644 | 3300025933 | Ga0207706_10371654 | Ga0207706_103716542 | 119 |
| 645 | 3300025933 | Ga0207706_11690729 | Ga0207706_116907291 | 119 |
| 646 | 3300025935 | Ga0207709_10039886 | Ga0207709_100398864 | 119 |
| 647 | 3300025935 | Ga0207709_11378050 | Ga0207709_113780502 | 119 |
| 648 | 3300025936 | Ga0207670_10040465 | Ga0207670_100404654 | 119 |
| 649 | 3300025936 | Ga0207670_10091205 | Ga0207670_100912052 | 119 |
| 650 | 3300025936 | Ga0207670_10136471 | Ga0207670_101364712 | 119 |
| 651 | 3300025936 | Ga0207670_10203833 | Ga0207670_102038332 | 119 |
| 652 | 3300025937 | Ga0207669_10008898 | Ga0207669_100088986 | 119 |
| 653 | 3300025937 | Ga0207669_10124508 | Ga0207669_101245082 | 119 |
| 654 | 3300025937 | Ga0207669_10818753 | Ga0207669_108187532 | 119 |
| 655 | 3300025938 | Ga0207704_10009089 | Ga0207704_100090894 | 119 |
| 656 | 3300025938 | Ga0207704_10071029 | Ga0207704_100710292 | 119 |
| 657 | 3300025938 | Ga0207704_10156445 | Ga0207704_101564451 | 119 |
| 658 | 3300025938 | Ga0207704_10480390 | Ga0207704_104803902 | 119 |
| 659 | 3300025938 | Ga0207704_10935495 | Ga0207704_109354952 | 119 |
| 660 | 3300025939 | Ga0207665_10123760 | Ga0207665_101237602 | 119 |
| 661 | 3300025940 | Ga0207691_10001340 | Ga0207691_1000134017 | 119 |
| 662 | 3300025940 | Ga0207691_10008332 | Ga0207691_100083323 | 119 |
| 663 | 3300025940 | Ga0207691_10009993 | Ga0207691_100099932 | 119 |
| 664 | 3300025940 | Ga0207691_10072598 | Ga0207691_100725983 | 119 |
| 665 | 3300025940 | Ga0207691_10170907 | Ga0207691_101709072 | 119 |
| 666 | 3300025940 | Ga0207691_10367487 | Ga0207691_103674871 | 119 |
| 667 | 3300025940 | Ga0207691_10440963 | Ga0207691_104409632 | 119 |
| 668 | 3300025940 | Ga0207691_10444171 | Ga0207691_104441712 | 119 |
| 669 | 3300025941 | Ga0207711_10053060 | Ga0207711_100530604 | 119 |
| 670 | 3300025941 | Ga0207711_10132630 | Ga0207711_101326304 | 119 |
| 671 | 3300025941 | Ga0207711_10577632 | Ga0207711_105776322 | 119 |
| 672 | 3300025941 | Ga0207711_10981813 | Ga0207711_109818132 | 119 |
| 673 | 3300025942 | Ga0207689_10009385 | Ga0207689_100093856 | 119 |
| 674 | 3300025942 | Ga0207689_10087974 | Ga0207689_100879742 | 119 |
| 675 | 3300025942 | Ga0207689_11744840 | Ga0207689_117448401 | 119 |
| 676 | 3300025945 | Ga0207679_10959545 | Ga0207679_109595452 | 119 |
| 677 | 3300025960 | Ga0207651_10008440 | Ga0207651_100084405 | 119 |
| 678 | 3300025960 | Ga0207651_10168645 | Ga0207651_101686452 | 119 |
| 679 | 3300025960 | Ga0207651_10224327 | Ga0207651_102243272 | 119 |
| 680 | 3300025960 | Ga0207651_10572169 | Ga0207651_105721692 | 119 |
| 681 | 3300025960 | Ga0207651_10661013 | Ga0207651_106610132 | 119 |
| 682 | 3300025961 | Ga0207712_10121386 | Ga0207712_101213862 | 119 |
| 683 | 3300025961 | Ga0207712_11519808 | Ga0207712_115198081 | 119 |
| 684 | 3300025972 | Ga0207668_10009499 | Ga0207668_100094994 | 119 |
| 685 | 3300025972 | Ga0207668_10070567 | Ga0207668_100705673 | 119 |
| 686 | 3300025972 | Ga0207668_10648104 | Ga0207668_106481042 | 119 |
| 687 | 3300025972 | Ga0207668_11036018 | Ga0207668_110360182 | 119 |
| 688 | 3300025972 | Ga0207668_11165618 | Ga0207668_111656181 | 119 |
| 689 | 3300025981 | Ga0207640_10101516 | Ga0207640_101015162 | 119 |
| 690 | 3300025981 | Ga0207640_10327720 | Ga0207640_103277202 | 119 |
| 691 | 3300025981 | Ga0207640_10761161 | Ga0207640_107611612 | 119 |
| 692 | 3300025986 | Ga0207658_10734154 | Ga0207658_107341542 | 119 |
| 693 | 3300026023 | Ga0207677_10154074 | Ga0207677_101540743 | 119 |
| 694 | 3300026023 | Ga0207677_12016001 | Ga0207677_120160011 | 119 |
| 695 | 3300026035 | Ga0207703_10096065 | Ga0207703_100960652 | 119 |
| 696 | 3300026035 | Ga0207703_11054795 | Ga0207703_110547952 | 119 |
| 697 | 3300026035 | Ga0207703_11380736 | Ga0207703_113807361 | 119 |
| 698 | 3300026075 | Ga0207708_10003436 | Ga0207708_1000343610 | 119 |
| 699 | 3300026075 | Ga0207708_10029898 | Ga0207708_100298982 | 119 |
| 700 | 3300026075 | Ga0207708_10091093 | Ga0207708_100910932 | 119 |
| 701 | 3300026078 | Ga0207702_10189450 | Ga0207702_101894501 | 119 |
| 702 | 3300026088 | Ga0207641_10017045 | Ga0207641_100170453 | 119 |
| 703 | 3300026088 | Ga0207641_10254176 | Ga0207641_102541762 | 119 |
| 704 | 3300026088 | Ga0207641_10859732 | Ga0207641_108597322 | 119 |
| 705 | 3300026089 | Ga0207648_10006798 | Ga0207648_100067986 | 119 |
| 706 | 3300026089 | Ga0207648_10010221 | Ga0207648_100102212 | 119 |
| 707 | 3300026089 | Ga0207648_10065638 | Ga0207648_100656384 | 119 |
| 708 | 3300026089 | Ga0207648_10125085 | Ga0207648_101250853 | 119 |
| 709 | 3300026095 | Ga0207676_10023885 | Ga0207676_100238852 | 119 |
| 710 | 3300026095 | Ga0207676_10298808 | Ga0207676_102988082 | 119 |
| 711 | 3300026095 | Ga0207676_10365983 | Ga0207676_103659832 | 119 |
| 712 | 3300026116 | Ga0207674_10063658 | Ga0207674_100636584 | 119 |
| 713 | 3300026116 | Ga0207674_10094187 | Ga0207674_100941873 | 119 |
| 714 | 3300026116 | Ga0207674_10923396 | Ga0207674_109233961 | 119 |
| 715 | 3300026118 | Ga0207675_100006775 | Ga0207675_1000067754 | 119 |
| 716 | 3300026118 | Ga0207675_100028532 | Ga0207675_1000285326 | 119 |
| 717 | 3300026118 | Ga0207675_100055390 | Ga0207675_1000553903 | 119 |
| 718 | 3300026118 | Ga0207675_100070045 | Ga0207675_1000700453 | 119 |
| 719 | 3300026118 | Ga0207675_100096188 | Ga0207675_1000961884 | 119 |
| 720 | 3300026118 | Ga0207675_100187573 | Ga0207675_1001875732 | 119 |
| 721 | 3300026118 | Ga0207675_102019977 | Ga0207675_1020199771 | 119 |
| 722 | 3300026121 | Ga0207683_10059345 | Ga0207683_100593454 | 119 |
| 723 | 3300026121 | Ga0207683_10206023 | Ga0207683_102060232 | 119 |
| 724 | 3300026121 | Ga0207683_10214207 | Ga0207683_102142072 | 119 |
| 725 | 3300026121 | Ga0207683_10394443 | Ga0207683_103944432 | 119 |
| 726 | 3300026121 | Ga0207683_11035767 | Ga0207683_110357672 | 119 |
| 727 | 3300026121 | Ga0207683_11589114 | Ga0207683_115891141 | 119 |
| 728 | 3300026142 | Ga0207698_10513602 | Ga0207698_105136022 | 119 |
| 729 | 3300026142 | Ga0207698_11103328 | Ga0207698_111033281 | 119 |
| 730 | 3300027462 | Ga0210000_1016949 | Ga0210000_10169493 | 119 |
| 731 | 3300027526 | Ga0209968_1054170 | Ga0209968_10541701 | 119 |
| 732 | 3300027614 | Ga0209970_1007302 | Ga0209970_10073023 | 119 |
| 733 | 3300027617 | Ga0210002_1018709 | Ga0210002_10187091 | 119 |
| 734 | 3300027682 | Ga0209971_1008263 | Ga0209971_10082632 | 119 |
| 735 | 3300027682 | Ga0209971_1072879 | Ga0209971_10728792 | 119 |
| 736 | 3300027695 | Ga0209966_1015446 | Ga0209966_10154461 | 119 |
| 737 | 3300027695 | Ga0209966_1064389 | Ga0209966_10643892 | 119 |
| 738 | 3300027717 | Ga0209998_10007799 | Ga0209998_100077994 | 119 |
| 739 | 3300027876 | Ga0209974_10128081 | Ga0209974_101280812 | 119 |
| 740 | 3300027907 | Ga0207428_10156321 | Ga0207428_101563212 | 119 |
| 741 | 3300027907 | Ga0207428_10326338 | Ga0207428_103263381 | 119 |
| 742 | 3300028379 | Ga0268266_10080203 | Ga0268266_100802032 | 119 |
| 743 | 3300028379 | Ga0268266_10472430 | Ga0268266_104724302 | 119 |
| 744 | 3300028379 | Ga0268266_11790717 | Ga0268266_117907171 | 119 |
| 745 | 3300028380 | Ga0268265_10073416 | Ga0268265_100734162 | 119 |
| 746 | 3300028380 | Ga0268265_10087869 | Ga0268265_100878692 | 119 |
| 747 | 3300028380 | Ga0268265_10485084 | Ga0268265_104850842 | 119 |
| 748 | 3300028380 | Ga0268265_10498585 | Ga0268265_104985852 | 119 |
| 749 | 3300028380 | Ga0268265_10531940 | Ga0268265_105319402 | 119 |
| 750 | 3300028381 | Ga0268264_10019390 | Ga0268264_100193904 | 119 |
| 751 | 3300028381 | Ga0268264_10084470 | Ga0268264_100844702 | 119 |
| 752 | 3300028381 | Ga0268264_10133590 | Ga0268264_101335902 | 119 |
| 753 | 3300028666 | Ga0265336_10076650 | Ga0265336_100766503 | 119 |
| 754 | 3300028786 | Ga0307517_10228870 | Ga0307517_102288702 | 119 |
| 755 | 3300028794 | Ga0307515_10293201 | Ga0307515_102932012 | 119 |
| 756 | 3300030521 | Ga0307511_10344090 | Ga0307511_103440902 | 119 |
| 757 | 3300031456 | Ga0307513_10031619 | Ga0307513_100316195 | 119 |
| 758 | 3300031456 | Ga0307513_10076534 | Ga0307513_100765343 | 119 |
| 759 | 3300031548 | Ga0307408_100041613 | Ga0307408_1000416136 | 119 |
| 760 | 3300031548 | Ga0307408_100050815 | Ga0307408_1000508152 | 119 |
| 761 | 3300031548 | Ga0307408_101174283 | Ga0307408_1011742831 | 119 |
| 762 | 3300031731 | Ga0307405_10112123 | Ga0307405_101121232 | 119 |
| 763 | 3300031731 | Ga0307405_10112223 | Ga0307405_101122233 | 119 |
| 764 | 3300031731 | Ga0307405_10314844 | Ga0307405_103148442 | 119 |
| 765 | 3300031731 | Ga0307405_11443449 | Ga0307405_114434491 | 119 |
| 766 | 3300031824 | Ga0307413_10009445 | Ga0307413_100094453 | 119 |
| 767 | 3300031852 | Ga0307410_11196331 | Ga0307410_111963311 | 119 |
| 768 | 3300031901 | Ga0307406_10011667 | Ga0307406_100116672 | 119 |
| 769 | 3300031903 | Ga0307407_10205972 | Ga0307407_102059722 | 119 |
| 770 | 3300031911 | Ga0307412_10109505 | Ga0307412_101095051 | 119 |
| 771 | 3300031911 | Ga0307412_11011721 | Ga0307412_110117211 | 119 |
| 772 | 3300031911 | Ga0307412_11738684 | Ga0307412_117386842 | 119 |
| 773 | 3300031995 | Ga0307409_100030472 | Ga0307409_1000304723 | 119 |
| 774 | 3300031995 | Ga0307409_100072272 | Ga0307409_1000722722 | 119 |
| 775 | 3300032002 | Ga0307416_100007315 | Ga0307416_1000073158 | 119 |
| 776 | 3300032002 | Ga0307416_100446731 | Ga0307416_1004467312 | 119 |
| 777 | 3300032004 | Ga0307414_10497157 | Ga0307414_104971571 | 119 |
| 778 | 3300032005 | Ga0307411_10009093 | Ga0307411_100090934 | 119 |
| 779 | 3300032005 | Ga0307411_10742234 | Ga0307411_107422342 | 119 |
| 780 | 3300032126 | Ga0307415_100025640 | Ga0307415_1000256402 | 119 |
| 781 | 3300032126 | Ga0307415_100748194 | Ga0307415_1007481942 | 119 |
| 782 | 3300032126 | Ga0307415_101938870 | Ga0307415_1019388701 | 119 |
| 783 | 3300034819 | Ga0373958_0191400 | Ga0373958_0191400_145_504 | 119 |
| 784 | 3300035241 | Ga0373961_0182157 | Ga0373961_0182157_91_450 | 119 |
| 785 | 3300035691 | Ga0373931_0357414 | Ga0373931_0357414_205_564 | 119 |
| 786 | 3300035691 | Ga0373931_0452931 | Ga0373931_0452931_22_381 | 119 |
| 787 | 3300037068 | Ga0373925_0463292 | Ga0373925_0463292_437_796 | 119 |
| 788 | 3300041451 | Ga0451791_0408146 | Ga0451791_0408146_583_948 | 119 |
| 789 | 3300041451 | Ga0451791_1109250 | Ga0451791_1109250_386_751 | 119 |
| 790 | 3300041452 | Ga0451793_1139976 | Ga0451793_1139976_147_506 | 119 |
| 791 | 3300041452 | Ga0451793_1266290 | Ga0451793_1266290_63_428 | 119 |
| 792 | 3300041453 | Ga0451797_1322930 | Ga0451797_1322930_1404_1769 | 119 |
| 793 | 3300041459 | Ga0451800_0205198 | Ga0451800_0205198_389_754 | 119 |
| 794 | 3300041460 | Ga0451802_0332107 | Ga0451802_0332107_597_962 | 119 |
| 795 | 3300041486 | Ga0451807_0568058 | Ga0451807_0568058_2166_2531 | 119 |
| 796 | 3300041494 | Ga0451837_1029966 | Ga0451837_1029966_2484_2849 | 119 |
| 797 | 3300041512 | Ga0451853_2805711 | Ga0451853_2805711_53_418 | 119 |
| 798 | 3300041512 | Ga0451853_3090388 | Ga0451853_3090388_126_485 | 119 |
| 799 | 3300041512 | Ga0451853_3458144 | Ga0451853_3458144_592_957 | 119 |
| 800 | 3300042001 | Ga0439441_002708 | Ga0439441_002708_129_488 | 119 |
| 801 | 3300042435 | Ga0439434_0122921 | Ga0439434_0122921_289_648 | 119 |
| 802 | 3300042437 | Ga0439444_0086875 | Ga0439444_0086875_300_665 | 119 |
| 803 | 3300042438 | Ga0439459_0195351 | Ga0439459_0195351_103_462 | 119 |
| 804 | 3300042461 | Ga0439460_0087242 | Ga0439460_0087242_91_450 | 119 |
| 805 | 3300044712 | Ga0453684_2369017 | Ga0453684_2369017_102_461 | 119 |
| 806 | 3300046454 | Ga0495592_0567717 | Ga0495592_0567717_224_583 | 119 |
| 807 | 3300046457 | Ga0495590_0005899 | Ga0495590_0005899_1930_2289 | 119 |
| 808 | 3300046460 | Ga0495638_0031603 | Ga0495638_0031603_1639_2001 | 119 |
| 809 | 3300046461 | Ga0495641_0296405 | Ga0495641_0296405_30_389 | 119 |
| 810 | 3300046471 | Ga0495650_0087027 | Ga0495650_0087027_589_948 | 119 |
| 811 | 3300046472 | Ga0495580_0398656 | Ga0495580_0398656_407_766 | 119 |
| 812 | 3300046475 | Ga0495639_0047934 | Ga0495639_0047934_730_1089 | 119 |
| 813 | 3300046491 | Ga0495584_0711558 | Ga0495584_0711558_73_435 | 119 |
| 814 | 3300046492 | Ga0495585_0105295 | Ga0495585_0105295_396_755 | 119 |
| 815 | 3300046492 | Ga0495585_0360636 | Ga0495585_0360636_190_549 | 119 |
| 816 | 3300046513 | Ga0495616_0156341 | Ga0495616_0156341_26_385 | 119 |
| 817 | 3300046514 | Ga0495618_0118886 | Ga0495618_0118886_1162_1521 | 119 |
| 818 | 3300046515 | Ga0495620_0129520 | Ga0495620_0129520_375_734 | 119 |
| 819 | 3300046516 | Ga0495628_0229858 | Ga0495628_0229858_562_921 | 119 |
| 820 | 3300046519 | Ga0495632_0273994 | Ga0495632_0273994_37_396 | 119 |
| 821 | 3300046529 | Ga0495652_0186082 | Ga0495652_0186082_937_1296 | 119 |
| 822 | 3300046533 | Ga0495640_0574015 | Ga0495640_0574015_77_475 | 119 |
| 823 | 3300046536 | Ga0495587_0169715 | Ga0495587_0169715_92_490 | 119 |
| 824 | 3300046536 | Ga0495587_0394923 | Ga0495587_0394923_196_555 | 119 |
| 825 | 3300046539 | Ga0495621_0002870 | Ga0495621_0002870_2017_2379 | 119 |
| 826 | 3300046539 | Ga0495621_0153108 | Ga0495621_0153108_403_762 | 119 |
| 827 | 3300046539 | Ga0495621_0275249 | Ga0495621_0275249_16_375 | 119 |
| 828 | 3300046559 | Ga0495667_0155994 | Ga0495667_0155994_346_705 | 119 |
| 829 | 3300046615 | Ga0495656_0075175 | Ga0495656_0075175_868_1227 | 119 |
| 830 | 3300046616 | Ga0495668_0374095 | Ga0495668_0374095_119_478 | 119 |
| 831 | 3300046660 | Ga0495625_0060202 | Ga0495625_0060202_734_1093 | 119 |
| 832 | 3300046660 | Ga0495625_0081023 | Ga0495625_0081023_1847_2206 | 119 |
| 833 | 3300046663 | Ga0495635_0362707 | Ga0495635_0362707_41_439 | 119 |
| 834 | 3300046678 | Ga0495599_0237946 | Ga0495599_0237946_462_860 | 119 |
| 835 | 3300046678 | Ga0495599_0420483 | Ga0495599_0420483_290_649 | 119 |
| 836 | 3300046694 | Ga0495649_0506525 | Ga0495649_0506525_135_494 | 119 |
| 837 | 3300047315 | Ga0495581_0820107 | Ga0495581_0820107_72_431 | 119 |
| 838 | 3300047317 | Ga0495604_0119888 | Ga0495604_0119888_827_1186 | 119 |
| 839 | 3300047317 | Ga0495604_0771887 | Ga0495604_0771887_12_371 | 119 |
| 840 | 3300047447 | Ga0495685_019324 | Ga0495685_019324_1574_1933 | 119 |
| 841 | 3300047471 | Ga0495684_0817617 | Ga0495684_0817617_124_483 | 119 |
| 842 | 3300048088 | Ga0495602_0368870 | Ga0495602_0368870_605_1003 | 119 |
| 843 | 3300048090 | Ga0495615_0047193 | Ga0495615_0047193_181_540 | 119 |
| 844 | 3300048091 | Ga0495626_0116094 | Ga0495626_0116094_634_993 | 119 |
| 845 | 3300048903 | Ga0496100_0004400 | Ga0496100_0004400_744_1103 | 119 |
| 846 | 3300048903 | Ga0496100_0182201 | Ga0496100_0182201_220_579 | 119 |
| 847 | 3300048905 | Ga0496102_0095979 | Ga0496102_0095979_941_1300 | 119 |
| 848 | 3300048906 | Ga0496103_0026288 | Ga0496103_0026288_418_777 | 119 |
| 849 | 3300048907 | Ga0496104_0004927 | Ga0496104_0004927_539_898 | 119 |
| 850 | 3300048907 | Ga0496104_0294739 | Ga0496104_0294739_641_1039 | 119 |
| 851 | 3300048908 | Ga0496105_0010453 | Ga0496105_0010453_749_1108 | 119 |
| 852 | 3300048908 | Ga0496105_0721191 | Ga0496105_0721191_329_727 | 119 |
| 853 | 3300048909 | Ga0496106_0018018 | Ga0496106_0018018_204_563 | 119 |
| 854 | 3300048910 | Ga0496107_0001216 | Ga0496107_0001216_711_1070 | 119 |
| 855 | 3300048911 | Ga0496108_0001982 | Ga0496108_0001982_1219_1578 | 119 |
| 856 | 3300048912 | Ga0496109_0000633 | Ga0496109_0000633_28747_29106 | 119 |
| 857 | 3300048912 | Ga0496109_0111219 | Ga0496109_0111219_941_1300 | 119 |
| 858 | 3300048913 | Ga0496110_0007585 | Ga0496110_0007585_6570_6929 | 119 |
| 859 | 3300048913 | Ga0496110_0682383 | Ga0496110_0682383_546_905 | 119 |
| 860 | 3300048914 | Ga0496111_0006790 | Ga0496111_0006790_5853_6212 | 119 |
| 861 | 3300048914 | Ga0496111_0097382 | Ga0496111_0097382_1219_1578 | 119 |
| 862 | 3300048915 | Ga0496112_0000400 | Ga0496112_0000400_18244_18603 | 119 |
| 863 | 3300048915 | Ga0496112_0612154 | Ga0496112_0612154_599_958 | 119 |
| 864 | 3300048915 | Ga0496112_1148832 | Ga0496112_1148832_181_540 | 119 |
| 865 | 3300048916 | Ga0496113_0005600 | Ga0496113_0005600_4990_5349 | 119 |
| 866 | 3300048916 | Ga0496113_0051586 | Ga0496113_0051586_2314_2673 | 119 |
| 867 | 3300048917 | Ga0496114_0204233 | Ga0496114_0204233_432_791 | 119 |
| 868 | 3300048917 | Ga0496114_0272876 | Ga0496114_0272876_139_498 | 119 |
| 869 | 3300048917 | Ga0496114_0874533 | Ga0496114_0874533_190_549 | 119 |
| 870 | 3300048918 | Ga0496115_0022318 | Ga0496115_0022318_3745_4104 | 119 |
| 871 | 3300048919 | Ga0496116_0152320 | Ga0496116_0152320_407_766 | 119 |
| 872 | 3300048920 | Ga0496117_0316061 | Ga0496117_0316061_217_576 | 119 |
| 873 | 3300048921 | Ga0496118_0018464 | Ga0496118_0018464_5345_5704 | 119 |
| 874 | 3300048924 | Ga0496121_0105333 | Ga0496121_0105333_1333_1692 | 119 |
| 875 | 3300048925 | Ga0496122_0096002 | Ga0496122_0096002_1191_1550 | 119 |
| 876 | 3300048926 | Ga0496123_0100612 | Ga0496123_0100612_444_803 | 119 |
| 877 | 3300048927 | Ga0496124_0151279 | Ga0496124_0151279_1274_1633 | 119 |
| 878 | 3300048928 | Ga0496125_0000164 | Ga0496125_0000164_140392_140751 | 119 |
| 879 | 3300049459 | Ga0495678_163843 | Ga0495678_163843_10_369 | 119 |
| 880 | 3300049520 | Ga0501297_075804 | Ga0501297_075804_169_528 | 119 |
| 881 | 3300049570 | Ga0501033_0848342 | Ga0501033_0848342_16_375 | 119 |
| 882 | 3300049572 | Ga0501036_0521226 | Ga0501036_0521226_135_527 | 119 |
| 883 | 3300049572 | Ga0501036_0922313 | Ga0501036_0922313_70_429 | 119 |
| 884 | 3300049572 | Ga0501036_1068057 | Ga0501036_1068057_51_410 | 119 |
| 885 | 3300049572 | Ga0501036_1086425 | Ga0501036_1086425_223_582 | 119 |
| 886 | 3300049574 | Ga0501038_0169293 | Ga0501038_0169293_16_408 | 119 |
| 887 | 3300049575 | Ga0501039_0527053 | Ga0501039_0527053_197_589 | 119 |
| 888 | 3300049575 | Ga0501039_1317651 | Ga0501039_1317651_46_405 | 119 |
| 889 | 3300049576 | Ga0501040_0070046 | Ga0501040_0070046_1373_1765 | 119 |
| 890 | 3300049576 | Ga0501040_1041791 | Ga0501040_1041791_14_373 | 119 |
| 891 | 3300049577 | Ga0501041_0429632 | Ga0501041_0429632_223_582 | 119 |
| 892 | 3300049577 | Ga0501041_0447645 | Ga0501041_0447645_173_532 | 119 |
| 893 | 3300049578 | Ga0501042_0051674 | Ga0501042_0051674_1366_1737 | 119 |
| 894 | 3300049578 | Ga0501042_0519598 | Ga0501042_0519598_247_606 | 119 |
| 895 | 3300049578 | Ga0501042_0606226 | Ga0501042_0606226_183_545 | 119 |
| 896 | 3300049578 | Ga0501042_1055765 | Ga0501042_1055765_185_544 | 119 |
| 897 | 3300049580 | Ga0501046_0166832 | Ga0501046_0166832_951_1310 | 119 |
| 898 | 3300049580 | Ga0501046_0257553 | Ga0501046_0257553_272_631 | 119 |
| 899 | 3300049582 | Ga0501048_0227922 | Ga0501048_0227922_554_946 | 119 |
| 900 | 3300049583 | Ga0501067_0173646 | Ga0501067_0173646_190_549 | 119 |
| 901 | 3300049584 | Ga0501068_0025220 | Ga0501068_0025220_1478_1837 | 119 |
| 902 | 3300049584 | Ga0501068_0668236 | Ga0501068_0668236_133_492 | 119 |
| 903 | 3300049585 | Ga0501069_0130668 | Ga0501069_0130668_404_763 | 119 |
| 904 | 3300049586 | Ga0501070_0084140 | Ga0501070_0084140_1530_1889 | 119 |
| 905 | 3300049587 | Ga0501071_0085395 | Ga0501071_0085395_1377_1736 | 119 |
| 906 | 3300049587 | Ga0501071_0392564 | Ga0501071_0392564_478_837 | 119 |
| 907 | 3300049588 | Ga0501072_0301214 | Ga0501072_0301214_451_810 | 119 |
| 908 | 3300049589 | Ga0501073_0062627 | Ga0501073_0062627_544_903 | 119 |
| 909 | 3300049589 | Ga0501073_0408892 | Ga0501073_0408892_109_471 | 119 |
| 910 | 3300049590 | Ga0501074_0285423 | Ga0501074_0285423_692_1051 | 119 |
| 911 | 3300049590 | Ga0501074_0379355 | Ga0501074_0379355_331_690 | 119 |
| 912 | 3300049590 | Ga0501074_1141699 | Ga0501074_1141699_117_476 | 119 |
| 913 | 3300049591 | Ga0501075_0129719 | Ga0501075_0129719_899_1258 | 119 |
| 914 | 3300049591 | Ga0501075_0279702 | Ga0501075_0279702_869_1228 | 119 |
| 915 | 3300049591 | Ga0501075_0310909 | Ga0501075_0310909_725_1084 | 119 |
| 916 | 3300049591 | Ga0501075_0498458 | Ga0501075_0498458_138_497 | 119 |
| 917 | 3300049591 | Ga0501075_1122258 | Ga0501075_1122258_172_531 | 119 |
| 918 | 3300049591 | Ga0501075_1311480 | Ga0501075_1311480_101_496 | 119 |
| 919 | 3300049592 | Ga0501076_0045487 | Ga0501076_0045487_2994_3386 | 119 |
| 920 | 3300049592 | Ga0501076_0247013 | Ga0501076_0247013_296_655 | 119 |
| 921 | 3300049592 | Ga0501076_0362875 | Ga0501076_0362875_346_705 | 119 |
| 922 | 3300049592 | Ga0501076_0483046 | Ga0501076_0483046_139_498 | 119 |
| 923 | 3300049592 | Ga0501076_0543079 | Ga0501076_0543079_293_652 | 119 |
| 924 | 3300049592 | Ga0501076_0959496 | Ga0501076_0959496_192_551 | 119 |
| 925 | 3300049593 | Ga0501077_0280574 | Ga0501077_0280574_175_534 | 119 |
| 926 | 3300049593 | Ga0501077_0305632 | Ga0501077_0305632_571_930 | 119 |
| 927 | 3300049593 | Ga0501077_0386524 | Ga0501077_0386524_239_631 | 119 |
| 928 | 3300049593 | Ga0501077_0452288 | Ga0501077_0452288_192_551 | 119 |
| 929 | 3300049741 | Ga0501079_0106401 | Ga0501079_0106401_139_498 | 119 |
| 930 | 3300049741 | Ga0501079_0252495 | Ga0501079_0252495_449_808 | 119 |
| 931 | 3300049741 | Ga0501079_0468376 | Ga0501079_0468376_550_912 | 119 |
| 932 | 3300049741 | Ga0501079_0567044 | Ga0501079_0567044_423_815 | 119 |
| 933 | 3300049742 | Ga0501080_0442922 | Ga0501080_0442922_598_957 | 119 |
| 934 | 3300049742 | Ga0501080_1323437 | Ga0501080_1323437_10_402 | 119 |
| 935 | 3300049743 | Ga0501081_0088873 | Ga0501081_0088873_1754_2113 | 119 |
| 936 | 3300049743 | Ga0501081_0294962 | Ga0501081_0294962_132_491 | 119 |
| 937 | 3300049743 | Ga0501081_0324108 | Ga0501081_0324108_214_573 | 119 |
| 938 | 3300049743 | Ga0501081_1077780 | Ga0501081_1077780_239_598 | 119 |
| 939 | 3300049744 | Ga0501083_0130949 | Ga0501083_0130949_479_838 | 119 |
| 940 | 3300049822 | Ga0501035_0156134 | Ga0501035_0156134_867_1226 | 119 |
| 941 | 3300049823 | Ga0501044_1171247 | Ga0501044_1171247_152_511 | 119 |
| 942 | 3300050489 | nmdc:mga03683_39084_c1 | nmdc:mga03683_39084_c1_1536_1895 | 119 |
| 943 | 3300050489 | nmdc:mga03683_61999_c1 | nmdc:mga03683_61999_c1_988_1347 | 119 |
| 944 | 3300050489 | nmdc:mga03683_78013_c1 | nmdc:mga03683_78013_c1_355_747 | 119 |
| 945 | 3300050490 | nmdc:mga03n38_1178_c1 | nmdc:mga03n38_1178_c1_5772_6164 | 119 |
| 946 | 3300050490 | nmdc:mga03n38_194356_c1 | nmdc:mga03n38_194356_c1_596_955 | 119 |
| 947 | 3300050490 | nmdc:mga03n38_961607_c1 | nmdc:mga03n38_961607_c1_124_489 | 119 |
| 948 | 3300050491 | nmdc:mga00v17_397260_c1 | nmdc:mga00v17_397260_c1_55_414 | 119 |
| 949 | 3300050492 | nmdc:mga0yw44_10029_c1 | nmdc:mga0yw44_10029_c1_372_731 | 119 |
| 950 | 3300050492 | nmdc:mga0yw44_212548_c1 | nmdc:mga0yw44_212548_c1_877_1236 | 119 |
| 951 | 3300050492 | nmdc:mga0yw44_29263_c2 | nmdc:mga0yw44_29263_c2_173_538 | 119 |
| 952 | 3300050492 | nmdc:mga0yw44_832033_c1 | nmdc:mga0yw44_832033_c1_35_394 | 119 |
| 953 | 3300050494 | nmdc:mga06z11_136192_c1 | nmdc:mga06z11_136192_c1_824_1183 | 119 |
| 954 | 3300050494 | nmdc:mga06z11_206027_c1 | nmdc:mga06z11_206027_c1_496_855 | 119 |
| 955 | 3300050494 | nmdc:mga06z11_224408_c1 | nmdc:mga06z11_224408_c1_551_910 | 119 |
| 956 | 3300050494 | nmdc:mga06z11_3732_c1 | nmdc:mga06z11_3732_c1_1079_1471 | 119 |
| 957 | 3300050496 | nmdc:mga07m45_134146_c1 | nmdc:mga07m45_134146_c1_215_574 | 119 |
| 958 | 3300050496 | nmdc:mga07m45_1587_c1 | nmdc:mga07m45_1587_c1_4614_5006 | 119 |
| 959 | 3300050507 | nmdc:mga05p37_102920_c1 | nmdc:mga05p37_102920_c1_1413_1772 | 119 |
| 960 | 3300050507 | nmdc:mga05p37_2192820_c1 | nmdc:mga05p37_2192820_c1_118_477 | 119 |
| 961 | 3300050507 | nmdc:mga05p37_348_c1 | nmdc:mga05p37_348_c1_20610_20969 | 119 |
| 962 | 3300050507 | nmdc:mga05p37_468372_c1 | nmdc:mga05p37_468372_c1_714_1073 | 119 |
| 963 | 3300050508 | nmdc:mga09592_151652_c1 | nmdc:mga09592_151652_c1_106_465 | 119 |
| 964 | 3300050508 | nmdc:mga09592_5_c1 | nmdc:mga09592_5_c1_104364_104723 | 119 |
| 965 | 3300050509 | nmdc:mga0qj67_1273265_c1 | nmdc:mga0qj67_1273265_c1_84_443 | 119 |
| 966 | 3300050509 | nmdc:mga0qj67_45509_c1 | nmdc:mga0qj67_45509_c1_469_828 | 119 |
| 967 | 3300050510 | nmdc:mga06r32_102295_c1 | nmdc:mga06r32_102295_c1_1288_1647 | 119 |
| 968 | 3300050510 | nmdc:mga06r32_11679_c1 | nmdc:mga06r32_11679_c1_6283_6642 | 119 |
| 969 | 3300050510 | nmdc:mga06r32_191709_c1 | nmdc:mga06r32_191709_c1_222_581 | 119 |
| 970 | 3300050510 | nmdc:mga06r32_314673_c1 | nmdc:mga06r32_314673_c1_1085_1444 | 119 |
| 971 | 3300050510 | nmdc:mga06r32_950258_c1 | nmdc:mga06r32_950258_c1_54_413 | 119 |
| 972 | 3300050510 | nmdc:mga06r32_96986_c1 | nmdc:mga06r32_96986_c1_12_377 | 119 |
| 973 | 3300050511 | nmdc:mga08y16_221905_c1 | nmdc:mga08y16_221905_c1_912_1271 | 119 |
| 974 | 3300050511 | nmdc:mga08y16_230263_c1 | nmdc:mga08y16_230263_c1_1485_1850 | 119 |
| 975 | 3300050511 | nmdc:mga08y16_30230_c1 | nmdc:mga08y16_30230_c1_55_414 | 119 |
| 976 | 3300050511 | nmdc:mga08y16_50531_c1 | nmdc:mga08y16_50531_c1_2619_3038 | 119 |
| 977 | 3300050511 | nmdc:mga08y16_955334_c1 | nmdc:mga08y16_955334_c1_387_749 | 119 |
| 978 | 3300050512 | nmdc:mga0n895_413112_c1 | nmdc:mga0n895_413112_c1_216_578 | 119 |
| 979 | 3300050512 | nmdc:mga0n895_42972_c1 | nmdc:mga0n895_42972_c1_309_668 | 119 |
| 980 | 3300050513 | nmdc:mga0rr50_1077155_c1 | nmdc:mga0rr50_1077155_c1_215_574 | 119 |
| 981 | 3300050515 | nmdc:mga0a205_779377_c1 | nmdc:mga0a205_779377_c1_73_435 | 119 |
| 982 | 3300050516 | nmdc:mga0sz30_62707_c1 | nmdc:mga0sz30_62707_c1_460_891 | 119 |
| 983 | 3300053077 | Ga0495601_0013981 | Ga0495601_0013981_4346_4705 | 119 |
| 984 | 3300053078 | Ga0495612_0094096 | Ga0495612_0094096_538_897 | 119 |
| 985 | 3300053080 | Ga0500635_0102332 | Ga0500635_0102332_526_885 | 119 |
| 986 | 3300053083 | Ga0495655_0000628 | Ga0495655_0000628_2409_2768 | 119 |
| 987 | 3300053084 | Ga0495595_0155983 | Ga0495595_0155983_686_1084 | 119 |
| 988 | 3300053085 | Ga0495619_0380483 | Ga0495619_0380483_26_424 | 119 |
| 989 | 3300053121 | Ga0500607_259147 | Ga0500607_259147_154_513 | 119 |
| 990 | 3300053125 | Ga0500618_005777 | Ga0500618_005777_512_871 | 119 |
| 991 | 3300053723 | Ga0500567_043907 | Ga0500567_043907_1681_2040 | 119 |
| 992 | 3300054114 | Ga0501084_0073208 | Ga0501084_0073208_1096_1455 | 119 |
| 993 | 3300054114 | Ga0501084_0073995 | Ga0501084_0073995_992_1351 | 119 |
| 994 | 3300054114 | Ga0501084_1618901 | Ga0501084_1618901_77_436 | 119 |
| 995 | 3300060353 | Ga0501082_0182537 | Ga0501082_0182537_1050_1409 | 119 |
| 996 | 3300060353 | Ga0501082_0251458 | Ga0501082_0251458_144_536 | 119 |
| 997 | 2162886007 | SwRhRL2b_contig_442106 | SwRhRL2b_0138.00001650 | 120 |
| 998 | 2162886007 | SwRhRL2b_contig_844195 | SwRhRL2b_0989.00005140 | 120 |
| 999 | 3300005295 | Ga0065707_10349446 | Ga0065707_103494462 | 120 |
| 1000 | 3300005295 | Ga0065707_10546411 | Ga0065707_105464112 | 120 |
| 1001 | 3300005444 | Ga0070694_100276844 | Ga0070694_1002768442 | 120 |
| 1002 | 3300005468 | Ga0070707_100282148 | Ga0070707_1002821482 | 120 |
| 1003 | 3300005471 | Ga0070698_101671845 | Ga0070698_1016718451 | 120 |
| 1004 | 3300005518 | Ga0070699_100000012 | Ga0070699_10000001263 | 120 |
| 1005 | 3300005536 | Ga0070697_101005284 | Ga0070697_1010052841 | 120 |
| 1006 | 3300005617 | Ga0068859_100620354 | Ga0068859_1006203542 | 120 |
| 1007 | 3300005617 | Ga0068859_100905409 | Ga0068859_1009054092 | 120 |
| 1008 | 3300005841 | Ga0068863_100113905 | Ga0068863_1001139051 | 120 |
| 1009 | 3300005842 | Ga0068858_100005836 | Ga0068858_1000058367 | 120 |
| 1010 | 3300005843 | Ga0068860_100543002 | Ga0068860_1005430022 | 120 |
| 1011 | 3300006058 | Ga0075432_10552234 | Ga0075432_105522341 | 120 |
| 1012 | 3300006237 | Ga0097621_100205331 | Ga0097621_1002053311 | 120 |
| 1013 | 3300006871 | Ga0075434_101521405 | Ga0075434_1015214052 | 120 |
| 1014 | 3300006880 | Ga0075429_101426640 | Ga0075429_1014266402 | 120 |
| 1015 | 3300006931 | Ga0097620_100620283 | Ga0097620_1006202832 | 120 |
| 1016 | 3300006931 | Ga0097620_100905368 | Ga0097620_1009053682 | 120 |
| 1017 | 3300007788 | Ga0099795_10000022 | Ga0099795_1000002234 | 120 |
| 1018 | 3300009094 | Ga0111539_10025568 | Ga0111539_100255686 | 120 |
| 1019 | 3300009101 | Ga0105247_10002316 | Ga0105247_100023167 | 120 |
| 1020 | 3300009147 | Ga0114129_10452513 | Ga0114129_104525132 | 120 |
| 1021 | 3300009147 | Ga0114129_11712671 | Ga0114129_117126711 | 120 |
| 1022 | 3300009176 | Ga0105242_13157271 | Ga0105242_131572711 | 120 |
| 1023 | 3300009177 | Ga0105248_10031395 | Ga0105248_100313955 | 120 |
| 1024 | 3300009177 | Ga0105248_10310970 | Ga0105248_103109702 | 120 |
| 1025 | 3300009545 | Ga0105237_11227353 | Ga0105237_112273532 | 120 |
| 1026 | 3300009551 | Ga0105238_10216685 | Ga0105238_102166854 | 120 |
| 1027 | 3300009553 | Ga0105249_10597082 | Ga0105249_105970822 | 120 |
| 1028 | 3300010159 | Ga0099796_10000153 | Ga0099796_100001537 | 120 |
| 1029 | 3300013306 | Ga0163162_10057411 | Ga0163162_100574118 | 120 |
| 1030 | 3300014325 | Ga0163163_10271568 | Ga0163163_102715681 | 120 |
| 1031 | 3300014968 | Ga0157379_10013529 | Ga0157379_100135294 | 120 |
| 1032 | 3300014968 | Ga0157379_10053782 | Ga0157379_100537823 | 120 |
| 1033 | 3300025903 | Ga0207680_10312532 | Ga0207680_103125322 | 120 |
| 1034 | 3300025914 | Ga0207671_10731091 | Ga0207671_107310911 | 120 |
| 1035 | 3300025918 | Ga0207662_10267689 | Ga0207662_102676892 | 120 |
| 1036 | 3300025922 | Ga0207646_10935093 | Ga0207646_109350932 | 120 |
| 1037 | 3300025924 | Ga0207694_10613141 | Ga0207694_106131412 | 120 |
| 1038 | 3300025924 | Ga0207694_10954270 | Ga0207694_109542701 | 120 |
| 1039 | 3300025933 | Ga0207706_10192645 | Ga0207706_101926453 | 120 |
| 1040 | 3300025934 | Ga0207686_10025970 | Ga0207686_100259702 | 120 |
| 1041 | 3300025941 | Ga0207711_10046436 | Ga0207711_100464362 | 120 |
| 1042 | 3300025961 | Ga0207712_10112492 | Ga0207712_101124922 | 120 |
| 1043 | 3300025981 | Ga0207640_10734150 | Ga0207640_107341502 | 120 |
| 1044 | 3300025986 | Ga0207658_10000197 | Ga0207658_1000019728 | 120 |
| 1045 | 3300026035 | Ga0207703_10422123 | Ga0207703_104221232 | 120 |
| 1046 | 3300026088 | Ga0207641_10183121 | Ga0207641_101831211 | 120 |
| 1047 | 3300027907 | Ga0207428_10221566 | Ga0207428_102215661 | 120 |
| 1048 | 3300028794 | Ga0307515_10000358 | Ga0307515_1000035810 | 120 |
| 1049 | 3300031665 | Ga0316575_10054229 | Ga0316575_100542291 | 120 |
| 1050 | 3300031691 | Ga0316579_10046748 | Ga0316579_100467483 | 120 |
| 1051 | 3300031727 | Ga0316576_10167592 | Ga0316576_101675923 | 120 |
| 1052 | 3300031728 | Ga0316578_10072822 | Ga0316578_100728223 | 120 |
| 1053 | 3300031730 | Ga0307516_10824918 | Ga0307516_108249182 | 120 |
| 1054 | 3300031733 | Ga0316577_10016044 | Ga0316577_100160444 | 120 |
| 1055 | 3300032137 | Ga0316585_10010265 | Ga0316585_100102653 | 120 |
| 1056 | 3300032139 | Ga0316580_10049611 | Ga0316580_100496112 | 120 |
| 1057 | 3300035398 | Ga0316574_0079917 | Ga0316574_0079917_1240_1602 | 120 |
| 1058 | 3300036712 | Ga0316584_0229151 | Ga0316584_0229151_253_615 | 120 |
| 1059 | 3300041413 | Ga0439465_0281421 | Ga0439465_0281421_60_425 | 120 |
| 1060 | 3300042004 | Ga0439445_0057312 | Ga0439445_0057312_148_513 | 120 |
| 1061 | 3300045051 | Ga0451576_1684726 | Ga0451576_1684726_102_464 | 120 |
| 1062 | 3300050507 | nmdc:mga05p37_1689629_c1 | nmdc:mga05p37_1689629_c1_177_539 | 120 |
| 1063 | 3300050507 | nmdc:mga05p37_448926_c1 | nmdc:mga05p37_448926_c1_969_1331 | 120 |
| 1064 | 3300050508 | nmdc:mga09592_1260904_c1 | nmdc:mga09592_1260904_c1_235_597 | 120 |
| 1065 | 3300050511 | nmdc:mga08y16_399159_c1 | nmdc:mga08y16_399159_c1_885_1247 | 120 |
| 1066 | 3300050515 | nmdc:mga0a205_506359_c1 | nmdc:mga0a205_506359_c1_278_640 | 120 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2okq-assembly1.cif.gz_A | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.9287 | 2 | 118 |
| 2okq-assembly1.cif.gz_B | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.9251 | 2 | 120 |
| 2okq-assembly1.cif.gz_A | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.8845 | 2 | 118 |
| 2okq-assembly1.cif.gz_B | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.8504 | 2 | 120 |
| 8avi-assembly1.cif.gz_B | crystal structure of isdg from bacillus cereus in complex with heme | 0.7765 | 4 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAQ6_1_117_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9346 | 3 | 120 | 3.30.70.100 |
| af_P0AAQ6_1_117_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9194 | 3 | 120 | 3.30.70.100 |
| 3kg1A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7711 | 1 | 119 | 3.30.70.100 |
| af_Q55CR9_1_97_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7483 | 2 | 117 | 3.30.70.100 |
| 4dpoB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7472 | 3 | 116 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R2I8P8-F1-model_v4 | Uncharacterized protein YbaA (DUF1428 family) | 0.9604 | 3 | 120 |
|
| AF-A0A2W7C8D6-F1-model_v4 | RNA signal recognition particle | 0.9591 | 3 | 120 |
|
| AF-A0A6J4S241-F1-model_v4 | RNA signal recognition particle 4.5S RNA | 0.9583 | 2 | 120 |
|
| AF-A0A442F9M7-F1-model_v4 | DUF1428 family protein | 0.958 | 3 | 120 |
|
| AF-A0A2P9AJ88-F1-model_v4 | RNA signal recognition particle 4.5S RNA | 0.9576 | 3 | 120 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar