F489404

General Info

Members Datasets Scaffolds Average Seq Length
1066 378 1066 120

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100280122|Ga0307408_1002801221
Length 132
Sequence MAYVDGFLLPVPKKNLPRYRSIARRAGKVWMEHGALEYRESVADDLGKMSRGFGQGVRIKGGEVAMFSWIVYRSKRDRDRINRLVLKDPRILALMTPSNQIFDDKRMAYGGFRTIVDLAIKGTGHRAKAKKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
123 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300025227 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
206 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
212 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
213 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
214 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
215 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
229 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
230 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
231 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
238 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
239 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
240 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
241 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
242 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
243 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
244 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
247 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
250 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
251 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
270 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
291 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
294 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
311 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
312 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
313 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
314 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
315 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
316 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
317 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
318 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
319 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
320 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
334 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
335 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
336 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
337 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
338 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
339 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
340 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
341 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
342 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
343 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
344 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
345 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
346 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
351 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
352 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
353 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
354 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
355 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
356 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
357 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
358 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
359 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
360 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
361 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
362 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
363 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
364 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
367 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
368 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
369 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
370 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
374 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
375 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
378 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.94
Nodule 0
Rhizoplane 4.13
Rhizosphere 89.87
Stem 0
Stem Tuber 0
Unclassified 2.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_442106 2162886007 Bacteria 1269
2 SwRhRL2b_contig_844195 2162886007 Bacteria 2972
3 JGI24746J21847_1031565 3300001977 Bacteria 730
4 JGI24739J22299_10162950 3300001989 Bacteria 658
5 JGI24737J22298_10022369 3300001990 Bacteria 2010
6 JGI24743J22301_10000289 3300001991 Bacteria 5445
7 JGI24750J21931_1002677 3300002070 Bacteria 2137
8 JGI24748J21848_1044144 3300002074 Bacteria 572
9 JGI24738J21930_10156264 3300002075 Bacteria 509
10 JGI24744J21845_10001142 3300002077 Bacteria 5162
11 JGI24744J21845_10101059 3300002077 Unclassified 532
12 JGI24033J26618_1003370 3300002155 Bacteria 1683
13 JGI24742J22300_10043033 3300002244 Bacteria 807
14 JGI24742J22300_10085329 3300002244 Bacteria 600
15 JGI24751J29686_10003925 3300002459 Bacteria 3004
16 rootH2_10015358 3300003320 Bacteria 34751
17 rootH1_10157129 3300003323 Bacteria 5023
18 JGI25407J50210_10147166 3300003373 Bacteria 580
19 Ga0065715_10759263 3300005293 Bacteria 626
20 Ga0065707_10349446 3300005295 Bacteria 921
21 Ga0065707_10546411 3300005295 Bacteria 724
22 Ga0065707_10598815 3300005295 Bacteria 681
23 Ga0065707_10636514 3300005295 Bacteria 670
24 Ga0065707_10800179 3300005295 Bacteria 599
25 Ga0070676_10129134 3300005328 Bacteria 1596
26 Ga0070676_10397834 3300005328 Bacteria 958
27 Ga0070676_10575923 3300005328 Bacteria 809
28 Ga0070683_102086620 3300005329 Bacteria 544
29 Ga0070690_100009413 3300005330 Bacteria 5658
30 Ga0070690_100041690 3300005330 Bacteria 2906
31 Ga0070690_100612470 3300005330 Bacteria 828
32 Ga0070690_100716923 3300005330 Bacteria 769
33 Ga0070670_100173351 3300005331 Bacteria 1871
34 Ga0070670_100812416 3300005331 Bacteria 845
35 Ga0070677_10016023 3300005333 Bacteria 2663
36 Ga0070677_10042171 3300005333 Bacteria 1805
37 Ga0070677_10179249 3300005333 Bacteria 1008
38 Ga0070677_10211260 3300005333 Bacteria 942
39 Ga0068869_100039936 3300005334 Bacteria 3353
40 Ga0068869_100104321 3300005334 Bacteria 2149
41 Ga0068869_100703600 3300005334 Bacteria 862
42 Ga0068869_101000833 3300005334 Unclassified 728
43 Ga0068869_101492468 3300005334 Bacteria 600
44 Ga0068869_101741194 3300005334 Bacteria 557
45 Ga0070666_10411434 3300005335 Bacteria 973
46 Ga0070680_100339665 3300005336 Bacteria 1276
47 Ga0068868_100058792 3300005338 Bacteria 3039
48 Ga0070660_100112452 3300005339 Bacteria 2168
49 Ga0070689_100027085 3300005340 Bacteria 4319
50 Ga0070689_100276349 3300005340 Bacteria 1392
51 Ga0070689_100403657 3300005340 Bacteria 1156
52 Ga0070689_100587071 3300005340 Bacteria 964
53 Ga0070689_100587204 3300005340 Bacteria 964
54 Ga0070691_10062475 3300005341 Bacteria 1794
55 Ga0070691_10382175 3300005341 Bacteria 789
56 Ga0070691_10556161 3300005341 Bacteria 671
57 Ga0070687_100013616 3300005343 Bacteria 3629
58 Ga0070687_100332283 3300005343 Bacteria 975
59 Ga0070687_100879638 3300005343 Bacteria 641
60 Ga0070661_100974151 3300005344 Bacteria 703
61 Ga0070692_10055110 3300005345 Bacteria 2078
62 Ga0070692_10274115 3300005345 Bacteria 1020
63 Ga0070692_10340976 3300005345 Bacteria 928
64 Ga0070668_100071393 3300005347 Bacteria 2704
65 Ga0070668_100163900 3300005347 Bacteria 1805
66 Ga0070668_100165081 3300005347 Bacteria 1799
67 Ga0070668_100421980 3300005347 Bacteria 1142
68 Ga0070668_100499828 3300005347 Bacteria 1052
69 Ga0070668_100781846 3300005347 Bacteria 847
70 Ga0070668_101021219 3300005347 Bacteria 744
71 Ga0070669_100024281 3300005353 Bacteria 4347
72 Ga0070669_100032969 3300005353 Bacteria 3744
73 Ga0070669_100076141 3300005353 Bacteria 2490
74 Ga0070669_101767839 3300005353 Bacteria 539
75 Ga0070675_100021110 3300005354 Bacteria 5201
76 Ga0070675_100195145 3300005354 Bacteria 1756
77 Ga0070675_100474882 3300005354 Bacteria 1124
78 Ga0070675_100490600 3300005354 Bacteria 1106
79 Ga0070674_100008010 3300005356 Bacteria 6262
80 Ga0070674_100013939 3300005356 Bacteria 4984
81 Ga0070674_100019263 3300005356 Bacteria 4333
82 Ga0070674_100039433 3300005356 Bacteria 3189
83 Ga0070674_100308610 3300005356 Bacteria 1264
84 Ga0070674_100793274 3300005356 Bacteria 817
85 Ga0070673_100034287 3300005364 Bacteria 3839
86 Ga0070673_100051856 3300005364 Bacteria 3216
87 Ga0070673_100290422 3300005364 Bacteria 1437
88 Ga0070673_100578887 3300005364 Bacteria 1022
89 Ga0070673_100607969 3300005364 Bacteria 998
90 Ga0070673_100855410 3300005364 Bacteria 842
91 Ga0070673_101019821 3300005364 Bacteria 771
92 Ga0070673_101234034 3300005364 Bacteria 701
93 Ga0070673_101347997 3300005364 Bacteria 671
94 Ga0070688_100006679 3300005365 Bacteria 6182
95 Ga0070688_100030550 3300005365 Bacteria 3235
96 Ga0070688_100066185 3300005365 Bacteria 2299
97 Ga0070688_100093546 3300005365 Bacteria 1969
98 Ga0070688_100176158 3300005365 Bacteria 1480
99 Ga0070688_100221112 3300005365 Bacteria 1334
100 Ga0070659_100006061 3300005366 Bacteria 8721
101 Ga0070659_100151620 3300005366 Bacteria 1891
102 Ga0070659_101051100 3300005366 Bacteria 716
103 Ga0070667_100042351 3300005367 Bacteria 3821
104 Ga0070667_100353143 3300005367 Bacteria 1331
105 Ga0070667_100429111 3300005367 Bacteria 1206
106 Ga0070667_101581259 3300005367 Bacteria 616
107 Ga0070703_10070998 3300005406 Bacteria 1163
108 Ga0070701_10011428 3300005438 Bacteria 3969
109 Ga0070701_10108626 3300005438 Bacteria 1547
110 Ga0070701_10147202 3300005438 Bacteria 1353
111 Ga0070701_10612076 3300005438 Bacteria 723
112 Ga0070701_10815755 3300005438 Bacteria 638
113 Ga0070711_101013505 3300005439 Bacteria 713
114 Ga0070705_100013904 3300005440 Bacteria 4128
115 Ga0070705_100081424 3300005440 Bacteria 1989
116 Ga0070705_100115279 3300005440 Bacteria 1725
117 Ga0070705_100123176 3300005440 Bacteria 1678
118 Ga0070705_100891852 3300005440 Bacteria 714
119 Ga0070700_100001831 3300005441 Bacteria 10735
120 Ga0070700_100024645 3300005441 Bacteria 3535
121 Ga0070700_100213204 3300005441 Bacteria 1364
122 Ga0070700_100272249 3300005441 Bacteria 1224
123 Ga0070700_100354636 3300005441 Bacteria 1089
124 Ga0070700_100425144 3300005441 Bacteria 1005
125 Ga0070700_100570968 3300005441 Bacteria 882
126 Ga0070694_100067189 3300005444 Bacteria 2461
127 Ga0070694_100120415 3300005444 Bacteria 1882
128 Ga0070694_100227034 3300005444 Bacteria 1403
129 Ga0070694_100276844 3300005444 Unclassified 1278
130 Ga0070694_100506881 3300005444 Bacteria 961
131 Ga0070694_100898372 3300005444 Bacteria 731
132 Ga0070694_100934547 3300005444 Bacteria 717
133 Ga0070663_100034544 3300005455 Bacteria 3502
134 Ga0070663_100042205 3300005455 Bacteria 3204
135 Ga0070663_100192677 3300005455 Bacteria 1587
136 Ga0070678_100051594 3300005456 Bacteria 2982
137 Ga0070678_100147121 3300005456 Bacteria 1893
138 Ga0070678_100285946 3300005456 Bacteria 1396
139 Ga0070678_100536330 3300005456 Bacteria 1037
140 Ga0070678_100611740 3300005456 Bacteria 974
141 Ga0070662_100039586 3300005457 Bacteria 3352
142 Ga0070662_100181707 3300005457 Bacteria 1658
143 Ga0070662_100639693 3300005457 Bacteria 897
144 Ga0070662_100779514 3300005457 Bacteria 812
145 Ga0070662_100795103 3300005457 Bacteria 804
146 Ga0070662_101620786 3300005457 Bacteria 559
147 Ga0070681_10066648 3300005458 Bacteria 3569
148 Ga0070681_11166494 3300005458 Bacteria 692
149 Ga0068867_100026934 3300005459 Bacteria 4131
150 Ga0068867_100062864 3300005459 Bacteria 2759
151 Ga0068867_100185720 3300005459 Bacteria 1656
152 Ga0068867_100437315 3300005459 Bacteria 1112
153 Ga0068867_100483201 3300005459 Bacteria 1062
154 Ga0070685_10002826 3300005466 Bacteria 8871
155 Ga0070685_10152406 3300005466 Bacteria 1466
156 Ga0070685_10524535 3300005466 Bacteria 842
157 Ga0070707_100282148 3300005468 Unclassified 1614
158 Ga0070707_101845867 3300005468 Unclassified 572
159 Ga0070698_100020375 3300005471 Bacteria 6950
160 Ga0070698_101671845 3300005471 Unclassified 589
161 Ga0070699_100000012 3300005518 Bacteria 246521
162 Ga0070699_100246708 3300005518 Bacteria 1595
163 Ga0070699_100451974 3300005518 Bacteria 1165
164 Ga0070679_100053571 3300005530 Bacteria 4016
165 Ga0070684_100153697 3300005535 Bacteria 2086
166 Ga0070697_100323693 3300005536 Unclassified 1328
167 Ga0070697_100803916 3300005536 Bacteria 832
168 Ga0070697_101005284 3300005536 Unclassified 741
169 Ga0070697_101961306 3300005536 Unclassified 524
170 Ga0068853_100197108 3300005539 Bacteria 1832
171 Ga0068853_100545824 3300005539 Bacteria 1098
172 Ga0070672_100011114 3300005543 Bacteria 6270
173 Ga0070672_100093329 3300005543 Bacteria 2431
174 Ga0070672_100369918 3300005543 Bacteria 1224
175 Ga0070672_100654130 3300005543 Bacteria 918
176 Ga0070672_101071472 3300005543 Bacteria 716
177 Ga0070686_100009432 3300005544 Bacteria 5487
178 Ga0070686_100037119 3300005544 Bacteria 3021
179 Ga0070686_100948792 3300005544 Unclassified 703
180 Ga0070695_100011470 3300005545 Bacteria 5300
181 Ga0070695_100103183 3300005545 Bacteria 1924
182 Ga0070695_100300607 3300005545 Bacteria 1186
183 Ga0070695_101528312 3300005545 Bacteria 556
184 Ga0070696_100009053 3300005546 Bacteria 6667
185 Ga0070696_100166438 3300005546 Bacteria 1627
186 Ga0070693_100006310 3300005547 Bacteria 5747
187 Ga0070693_100658952 3300005547 Bacteria 762
188 Ga0070665_100048285 3300005548 Bacteria 4274
189 Ga0070665_100095945 3300005548 Bacteria 2970
190 Ga0070665_100258146 3300005548 Bacteria 1744
191 Ga0070665_100496069 3300005548 Bacteria 1232
192 Ga0070665_101185842 3300005548 Bacteria 774
193 Ga0070704_100054091 3300005549 Bacteria 2840
194 Ga0070704_100179392 3300005549 Bacteria 1692
195 Ga0070704_100374703 3300005549 Bacteria 1208
196 Ga0070664_100258165 3300005564 Bacteria 1567
197 Ga0070664_100336652 3300005564 Bacteria 1370
198 Ga0070664_101889046 3300005564 Unclassified 566
199 Ga0068857_100024296 3300005577 Bacteria 5333
200 Ga0068857_100249292 3300005577 Bacteria 1627
201 Ga0068857_100501143 3300005577 Bacteria 1140
202 Ga0068857_100523862 3300005577 Bacteria 1114
203 Ga0068854_100088893 3300005578 Bacteria 2295
204 Ga0068854_100758180 3300005578 Bacteria 842
205 Ga0068854_100832597 3300005578 Bacteria 806
206 Ga0068854_101260940 3300005578 Bacteria 664
207 Ga0068854_101853022 3300005578 Bacteria 554
208 Ga0070702_100011472 3300005615 Bacteria 4408
209 Ga0070702_100020816 3300005615 Bacteria 3442
210 Ga0070702_100276643 3300005615 Bacteria 1151
211 Ga0070702_100386439 3300005615 Bacteria 997
212 Ga0068852_100162491 3300005616 Bacteria 2086
213 Ga0068852_102268943 3300005616 Bacteria 564
214 Ga0068859_100139957 3300005617 Bacteria 2494
215 Ga0068859_100392249 3300005617 Bacteria 1484
216 Ga0068859_100503115 3300005617 Bacteria 1307
217 Ga0068859_100620354 3300005617 Bacteria 1174
218 Ga0068859_100691468 3300005617 Bacteria 1111
219 Ga0068859_100896314 3300005617 Bacteria 972
220 Ga0068859_100905409 3300005617 Bacteria 967
221 Ga0068859_102107141 3300005617 Bacteria 623
222 Ga0068864_100019800 3300005618 Bacteria 5626
223 Ga0068864_100053857 3300005618 Bacteria 3472
224 Ga0068864_100228708 3300005618 Bacteria 1719
225 Ga0068864_101373641 3300005618 Bacteria 708
226 Ga0068866_10036038 3300005718 Bacteria 2421
227 Ga0068866_10110477 3300005718 Bacteria 1533
228 Ga0068866_10675756 3300005718 Bacteria 706
229 Ga0068866_10726436 3300005718 Bacteria 684
230 Ga0068861_100009091 3300005719 Bacteria 6850
231 Ga0068861_100033722 3300005719 Bacteria 3780
232 Ga0068861_100034292 3300005719 Bacteria 3752
233 Ga0068861_100133863 3300005719 Bacteria 2015
234 Ga0068861_100140301 3300005719 Bacteria 1972
235 Ga0068861_100173354 3300005719 Bacteria 1789
236 Ga0068861_100296339 3300005719 Bacteria 1399
237 Ga0068861_100424974 3300005719 Bacteria 1185
238 Ga0068861_100693384 3300005719 Bacteria 945
239 Ga0068870_10002310 3300005840 Bacteria 7924
240 Ga0068870_10044675 3300005840 Bacteria 2316
241 Ga0068870_10053710 3300005840 Bacteria 2140
242 Ga0068870_10462106 3300005840 Bacteria 839
243 Ga0068870_10477476 3300005840 Bacteria 827
244 Ga0068863_100113905 3300005841 Bacteria 2576
245 Ga0068863_100292468 3300005841 Bacteria 1579
246 Ga0068863_100964527 3300005841 Bacteria 854
247 Ga0068863_101106419 3300005841 Bacteria 797
248 Ga0068863_101143695 3300005841 Unclassified 783
249 Ga0068863_101946318 3300005841 Bacteria 598
250 Ga0068863_102642931 3300005841 Bacteria 511
251 Ga0068858_100005836 3300005842 Bacteria 12027
252 Ga0068858_100023261 3300005842 Bacteria 5775
253 Ga0068858_100201330 3300005842 Bacteria 1883
254 Ga0068858_100231770 3300005842 Bacteria 1751
255 Ga0068860_100029497 3300005843 Bacteria 5278
256 Ga0068860_100046638 3300005843 Bacteria 4132
257 Ga0068860_100418461 3300005843 Bacteria 1328
258 Ga0068860_100543002 3300005843 Bacteria 1164
259 Ga0068860_100713908 3300005843 Bacteria 1013
260 Ga0068860_100874969 3300005843 Bacteria 914
261 Ga0068860_100904726 3300005843 Bacteria 899
262 Ga0068862_100128197 3300005844 Bacteria 2242
263 Ga0068862_100193183 3300005844 Bacteria 1833
264 Ga0068862_100246388 3300005844 Bacteria 1627
265 Ga0068862_100342701 3300005844 Bacteria 1385
266 Ga0068862_100372681 3300005844 Bacteria 1329
267 Ga0068862_100719449 3300005844 Bacteria 969
268 Ga0068862_101436801 3300005844 Bacteria 694
269 Ga0081455_10004385 3300005937 Bacteria 15894
270 Ga0081455_10006450 3300005937 Bacteria 12569
271 Ga0081538_10015699 3300005981 Bacteria 5848
272 Ga0081538_10036943 3300005981 Bacteria 3178
273 Ga0070717_11119478 3300006028 Bacteria 717
274 Ga0075365_10011977 3300006038 Bacteria 5125
275 Ga0075365_10050444 3300006038 Bacteria 2745
276 Ga0075365_10775439 3300006038 Bacteria 677
277 Ga0075363_100006440 3300006048 Bacteria 5333
278 Ga0075363_100330740 3300006048 Bacteria 887
279 Ga0075364_10173269 3300006051 Bacteria 1459
280 Ga0075432_10552234 3300006058 Bacteria 520
281 Ga0070715_10017981 3300006163 Bacteria 2686
282 Ga0070712_100183080 3300006175 Bacteria 1634
283 Ga0075362_10058135 3300006177 Bacteria 1744
284 Ga0075362_10086876 3300006177 Bacteria 1448
285 Ga0075362_10137611 3300006177 Bacteria 1166
286 Ga0075367_10006406 3300006178 Bacteria 5945
287 Ga0075367_10256038 3300006178 Bacteria 1098
288 Ga0075367_10482339 3300006178 Bacteria 786
289 Ga0075367_10848917 3300006178 Bacteria 582
290 Ga0075369_10096470 3300006186 Bacteria 1324
291 Ga0075369_10480281 3300006186 Bacteria 590
292 Ga0075366_10481327 3300006195 Bacteria 767
293 Ga0097621_100014001 3300006237 Bacteria 5992
294 Ga0097621_100197699 3300006237 Bacteria 1744
295 Ga0097621_100205331 3300006237 Bacteria 1712
296 Ga0097621_100912438 3300006237 Bacteria 819
297 Ga0097621_100966918 3300006237 Unclassified 795
298 Ga0075370_10069593 3300006353 Bacteria 2011
299 Ga0075370_10773796 3300006353 Bacteria 585
300 Ga0068871_100030159 3300006358 Bacteria 4268
301 Ga0068871_100274062 3300006358 Bacteria 1474
302 Ga0068871_100562601 3300006358 Bacteria 1034
303 Ga0068871_100974999 3300006358 Bacteria 788
304 Ga0068871_101588998 3300006358 Bacteria 619
305 Ga0068871_102080032 3300006358 Bacteria 541
306 Ga0075428_100088621 3300006844 Bacteria 3375
307 Ga0075428_100111490 3300006844 Bacteria 2980
308 Ga0075428_100165771 3300006844 Bacteria 2397
309 Ga0075428_100375310 3300006844 Bacteria 1525
310 Ga0075428_100674699 3300006844 Bacteria 1102
311 Ga0075430_100021899 3300006846 Bacteria 5431
312 Ga0075430_100161849 3300006846 Bacteria 1863
313 Ga0075430_100221187 3300006846 Bacteria 1571
314 Ga0075430_100324024 3300006846 Bacteria 1273
315 Ga0075430_101421549 3300006846 Bacteria 570
316 Ga0075431_100020076 3300006847 Bacteria 6823
317 Ga0075431_100024922 3300006847 Bacteria 6132
318 Ga0075431_100063780 3300006847 Bacteria 3803
319 Ga0075431_100102562 3300006847 Bacteria 2953
320 Ga0075431_100366567 3300006847 Bacteria 1446
321 Ga0075433_10072810 3300006852 Bacteria 3022
322 Ga0075434_100112818 3300006871 Bacteria 2730
323 Ga0075434_100278673 3300006871 Bacteria 1692
324 Ga0075434_100629395 3300006871 Bacteria 1092
325 Ga0075434_101053870 3300006871 Bacteria 827
326 Ga0075434_101521405 3300006871 Bacteria 678
327 Ga0075429_100000516 3300006880 Bacteria 29275
328 Ga0075429_100061796 3300006880 Bacteria 3263
329 Ga0075429_101426640 3300006880 Bacteria 603
330 Ga0068865_100101247 3300006881 Bacteria 2109
331 Ga0068865_100344279 3300006881 Bacteria 1206
332 Ga0097620_100139956 3300006931 Bacteria 2494
333 Ga0097620_100392299 3300006931 Bacteria 1484
334 Ga0097620_100503145 3300006931 Bacteria 1307
335 Ga0097620_100620283 3300006931 Bacteria 1174
336 Ga0097620_100691483 3300006931 Bacteria 1111
337 Ga0097620_100896301 3300006931 Bacteria 972
338 Ga0097620_100905368 3300006931 Bacteria 967
339 Ga0097620_102107088 3300006931 Bacteria 623
340 Ga0075435_100095165 3300007076 Bacteria 2463
341 Ga0099795_10000022 3300007788 Bacteria 52585
342 Ga0105250_10035451 3300009092 Bacteria 2001
343 Ga0111539_10025568 3300009094 Bacteria 7237
344 Ga0111539_10091488 3300009094 Bacteria 3574
345 Ga0111539_10470432 3300009094 Bacteria 1464
346 Ga0111539_10613229 3300009094 Bacteria 1267
347 Ga0111539_10717690 3300009094 Bacteria 1164
348 Ga0111539_10766076 3300009094 Bacteria 1123
349 Ga0111539_11158669 3300009094 Bacteria 898
350 Ga0111539_11981300 3300009094 Bacteria 675
351 Ga0105245_10138958 3300009098 Bacteria 2286
352 Ga0105247_10002316 3300009101 Bacteria 13011
353 Ga0105247_10017387 3300009101 Bacteria 4318
354 Ga0114129_10006246 3300009147 Bacteria 16890
355 Ga0114129_10040767 3300009147 Bacteria 6545
356 Ga0114129_10206847 3300009147 Bacteria 2655
357 Ga0114129_10373351 3300009147 Bacteria 1885
358 Ga0114129_10452513 3300009147 Bacteria 1684
359 Ga0114129_10779165 3300009147 Bacteria 1222
360 Ga0114129_11124000 3300009147 Bacteria 982
361 Ga0114129_11149003 3300009147 Bacteria 970
362 Ga0114129_11712671 3300009147 Bacteria 767
363 Ga0105243_10046925 3300009148 Bacteria 3400
364 Ga0105243_10300094 3300009148 Bacteria 1455
365 Ga0105243_10390765 3300009148 Bacteria 1289
366 Ga0105243_10762726 3300009148 Bacteria 950
367 Ga0105243_10834875 3300009148 Bacteria 911
368 Ga0105241_10411180 3300009174 Bacteria 1189
369 Ga0105241_10712673 3300009174 Bacteria 917
370 Ga0105242_10015964 3300009176 Bacteria 5836
371 Ga0105242_10261036 3300009176 Bacteria 1565
372 Ga0105242_13157271 3300009176 Bacteria 511
373 Ga0105248_10013593 3300009177 Bacteria 8961
374 Ga0105248_10031395 3300009177 Bacteria 5938
375 Ga0105248_10310970 3300009177 Bacteria 1774
376 Ga0105248_10373142 3300009177 Bacteria 1606
377 Ga0105248_10849747 3300009177 Bacteria 1030
378 Ga0105237_10157318 3300009545 Bacteria 2270
379 Ga0105237_11227353 3300009545 Bacteria 756
380 Ga0105238_10216685 3300009551 Bacteria 1890
381 Ga0105238_10315895 3300009551 Bacteria 1548
382 Ga0105238_10516766 3300009551 Bacteria 1196
383 Ga0105238_11734471 3300009551 Unclassified 656
384 Ga0105249_10046617 3300009553 Bacteria 3945
385 Ga0105249_10058640 3300009553 Bacteria 3529
386 Ga0105249_10572772 3300009553 Bacteria 1182
387 Ga0105249_10597082 3300009553 Bacteria 1158
388 Ga0105249_10773384 3300009553 Bacteria 1023
389 Ga0099796_10000153 3300010159 Bacteria 10219
390 Ga0105239_10926368 3300010375 Bacteria 1000
391 Ga0105246_10012857 3300011119 Bacteria 5234
392 Ga0105246_10147417 3300011119 Bacteria 1777
393 Ga0157341_1003637 3300012494 Bacteria 1085
394 Ga0157326_1010374 3300012513 Bacteria 1038
395 Ga0157326_1034287 3300012513 Bacteria 686
396 Ga0157373_10028056 3300013100 Bacteria 4062
397 Ga0157371_10448916 3300013102 Bacteria 948
398 Ga0157371_10716731 3300013102 Bacteria 750
399 Ga0157371_11025873 3300013102 Unclassified 630
400 Ga0157374_10484621 3300013296 Bacteria 1240
401 Ga0157374_12731598 3300013296 Bacteria 521
402 Ga0157378_10016082 3300013297 Bacteria 6553
403 Ga0157378_10242931 3300013297 Bacteria 1721
404 Ga0157378_11397435 3300013297 Bacteria 743
405 Ga0157378_12078554 3300013297 Bacteria 618
406 Ga0163162_10044564 3300013306 Bacteria 4443
407 Ga0163162_10057411 3300013306 Bacteria 3920
408 Ga0163162_11160413 3300013306 Bacteria 876
409 Ga0163162_11379610 3300013306 Bacteria 802
410 Ga0163162_11828480 3300013306 Bacteria 695
411 Ga0163162_11866294 3300013306 Bacteria 688
412 Ga0157372_10007051 3300013307 Bacteria 11969
413 Ga0157372_10888523 3300013307 Bacteria 1034
414 Ga0157375_10102597 3300013308 Bacteria 2946
415 Ga0157375_10972892 3300013308 Unclassified 989
416 Ga0157375_11274581 3300013308 Bacteria 863
417 Ga0157375_13115047 3300013308 Bacteria 553
418 Ga0163163_10267597 3300014325 Bacteria 1760
419 Ga0163163_10271568 3300014325 Bacteria 1747
420 Ga0163163_10891707 3300014325 Bacteria 953
421 Ga0157380_10053038 3300014326 Bacteria 3213
422 Ga0157380_10099751 3300014326 Bacteria 2416
423 Ga0157380_10121023 3300014326 Bacteria 2217
424 Ga0157380_10171516 3300014326 Bacteria 1896
425 Ga0157380_10343883 3300014326 Bacteria 1393
426 Ga0157380_10422125 3300014326 Bacteria 1272
427 Ga0157380_10510970 3300014326 Bacteria 1169
428 Ga0157380_10863907 3300014326 Bacteria 928
429 Ga0157380_10869019 3300014326 Bacteria 925
430 Ga0157380_11203236 3300014326 Bacteria 801
431 Ga0157380_11254780 3300014326 Bacteria 787
432 Ga0157380_11878385 3300014326 Bacteria 659
433 Ga0182008_10088724 3300014497 Bacteria 1524
434 Ga0182008_10192751 3300014497 Bacteria 1035
435 Ga0157377_10060707 3300014745 Bacteria 2159
436 Ga0157377_10078011 3300014745 Bacteria 1930
437 Ga0157379_10013529 3300014968 Bacteria 7151
438 Ga0157379_10053782 3300014968 Unclassified 3597
439 Ga0157379_10347170 3300014968 Bacteria 1358
440 Ga0157379_10561869 3300014968 Unclassified 1062
441 Ga0157379_10643133 3300014968 Bacteria 992
442 Ga0157379_10666387 3300014968 Bacteria 975
443 Ga0157379_11296301 3300014968 Unclassified 703
444 Ga0157379_12498597 3300014968 Bacteria 516
445 Ga0157376_10028966 3300014969 Bacteria 4408
446 Ga0157376_10045197 3300014969 Bacteria 3624
447 Ga0157376_10460957 3300014969 Bacteria 1242
448 Ga0157376_10507449 3300014969 Unclassified 1186
449 Ga0157376_11985290 3300014969 Unclassified 619
450 Ga0182006_1071938 3300015261 Bacteria 1280
451 Ga0182007_10045579 3300015262 Bacteria 1453
452 Ga0182007_10047438 3300015262 Bacteria 1421
453 Ga0182007_10151356 3300015262 Bacteria 789
454 Ga0163161_10035357 3300017792 Bacteria 3576
455 Ga0163161_10089587 3300017792 Bacteria 2276
456 Ga0163161_10261797 3300017792 Bacteria 1351
457 Ga0163161_10767451 3300017792 Unclassified 808
458 Ga0207638_1003840 3300025227 Bacteria 610
459 Ga0209758_1018310 3300025297 Bacteria 3441
460 Ga0207697_10548945 3300025315 Bacteria 508
461 Ga0207682_10003239 3300025893 Bacteria 7121
462 Ga0207682_10023027 3300025893 Bacteria 2458
463 Ga0207642_10036811 3300025899 Bacteria 2103
464 Ga0207642_10216771 3300025899 Bacteria 1067
465 Ga0207642_10325115 3300025899 Bacteria 899
466 Ga0207642_10494725 3300025899 Bacteria 748
467 Ga0207710_10074811 3300025900 Bacteria 1560
468 Ga0207688_10000283 3300025901 Bacteria 23210
469 Ga0207688_10133948 3300025901 Bacteria 1454
470 Ga0207680_10088104 3300025903 Bacteria 1967
471 Ga0207680_10312532 3300025903 Bacteria 1097
472 Ga0207647_10008609 3300025904 Bacteria 7303
473 Ga0207647_10288886 3300025904 Bacteria 935
474 Ga0207685_10011195 3300025905 Bacteria 2685
475 Ga0207645_10004284 3300025907 Bacteria 10588
476 Ga0207645_10075319 3300025907 Bacteria 2160
477 Ga0207645_10149060 3300025907 Bacteria 1526
478 Ga0207645_10374439 3300025907 Bacteria 955
479 Ga0207645_10858230 3300025907 Bacteria 617
480 Ga0207643_10000615 3300025908 Bacteria 22480
481 Ga0207643_10038281 3300025908 Bacteria 2693
482 Ga0207643_10089816 3300025908 Bacteria 1790
483 Ga0207643_10110027 3300025908 Bacteria 1623
484 Ga0207643_10713642 3300025908 Bacteria 648
485 Ga0207707_10099173 3300025912 Bacteria 2546
486 Ga0207671_10481807 3300025914 Bacteria 989
487 Ga0207671_10731091 3300025914 Bacteria 786
488 Ga0207663_10197530 3300025916 Bacteria 1449
489 Ga0207662_10002182 3300025918 Bacteria 9762
490 Ga0207662_10019443 3300025918 Bacteria 3865
491 Ga0207662_10157989 3300025918 Bacteria 1447
492 Ga0207662_10267689 3300025918 Unclassified 1127
493 Ga0207657_10111144 3300025919 Bacteria 2263
494 Ga0207657_10816507 3300025919 Bacteria 720
495 Ga0207649_10974225 3300025920 Bacteria 667
496 Ga0207649_11129601 3300025920 Bacteria 618
497 Ga0207652_10089380 3300025921 Bacteria 2705
498 Ga0207652_11197203 3300025921 Bacteria 661
499 Ga0207646_10935093 3300025922 Unclassified 768
500 Ga0207681_10019540 3300025923 Bacteria 4282
501 Ga0207681_10032108 3300025923 Bacteria 3436
502 Ga0207681_10103416 3300025923 Bacteria 2058
503 Ga0207681_10339484 3300025923 Bacteria 1199
504 Ga0207681_10691224 3300025923 Bacteria 848
505 Ga0207681_10701050 3300025923 Bacteria 842
506 Ga0207694_10557457 3300025924 Bacteria 962
507 Ga0207694_10613141 3300025924 Bacteria 915
508 Ga0207694_10954270 3300025924 Bacteria 725
509 Ga0207694_11052464 3300025924 Bacteria 689
510 Ga0207650_10043430 3300025925 Bacteria 3299
511 Ga0207650_10144074 3300025925 Bacteria 1875
512 Ga0207650_10163106 3300025925 Bacteria 1767
513 Ga0207659_10160130 3300025926 Bacteria 1766
514 Ga0207659_10509646 3300025926 Bacteria 1019
515 Ga0207659_11630553 3300025926 Bacteria 550
516 Ga0207659_11729908 3300025926 Unclassified 532
517 Ga0207690_10015285 3300025932 Bacteria 4647
518 Ga0207690_10024268 3300025932 Bacteria 3796
519 Ga0207690_10313276 3300025932 Bacteria 1231
520 Ga0207690_10409627 3300025932 Bacteria 1083
521 Ga0207706_10011257 3300025933 Bacteria 8155
522 Ga0207706_10025823 3300025933 Bacteria 5261
523 Ga0207706_10083579 3300025933 Bacteria 2807
524 Ga0207706_10097236 3300025933 Bacteria 2589
525 Ga0207706_10192645 3300025933 Bacteria 1789
526 Ga0207706_10232699 3300025933 Bacteria 1612
527 Ga0207706_10371654 3300025933 Bacteria 1241
528 Ga0207706_10489218 3300025933 Bacteria 1062
529 Ga0207706_10939280 3300025933 Bacteria 729
530 Ga0207706_11690729 3300025933 Unclassified 510
531 Ga0207686_10025970 3300025934 Bacteria 3414
532 Ga0207686_10802782 3300025934 Bacteria 754
533 Ga0207709_10039886 3300025935 Bacteria 2808
534 Ga0207709_10258863 3300025935 Bacteria 1275
535 Ga0207709_10259269 3300025935 Bacteria 1274
536 Ga0207709_11378050 3300025935 Bacteria 584
537 Ga0207670_10040465 3300025936 Bacteria 3059
538 Ga0207670_10091205 3300025936 Bacteria 2154
539 Ga0207670_10136471 3300025936 Bacteria 1804
540 Ga0207670_10203833 3300025936 Bacteria 1504
541 Ga0207669_10008898 3300025937 Bacteria 4743
542 Ga0207669_10033296 3300025937 Bacteria 2906
543 Ga0207669_10124508 3300025937 Bacteria 1758
544 Ga0207669_10818753 3300025937 Bacteria 773
545 Ga0207669_11571520 3300025937 Bacteria 561
546 Ga0207704_10009089 3300025938 Bacteria 4778
547 Ga0207704_10071029 3300025938 Bacteria 2207
548 Ga0207704_10156445 3300025938 Bacteria 1616
549 Ga0207704_10362465 3300025938 Bacteria 1132
550 Ga0207704_10417450 3300025938 Bacteria 1063
551 Ga0207704_10480390 3300025938 Bacteria 997
552 Ga0207704_10935495 3300025938 Unclassified 730
553 Ga0207665_10123760 3300025939 Bacteria 1829
554 Ga0207691_10001340 3300025940 Bacteria 24566
555 Ga0207691_10005505 3300025940 Bacteria 12237
556 Ga0207691_10008332 3300025940 Bacteria 9956
557 Ga0207691_10009993 3300025940 Bacteria 9113
558 Ga0207691_10072598 3300025940 Bacteria 3104
559 Ga0207691_10170907 3300025940 Bacteria 1903
560 Ga0207691_10367487 3300025940 Bacteria 1229
561 Ga0207691_10440963 3300025940 Bacteria 1109
562 Ga0207691_10444171 3300025940 Bacteria 1104
563 Ga0207711_10046436 3300025941 Bacteria 3711
564 Ga0207711_10053060 3300025941 Bacteria 3477
565 Ga0207711_10132630 3300025941 Bacteria 2235
566 Ga0207711_10289652 3300025941 Bacteria 1509
567 Ga0207711_10577632 3300025941 Bacteria 1048
568 Ga0207711_10981813 3300025941 Bacteria 784
569 Ga0207689_10009385 3300025942 Bacteria 8452
570 Ga0207689_10087974 3300025942 Bacteria 2552
571 Ga0207689_11537481 3300025942 Unclassified 555
572 Ga0207689_11744840 3300025942 Unclassified 515
573 Ga0207679_10959545 3300025945 Bacteria 783
574 Ga0207679_11140419 3300025945 Bacteria 715
575 Ga0207651_10008440 3300025960 Bacteria 5565
576 Ga0207651_10168645 3300025960 Bacteria 1724
577 Ga0207651_10224327 3300025960 Bacteria 1521
578 Ga0207651_10572169 3300025960 Bacteria 985
579 Ga0207651_10661013 3300025960 Bacteria 918
580 Ga0207651_10919728 3300025960 Bacteria 779
581 Ga0207712_10060130 3300025961 Bacteria 2692
582 Ga0207712_10112492 3300025961 Bacteria 2044
583 Ga0207712_10121386 3300025961 Bacteria 1978
584 Ga0207712_11519808 3300025961 Bacteria 600
585 Ga0207668_10009499 3300025972 Bacteria 5835
586 Ga0207668_10070567 3300025972 Bacteria 2492
587 Ga0207668_10235326 3300025972 Bacteria 1479
588 Ga0207668_10648104 3300025972 Bacteria 924
589 Ga0207668_10871932 3300025972 Bacteria 800
590 Ga0207668_11036018 3300025972 Bacteria 734
591 Ga0207668_11165618 3300025972 Bacteria 692
592 Ga0207640_10085407 3300025981 Bacteria 2170
593 Ga0207640_10101516 3300025981 Bacteria 2019
594 Ga0207640_10327720 3300025981 Bacteria 1222
595 Ga0207640_10734150 3300025981 Bacteria 850
596 Ga0207640_10761161 3300025981 Bacteria 836
597 Ga0207640_10954915 3300025981 Bacteria 752
598 Ga0207658_10000197 3300025986 Bacteria 63743
599 Ga0207658_10734154 3300025986 Bacteria 894
600 Ga0207677_10154074 3300026023 Bacteria 1777
601 Ga0207677_10704384 3300026023 Bacteria 896
602 Ga0207677_12016001 3300026023 Unclassified 536
603 Ga0207703_10096065 3300026035 Bacteria 2501
604 Ga0207703_10167161 3300026035 Bacteria 1931
605 Ga0207703_10422123 3300026035 Bacteria 1241
606 Ga0207703_11054795 3300026035 Bacteria 780
607 Ga0207703_11380736 3300026035 Bacteria 678
608 Ga0207678_10246095 3300026067 Bacteria 1531
609 Ga0207678_10512222 3300026067 Bacteria 1047
610 Ga0207708_10003436 3300026075 Bacteria 11669
611 Ga0207708_10029898 3300026075 Bacteria 4131
612 Ga0207708_10091093 3300026075 Bacteria 2351
613 Ga0207708_10132218 3300026075 Bacteria 1952
614 Ga0207708_10180197 3300026075 Bacteria 1677
615 Ga0207702_10189450 3300026078 Bacteria 1899
616 Ga0207641_10017045 3300026088 Bacteria 5945
617 Ga0207641_10183121 3300026088 Bacteria 1920
618 Ga0207641_10254176 3300026088 Bacteria 1642
619 Ga0207641_10859732 3300026088 Bacteria 899
620 Ga0207641_11307783 3300026088 Bacteria 725
621 Ga0207648_10006798 3300026089 Bacteria 11340
622 Ga0207648_10010221 3300026089 Bacteria 8921
623 Ga0207648_10022150 3300026089 Bacteria 5708
624 Ga0207648_10065638 3300026089 Bacteria 3164
625 Ga0207648_10125085 3300026089 Bacteria 2261
626 Ga0207648_10208303 3300026089 Bacteria 1735
627 Ga0207648_10641701 3300026089 Bacteria 981
628 Ga0207676_10023885 3300026095 Bacteria 4518
629 Ga0207676_10298808 3300026095 Bacteria 1469
630 Ga0207676_10365983 3300026095 Bacteria 1338
631 Ga0207674_10063658 3300026116 Bacteria 3723
632 Ga0207674_10094187 3300026116 Bacteria 2982
633 Ga0207674_10923396 3300026116 Bacteria 841
634 Ga0207675_100006775 3300026118 Bacteria 10836
635 Ga0207675_100018555 3300026118 Bacteria 6490
636 Ga0207675_100028532 3300026118 Bacteria 5197
637 Ga0207675_100055390 3300026118 Bacteria 3699
638 Ga0207675_100070045 3300026118 Bacteria 3278
639 Ga0207675_100096188 3300026118 Bacteria 2788
640 Ga0207675_100187573 3300026118 Bacteria 1982
641 Ga0207675_100494449 3300026118 Bacteria 1217
642 Ga0207675_102019977 3300026118 Bacteria 594
643 Ga0207683_10028583 3300026121 Bacteria 4823
644 Ga0207683_10059345 3300026121 Bacteria 3361
645 Ga0207683_10206023 3300026121 Bacteria 1789
646 Ga0207683_10214207 3300026121 Bacteria 1754
647 Ga0207683_10394443 3300026121 Bacteria 1273
648 Ga0207683_10524950 3300026121 Bacteria 1094
649 Ga0207683_11035767 3300026121 Bacteria 762
650 Ga0207683_11589114 3300026121 Bacteria 603
651 Ga0207698_10513602 3300026142 Bacteria 1168
652 Ga0207698_11103328 3300026142 Bacteria 806
653 Ga0207698_12312798 3300026142 Bacteria 549
654 Ga0210000_1016949 3300027462 Bacteria 1102
655 Ga0209968_1054170 3300027526 Bacteria 700
656 Ga0209970_1007302 3300027614 Bacteria 1811
657 Ga0210002_1018709 3300027617 Bacteria 1109
658 Ga0209971_1008263 3300027682 Bacteria 2467
659 Ga0209971_1072879 3300027682 Bacteria 834
660 Ga0209966_1015446 3300027695 Bacteria 1434
661 Ga0209966_1064389 3300027695 Bacteria 796
662 Ga0209998_10007799 3300027717 Bacteria 2222
663 Ga0209974_10042439 3300027876 Bacteria 1514
664 Ga0209974_10128081 3300027876 Bacteria 904
665 Ga0207428_10156321 3300027907 Bacteria 1734
666 Ga0207428_10221566 3300027907 Bacteria 1418
667 Ga0207428_10326338 3300027907 Bacteria 1133
668 Ga0268266_10080203 3300028379 Bacteria 2843
669 Ga0268266_10237482 3300028379 Bacteria 1681
670 Ga0268266_10472430 3300028379 Bacteria 1194
671 Ga0268266_11790717 3300028379 Bacteria 589
672 Ga0268265_10073416 3300028380 Bacteria 2672
673 Ga0268265_10087869 3300028380 Bacteria 2475
674 Ga0268265_10485084 3300028380 Bacteria 1162
675 Ga0268265_10498585 3300028380 Bacteria 1147
676 Ga0268265_10531940 3300028380 Bacteria 1113
677 Ga0268265_10717636 3300028380 Bacteria 967
678 Ga0268265_12095664 3300028380 Bacteria 573
679 Ga0268264_10019390 3300028381 Bacteria 5559
680 Ga0268264_10084470 3300028381 Bacteria 2722
681 Ga0268264_10133590 3300028381 Bacteria 2204
682 Ga0265336_10076650 3300028666 Bacteria 999
683 Ga0307517_10228870 3300028786 Bacteria 1119
684 Ga0307515_10000358 3300028794 Bacteria 112133
685 Ga0307515_10293201 3300028794 Bacteria 1320
686 Ga0307511_10344090 3300030521 Bacteria 645
687 Ga0307513_10031619 3300031456 Bacteria 5991
688 Ga0307513_10076534 3300031456 Bacteria 3470
689 Ga0307408_100041613 3300031548 Bacteria 3258
690 Ga0307408_100050815 3300031548 Bacteria 2983
691 Ga0307408_100280122 3300031548 Unclassified 1388
692 Ga0307408_101174283 3300031548 Bacteria 715
693 Ga0316575_10054229 3300031665 Bacteria 1597
694 Ga0316579_10046748 3300031691 Bacteria 2020
695 Ga0316576_10167592 3300031727 Bacteria 1657
696 Ga0316578_10072822 3300031728 Bacteria 2035
697 Ga0307516_10824918 3300031730 Bacteria 590
698 Ga0307405_10112123 3300031731 Bacteria 1850
699 Ga0307405_10112223 3300031731 Bacteria 1849
700 Ga0307405_10314844 3300031731 Bacteria 1193
701 Ga0307405_11443449 3300031731 Bacteria 603
702 Ga0316577_10016044 3300031733 Bacteria 4123
703 Ga0307413_10009445 3300031824 Bacteria 4670
704 Ga0307413_10147138 3300031824 Bacteria 1636
705 Ga0307410_10027077 3300031852 Bacteria 3619
706 Ga0307410_11196331 3300031852 Unclassified 662
707 Ga0307406_10011667 3300031901 Bacteria 4988
708 Ga0307406_10310814 3300031901 Unclassified 1215
709 Ga0307406_12021221 3300031901 Bacteria 515
710 Ga0307407_10012375 3300031903 Bacteria 4098
711 Ga0307407_10205972 3300031903 Bacteria 1321
712 Ga0307407_10338632 3300031903 Unclassified 1061
713 Ga0307412_10109505 3300031911 Bacteria 1969
714 Ga0307412_10343604 3300031911 Unclassified 1195
715 Ga0307412_11011721 3300031911 Bacteria 735
716 Ga0307412_11738684 3300031911 Bacteria 572
717 Ga0307409_100030472 3300031995 Bacteria 3876
718 Ga0307409_100072272 3300031995 Bacteria 2746
719 Ga0307409_100094227 3300031995 Bacteria 2463
720 Ga0307416_100007315 3300032002 Bacteria 7006
721 Ga0307416_100094520 3300032002 Unclassified 2578
722 Ga0307416_100446731 3300032002 Bacteria 1344
723 Ga0307414_10497157 3300032004 Bacteria 1078
724 Ga0307414_10906003 3300032004 Unclassified 809
725 Ga0307411_10009093 3300032005 Bacteria 5199
726 Ga0307411_10081837 3300032005 Bacteria 2225
727 Ga0307411_10314037 3300032005 Bacteria 1262
728 Ga0307411_10385597 3300032005 Bacteria 1154
729 Ga0307411_10742234 3300032005 Bacteria 859
730 Ga0307415_100025640 3300032126 Bacteria 3704
731 Ga0307415_100748194 3300032126 Bacteria 887
732 Ga0307415_101938870 3300032126 Bacteria 572
733 Ga0316585_10010265 3300032137 Bacteria 2746
734 Ga0316580_10049611 3300032139 Bacteria 1293
735 Ga0373958_0191400 3300034819 Bacteria 532
736 Ga0373928_0150689 3300035084 Bacteria 644
737 Ga0373961_0182157 3300035241 Bacteria 732
738 Ga0316574_0079917 3300035398 Bacteria 2074
739 Ga0373931_0357414 3300035691 Bacteria 916
740 Ga0373931_0452931 3300035691 Bacteria 821
741 Ga0316584_0229151 3300036712 Bacteria 1362
742 Ga0373925_0463292 3300037068 Bacteria 1039
743 Ga0439465_0281421 3300041413 Bacteria 620
744 Ga0451791_0408146 3300041451 Bacteria 2761
745 Ga0451791_1109250 3300041451 Bacteria 1818
746 Ga0451793_1139976 3300041452 Unclassified 573
747 Ga0451793_1266290 3300041452 Bacteria 964
748 Ga0451797_1322930 3300041453 Bacteria 2125
749 Ga0451800_0205198 3300041459 Bacteria 1169
750 Ga0451802_0332107 3300041460 Bacteria 1238
751 Ga0451807_0568058 3300041486 Bacteria 2713
752 Ga0451807_2422974 3300041486 Bacteria 929
753 Ga0451807_2604943 3300041486 Bacteria 1053
754 Ga0451837_1029966 3300041494 Bacteria 3320
755 Ga0451853_2805711 3300041512 Unclassified 543
756 Ga0451853_3090388 3300041512 Bacteria 597
757 Ga0451853_3458144 3300041512 Bacteria 1738
758 Ga0451853_3968423 3300041512 Bacteria 1138
759 Ga0439441_002708 3300042001 Bacteria 2524
760 Ga0439445_0057312 3300042004 Unclassified 1060
761 Ga0439434_0122921 3300042435 Bacteria 847
762 Ga0439444_0086875 3300042437 Bacteria 692
763 Ga0439459_0195351 3300042438 Bacteria 550
764 Ga0439460_0087242 3300042461 Bacteria 987
765 Ga0451577_0120548 3300042876 Bacteria 2349
766 Ga0451577_0141480 3300042876 Unclassified 2162
767 Ga0453684_0121922 3300044712 Bacteria 3146
768 Ga0453684_1138063 3300044712 Unclassified 823
769 Ga0453684_2369017 3300044712 Bacteria 526
770 Ga0451576_0732517 3300045051 Bacteria 1039
771 Ga0451576_1684726 3300045051 Bacteria 657
772 Ga0495627_215332 3300046453 Bacteria 528
773 Ga0495592_0567717 3300046454 Bacteria 696
774 Ga0495590_0005899 3300046457 Bacteria 4806
775 Ga0495638_0031603 3300046460 Bacteria 3401
776 Ga0495641_0296405 3300046461 Bacteria 729
777 Ga0495650_0087027 3300046471 Bacteria 1195
778 Ga0495580_0398656 3300046472 Bacteria 928
779 Ga0495639_0047934 3300046475 Bacteria 1937
780 Ga0495584_0711558 3300046491 Bacteria 512
781 Ga0495585_0080608 3300046492 Bacteria 1764
782 Ga0495585_0105295 3300046492 Bacteria 1505
783 Ga0495585_0360636 3300046492 Bacteria 705
784 Ga0495616_0156341 3300046513 Bacteria 1028
785 Ga0495618_0118886 3300046514 Bacteria 1693
786 Ga0495620_0129520 3300046515 Bacteria 991
787 Ga0495628_0229858 3300046516 Bacteria 1391
788 Ga0495632_0088149 3300046519 Bacteria 1474
789 Ga0495632_0273994 3300046519 Bacteria 752
790 Ga0495637_0017363 3300046520 Bacteria 3355
791 Ga0495644_0345835 3300046523 Bacteria 585
792 Ga0495663_0037513 3300046525 Bacteria 1462
793 Ga0495652_0186082 3300046529 Bacteria 1589
794 Ga0495640_0574015 3300046533 Bacteria 683
795 Ga0495587_0169715 3300046536 Bacteria 1240
796 Ga0495587_0394923 3300046536 Bacteria 769
797 Ga0495621_0002870 3300046539 Bacteria 4694
798 Ga0495621_0153108 3300046539 Bacteria 908
799 Ga0495621_0275249 3300046539 Bacteria 693
800 Ga0495667_0155994 3300046559 Bacteria 1469
801 Ga0495656_0075175 3300046615 Bacteria 1511
802 Ga0495656_0087629 3300046615 Bacteria 1418
803 Ga0495668_0374095 3300046616 Bacteria 782
804 Ga0495611_0338941 3300046648 Bacteria 691
805 Ga0495625_0060202 3300046660 Bacteria 2691
806 Ga0495625_0077317 3300046660 Bacteria 2326
807 Ga0495625_0081023 3300046660 Bacteria 2260
808 Ga0495635_0362707 3300046663 Bacteria 966
809 Ga0495659_0107385 3300046664 Bacteria 1087
810 Ga0495661_0214993 3300046665 Bacteria 999
811 Ga0495599_0237946 3300046678 Bacteria 1111
812 Ga0495599_0420483 3300046678 Bacteria 794
813 Ga0495670_0435474 3300046691 Bacteria 710
814 Ga0495649_0506525 3300046694 Bacteria 600
815 Ga0495649_0537546 3300046694 Bacteria 579
816 Ga0495581_0820107 3300047315 Bacteria 533
817 Ga0495604_0119888 3300047317 Bacteria 1906
818 Ga0495604_0771887 3300047317 Bacteria 607
819 Ga0495685_019324 3300047447 Bacteria 2341
820 Ga0495684_0817617 3300047471 Bacteria 607
821 Ga0495602_0368870 3300048088 Bacteria 1031
822 Ga0495615_0047193 3300048090 Bacteria 1097
823 Ga0495626_0116094 3300048091 Bacteria 1155
824 Ga0496100_0004400 3300048903 Bacteria 7463
825 Ga0496100_0182201 3300048903 Bacteria 1519
826 Ga0496102_0095979 3300048905 Bacteria 2748
827 Ga0496102_1275242 3300048905 Bacteria 654
828 Ga0496103_0026288 3300048906 Bacteria 3523
829 Ga0496103_0991334 3300048906 Bacteria 523
830 Ga0496104_0004927 3300048907 Bacteria 11647
831 Ga0496104_0090195 3300048907 Bacteria 2929
832 Ga0496104_0294739 3300048907 Bacteria 1535
833 Ga0496105_0010453 3300048908 Bacteria 7296
834 Ga0496105_0219291 3300048908 Bacteria 1549
835 Ga0496105_0721191 3300048908 Bacteria 764
836 Ga0496106_0018018 3300048909 Bacteria 5221
837 Ga0496106_0073320 3300048909 Bacteria 2619
838 Ga0496107_0001216 3300048910 Bacteria 15691
839 Ga0496107_0122677 3300048910 Bacteria 1914
840 Ga0496108_0001982 3300048911 Bacteria 16387
841 Ga0496109_0000633 3300048912 Bacteria 29328
842 Ga0496109_0111219 3300048912 Bacteria 2547
843 Ga0496109_0923270 3300048912 Bacteria 811
844 Ga0496110_0007585 3300048913 Bacteria 8669
845 Ga0496110_0682383 3300048913 Bacteria 928
846 Ga0496111_0006790 3300048914 Bacteria 7459
847 Ga0496111_0097382 3300048914 Bacteria 2159
848 Ga0496112_0000400 3300048915 Bacteria 28343
849 Ga0496112_0612154 3300048915 Bacteria 1020
850 Ga0496112_1148832 3300048915 Bacteria 694
851 Ga0496113_0005600 3300048916 Bacteria 7856
852 Ga0496113_0051586 3300048916 Bacteria 3070
853 Ga0496114_0204233 3300048917 Bacteria 1731
854 Ga0496114_0272876 3300048917 Bacteria 1490
855 Ga0496114_0274173 3300048917 Bacteria 1487
856 Ga0496114_0874533 3300048917 Bacteria 779
857 Ga0496115_0022318 3300048918 Bacteria 4902
858 Ga0496116_0152320 3300048919 Bacteria 1282
859 Ga0496117_0316061 3300048920 Bacteria 820
860 Ga0496118_0018464 3300048921 Bacteria 6293
861 Ga0496121_0105333 3300048924 Bacteria 2165
862 Ga0496122_0096002 3300048925 Bacteria 2001
863 Ga0496123_0100612 3300048926 Bacteria 1683
864 Ga0496124_0151279 3300048927 Bacteria 1820
865 Ga0496125_0000164 3300048928 Bacteria 147789
866 Ga0495678_163843 3300049459 Bacteria 709
867 Ga0501297_075804 3300049520 Unclassified 538
868 Ga0501031_0274551 3300049568 Bacteria 1094
869 Ga0501032_0014842 3300049569 Bacteria 5513
870 Ga0501032_0978080 3300049569 Bacteria 532
871 Ga0501033_0021211 3300049570 Bacteria 4901
872 Ga0501033_0179021 3300049570 Bacteria 1520
873 Ga0501033_0848342 3300049570 Bacteria 616
874 Ga0501036_0015220 3300049572 Bacteria 6423
875 Ga0501036_0041878 3300049572 Bacteria 3876
876 Ga0501036_0504276 3300049572 Bacteria 1007
877 Ga0501036_0521226 3300049572 Bacteria 988
878 Ga0501036_0922313 3300049572 Bacteria 716
879 Ga0501036_1068057 3300049572 Bacteria 660
880 Ga0501036_1086425 3300049572 Bacteria 654
881 Ga0501036_1267287 3300049572 Bacteria 600
882 Ga0501037_0796547 3300049573 Bacteria 624
883 Ga0501038_0020300 3300049574 Bacteria 5976
884 Ga0501038_0169293 3300049574 Bacteria 1770
885 Ga0501038_1221805 3300049574 Bacteria 545
886 Ga0501039_0058792 3300049575 Bacteria 2978
887 Ga0501039_0120483 3300049575 Bacteria 2056
888 Ga0501039_0527053 3300049575 Bacteria 927
889 Ga0501039_1028680 3300049575 Bacteria 639
890 Ga0501039_1317651 3300049575 Bacteria 557
891 Ga0501040_0010290 3300049576 Bacteria 6117
892 Ga0501040_0070046 3300049576 Bacteria 2420
893 Ga0501040_1041791 3300049576 Bacteria 593
894 Ga0501040_1347065 3300049576 Bacteria 518
895 Ga0501041_0033240 3300049577 Bacteria 3120
896 Ga0501041_0033891 3300049577 Bacteria 3090
897 Ga0501041_0429632 3300049577 Bacteria 838
898 Ga0501041_0447645 3300049577 Bacteria 820
899 Ga0501042_0035033 3300049578 Bacteria 3561
900 Ga0501042_0051674 3300049578 Bacteria 2932
901 Ga0501042_0519598 3300049578 Bacteria 865
902 Ga0501042_0600514 3300049578 Bacteria 800
903 Ga0501042_0601326 3300049578 Bacteria 800
904 Ga0501042_0606226 3300049578 Bacteria 796
905 Ga0501042_1055765 3300049578 Bacteria 592
906 Ga0501043_0259897 3300049579 Bacteria 1336
907 Ga0501043_0753301 3300049579 Bacteria 708
908 Ga0501046_0154988 3300049580 Bacteria 1726
909 Ga0501046_0166832 3300049580 Bacteria 1654
910 Ga0501046_0257553 3300049580 Bacteria 1283
911 Ga0501048_0058949 3300049582 Bacteria 2720
912 Ga0501048_0227922 3300049582 Bacteria 1322
913 Ga0501067_0173646 3300049583 Bacteria 1200
914 Ga0501068_0025220 3300049584 Bacteria 3497
915 Ga0501068_0046874 3300049584 Bacteria 2606
916 Ga0501068_0253447 3300049584 Bacteria 1122
917 Ga0501068_0668236 3300049584 Bacteria 679
918 Ga0501069_0017872 3300049585 Bacteria 3824
919 Ga0501069_0130668 3300049585 Bacteria 1438
920 Ga0501070_0084140 3300049586 Bacteria 2634
921 Ga0501070_0314163 3300049586 Bacteria 1275
922 Ga0501071_0038731 3300049587 Bacteria 3407
923 Ga0501071_0085395 3300049587 Bacteria 2314
924 Ga0501071_0392564 3300049587 Bacteria 1059
925 Ga0501072_0003174 3300049588 Bacteria 12358
926 Ga0501072_0197503 3300049588 Bacteria 1604
927 Ga0501072_0244921 3300049588 Bacteria 1428
928 Ga0501072_0300167 3300049588 Bacteria 1277
929 Ga0501072_0301214 3300049588 Bacteria 1274
930 Ga0501073_0062627 3300049589 Bacteria 2594
931 Ga0501073_0162868 3300049589 Bacteria 1545
932 Ga0501073_0408892 3300049589 Bacteria 938
933 Ga0501074_0055255 3300049590 Bacteria 2862
934 Ga0501074_0119587 3300049590 Bacteria 1884
935 Ga0501074_0285423 3300049590 Bacteria 1173
936 Ga0501074_0379355 3300049590 Bacteria 1003
937 Ga0501074_0543277 3300049590 Bacteria 823
938 Ga0501074_1141699 3300049590 Bacteria 547
939 Ga0501075_0008080 3300049591 Bacteria 7317
940 Ga0501075_0102482 3300049591 Bacteria 2174
941 Ga0501075_0129719 3300049591 Bacteria 1921
942 Ga0501075_0150567 3300049591 Bacteria 1774
943 Ga0501075_0279702 3300049591 Bacteria 1272
944 Ga0501075_0310909 3300049591 Bacteria 1201
945 Ga0501075_0498458 3300049591 Bacteria 929
946 Ga0501075_0661431 3300049591 Bacteria 796
947 Ga0501075_1122258 3300049591 Bacteria 597
948 Ga0501075_1311480 3300049591 Bacteria 549
949 Ga0501076_0037327 3300049592 Bacteria 3809
950 Ga0501076_0045487 3300049592 Bacteria 3466
951 Ga0501076_0057885 3300049592 Bacteria 3079
952 Ga0501076_0247013 3300049592 Bacteria 1460
953 Ga0501076_0362875 3300049592 Bacteria 1190
954 Ga0501076_0483046 3300049592 Bacteria 1021
955 Ga0501076_0543079 3300049592 Bacteria 958
956 Ga0501076_0959496 3300049592 Bacteria 705
957 Ga0501076_0990532 3300049592 Bacteria 692
958 Ga0501077_0009972 3300049593 Bacteria 5912
959 Ga0501077_0061225 3300049593 Bacteria 2388
960 Ga0501077_0226965 3300049593 Bacteria 1187
961 Ga0501077_0280574 3300049593 Bacteria 1060
962 Ga0501077_0305632 3300049593 Bacteria 1013
963 Ga0501077_0386524 3300049593 Bacteria 894
964 Ga0501077_0452288 3300049593 Bacteria 822
965 Ga0501079_0106401 3300049741 Bacteria 2177
966 Ga0501079_0252495 3300049741 Bacteria 1378
967 Ga0501079_0317593 3300049741 Bacteria 1219
968 Ga0501079_0462419 3300049741 Bacteria 996
969 Ga0501079_0468376 3300049741 Bacteria 990
970 Ga0501079_0567044 3300049741 Bacteria 893
971 Ga0501079_1041991 3300049741 Bacteria 644
972 Ga0501080_0192894 3300049742 Bacteria 1872
973 Ga0501080_0442922 3300049742 Bacteria 1165
974 Ga0501080_1323437 3300049742 Bacteria 616
975 Ga0501081_0088873 3300049743 Bacteria 2171
976 Ga0501081_0294962 3300049743 Bacteria 1189
977 Ga0501081_0324108 3300049743 Bacteria 1133
978 Ga0501081_1000567 3300049743 Bacteria 632
979 Ga0501081_1077780 3300049743 Bacteria 608
980 Ga0501081_1295789 3300049743 Bacteria 552
981 Ga0501083_0130949 3300049744 Bacteria 1644
982 Ga0501035_0156134 3300049822 Bacteria 1978
983 Ga0501035_0191060 3300049822 Bacteria 1760
984 Ga0501044_1171247 3300049823 Bacteria 637
985 Ga0501044_1236664 3300049823 Bacteria 614
986 Ga0501045_0054894 3300049824 Bacteria 2913
987 Ga0501045_0056579 3300049824 Bacteria 2869
988 Ga0501045_0177568 3300049824 Bacteria 1586
989 nmdc:mga03683_39084_c1 3300050489 Bacteria 1941
990 nmdc:mga03683_61999_c1 3300050489 Bacteria 1583
991 nmdc:mga03683_78013_c1 3300050489 Bacteria 858
992 nmdc:mga03n38_1178_c1 3300050490 Bacteria 7287
993 nmdc:mga03n38_194356_c1 3300050490 Bacteria 1047
994 nmdc:mga03n38_961607_c1 3300050490 Bacteria 504
995 nmdc:mga00v17_397260_c1 3300050491 Bacteria 896
996 nmdc:mga0yw44_10029_c1 3300050492 Bacteria 4819
997 nmdc:mga0yw44_212548_c1 3300050492 Bacteria 1280
998 nmdc:mga0yw44_29263_c2 3300050492 Bacteria 1024
999 nmdc:mga0yw44_832033_c1 3300050492 Bacteria 627
1000 nmdc:mga06z11_136192_c1 3300050494 Bacteria 1384
1001 nmdc:mga06z11_206027_c1 3300050494 Bacteria 1144
1002 nmdc:mga06z11_224408_c1 3300050494 Bacteria 1099
1003 nmdc:mga06z11_3732_c1 3300050494 Bacteria 5919
1004 nmdc:mga06z11_459846_c1 3300050494 Bacteria 769
1005 nmdc:mga07m45_134146_c1 3300050496 Bacteria 1433
1006 nmdc:mga07m45_1587_c1 3300050496 Bacteria 10470
1007 nmdc:mga05p37_102920_c1 3300050507 Bacteria 3516
1008 nmdc:mga05p37_1501614_c1 3300050507 Bacteria 671
1009 nmdc:mga05p37_1689629_c1 3300050507 Bacteria 618
1010 nmdc:mga05p37_176990_c1 3300050507 Bacteria 2598
1011 nmdc:mga05p37_2192820_c1 3300050507 Bacteria 513
1012 nmdc:mga05p37_348_c1 3300050507 Bacteria 49472
1013 nmdc:mga05p37_448926_c1 3300050507 Bacteria 1493
1014 nmdc:mga05p37_468372_c1 3300050507 Bacteria 1454
1015 nmdc:mga09592_1260904_c1 3300050508 Bacteria 609
1016 nmdc:mga09592_151652_c1 3300050508 Bacteria 2000
1017 nmdc:mga09592_5_c1 3300050508 Bacteria 130353
1018 nmdc:mga0qj67_1273265_c1 3300050509 Bacteria 570
1019 nmdc:mga0qj67_45509_c1 3300050509 Bacteria 3463
1020 nmdc:mga06r32_102295_c1 3300050510 Bacteria 2812
1021 nmdc:mga06r32_11679_c1 3300050510 Bacteria 7904
1022 nmdc:mga06r32_191709_c1 3300050510 Bacteria 2031
1023 nmdc:mga06r32_314673_c1 3300050510 Bacteria 1551
1024 nmdc:mga06r32_950258_c1 3300050510 Bacteria 814
1025 nmdc:mga06r32_96986_c1 3300050510 Bacteria 941
1026 nmdc:mga08y16_221905_c1 3300050511 Bacteria 1956
1027 nmdc:mga08y16_230263_c1 3300050511 Bacteria 1916
1028 nmdc:mga08y16_2349_c1 3300050511 Bacteria 19391
1029 nmdc:mga08y16_30230_c1 3300050511 Bacteria 5702
1030 nmdc:mga08y16_399159_c1 3300050511 Bacteria 1408
1031 nmdc:mga08y16_405778_c1 3300050511 Bacteria 1394
1032 nmdc:mga08y16_50531_c1 3300050511 Bacteria 4351
1033 nmdc:mga08y16_955334_c1 3300050511 Bacteria 840
1034 nmdc:mga0n895_409720_c1 3300050512 Bacteria 1371
1035 nmdc:mga0n895_413112_c1 3300050512 Bacteria 1364
1036 nmdc:mga0n895_42972_c1 3300050512 Bacteria 4401
1037 nmdc:mga0n895_473758_c1 3300050512 Bacteria 1263
1038 nmdc:mga0rr50_1077155_c1 3300050513 Bacteria 684
1039 nmdc:mga08x19_153055_c1 3300050514 Bacteria 1563
1040 nmdc:mga0a205_29717_c2 3300050515 Bacteria 3178
1041 nmdc:mga0a205_506359_c1 3300050515 Bacteria 1064
1042 nmdc:mga0a205_779377_c1 3300050515 Bacteria 804
1043 nmdc:mga0sz30_62707_c1 3300050516 Bacteria 1590
1044 Ga0495601_0013981 3300053077 Bacteria 4833
1045 Ga0495612_0094096 3300053078 Bacteria 1272
1046 Ga0500635_0102332 3300053080 Bacteria 1055
1047 Ga0495655_0000628 3300053083 Bacteria 5741
1048 Ga0495595_0155983 3300053084 Bacteria 1125
1049 Ga0495619_0380483 3300053085 Bacteria 975
1050 Ga0500607_259147 3300053121 Bacteria 683
1051 Ga0500618_005777 3300053125 Bacteria 3720
1052 Ga0500567_043907 3300053723 Bacteria 2073
1053 Ga0501084_0033695 3300054114 Bacteria 4284
1054 Ga0501084_0073208 3300054114 Bacteria 2869
1055 Ga0501084_0073995 3300054114 Bacteria 2853
1056 Ga0501084_0147187 3300054114 Bacteria 1984
1057 Ga0501084_1618901 3300054114 Bacteria 541
1058 Ga0501082_0006177 3300060353 Bacteria 10398
1059 Ga0501082_0180677 3300060353 Bacteria 1835
1060 Ga0501082_0182537 3300060353 Bacteria 1825
1061 Ga0501082_0251458 3300060353 Bacteria 1538
1062 Ga0501082_0294415 3300060353 Bacteria 1413
1063 Ga0501082_1646562 3300060353 Bacteria 560
1064 Ga0530510_0008431 3300061734 Bacteria 7184
1065 Ga0530510_0040315 3300061734 Bacteria 3370
1066 Ga0530510_0363112 3300061734 Bacteria 1089

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046519 Ga0495632_0088149 Ga0495632_0088149_199_618 105
2 3300009545 Ga0105237_10157318 Ga0105237_101573184 109
3 3300025914 Ga0207671_10481807 Ga0207671_104818072 109
4 3300035084 Ga0373928_0150689 Ga0373928_0150689_181_546 109
5 3300031824 Ga0307413_10147138 Ga0307413_101471382 113
6 3300031852 Ga0307410_10027077 Ga0307410_100270773 113
7 3300031903 Ga0307407_10012375 Ga0307407_100123754 113
8 3300031995 Ga0307409_100094227 Ga0307409_1000942272 113
9 3300032005 Ga0307411_10314037 Ga0307411_103140372 113
10 3300046648 Ga0495611_0338941 Ga0495611_0338941_144_503 114
11 3300002077 JGI24744J21845_10101059 JGI24744J21845_101010591 117
12 3300002244 JGI24742J22300_10043033 JGI24742J22300_100430332 117
13 3300005293 Ga0065715_10759263 Ga0065715_107592632 117
14 3300005328 Ga0070676_10397834 Ga0070676_103978342 117
15 3300005333 Ga0070677_10042171 Ga0070677_100421712 117
16 3300005334 Ga0068869_100104321 Ga0068869_1001043212 117
17 3300005334 Ga0068869_101000833 Ga0068869_1010008332 117
18 3300005356 Ga0070674_100039433 Ga0070674_1000394333 117
19 3300005364 Ga0070673_100290422 Ga0070673_1002904222 117
20 3300005367 Ga0070667_100429111 Ga0070667_1004291112 117
21 3300005438 Ga0070701_10612076 Ga0070701_106120762 117
22 3300005455 Ga0070663_100042205 Ga0070663_1000422052 117
23 3300005456 Ga0070678_100051594 Ga0070678_1000515942 117
24 3300005457 Ga0070662_100639693 Ga0070662_1006396931 117
25 3300005459 Ga0068867_100437315 Ga0068867_1004373152 117
26 3300005543 Ga0070672_100011114 Ga0070672_1000111144 117
27 3300005548 Ga0070665_100258146 Ga0070665_1002581462 117
28 3300005615 Ga0070702_100386439 Ga0070702_1003864391 117
29 3300005719 Ga0068861_100424974 Ga0068861_1004249742 117
30 3300005840 Ga0068870_10477476 Ga0068870_104774762 117
31 3300005841 Ga0068863_101143695 Ga0068863_1011436951 117
32 3300006237 Ga0097621_100966918 Ga0097621_1009669182 117
33 3300006358 Ga0068871_100274062 Ga0068871_1002740621 117
34 3300006358 Ga0068871_100974999 Ga0068871_1009749992 117
35 3300006871 Ga0075434_100629395 Ga0075434_1006293951 117
36 3300009148 Ga0105243_10762726 Ga0105243_107627261 117
37 3300009176 Ga0105242_10261036 Ga0105242_102610361 117
38 3300013297 Ga0157378_11397435 Ga0157378_113974352 117
39 3300013306 Ga0163162_11160413 Ga0163162_111604132 117
40 3300013308 Ga0157375_10972892 Ga0157375_109728921 117
41 3300014325 Ga0163163_10891707 Ga0163163_108917072 117
42 3300014968 Ga0157379_10643133 Ga0157379_106431332 117
43 3300014969 Ga0157376_10507449 Ga0157376_105074492 117
44 3300017792 Ga0163161_10767451 Ga0163161_107674512 117
45 3300025893 Ga0207682_10003239 Ga0207682_100032397 117
46 3300025899 Ga0207642_10036811 Ga0207642_100368112 117
47 3300025907 Ga0207645_10075319 Ga0207645_100753192 117
48 3300025908 Ga0207643_10713642 Ga0207643_107136421 117
49 3300025933 Ga0207706_10939280 Ga0207706_109392801 117
50 3300025934 Ga0207686_10802782 Ga0207686_108027822 117
51 3300025935 Ga0207709_10259269 Ga0207709_102592692 117
52 3300025937 Ga0207669_10033296 Ga0207669_100332962 117
53 3300025937 Ga0207669_11571520 Ga0207669_115715201 117
54 3300025938 Ga0207704_10417450 Ga0207704_104174502 117
55 3300025940 Ga0207691_10005505 Ga0207691_100055058 117
56 3300025941 Ga0207711_10289652 Ga0207711_102896522 117
57 3300025942 Ga0207689_11537481 Ga0207689_115374812 117
58 3300025960 Ga0207651_10919728 Ga0207651_109197282 117
59 3300026023 Ga0207677_10704384 Ga0207677_107043842 117
60 3300026067 Ga0207678_10246095 Ga0207678_102460952 117
61 3300026088 Ga0207641_11307783 Ga0207641_113077831 117
62 3300026089 Ga0207648_10022150 Ga0207648_100221503 117
63 3300026121 Ga0207683_10028583 Ga0207683_100285833 117
64 3300028379 Ga0268266_10237482 Ga0268266_102374822 117
65 3300028380 Ga0268265_12095664 Ga0268265_120956641 117
66 3300031548 Ga0307408_100280122 Ga0307408_1002801221 117
67 3300031901 Ga0307406_10310814 Ga0307406_103108141 117
68 3300031903 Ga0307407_10338632 Ga0307407_103386321 117
69 3300031911 Ga0307412_10343604 Ga0307412_103436041 117
70 3300032002 Ga0307416_100094520 Ga0307416_1000945202 117
71 3300032004 Ga0307414_10906003 Ga0307414_109060032 117
72 3300032005 Ga0307411_10081837 Ga0307411_100818372 117
73 3300041486 Ga0451807_2604943 Ga0451807_2604943_381_734 117
74 3300042876 Ga0451577_0120548 Ga0451577_0120548_1848_2201 117
75 3300044712 Ga0453684_0121922 Ga0453684_0121922_1230_1583 117
76 3300046691 Ga0495670_0435474 Ga0495670_0435474_195_548 117
77 3300046694 Ga0495649_0537546 Ga0495649_0537546_87_440 117
78 3300048912 Ga0496109_0923270 Ga0496109_0923270_52_405 117
79 3300050512 nmdc:mga0n895_409720_c1 nmdc:mga0n895_409720_c1_298_651 117
80 3300050514 nmdc:mga08x19_153055_c1 nmdc:mga08x19_153055_c1_270_623 117
81 3300002244 JGI24742J22300_10085329 JGI24742J22300_100853291 118
82 3300005330 Ga0070690_100716923 Ga0070690_1007169231 118
83 3300005335 Ga0070666_10411434 Ga0070666_104114342 118
84 3300005340 Ga0070689_100276349 Ga0070689_1002763493 118
85 3300005347 Ga0070668_100499828 Ga0070668_1004998282 118
86 3300005347 Ga0070668_101021219 Ga0070668_1010212192 118
87 3300005354 Ga0070675_100490600 Ga0070675_1004906002 118
88 3300005356 Ga0070674_100008010 Ga0070674_1000080107 118
89 3300005364 Ga0070673_100578887 Ga0070673_1005788871 118
90 3300005365 Ga0070688_100066185 Ga0070688_1000661853 118
91 3300005366 Ga0070659_101051100 Ga0070659_1010511001 118
92 3300005367 Ga0070667_100042351 Ga0070667_1000423514 118
93 3300005440 Ga0070705_100891852 Ga0070705_1008918521 118
94 3300005441 Ga0070700_100570968 Ga0070700_1005709682 118
95 3300005444 Ga0070694_100506881 Ga0070694_1005068812 118
96 3300005444 Ga0070694_100898372 Ga0070694_1008983721 118
97 3300005455 Ga0070663_100192677 Ga0070663_1001926771 118
98 3300005456 Ga0070678_100536330 Ga0070678_1005363302 118
99 3300005457 Ga0070662_101620786 Ga0070662_1016207861 118
100 3300005543 Ga0070672_100654130 Ga0070672_1006541302 118
101 3300005546 Ga0070696_100166438 Ga0070696_1001664383 118
102 3300005549 Ga0070704_100179392 Ga0070704_1001793922 118
103 3300005578 Ga0068854_100832597 Ga0068854_1008325972 118
104 3300005578 Ga0068854_101260940 Ga0068854_1012609402 118
105 3300005616 Ga0068852_102268943 Ga0068852_1022689431 118
106 3300005617 Ga0068859_100503115 Ga0068859_1005031153 118
107 3300005718 Ga0068866_10675756 Ga0068866_106757562 118
108 3300005718 Ga0068866_10726436 Ga0068866_107264361 118
109 3300005719 Ga0068861_100034292 Ga0068861_1000342922 118
110 3300005840 Ga0068870_10044675 Ga0068870_100446753 118
111 3300005841 Ga0068863_101946318 Ga0068863_1019463182 118
112 3300005842 Ga0068858_100201330 Ga0068858_1002013303 118
113 3300005843 Ga0068860_100904726 Ga0068860_1009047262 118
114 3300005844 Ga0068862_100128197 Ga0068862_1001281974 118
115 3300006177 Ga0075362_10058135 Ga0075362_100581352 118
116 3300006237 Ga0097621_100912438 Ga0097621_1009124382 118
117 3300006846 Ga0075430_100221187 Ga0075430_1002211872 118
118 3300006852 Ga0075433_10072810 Ga0075433_100728102 118
119 3300006871 Ga0075434_100278673 Ga0075434_1002786732 118
120 3300006881 Ga0068865_100101247 Ga0068865_1001012473 118
121 3300006931 Ga0097620_100503145 Ga0097620_1005031453 118
122 3300009094 Ga0111539_10717690 Ga0111539_107176902 118
123 3300009094 Ga0111539_10766076 Ga0111539_107660762 118
124 3300009147 Ga0114129_10206847 Ga0114129_102068472 118
125 3300009147 Ga0114129_11124000 Ga0114129_111240002 118
126 3300009148 Ga0105243_10046925 Ga0105243_100469254 118
127 3300009553 Ga0105249_10046617 Ga0105249_100466173 118
128 3300010375 Ga0105239_10926368 Ga0105239_109263681 118
129 3300011119 Ga0105246_10147417 Ga0105246_101474173 118
130 3300012494 Ga0157341_1003637 Ga0157341_10036372 118
131 3300012513 Ga0157326_1010374 Ga0157326_10103742 118
132 3300013296 Ga0157374_12731598 Ga0157374_127315981 118
133 3300013306 Ga0163162_11379610 Ga0163162_113796102 118
134 3300013308 Ga0157375_10102597 Ga0157375_101025973 118
135 3300013308 Ga0157375_11274581 Ga0157375_112745812 118
136 3300014325 Ga0163163_10267597 Ga0163163_102675972 118
137 3300014326 Ga0157380_10422125 Ga0157380_104221253 118
138 3300014326 Ga0157380_10863907 Ga0157380_108639072 118
139 3300014969 Ga0157376_10028966 Ga0157376_100289663 118
140 3300017792 Ga0163161_10089587 Ga0163161_100895872 118
141 3300025899 Ga0207642_10325115 Ga0207642_103251152 118
142 3300025899 Ga0207642_10494725 Ga0207642_104947252 118
143 3300025901 Ga0207688_10133948 Ga0207688_101339482 118
144 3300025904 Ga0207647_10288886 Ga0207647_102888861 118
145 3300025908 Ga0207643_10089816 Ga0207643_100898162 118
146 3300025923 Ga0207681_10701050 Ga0207681_107010502 118
147 3300025933 Ga0207706_10489218 Ga0207706_104892182 118
148 3300025935 Ga0207709_10258863 Ga0207709_102588632 118
149 3300025938 Ga0207704_10362465 Ga0207704_103624652 118
150 3300025945 Ga0207679_11140419 Ga0207679_111404191 118
151 3300025961 Ga0207712_10060130 Ga0207712_100601302 118
152 3300025972 Ga0207668_10235326 Ga0207668_102353262 118
153 3300025972 Ga0207668_10871932 Ga0207668_108719322 118
154 3300025981 Ga0207640_10085407 Ga0207640_100854073 118
155 3300025981 Ga0207640_10954915 Ga0207640_109549152 118
156 3300026035 Ga0207703_10167161 Ga0207703_101671612 118
157 3300026067 Ga0207678_10512222 Ga0207678_105122222 118
158 3300026075 Ga0207708_10132218 Ga0207708_101322183 118
159 3300026075 Ga0207708_10180197 Ga0207708_101801972 118
160 3300026089 Ga0207648_10208303 Ga0207648_102083032 118
161 3300026089 Ga0207648_10641701 Ga0207648_106417012 118
162 3300026118 Ga0207675_100018555 Ga0207675_1000185557 118
163 3300026118 Ga0207675_100494449 Ga0207675_1004944492 118
164 3300026121 Ga0207683_10524950 Ga0207683_105249502 118
165 3300026142 Ga0207698_12312798 Ga0207698_123127981 118
166 3300027876 Ga0209974_10042439 Ga0209974_100424392 118
167 3300028380 Ga0268265_10717636 Ga0268265_107176362 118
168 3300031901 Ga0307406_12021221 Ga0307406_120212212 118
169 3300032005 Ga0307411_10385597 Ga0307411_103855973 118
170 3300041486 Ga0451807_2422974 Ga0451807_2422974_126_482 118
171 3300041512 Ga0451853_3968423 Ga0451853_3968423_516_872 118
172 3300042876 Ga0451577_0141480 Ga0451577_0141480_59_415 118
173 3300044712 Ga0453684_1138063 Ga0453684_1138063_397_753 118
174 3300045051 Ga0451576_0732517 Ga0451576_0732517_46_402 118
175 3300046453 Ga0495627_215332 Ga0495627_215332_14_370 118
176 3300046492 Ga0495585_0080608 Ga0495585_0080608_41_397 118
177 3300046520 Ga0495637_0017363 Ga0495637_0017363_677_1033 118
178 3300046523 Ga0495644_0345835 Ga0495644_0345835_48_404 118
179 3300046525 Ga0495663_0037513 Ga0495663_0037513_30_386 118
180 3300046615 Ga0495656_0087629 Ga0495656_0087629_986_1342 118
181 3300046660 Ga0495625_0077317 Ga0495625_0077317_832_1188 118
182 3300046664 Ga0495659_0107385 Ga0495659_0107385_121_477 118
183 3300046665 Ga0495661_0214993 Ga0495661_0214993_196_552 118
184 3300048905 Ga0496102_1275242 Ga0496102_1275242_224_580 118
185 3300048906 Ga0496103_0991334 Ga0496103_0991334_75_431 118
186 3300048907 Ga0496104_0090195 Ga0496104_0090195_1439_1795 118
187 3300048908 Ga0496105_0219291 Ga0496105_0219291_985_1341 118
188 3300048909 Ga0496106_0073320 Ga0496106_0073320_947_1303 118
189 3300048910 Ga0496107_0122677 Ga0496107_0122677_943_1299 118
190 3300048917 Ga0496114_0274173 Ga0496114_0274173_342_698 118
191 3300049568 Ga0501031_0274551 Ga0501031_0274551_231_587 118
192 3300049569 Ga0501032_0014842 Ga0501032_0014842_4226_4582 118
193 3300049569 Ga0501032_0978080 Ga0501032_0978080_115_471 118
194 3300049570 Ga0501033_0021211 Ga0501033_0021211_2054_2410 118
195 3300049570 Ga0501033_0179021 Ga0501033_0179021_681_1037 118
196 3300049572 Ga0501036_0015220 Ga0501036_0015220_4274_4630 118
197 3300049572 Ga0501036_0041878 Ga0501036_0041878_1480_1836 118
198 3300049572 Ga0501036_0504276 Ga0501036_0504276_516_875 118
199 3300049572 Ga0501036_1267287 Ga0501036_1267287_145_501 118
200 3300049573 Ga0501037_0796547 Ga0501037_0796547_233_589 118
201 3300049574 Ga0501038_0020300 Ga0501038_0020300_396_752 118
202 3300049574 Ga0501038_1221805 Ga0501038_1221805_178_534 118
203 3300049575 Ga0501039_0058792 Ga0501039_0058792_1009_1365 118
204 3300049575 Ga0501039_0120483 Ga0501039_0120483_995_1351 118
205 3300049575 Ga0501039_1028680 Ga0501039_1028680_215_574 118
206 3300049576 Ga0501040_0010290 Ga0501040_0010290_472_828 118
207 3300049576 Ga0501040_1347065 Ga0501040_1347065_135_491 118
208 3300049577 Ga0501041_0033240 Ga0501041_0033240_2027_2383 118
209 3300049577 Ga0501041_0033891 Ga0501041_0033891_737_1093 118
210 3300049578 Ga0501042_0035033 Ga0501042_0035033_2355_2711 118
211 3300049578 Ga0501042_0600514 Ga0501042_0600514_95_451 118
212 3300049578 Ga0501042_0601326 Ga0501042_0601326_414_770 118
213 3300049579 Ga0501043_0259897 Ga0501043_0259897_928_1284 118
214 3300049579 Ga0501043_0753301 Ga0501043_0753301_64_420 118
215 3300049580 Ga0501046_0154988 Ga0501046_0154988_655_1011 118
216 3300049582 Ga0501048_0058949 Ga0501048_0058949_1721_2077 118
217 3300049584 Ga0501068_0046874 Ga0501068_0046874_1115_1471 118
218 3300049584 Ga0501068_0253447 Ga0501068_0253447_719_1078 118
219 3300049585 Ga0501069_0017872 Ga0501069_0017872_1298_1654 118
220 3300049586 Ga0501070_0314163 Ga0501070_0314163_23_379 118
221 3300049587 Ga0501071_0038731 Ga0501071_0038731_2358_2714 118
222 3300049588 Ga0501072_0003174 Ga0501072_0003174_1629_1985 118
223 3300049588 Ga0501072_0197503 Ga0501072_0197503_907_1263 118
224 3300049588 Ga0501072_0244921 Ga0501072_0244921_700_1056 118
225 3300049588 Ga0501072_0300167 Ga0501072_0300167_797_1153 118
226 3300049589 Ga0501073_0162868 Ga0501073_0162868_1121_1477 118
227 3300049590 Ga0501074_0055255 Ga0501074_0055255_393_749 118
228 3300049590 Ga0501074_0119587 Ga0501074_0119587_1382_1738 118
229 3300049590 Ga0501074_0543277 Ga0501074_0543277_422_781 118
230 3300049591 Ga0501075_0008080 Ga0501075_0008080_5971_6327 118
231 3300049591 Ga0501075_0102482 Ga0501075_0102482_1621_1980 118
232 3300049591 Ga0501075_0150567 Ga0501075_0150567_1047_1406 118
233 3300049591 Ga0501075_0661431 Ga0501075_0661431_221_577 118
234 3300049592 Ga0501076_0037327 Ga0501076_0037327_1569_1925 118
235 3300049592 Ga0501076_0057885 Ga0501076_0057885_2617_2973 118
236 3300049592 Ga0501076_0990532 Ga0501076_0990532_173_532 118
237 3300049593 Ga0501077_0009972 Ga0501077_0009972_2864_3220 118
238 3300049593 Ga0501077_0061225 Ga0501077_0061225_900_1256 118
239 3300049593 Ga0501077_0226965 Ga0501077_0226965_760_1119 118
240 3300049741 Ga0501079_0317593 Ga0501079_0317593_19_375 118
241 3300049741 Ga0501079_0462419 Ga0501079_0462419_86_442 118
242 3300049741 Ga0501079_1041991 Ga0501079_1041991_146_502 118
243 3300049742 Ga0501080_0192894 Ga0501080_0192894_824_1180 118
244 3300049743 Ga0501081_1000567 Ga0501081_1000567_171_527 118
245 3300049743 Ga0501081_1295789 Ga0501081_1295789_71_430 118
246 3300049822 Ga0501035_0191060 Ga0501035_0191060_927_1283 118
247 3300049823 Ga0501044_1236664 Ga0501044_1236664_162_518 118
248 3300049824 Ga0501045_0054894 Ga0501045_0054894_944_1300 118
249 3300049824 Ga0501045_0056579 Ga0501045_0056579_535_891 118
250 3300049824 Ga0501045_0177568 Ga0501045_0177568_1209_1565 118
251 3300050494 nmdc:mga06z11_459846_c1 nmdc:mga06z11_459846_c1_32_388 118
252 3300050507 nmdc:mga05p37_1501614_c1 nmdc:mga05p37_1501614_c1_96_452 118
253 3300050507 nmdc:mga05p37_176990_c1 nmdc:mga05p37_176990_c1_1260_1616 118
254 3300050511 nmdc:mga08y16_2349_c1 nmdc:mga08y16_2349_c1_10390_10833 118
255 3300050511 nmdc:mga08y16_405778_c1 nmdc:mga08y16_405778_c1_597_956 118
256 3300050512 nmdc:mga0n895_473758_c1 nmdc:mga0n895_473758_c1_705_1061 118
257 3300050515 nmdc:mga0a205_29717_c2 nmdc:mga0a205_29717_c2_1058_1414 118
258 3300054114 Ga0501084_0033695 Ga0501084_0033695_788_1144 118
259 3300054114 Ga0501084_0147187 Ga0501084_0147187_328_684 118
260 3300060353 Ga0501082_0006177 Ga0501082_0006177_7762_8118 118
261 3300060353 Ga0501082_0180677 Ga0501082_0180677_247_603 118
262 3300060353 Ga0501082_0294415 Ga0501082_0294415_998_1357 118
263 3300060353 Ga0501082_1646562 Ga0501082_1646562_58_414 118
264 3300061734 Ga0530510_0008431 Ga0530510_0008431_4045_4401 118
265 3300061734 Ga0530510_0040315 Ga0530510_0040315_2523_2882 118
266 3300061734 Ga0530510_0363112 Ga0530510_0363112_518_874 118
267 3300001977 JGI24746J21847_1031565 JGI24746J21847_10315652 119
268 3300001989 JGI24739J22299_10162950 JGI24739J22299_101629501 119
269 3300001990 JGI24737J22298_10022369 JGI24737J22298_100223692 119
270 3300001991 JGI24743J22301_10000289 JGI24743J22301_100002896 119
271 3300002070 JGI24750J21931_1002677 JGI24750J21931_10026773 119
272 3300002074 JGI24748J21848_1044144 JGI24748J21848_10441442 119
273 3300002075 JGI24738J21930_10156264 JGI24738J21930_101562641 119
274 3300002077 JGI24744J21845_10001142 JGI24744J21845_100011424 119
275 3300002155 JGI24033J26618_1003370 JGI24033J26618_10033704 119
276 3300002459 JGI24751J29686_10003925 JGI24751J29686_100039252 119
277 3300003320 rootH2_10015358 rootH2_100153583 119
278 3300003323 rootH1_10157129 rootH1_101571294 119
279 3300003373 JGI25407J50210_10147166 JGI25407J50210_101471662 119
280 3300005295 Ga0065707_10598815 Ga0065707_105988151 119
281 3300005295 Ga0065707_10636514 Ga0065707_106365141 119
282 3300005295 Ga0065707_10800179 Ga0065707_108001791 119
283 3300005328 Ga0070676_10129134 Ga0070676_101291342 119
284 3300005328 Ga0070676_10575923 Ga0070676_105759231 119
285 3300005329 Ga0070683_102086620 Ga0070683_1020866201 119
286 3300005330 Ga0070690_100009413 Ga0070690_1000094136 119
287 3300005330 Ga0070690_100041690 Ga0070690_1000416901 119
288 3300005330 Ga0070690_100612470 Ga0070690_1006124702 119
289 3300005331 Ga0070670_100173351 Ga0070670_1001733513 119
290 3300005331 Ga0070670_100812416 Ga0070670_1008124161 119
291 3300005333 Ga0070677_10016023 Ga0070677_100160232 119
292 3300005333 Ga0070677_10179249 Ga0070677_101792491 119
293 3300005333 Ga0070677_10211260 Ga0070677_102112601 119
294 3300005334 Ga0068869_100039936 Ga0068869_1000399364 119
295 3300005334 Ga0068869_100703600 Ga0068869_1007036002 119
296 3300005334 Ga0068869_101492468 Ga0068869_1014924682 119
297 3300005334 Ga0068869_101741194 Ga0068869_1017411941 119
298 3300005336 Ga0070680_100339665 Ga0070680_1003396652 119
299 3300005338 Ga0068868_100058792 Ga0068868_1000587924 119
300 3300005339 Ga0070660_100112452 Ga0070660_1001124521 119
301 3300005340 Ga0070689_100027085 Ga0070689_1000270852 119
302 3300005340 Ga0070689_100403657 Ga0070689_1004036572 119
303 3300005340 Ga0070689_100587071 Ga0070689_1005870712 119
304 3300005340 Ga0070689_100587204 Ga0070689_1005872042 119
305 3300005341 Ga0070691_10062475 Ga0070691_100624754 119
306 3300005341 Ga0070691_10382175 Ga0070691_103821752 119
307 3300005341 Ga0070691_10556161 Ga0070691_105561611 119
308 3300005343 Ga0070687_100013616 Ga0070687_1000136165 119
309 3300005343 Ga0070687_100332283 Ga0070687_1003322832 119
310 3300005343 Ga0070687_100879638 Ga0070687_1008796381 119
311 3300005344 Ga0070661_100974151 Ga0070661_1009741512 119
312 3300005345 Ga0070692_10055110 Ga0070692_100551103 119
313 3300005345 Ga0070692_10274115 Ga0070692_102741152 119
314 3300005345 Ga0070692_10340976 Ga0070692_103409762 119
315 3300005347 Ga0070668_100071393 Ga0070668_1000713933 119
316 3300005347 Ga0070668_100163900 Ga0070668_1001639003 119
317 3300005347 Ga0070668_100165081 Ga0070668_1001650812 119
318 3300005347 Ga0070668_100421980 Ga0070668_1004219802 119
319 3300005347 Ga0070668_100781846 Ga0070668_1007818462 119
320 3300005353 Ga0070669_100024281 Ga0070669_1000242814 119
321 3300005353 Ga0070669_100032969 Ga0070669_1000329694 119
322 3300005353 Ga0070669_100076141 Ga0070669_1000761412 119
323 3300005353 Ga0070669_101767839 Ga0070669_1017678391 119
324 3300005354 Ga0070675_100021110 Ga0070675_1000211102 119
325 3300005354 Ga0070675_100195145 Ga0070675_1001951452 119
326 3300005354 Ga0070675_100474882 Ga0070675_1004748822 119
327 3300005356 Ga0070674_100013939 Ga0070674_1000139394 119
328 3300005356 Ga0070674_100019263 Ga0070674_1000192633 119
329 3300005356 Ga0070674_100308610 Ga0070674_1003086102 119
330 3300005356 Ga0070674_100793274 Ga0070674_1007932741 119
331 3300005364 Ga0070673_100034287 Ga0070673_1000342873 119
332 3300005364 Ga0070673_100051856 Ga0070673_1000518563 119
333 3300005364 Ga0070673_100607969 Ga0070673_1006079692 119
334 3300005364 Ga0070673_100855410 Ga0070673_1008554101 119
335 3300005364 Ga0070673_101019821 Ga0070673_1010198211 119
336 3300005364 Ga0070673_101234034 Ga0070673_1012340341 119
337 3300005364 Ga0070673_101347997 Ga0070673_1013479972 119
338 3300005365 Ga0070688_100006679 Ga0070688_1000066794 119
339 3300005365 Ga0070688_100030550 Ga0070688_1000305504 119
340 3300005365 Ga0070688_100093546 Ga0070688_1000935462 119
341 3300005365 Ga0070688_100176158 Ga0070688_1001761582 119
342 3300005365 Ga0070688_100221112 Ga0070688_1002211123 119
343 3300005366 Ga0070659_100006061 Ga0070659_1000060616 119
344 3300005366 Ga0070659_100151620 Ga0070659_1001516203 119
345 3300005367 Ga0070667_100353143 Ga0070667_1003531431 119
346 3300005367 Ga0070667_101581259 Ga0070667_1015812591 119
347 3300005406 Ga0070703_10070998 Ga0070703_100709981 119
348 3300005438 Ga0070701_10011428 Ga0070701_100114282 119
349 3300005438 Ga0070701_10108626 Ga0070701_101086262 119
350 3300005438 Ga0070701_10147202 Ga0070701_101472022 119
351 3300005438 Ga0070701_10815755 Ga0070701_108157551 119
352 3300005439 Ga0070711_101013505 Ga0070711_1010135051 119
353 3300005440 Ga0070705_100013904 Ga0070705_1000139044 119
354 3300005440 Ga0070705_100081424 Ga0070705_1000814243 119
355 3300005440 Ga0070705_100115279 Ga0070705_1001152793 119
356 3300005440 Ga0070705_100123176 Ga0070705_1001231763 119
357 3300005441 Ga0070700_100001831 Ga0070700_1000018317 119
358 3300005441 Ga0070700_100024645 Ga0070700_1000246452 119
359 3300005441 Ga0070700_100213204 Ga0070700_1002132042 119
360 3300005441 Ga0070700_100272249 Ga0070700_1002722492 119
361 3300005441 Ga0070700_100354636 Ga0070700_1003546362 119
362 3300005441 Ga0070700_100425144 Ga0070700_1004251442 119
363 3300005444 Ga0070694_100067189 Ga0070694_1000671892 119
364 3300005444 Ga0070694_100120415 Ga0070694_1001204153 119
365 3300005444 Ga0070694_100227034 Ga0070694_1002270343 119
366 3300005444 Ga0070694_100934547 Ga0070694_1009345472 119
367 3300005455 Ga0070663_100034544 Ga0070663_1000345445 119
368 3300005456 Ga0070678_100147121 Ga0070678_1001471212 119
369 3300005456 Ga0070678_100285946 Ga0070678_1002859462 119
370 3300005456 Ga0070678_100611740 Ga0070678_1006117402 119
371 3300005457 Ga0070662_100039586 Ga0070662_1000395862 119
372 3300005457 Ga0070662_100181707 Ga0070662_1001817072 119
373 3300005457 Ga0070662_100779514 Ga0070662_1007795141 119
374 3300005457 Ga0070662_100795103 Ga0070662_1007951032 119
375 3300005458 Ga0070681_10066648 Ga0070681_100666484 119
376 3300005458 Ga0070681_11166494 Ga0070681_111664941 119
377 3300005459 Ga0068867_100026934 Ga0068867_1000269344 119
378 3300005459 Ga0068867_100062864 Ga0068867_1000628642 119
379 3300005459 Ga0068867_100185720 Ga0068867_1001857202 119
380 3300005459 Ga0068867_100483201 Ga0068867_1004832012 119
381 3300005466 Ga0070685_10002826 Ga0070685_100028262 119
382 3300005466 Ga0070685_10152406 Ga0070685_101524062 119
383 3300005466 Ga0070685_10524535 Ga0070685_105245352 119
384 3300005468 Ga0070707_101845867 Ga0070707_1018458671 119
385 3300005471 Ga0070698_100020375 Ga0070698_1000203751 119
386 3300005518 Ga0070699_100246708 Ga0070699_1002467081 119
387 3300005518 Ga0070699_100451974 Ga0070699_1004519741 119
388 3300005530 Ga0070679_100053571 Ga0070679_1000535715 119
389 3300005535 Ga0070684_100153697 Ga0070684_1001536974 119
390 3300005536 Ga0070697_100323693 Ga0070697_1003236932 119
391 3300005536 Ga0070697_100803916 Ga0070697_1008039162 119
392 3300005536 Ga0070697_101961306 Ga0070697_1019613062 119
393 3300005539 Ga0068853_100197108 Ga0068853_1001971081 119
394 3300005539 Ga0068853_100545824 Ga0068853_1005458242 119
395 3300005543 Ga0070672_100093329 Ga0070672_1000933292 119
396 3300005543 Ga0070672_100369918 Ga0070672_1003699182 119
397 3300005543 Ga0070672_101071472 Ga0070672_1010714722 119
398 3300005544 Ga0070686_100009432 Ga0070686_1000094326 119
399 3300005544 Ga0070686_100037119 Ga0070686_1000371192 119
400 3300005544 Ga0070686_100948792 Ga0070686_1009487921 119
401 3300005545 Ga0070695_100011470 Ga0070695_1000114706 119
402 3300005545 Ga0070695_100103183 Ga0070695_1001031833 119
403 3300005545 Ga0070695_100300607 Ga0070695_1003006072 119
404 3300005545 Ga0070695_101528312 Ga0070695_1015283121 119
405 3300005546 Ga0070696_100009053 Ga0070696_1000090535 119
406 3300005547 Ga0070693_100006310 Ga0070693_1000063103 119
407 3300005547 Ga0070693_100658952 Ga0070693_1006589522 119
408 3300005548 Ga0070665_100048285 Ga0070665_1000482851 119
409 3300005548 Ga0070665_100095945 Ga0070665_1000959453 119
410 3300005548 Ga0070665_100496069 Ga0070665_1004960691 119
411 3300005548 Ga0070665_101185842 Ga0070665_1011858421 119
412 3300005549 Ga0070704_100054091 Ga0070704_1000540914 119
413 3300005549 Ga0070704_100374703 Ga0070704_1003747032 119
414 3300005564 Ga0070664_100258165 Ga0070664_1002581651 119
415 3300005564 Ga0070664_100336652 Ga0070664_1003366522 119
416 3300005564 Ga0070664_101889046 Ga0070664_1018890461 119
417 3300005577 Ga0068857_100024296 Ga0068857_1000242963 119
418 3300005577 Ga0068857_100249292 Ga0068857_1002492922 119
419 3300005577 Ga0068857_100501143 Ga0068857_1005011432 119
420 3300005577 Ga0068857_100523862 Ga0068857_1005238622 119
421 3300005578 Ga0068854_100088893 Ga0068854_1000888934 119
422 3300005578 Ga0068854_100758180 Ga0068854_1007581802 119
423 3300005578 Ga0068854_101853022 Ga0068854_1018530222 119
424 3300005615 Ga0070702_100011472 Ga0070702_1000114725 119
425 3300005615 Ga0070702_100020816 Ga0070702_1000208163 119
426 3300005615 Ga0070702_100276643 Ga0070702_1002766432 119
427 3300005616 Ga0068852_100162491 Ga0068852_1001624914 119
428 3300005617 Ga0068859_100139957 Ga0068859_1001399572 119
429 3300005617 Ga0068859_100392249 Ga0068859_1003922491 119
430 3300005617 Ga0068859_100691468 Ga0068859_1006914682 119
431 3300005617 Ga0068859_100896314 Ga0068859_1008963142 119
432 3300005617 Ga0068859_102107141 Ga0068859_1021071411 119
433 3300005618 Ga0068864_100019800 Ga0068864_1000198006 119
434 3300005618 Ga0068864_100053857 Ga0068864_1000538573 119
435 3300005618 Ga0068864_100228708 Ga0068864_1002287082 119
436 3300005618 Ga0068864_101373641 Ga0068864_1013736411 119
437 3300005718 Ga0068866_10036038 Ga0068866_100360381 119
438 3300005718 Ga0068866_10110477 Ga0068866_101104772 119
439 3300005719 Ga0068861_100009091 Ga0068861_1000090913 119
440 3300005719 Ga0068861_100033722 Ga0068861_1000337224 119
441 3300005719 Ga0068861_100133863 Ga0068861_1001338632 119
442 3300005719 Ga0068861_100140301 Ga0068861_1001403012 119
443 3300005719 Ga0068861_100173354 Ga0068861_1001733542 119
444 3300005719 Ga0068861_100296339 Ga0068861_1002963392 119
445 3300005719 Ga0068861_100693384 Ga0068861_1006933842 119
446 3300005840 Ga0068870_10002310 Ga0068870_100023103 119
447 3300005840 Ga0068870_10053710 Ga0068870_100537102 119
448 3300005840 Ga0068870_10462106 Ga0068870_104621062 119
449 3300005841 Ga0068863_100292468 Ga0068863_1002924681 119
450 3300005841 Ga0068863_100964527 Ga0068863_1009645272 119
451 3300005841 Ga0068863_101106419 Ga0068863_1011064191 119
452 3300005841 Ga0068863_102642931 Ga0068863_1026429311 119
453 3300005842 Ga0068858_100023261 Ga0068858_1000232614 119
454 3300005842 Ga0068858_100231770 Ga0068858_1002317702 119
455 3300005843 Ga0068860_100029497 Ga0068860_1000294974 119
456 3300005843 Ga0068860_100046638 Ga0068860_1000466384 119
457 3300005843 Ga0068860_100418461 Ga0068860_1004184612 119
458 3300005843 Ga0068860_100713908 Ga0068860_1007139082 119
459 3300005843 Ga0068860_100874969 Ga0068860_1008749692 119
460 3300005844 Ga0068862_100193183 Ga0068862_1001931832 119
461 3300005844 Ga0068862_100246388 Ga0068862_1002463882 119
462 3300005844 Ga0068862_100342701 Ga0068862_1003427012 119
463 3300005844 Ga0068862_100372681 Ga0068862_1003726812 119
464 3300005844 Ga0068862_100719449 Ga0068862_1007194492 119
465 3300005844 Ga0068862_101436801 Ga0068862_1014368012 119
466 3300005937 Ga0081455_10004385 Ga0081455_1000438511 119
467 3300005937 Ga0081455_10006450 Ga0081455_100064501 119
468 3300005981 Ga0081538_10015699 Ga0081538_100156996 119
469 3300005981 Ga0081538_10036943 Ga0081538_100369434 119
470 3300006028 Ga0070717_11119478 Ga0070717_111194782 119
471 3300006038 Ga0075365_10011977 Ga0075365_100119773 119
472 3300006038 Ga0075365_10050444 Ga0075365_100504442 119
473 3300006038 Ga0075365_10775439 Ga0075365_107754391 119
474 3300006048 Ga0075363_100006440 Ga0075363_1000064408 119
475 3300006048 Ga0075363_100330740 Ga0075363_1003307402 119
476 3300006051 Ga0075364_10173269 Ga0075364_101732692 119
477 3300006163 Ga0070715_10017981 Ga0070715_100179814 119
478 3300006175 Ga0070712_100183080 Ga0070712_1001830802 119
479 3300006177 Ga0075362_10086876 Ga0075362_100868762 119
480 3300006177 Ga0075362_10137611 Ga0075362_101376112 119
481 3300006178 Ga0075367_10006406 Ga0075367_100064066 119
482 3300006178 Ga0075367_10256038 Ga0075367_102560381 119
483 3300006178 Ga0075367_10482339 Ga0075367_104823391 119
484 3300006178 Ga0075367_10848917 Ga0075367_108489171 119
485 3300006186 Ga0075369_10096470 Ga0075369_100964701 119
486 3300006186 Ga0075369_10480281 Ga0075369_104802811 119
487 3300006195 Ga0075366_10481327 Ga0075366_104813271 119
488 3300006237 Ga0097621_100014001 Ga0097621_1000140015 119
489 3300006237 Ga0097621_100197699 Ga0097621_1001976992 119
490 3300006353 Ga0075370_10069593 Ga0075370_100695933 119
491 3300006353 Ga0075370_10773796 Ga0075370_107737962 119
492 3300006358 Ga0068871_100030159 Ga0068871_1000301594 119
493 3300006358 Ga0068871_100562601 Ga0068871_1005626012 119
494 3300006358 Ga0068871_101588998 Ga0068871_1015889982 119
495 3300006358 Ga0068871_102080032 Ga0068871_1020800321 119
496 3300006844 Ga0075428_100088621 Ga0075428_1000886212 119
497 3300006844 Ga0075428_100111490 Ga0075428_1001114902 119
498 3300006844 Ga0075428_100165771 Ga0075428_1001657713 119
499 3300006844 Ga0075428_100375310 Ga0075428_1003753102 119
500 3300006844 Ga0075428_100674699 Ga0075428_1006746991 119
501 3300006846 Ga0075430_100021899 Ga0075430_1000218992 119
502 3300006846 Ga0075430_100161849 Ga0075430_1001618492 119
503 3300006846 Ga0075430_100324024 Ga0075430_1003240242 119
504 3300006846 Ga0075430_101421549 Ga0075430_1014215491 119
505 3300006847 Ga0075431_100020076 Ga0075431_1000200764 119
506 3300006847 Ga0075431_100024922 Ga0075431_1000249224 119
507 3300006847 Ga0075431_100063780 Ga0075431_1000637802 119
508 3300006847 Ga0075431_100102562 Ga0075431_1001025622 119
509 3300006847 Ga0075431_100366567 Ga0075431_1003665672 119
510 3300006871 Ga0075434_100112818 Ga0075434_1001128182 119
511 3300006871 Ga0075434_101053870 Ga0075434_1010538702 119
512 3300006880 Ga0075429_100000516 Ga0075429_1000005165 119
513 3300006880 Ga0075429_100061796 Ga0075429_1000617962 119
514 3300006881 Ga0068865_100344279 Ga0068865_1003442791 119
515 3300006931 Ga0097620_100139956 Ga0097620_1001399562 119
516 3300006931 Ga0097620_100392299 Ga0097620_1003922991 119
517 3300006931 Ga0097620_100691483 Ga0097620_1006914832 119
518 3300006931 Ga0097620_100896301 Ga0097620_1008963012 119
519 3300006931 Ga0097620_102107088 Ga0097620_1021070882 119
520 3300007076 Ga0075435_100095165 Ga0075435_1000951653 119
521 3300009092 Ga0105250_10035451 Ga0105250_100354512 119
522 3300009094 Ga0111539_10091488 Ga0111539_100914884 119
523 3300009094 Ga0111539_10470432 Ga0111539_104704321 119
524 3300009094 Ga0111539_10613229 Ga0111539_106132292 119
525 3300009094 Ga0111539_11158669 Ga0111539_111586691 119
526 3300009094 Ga0111539_11981300 Ga0111539_119813001 119
527 3300009098 Ga0105245_10138958 Ga0105245_101389583 119
528 3300009101 Ga0105247_10017387 Ga0105247_100173874 119
529 3300009147 Ga0114129_10006246 Ga0114129_1000624613 119
530 3300009147 Ga0114129_10040767 Ga0114129_100407677 119
531 3300009147 Ga0114129_10373351 Ga0114129_103733513 119
532 3300009147 Ga0114129_10779165 Ga0114129_107791653 119
533 3300009147 Ga0114129_11149003 Ga0114129_111490032 119
534 3300009148 Ga0105243_10300094 Ga0105243_103000943 119
535 3300009148 Ga0105243_10390765 Ga0105243_103907652 119
536 3300009148 Ga0105243_10834875 Ga0105243_108348752 119
537 3300009174 Ga0105241_10411180 Ga0105241_104111802 119
538 3300009174 Ga0105241_10712673 Ga0105241_107126732 119
539 3300009176 Ga0105242_10015964 Ga0105242_100159642 119
540 3300009177 Ga0105248_10013593 Ga0105248_100135939 119
541 3300009177 Ga0105248_10373142 Ga0105248_103731422 119
542 3300009177 Ga0105248_10849747 Ga0105248_108497471 119
543 3300009551 Ga0105238_10315895 Ga0105238_103158952 119
544 3300009551 Ga0105238_10516766 Ga0105238_105167662 119
545 3300009551 Ga0105238_11734471 Ga0105238_117344711 119
546 3300009553 Ga0105249_10058640 Ga0105249_100586404 119
547 3300009553 Ga0105249_10572772 Ga0105249_105727722 119
548 3300009553 Ga0105249_10773384 Ga0105249_107733841 119
549 3300011119 Ga0105246_10012857 Ga0105246_100128572 119
550 3300012513 Ga0157326_1034287 Ga0157326_10342872 119
551 3300013100 Ga0157373_10028056 Ga0157373_100280564 119
552 3300013102 Ga0157371_10448916 Ga0157371_104489161 119
553 3300013102 Ga0157371_10716731 Ga0157371_107167312 119
554 3300013102 Ga0157371_11025873 Ga0157371_110258732 119
555 3300013296 Ga0157374_10484621 Ga0157374_104846211 119
556 3300013297 Ga0157378_10016082 Ga0157378_100160821 119
557 3300013297 Ga0157378_10242931 Ga0157378_102429313 119
558 3300013297 Ga0157378_12078554 Ga0157378_120785542 119
559 3300013306 Ga0163162_10044564 Ga0163162_100445646 119
560 3300013306 Ga0163162_11828480 Ga0163162_118284802 119
561 3300013306 Ga0163162_11866294 Ga0163162_118662942 119
562 3300013307 Ga0157372_10007051 Ga0157372_1000705110 119
563 3300013307 Ga0157372_10888523 Ga0157372_108885232 119
564 3300013308 Ga0157375_13115047 Ga0157375_131150471 119
565 3300014326 Ga0157380_10053038 Ga0157380_100530382 119
566 3300014326 Ga0157380_10099751 Ga0157380_100997515 119
567 3300014326 Ga0157380_10121023 Ga0157380_101210232 119
568 3300014326 Ga0157380_10171516 Ga0157380_101715162 119
569 3300014326 Ga0157380_10343883 Ga0157380_103438832 119
570 3300014326 Ga0157380_10510970 Ga0157380_105109702 119
571 3300014326 Ga0157380_10869019 Ga0157380_108690192 119
572 3300014326 Ga0157380_11203236 Ga0157380_112032362 119
573 3300014326 Ga0157380_11254780 Ga0157380_112547801 119
574 3300014326 Ga0157380_11878385 Ga0157380_118783852 119
575 3300014497 Ga0182008_10088724 Ga0182008_100887242 119
576 3300014497 Ga0182008_10192751 Ga0182008_101927512 119
577 3300014745 Ga0157377_10060707 Ga0157377_100607072 119
578 3300014745 Ga0157377_10078011 Ga0157377_100780113 119
579 3300014968 Ga0157379_10347170 Ga0157379_103471701 119
580 3300014968 Ga0157379_10561869 Ga0157379_105618692 119
581 3300014968 Ga0157379_10666387 Ga0157379_106663872 119
582 3300014968 Ga0157379_11296301 Ga0157379_112963011 119
583 3300014968 Ga0157379_12498597 Ga0157379_124985971 119
584 3300014969 Ga0157376_10045197 Ga0157376_100451973 119
585 3300014969 Ga0157376_10460957 Ga0157376_104609572 119
586 3300014969 Ga0157376_11985290 Ga0157376_119852901 119
587 3300015261 Ga0182006_1071938 Ga0182006_10719382 119
588 3300015262 Ga0182007_10045579 Ga0182007_100455792 119
589 3300015262 Ga0182007_10047438 Ga0182007_100474382 119
590 3300015262 Ga0182007_10151356 Ga0182007_101513562 119
591 3300017792 Ga0163161_10035357 Ga0163161_100353573 119
592 3300017792 Ga0163161_10261797 Ga0163161_102617972 119
593 3300025227 Ga0207638_1003840 Ga0207638_10038401 119
594 3300025297 Ga0209758_1018310 Ga0209758_10183102 119
595 3300025315 Ga0207697_10548945 Ga0207697_105489452 119
596 3300025893 Ga0207682_10023027 Ga0207682_100230273 119
597 3300025899 Ga0207642_10216771 Ga0207642_102167711 119
598 3300025900 Ga0207710_10074811 Ga0207710_100748111 119
599 3300025901 Ga0207688_10000283 Ga0207688_1000028310 119
600 3300025903 Ga0207680_10088104 Ga0207680_100881044 119
601 3300025904 Ga0207647_10008609 Ga0207647_100086096 119
602 3300025905 Ga0207685_10011195 Ga0207685_100111954 119
603 3300025907 Ga0207645_10004284 Ga0207645_100042843 119
604 3300025907 Ga0207645_10149060 Ga0207645_101490602 119
605 3300025907 Ga0207645_10374439 Ga0207645_103744391 119
606 3300025907 Ga0207645_10858230 Ga0207645_108582301 119
607 3300025908 Ga0207643_10000615 Ga0207643_1000061510 119
608 3300025908 Ga0207643_10038281 Ga0207643_100382813 119
609 3300025908 Ga0207643_10110027 Ga0207643_101100272 119
610 3300025912 Ga0207707_10099173 Ga0207707_100991733 119
611 3300025916 Ga0207663_10197530 Ga0207663_101975302 119
612 3300025918 Ga0207662_10002182 Ga0207662_100021827 119
613 3300025918 Ga0207662_10019443 Ga0207662_100194432 119
614 3300025918 Ga0207662_10157989 Ga0207662_101579892 119
615 3300025919 Ga0207657_10111144 Ga0207657_101111441 119
616 3300025919 Ga0207657_10816507 Ga0207657_108165072 119
617 3300025920 Ga0207649_10974225 Ga0207649_109742251 119
618 3300025920 Ga0207649_11129601 Ga0207649_111296011 119
619 3300025921 Ga0207652_10089380 Ga0207652_100893802 119
620 3300025921 Ga0207652_11197203 Ga0207652_111972031 119
621 3300025923 Ga0207681_10019540 Ga0207681_100195402 119
622 3300025923 Ga0207681_10032108 Ga0207681_100321082 119
623 3300025923 Ga0207681_10103416 Ga0207681_101034162 119
624 3300025923 Ga0207681_10339484 Ga0207681_103394842 119
625 3300025923 Ga0207681_10691224 Ga0207681_106912242 119
626 3300025924 Ga0207694_10557457 Ga0207694_105574571 119
627 3300025924 Ga0207694_11052464 Ga0207694_110524641 119
628 3300025925 Ga0207650_10043430 Ga0207650_100434303 119
629 3300025925 Ga0207650_10144074 Ga0207650_101440742 119
630 3300025925 Ga0207650_10163106 Ga0207650_101631062 119
631 3300025926 Ga0207659_10160130 Ga0207659_101601302 119
632 3300025926 Ga0207659_10509646 Ga0207659_105096462 119
633 3300025926 Ga0207659_11630553 Ga0207659_116305531 119
634 3300025926 Ga0207659_11729908 Ga0207659_117299082 119
635 3300025932 Ga0207690_10015285 Ga0207690_100152853 119
636 3300025932 Ga0207690_10024268 Ga0207690_100242683 119
637 3300025932 Ga0207690_10313276 Ga0207690_103132763 119
638 3300025932 Ga0207690_10409627 Ga0207690_104096271 119
639 3300025933 Ga0207706_10011257 Ga0207706_100112574 119
640 3300025933 Ga0207706_10025823 Ga0207706_100258235 119
641 3300025933 Ga0207706_10083579 Ga0207706_100835793 119
642 3300025933 Ga0207706_10097236 Ga0207706_100972363 119
643 3300025933 Ga0207706_10232699 Ga0207706_102326992 119
644 3300025933 Ga0207706_10371654 Ga0207706_103716542 119
645 3300025933 Ga0207706_11690729 Ga0207706_116907291 119
646 3300025935 Ga0207709_10039886 Ga0207709_100398864 119
647 3300025935 Ga0207709_11378050 Ga0207709_113780502 119
648 3300025936 Ga0207670_10040465 Ga0207670_100404654 119
649 3300025936 Ga0207670_10091205 Ga0207670_100912052 119
650 3300025936 Ga0207670_10136471 Ga0207670_101364712 119
651 3300025936 Ga0207670_10203833 Ga0207670_102038332 119
652 3300025937 Ga0207669_10008898 Ga0207669_100088986 119
653 3300025937 Ga0207669_10124508 Ga0207669_101245082 119
654 3300025937 Ga0207669_10818753 Ga0207669_108187532 119
655 3300025938 Ga0207704_10009089 Ga0207704_100090894 119
656 3300025938 Ga0207704_10071029 Ga0207704_100710292 119
657 3300025938 Ga0207704_10156445 Ga0207704_101564451 119
658 3300025938 Ga0207704_10480390 Ga0207704_104803902 119
659 3300025938 Ga0207704_10935495 Ga0207704_109354952 119
660 3300025939 Ga0207665_10123760 Ga0207665_101237602 119
661 3300025940 Ga0207691_10001340 Ga0207691_1000134017 119
662 3300025940 Ga0207691_10008332 Ga0207691_100083323 119
663 3300025940 Ga0207691_10009993 Ga0207691_100099932 119
664 3300025940 Ga0207691_10072598 Ga0207691_100725983 119
665 3300025940 Ga0207691_10170907 Ga0207691_101709072 119
666 3300025940 Ga0207691_10367487 Ga0207691_103674871 119
667 3300025940 Ga0207691_10440963 Ga0207691_104409632 119
668 3300025940 Ga0207691_10444171 Ga0207691_104441712 119
669 3300025941 Ga0207711_10053060 Ga0207711_100530604 119
670 3300025941 Ga0207711_10132630 Ga0207711_101326304 119
671 3300025941 Ga0207711_10577632 Ga0207711_105776322 119
672 3300025941 Ga0207711_10981813 Ga0207711_109818132 119
673 3300025942 Ga0207689_10009385 Ga0207689_100093856 119
674 3300025942 Ga0207689_10087974 Ga0207689_100879742 119
675 3300025942 Ga0207689_11744840 Ga0207689_117448401 119
676 3300025945 Ga0207679_10959545 Ga0207679_109595452 119
677 3300025960 Ga0207651_10008440 Ga0207651_100084405 119
678 3300025960 Ga0207651_10168645 Ga0207651_101686452 119
679 3300025960 Ga0207651_10224327 Ga0207651_102243272 119
680 3300025960 Ga0207651_10572169 Ga0207651_105721692 119
681 3300025960 Ga0207651_10661013 Ga0207651_106610132 119
682 3300025961 Ga0207712_10121386 Ga0207712_101213862 119
683 3300025961 Ga0207712_11519808 Ga0207712_115198081 119
684 3300025972 Ga0207668_10009499 Ga0207668_100094994 119
685 3300025972 Ga0207668_10070567 Ga0207668_100705673 119
686 3300025972 Ga0207668_10648104 Ga0207668_106481042 119
687 3300025972 Ga0207668_11036018 Ga0207668_110360182 119
688 3300025972 Ga0207668_11165618 Ga0207668_111656181 119
689 3300025981 Ga0207640_10101516 Ga0207640_101015162 119
690 3300025981 Ga0207640_10327720 Ga0207640_103277202 119
691 3300025981 Ga0207640_10761161 Ga0207640_107611612 119
692 3300025986 Ga0207658_10734154 Ga0207658_107341542 119
693 3300026023 Ga0207677_10154074 Ga0207677_101540743 119
694 3300026023 Ga0207677_12016001 Ga0207677_120160011 119
695 3300026035 Ga0207703_10096065 Ga0207703_100960652 119
696 3300026035 Ga0207703_11054795 Ga0207703_110547952 119
697 3300026035 Ga0207703_11380736 Ga0207703_113807361 119
698 3300026075 Ga0207708_10003436 Ga0207708_1000343610 119
699 3300026075 Ga0207708_10029898 Ga0207708_100298982 119
700 3300026075 Ga0207708_10091093 Ga0207708_100910932 119
701 3300026078 Ga0207702_10189450 Ga0207702_101894501 119
702 3300026088 Ga0207641_10017045 Ga0207641_100170453 119
703 3300026088 Ga0207641_10254176 Ga0207641_102541762 119
704 3300026088 Ga0207641_10859732 Ga0207641_108597322 119
705 3300026089 Ga0207648_10006798 Ga0207648_100067986 119
706 3300026089 Ga0207648_10010221 Ga0207648_100102212 119
707 3300026089 Ga0207648_10065638 Ga0207648_100656384 119
708 3300026089 Ga0207648_10125085 Ga0207648_101250853 119
709 3300026095 Ga0207676_10023885 Ga0207676_100238852 119
710 3300026095 Ga0207676_10298808 Ga0207676_102988082 119
711 3300026095 Ga0207676_10365983 Ga0207676_103659832 119
712 3300026116 Ga0207674_10063658 Ga0207674_100636584 119
713 3300026116 Ga0207674_10094187 Ga0207674_100941873 119
714 3300026116 Ga0207674_10923396 Ga0207674_109233961 119
715 3300026118 Ga0207675_100006775 Ga0207675_1000067754 119
716 3300026118 Ga0207675_100028532 Ga0207675_1000285326 119
717 3300026118 Ga0207675_100055390 Ga0207675_1000553903 119
718 3300026118 Ga0207675_100070045 Ga0207675_1000700453 119
719 3300026118 Ga0207675_100096188 Ga0207675_1000961884 119
720 3300026118 Ga0207675_100187573 Ga0207675_1001875732 119
721 3300026118 Ga0207675_102019977 Ga0207675_1020199771 119
722 3300026121 Ga0207683_10059345 Ga0207683_100593454 119
723 3300026121 Ga0207683_10206023 Ga0207683_102060232 119
724 3300026121 Ga0207683_10214207 Ga0207683_102142072 119
725 3300026121 Ga0207683_10394443 Ga0207683_103944432 119
726 3300026121 Ga0207683_11035767 Ga0207683_110357672 119
727 3300026121 Ga0207683_11589114 Ga0207683_115891141 119
728 3300026142 Ga0207698_10513602 Ga0207698_105136022 119
729 3300026142 Ga0207698_11103328 Ga0207698_111033281 119
730 3300027462 Ga0210000_1016949 Ga0210000_10169493 119
731 3300027526 Ga0209968_1054170 Ga0209968_10541701 119
732 3300027614 Ga0209970_1007302 Ga0209970_10073023 119
733 3300027617 Ga0210002_1018709 Ga0210002_10187091 119
734 3300027682 Ga0209971_1008263 Ga0209971_10082632 119
735 3300027682 Ga0209971_1072879 Ga0209971_10728792 119
736 3300027695 Ga0209966_1015446 Ga0209966_10154461 119
737 3300027695 Ga0209966_1064389 Ga0209966_10643892 119
738 3300027717 Ga0209998_10007799 Ga0209998_100077994 119
739 3300027876 Ga0209974_10128081 Ga0209974_101280812 119
740 3300027907 Ga0207428_10156321 Ga0207428_101563212 119
741 3300027907 Ga0207428_10326338 Ga0207428_103263381 119
742 3300028379 Ga0268266_10080203 Ga0268266_100802032 119
743 3300028379 Ga0268266_10472430 Ga0268266_104724302 119
744 3300028379 Ga0268266_11790717 Ga0268266_117907171 119
745 3300028380 Ga0268265_10073416 Ga0268265_100734162 119
746 3300028380 Ga0268265_10087869 Ga0268265_100878692 119
747 3300028380 Ga0268265_10485084 Ga0268265_104850842 119
748 3300028380 Ga0268265_10498585 Ga0268265_104985852 119
749 3300028380 Ga0268265_10531940 Ga0268265_105319402 119
750 3300028381 Ga0268264_10019390 Ga0268264_100193904 119
751 3300028381 Ga0268264_10084470 Ga0268264_100844702 119
752 3300028381 Ga0268264_10133590 Ga0268264_101335902 119
753 3300028666 Ga0265336_10076650 Ga0265336_100766503 119
754 3300028786 Ga0307517_10228870 Ga0307517_102288702 119
755 3300028794 Ga0307515_10293201 Ga0307515_102932012 119
756 3300030521 Ga0307511_10344090 Ga0307511_103440902 119
757 3300031456 Ga0307513_10031619 Ga0307513_100316195 119
758 3300031456 Ga0307513_10076534 Ga0307513_100765343 119
759 3300031548 Ga0307408_100041613 Ga0307408_1000416136 119
760 3300031548 Ga0307408_100050815 Ga0307408_1000508152 119
761 3300031548 Ga0307408_101174283 Ga0307408_1011742831 119
762 3300031731 Ga0307405_10112123 Ga0307405_101121232 119
763 3300031731 Ga0307405_10112223 Ga0307405_101122233 119
764 3300031731 Ga0307405_10314844 Ga0307405_103148442 119
765 3300031731 Ga0307405_11443449 Ga0307405_114434491 119
766 3300031824 Ga0307413_10009445 Ga0307413_100094453 119
767 3300031852 Ga0307410_11196331 Ga0307410_111963311 119
768 3300031901 Ga0307406_10011667 Ga0307406_100116672 119
769 3300031903 Ga0307407_10205972 Ga0307407_102059722 119
770 3300031911 Ga0307412_10109505 Ga0307412_101095051 119
771 3300031911 Ga0307412_11011721 Ga0307412_110117211 119
772 3300031911 Ga0307412_11738684 Ga0307412_117386842 119
773 3300031995 Ga0307409_100030472 Ga0307409_1000304723 119
774 3300031995 Ga0307409_100072272 Ga0307409_1000722722 119
775 3300032002 Ga0307416_100007315 Ga0307416_1000073158 119
776 3300032002 Ga0307416_100446731 Ga0307416_1004467312 119
777 3300032004 Ga0307414_10497157 Ga0307414_104971571 119
778 3300032005 Ga0307411_10009093 Ga0307411_100090934 119
779 3300032005 Ga0307411_10742234 Ga0307411_107422342 119
780 3300032126 Ga0307415_100025640 Ga0307415_1000256402 119
781 3300032126 Ga0307415_100748194 Ga0307415_1007481942 119
782 3300032126 Ga0307415_101938870 Ga0307415_1019388701 119
783 3300034819 Ga0373958_0191400 Ga0373958_0191400_145_504 119
784 3300035241 Ga0373961_0182157 Ga0373961_0182157_91_450 119
785 3300035691 Ga0373931_0357414 Ga0373931_0357414_205_564 119
786 3300035691 Ga0373931_0452931 Ga0373931_0452931_22_381 119
787 3300037068 Ga0373925_0463292 Ga0373925_0463292_437_796 119
788 3300041451 Ga0451791_0408146 Ga0451791_0408146_583_948 119
789 3300041451 Ga0451791_1109250 Ga0451791_1109250_386_751 119
790 3300041452 Ga0451793_1139976 Ga0451793_1139976_147_506 119
791 3300041452 Ga0451793_1266290 Ga0451793_1266290_63_428 119
792 3300041453 Ga0451797_1322930 Ga0451797_1322930_1404_1769 119
793 3300041459 Ga0451800_0205198 Ga0451800_0205198_389_754 119
794 3300041460 Ga0451802_0332107 Ga0451802_0332107_597_962 119
795 3300041486 Ga0451807_0568058 Ga0451807_0568058_2166_2531 119
796 3300041494 Ga0451837_1029966 Ga0451837_1029966_2484_2849 119
797 3300041512 Ga0451853_2805711 Ga0451853_2805711_53_418 119
798 3300041512 Ga0451853_3090388 Ga0451853_3090388_126_485 119
799 3300041512 Ga0451853_3458144 Ga0451853_3458144_592_957 119
800 3300042001 Ga0439441_002708 Ga0439441_002708_129_488 119
801 3300042435 Ga0439434_0122921 Ga0439434_0122921_289_648 119
802 3300042437 Ga0439444_0086875 Ga0439444_0086875_300_665 119
803 3300042438 Ga0439459_0195351 Ga0439459_0195351_103_462 119
804 3300042461 Ga0439460_0087242 Ga0439460_0087242_91_450 119
805 3300044712 Ga0453684_2369017 Ga0453684_2369017_102_461 119
806 3300046454 Ga0495592_0567717 Ga0495592_0567717_224_583 119
807 3300046457 Ga0495590_0005899 Ga0495590_0005899_1930_2289 119
808 3300046460 Ga0495638_0031603 Ga0495638_0031603_1639_2001 119
809 3300046461 Ga0495641_0296405 Ga0495641_0296405_30_389 119
810 3300046471 Ga0495650_0087027 Ga0495650_0087027_589_948 119
811 3300046472 Ga0495580_0398656 Ga0495580_0398656_407_766 119
812 3300046475 Ga0495639_0047934 Ga0495639_0047934_730_1089 119
813 3300046491 Ga0495584_0711558 Ga0495584_0711558_73_435 119
814 3300046492 Ga0495585_0105295 Ga0495585_0105295_396_755 119
815 3300046492 Ga0495585_0360636 Ga0495585_0360636_190_549 119
816 3300046513 Ga0495616_0156341 Ga0495616_0156341_26_385 119
817 3300046514 Ga0495618_0118886 Ga0495618_0118886_1162_1521 119
818 3300046515 Ga0495620_0129520 Ga0495620_0129520_375_734 119
819 3300046516 Ga0495628_0229858 Ga0495628_0229858_562_921 119
820 3300046519 Ga0495632_0273994 Ga0495632_0273994_37_396 119
821 3300046529 Ga0495652_0186082 Ga0495652_0186082_937_1296 119
822 3300046533 Ga0495640_0574015 Ga0495640_0574015_77_475 119
823 3300046536 Ga0495587_0169715 Ga0495587_0169715_92_490 119
824 3300046536 Ga0495587_0394923 Ga0495587_0394923_196_555 119
825 3300046539 Ga0495621_0002870 Ga0495621_0002870_2017_2379 119
826 3300046539 Ga0495621_0153108 Ga0495621_0153108_403_762 119
827 3300046539 Ga0495621_0275249 Ga0495621_0275249_16_375 119
828 3300046559 Ga0495667_0155994 Ga0495667_0155994_346_705 119
829 3300046615 Ga0495656_0075175 Ga0495656_0075175_868_1227 119
830 3300046616 Ga0495668_0374095 Ga0495668_0374095_119_478 119
831 3300046660 Ga0495625_0060202 Ga0495625_0060202_734_1093 119
832 3300046660 Ga0495625_0081023 Ga0495625_0081023_1847_2206 119
833 3300046663 Ga0495635_0362707 Ga0495635_0362707_41_439 119
834 3300046678 Ga0495599_0237946 Ga0495599_0237946_462_860 119
835 3300046678 Ga0495599_0420483 Ga0495599_0420483_290_649 119
836 3300046694 Ga0495649_0506525 Ga0495649_0506525_135_494 119
837 3300047315 Ga0495581_0820107 Ga0495581_0820107_72_431 119
838 3300047317 Ga0495604_0119888 Ga0495604_0119888_827_1186 119
839 3300047317 Ga0495604_0771887 Ga0495604_0771887_12_371 119
840 3300047447 Ga0495685_019324 Ga0495685_019324_1574_1933 119
841 3300047471 Ga0495684_0817617 Ga0495684_0817617_124_483 119
842 3300048088 Ga0495602_0368870 Ga0495602_0368870_605_1003 119
843 3300048090 Ga0495615_0047193 Ga0495615_0047193_181_540 119
844 3300048091 Ga0495626_0116094 Ga0495626_0116094_634_993 119
845 3300048903 Ga0496100_0004400 Ga0496100_0004400_744_1103 119
846 3300048903 Ga0496100_0182201 Ga0496100_0182201_220_579 119
847 3300048905 Ga0496102_0095979 Ga0496102_0095979_941_1300 119
848 3300048906 Ga0496103_0026288 Ga0496103_0026288_418_777 119
849 3300048907 Ga0496104_0004927 Ga0496104_0004927_539_898 119
850 3300048907 Ga0496104_0294739 Ga0496104_0294739_641_1039 119
851 3300048908 Ga0496105_0010453 Ga0496105_0010453_749_1108 119
852 3300048908 Ga0496105_0721191 Ga0496105_0721191_329_727 119
853 3300048909 Ga0496106_0018018 Ga0496106_0018018_204_563 119
854 3300048910 Ga0496107_0001216 Ga0496107_0001216_711_1070 119
855 3300048911 Ga0496108_0001982 Ga0496108_0001982_1219_1578 119
856 3300048912 Ga0496109_0000633 Ga0496109_0000633_28747_29106 119
857 3300048912 Ga0496109_0111219 Ga0496109_0111219_941_1300 119
858 3300048913 Ga0496110_0007585 Ga0496110_0007585_6570_6929 119
859 3300048913 Ga0496110_0682383 Ga0496110_0682383_546_905 119
860 3300048914 Ga0496111_0006790 Ga0496111_0006790_5853_6212 119
861 3300048914 Ga0496111_0097382 Ga0496111_0097382_1219_1578 119
862 3300048915 Ga0496112_0000400 Ga0496112_0000400_18244_18603 119
863 3300048915 Ga0496112_0612154 Ga0496112_0612154_599_958 119
864 3300048915 Ga0496112_1148832 Ga0496112_1148832_181_540 119
865 3300048916 Ga0496113_0005600 Ga0496113_0005600_4990_5349 119
866 3300048916 Ga0496113_0051586 Ga0496113_0051586_2314_2673 119
867 3300048917 Ga0496114_0204233 Ga0496114_0204233_432_791 119
868 3300048917 Ga0496114_0272876 Ga0496114_0272876_139_498 119
869 3300048917 Ga0496114_0874533 Ga0496114_0874533_190_549 119
870 3300048918 Ga0496115_0022318 Ga0496115_0022318_3745_4104 119
871 3300048919 Ga0496116_0152320 Ga0496116_0152320_407_766 119
872 3300048920 Ga0496117_0316061 Ga0496117_0316061_217_576 119
873 3300048921 Ga0496118_0018464 Ga0496118_0018464_5345_5704 119
874 3300048924 Ga0496121_0105333 Ga0496121_0105333_1333_1692 119
875 3300048925 Ga0496122_0096002 Ga0496122_0096002_1191_1550 119
876 3300048926 Ga0496123_0100612 Ga0496123_0100612_444_803 119
877 3300048927 Ga0496124_0151279 Ga0496124_0151279_1274_1633 119
878 3300048928 Ga0496125_0000164 Ga0496125_0000164_140392_140751 119
879 3300049459 Ga0495678_163843 Ga0495678_163843_10_369 119
880 3300049520 Ga0501297_075804 Ga0501297_075804_169_528 119
881 3300049570 Ga0501033_0848342 Ga0501033_0848342_16_375 119
882 3300049572 Ga0501036_0521226 Ga0501036_0521226_135_527 119
883 3300049572 Ga0501036_0922313 Ga0501036_0922313_70_429 119
884 3300049572 Ga0501036_1068057 Ga0501036_1068057_51_410 119
885 3300049572 Ga0501036_1086425 Ga0501036_1086425_223_582 119
886 3300049574 Ga0501038_0169293 Ga0501038_0169293_16_408 119
887 3300049575 Ga0501039_0527053 Ga0501039_0527053_197_589 119
888 3300049575 Ga0501039_1317651 Ga0501039_1317651_46_405 119
889 3300049576 Ga0501040_0070046 Ga0501040_0070046_1373_1765 119
890 3300049576 Ga0501040_1041791 Ga0501040_1041791_14_373 119
891 3300049577 Ga0501041_0429632 Ga0501041_0429632_223_582 119
892 3300049577 Ga0501041_0447645 Ga0501041_0447645_173_532 119
893 3300049578 Ga0501042_0051674 Ga0501042_0051674_1366_1737 119
894 3300049578 Ga0501042_0519598 Ga0501042_0519598_247_606 119
895 3300049578 Ga0501042_0606226 Ga0501042_0606226_183_545 119
896 3300049578 Ga0501042_1055765 Ga0501042_1055765_185_544 119
897 3300049580 Ga0501046_0166832 Ga0501046_0166832_951_1310 119
898 3300049580 Ga0501046_0257553 Ga0501046_0257553_272_631 119
899 3300049582 Ga0501048_0227922 Ga0501048_0227922_554_946 119
900 3300049583 Ga0501067_0173646 Ga0501067_0173646_190_549 119
901 3300049584 Ga0501068_0025220 Ga0501068_0025220_1478_1837 119
902 3300049584 Ga0501068_0668236 Ga0501068_0668236_133_492 119
903 3300049585 Ga0501069_0130668 Ga0501069_0130668_404_763 119
904 3300049586 Ga0501070_0084140 Ga0501070_0084140_1530_1889 119
905 3300049587 Ga0501071_0085395 Ga0501071_0085395_1377_1736 119
906 3300049587 Ga0501071_0392564 Ga0501071_0392564_478_837 119
907 3300049588 Ga0501072_0301214 Ga0501072_0301214_451_810 119
908 3300049589 Ga0501073_0062627 Ga0501073_0062627_544_903 119
909 3300049589 Ga0501073_0408892 Ga0501073_0408892_109_471 119
910 3300049590 Ga0501074_0285423 Ga0501074_0285423_692_1051 119
911 3300049590 Ga0501074_0379355 Ga0501074_0379355_331_690 119
912 3300049590 Ga0501074_1141699 Ga0501074_1141699_117_476 119
913 3300049591 Ga0501075_0129719 Ga0501075_0129719_899_1258 119
914 3300049591 Ga0501075_0279702 Ga0501075_0279702_869_1228 119
915 3300049591 Ga0501075_0310909 Ga0501075_0310909_725_1084 119
916 3300049591 Ga0501075_0498458 Ga0501075_0498458_138_497 119
917 3300049591 Ga0501075_1122258 Ga0501075_1122258_172_531 119
918 3300049591 Ga0501075_1311480 Ga0501075_1311480_101_496 119
919 3300049592 Ga0501076_0045487 Ga0501076_0045487_2994_3386 119
920 3300049592 Ga0501076_0247013 Ga0501076_0247013_296_655 119
921 3300049592 Ga0501076_0362875 Ga0501076_0362875_346_705 119
922 3300049592 Ga0501076_0483046 Ga0501076_0483046_139_498 119
923 3300049592 Ga0501076_0543079 Ga0501076_0543079_293_652 119
924 3300049592 Ga0501076_0959496 Ga0501076_0959496_192_551 119
925 3300049593 Ga0501077_0280574 Ga0501077_0280574_175_534 119
926 3300049593 Ga0501077_0305632 Ga0501077_0305632_571_930 119
927 3300049593 Ga0501077_0386524 Ga0501077_0386524_239_631 119
928 3300049593 Ga0501077_0452288 Ga0501077_0452288_192_551 119
929 3300049741 Ga0501079_0106401 Ga0501079_0106401_139_498 119
930 3300049741 Ga0501079_0252495 Ga0501079_0252495_449_808 119
931 3300049741 Ga0501079_0468376 Ga0501079_0468376_550_912 119
932 3300049741 Ga0501079_0567044 Ga0501079_0567044_423_815 119
933 3300049742 Ga0501080_0442922 Ga0501080_0442922_598_957 119
934 3300049742 Ga0501080_1323437 Ga0501080_1323437_10_402 119
935 3300049743 Ga0501081_0088873 Ga0501081_0088873_1754_2113 119
936 3300049743 Ga0501081_0294962 Ga0501081_0294962_132_491 119
937 3300049743 Ga0501081_0324108 Ga0501081_0324108_214_573 119
938 3300049743 Ga0501081_1077780 Ga0501081_1077780_239_598 119
939 3300049744 Ga0501083_0130949 Ga0501083_0130949_479_838 119
940 3300049822 Ga0501035_0156134 Ga0501035_0156134_867_1226 119
941 3300049823 Ga0501044_1171247 Ga0501044_1171247_152_511 119
942 3300050489 nmdc:mga03683_39084_c1 nmdc:mga03683_39084_c1_1536_1895 119
943 3300050489 nmdc:mga03683_61999_c1 nmdc:mga03683_61999_c1_988_1347 119
944 3300050489 nmdc:mga03683_78013_c1 nmdc:mga03683_78013_c1_355_747 119
945 3300050490 nmdc:mga03n38_1178_c1 nmdc:mga03n38_1178_c1_5772_6164 119
946 3300050490 nmdc:mga03n38_194356_c1 nmdc:mga03n38_194356_c1_596_955 119
947 3300050490 nmdc:mga03n38_961607_c1 nmdc:mga03n38_961607_c1_124_489 119
948 3300050491 nmdc:mga00v17_397260_c1 nmdc:mga00v17_397260_c1_55_414 119
949 3300050492 nmdc:mga0yw44_10029_c1 nmdc:mga0yw44_10029_c1_372_731 119
950 3300050492 nmdc:mga0yw44_212548_c1 nmdc:mga0yw44_212548_c1_877_1236 119
951 3300050492 nmdc:mga0yw44_29263_c2 nmdc:mga0yw44_29263_c2_173_538 119
952 3300050492 nmdc:mga0yw44_832033_c1 nmdc:mga0yw44_832033_c1_35_394 119
953 3300050494 nmdc:mga06z11_136192_c1 nmdc:mga06z11_136192_c1_824_1183 119
954 3300050494 nmdc:mga06z11_206027_c1 nmdc:mga06z11_206027_c1_496_855 119
955 3300050494 nmdc:mga06z11_224408_c1 nmdc:mga06z11_224408_c1_551_910 119
956 3300050494 nmdc:mga06z11_3732_c1 nmdc:mga06z11_3732_c1_1079_1471 119
957 3300050496 nmdc:mga07m45_134146_c1 nmdc:mga07m45_134146_c1_215_574 119
958 3300050496 nmdc:mga07m45_1587_c1 nmdc:mga07m45_1587_c1_4614_5006 119
959 3300050507 nmdc:mga05p37_102920_c1 nmdc:mga05p37_102920_c1_1413_1772 119
960 3300050507 nmdc:mga05p37_2192820_c1 nmdc:mga05p37_2192820_c1_118_477 119
961 3300050507 nmdc:mga05p37_348_c1 nmdc:mga05p37_348_c1_20610_20969 119
962 3300050507 nmdc:mga05p37_468372_c1 nmdc:mga05p37_468372_c1_714_1073 119
963 3300050508 nmdc:mga09592_151652_c1 nmdc:mga09592_151652_c1_106_465 119
964 3300050508 nmdc:mga09592_5_c1 nmdc:mga09592_5_c1_104364_104723 119
965 3300050509 nmdc:mga0qj67_1273265_c1 nmdc:mga0qj67_1273265_c1_84_443 119
966 3300050509 nmdc:mga0qj67_45509_c1 nmdc:mga0qj67_45509_c1_469_828 119
967 3300050510 nmdc:mga06r32_102295_c1 nmdc:mga06r32_102295_c1_1288_1647 119
968 3300050510 nmdc:mga06r32_11679_c1 nmdc:mga06r32_11679_c1_6283_6642 119
969 3300050510 nmdc:mga06r32_191709_c1 nmdc:mga06r32_191709_c1_222_581 119
970 3300050510 nmdc:mga06r32_314673_c1 nmdc:mga06r32_314673_c1_1085_1444 119
971 3300050510 nmdc:mga06r32_950258_c1 nmdc:mga06r32_950258_c1_54_413 119
972 3300050510 nmdc:mga06r32_96986_c1 nmdc:mga06r32_96986_c1_12_377 119
973 3300050511 nmdc:mga08y16_221905_c1 nmdc:mga08y16_221905_c1_912_1271 119
974 3300050511 nmdc:mga08y16_230263_c1 nmdc:mga08y16_230263_c1_1485_1850 119
975 3300050511 nmdc:mga08y16_30230_c1 nmdc:mga08y16_30230_c1_55_414 119
976 3300050511 nmdc:mga08y16_50531_c1 nmdc:mga08y16_50531_c1_2619_3038 119
977 3300050511 nmdc:mga08y16_955334_c1 nmdc:mga08y16_955334_c1_387_749 119
978 3300050512 nmdc:mga0n895_413112_c1 nmdc:mga0n895_413112_c1_216_578 119
979 3300050512 nmdc:mga0n895_42972_c1 nmdc:mga0n895_42972_c1_309_668 119
980 3300050513 nmdc:mga0rr50_1077155_c1 nmdc:mga0rr50_1077155_c1_215_574 119
981 3300050515 nmdc:mga0a205_779377_c1 nmdc:mga0a205_779377_c1_73_435 119
982 3300050516 nmdc:mga0sz30_62707_c1 nmdc:mga0sz30_62707_c1_460_891 119
983 3300053077 Ga0495601_0013981 Ga0495601_0013981_4346_4705 119
984 3300053078 Ga0495612_0094096 Ga0495612_0094096_538_897 119
985 3300053080 Ga0500635_0102332 Ga0500635_0102332_526_885 119
986 3300053083 Ga0495655_0000628 Ga0495655_0000628_2409_2768 119
987 3300053084 Ga0495595_0155983 Ga0495595_0155983_686_1084 119
988 3300053085 Ga0495619_0380483 Ga0495619_0380483_26_424 119
989 3300053121 Ga0500607_259147 Ga0500607_259147_154_513 119
990 3300053125 Ga0500618_005777 Ga0500618_005777_512_871 119
991 3300053723 Ga0500567_043907 Ga0500567_043907_1681_2040 119
992 3300054114 Ga0501084_0073208 Ga0501084_0073208_1096_1455 119
993 3300054114 Ga0501084_0073995 Ga0501084_0073995_992_1351 119
994 3300054114 Ga0501084_1618901 Ga0501084_1618901_77_436 119
995 3300060353 Ga0501082_0182537 Ga0501082_0182537_1050_1409 119
996 3300060353 Ga0501082_0251458 Ga0501082_0251458_144_536 119
997 2162886007 SwRhRL2b_contig_442106 SwRhRL2b_0138.00001650 120
998 2162886007 SwRhRL2b_contig_844195 SwRhRL2b_0989.00005140 120
999 3300005295 Ga0065707_10349446 Ga0065707_103494462 120
1000 3300005295 Ga0065707_10546411 Ga0065707_105464112 120
1001 3300005444 Ga0070694_100276844 Ga0070694_1002768442 120
1002 3300005468 Ga0070707_100282148 Ga0070707_1002821482 120
1003 3300005471 Ga0070698_101671845 Ga0070698_1016718451 120
1004 3300005518 Ga0070699_100000012 Ga0070699_10000001263 120
1005 3300005536 Ga0070697_101005284 Ga0070697_1010052841 120
1006 3300005617 Ga0068859_100620354 Ga0068859_1006203542 120
1007 3300005617 Ga0068859_100905409 Ga0068859_1009054092 120
1008 3300005841 Ga0068863_100113905 Ga0068863_1001139051 120
1009 3300005842 Ga0068858_100005836 Ga0068858_1000058367 120
1010 3300005843 Ga0068860_100543002 Ga0068860_1005430022 120
1011 3300006058 Ga0075432_10552234 Ga0075432_105522341 120
1012 3300006237 Ga0097621_100205331 Ga0097621_1002053311 120
1013 3300006871 Ga0075434_101521405 Ga0075434_1015214052 120
1014 3300006880 Ga0075429_101426640 Ga0075429_1014266402 120
1015 3300006931 Ga0097620_100620283 Ga0097620_1006202832 120
1016 3300006931 Ga0097620_100905368 Ga0097620_1009053682 120
1017 3300007788 Ga0099795_10000022 Ga0099795_1000002234 120
1018 3300009094 Ga0111539_10025568 Ga0111539_100255686 120
1019 3300009101 Ga0105247_10002316 Ga0105247_100023167 120
1020 3300009147 Ga0114129_10452513 Ga0114129_104525132 120
1021 3300009147 Ga0114129_11712671 Ga0114129_117126711 120
1022 3300009176 Ga0105242_13157271 Ga0105242_131572711 120
1023 3300009177 Ga0105248_10031395 Ga0105248_100313955 120
1024 3300009177 Ga0105248_10310970 Ga0105248_103109702 120
1025 3300009545 Ga0105237_11227353 Ga0105237_112273532 120
1026 3300009551 Ga0105238_10216685 Ga0105238_102166854 120
1027 3300009553 Ga0105249_10597082 Ga0105249_105970822 120
1028 3300010159 Ga0099796_10000153 Ga0099796_100001537 120
1029 3300013306 Ga0163162_10057411 Ga0163162_100574118 120
1030 3300014325 Ga0163163_10271568 Ga0163163_102715681 120
1031 3300014968 Ga0157379_10013529 Ga0157379_100135294 120
1032 3300014968 Ga0157379_10053782 Ga0157379_100537823 120
1033 3300025903 Ga0207680_10312532 Ga0207680_103125322 120
1034 3300025914 Ga0207671_10731091 Ga0207671_107310911 120
1035 3300025918 Ga0207662_10267689 Ga0207662_102676892 120
1036 3300025922 Ga0207646_10935093 Ga0207646_109350932 120
1037 3300025924 Ga0207694_10613141 Ga0207694_106131412 120
1038 3300025924 Ga0207694_10954270 Ga0207694_109542701 120
1039 3300025933 Ga0207706_10192645 Ga0207706_101926453 120
1040 3300025934 Ga0207686_10025970 Ga0207686_100259702 120
1041 3300025941 Ga0207711_10046436 Ga0207711_100464362 120
1042 3300025961 Ga0207712_10112492 Ga0207712_101124922 120
1043 3300025981 Ga0207640_10734150 Ga0207640_107341502 120
1044 3300025986 Ga0207658_10000197 Ga0207658_1000019728 120
1045 3300026035 Ga0207703_10422123 Ga0207703_104221232 120
1046 3300026088 Ga0207641_10183121 Ga0207641_101831211 120
1047 3300027907 Ga0207428_10221566 Ga0207428_102215661 120
1048 3300028794 Ga0307515_10000358 Ga0307515_1000035810 120
1049 3300031665 Ga0316575_10054229 Ga0316575_100542291 120
1050 3300031691 Ga0316579_10046748 Ga0316579_100467483 120
1051 3300031727 Ga0316576_10167592 Ga0316576_101675923 120
1052 3300031728 Ga0316578_10072822 Ga0316578_100728223 120
1053 3300031730 Ga0307516_10824918 Ga0307516_108249182 120
1054 3300031733 Ga0316577_10016044 Ga0316577_100160444 120
1055 3300032137 Ga0316585_10010265 Ga0316585_100102653 120
1056 3300032139 Ga0316580_10049611 Ga0316580_100496112 120
1057 3300035398 Ga0316574_0079917 Ga0316574_0079917_1240_1602 120
1058 3300036712 Ga0316584_0229151 Ga0316584_0229151_253_615 120
1059 3300041413 Ga0439465_0281421 Ga0439465_0281421_60_425 120
1060 3300042004 Ga0439445_0057312 Ga0439445_0057312_148_513 120
1061 3300045051 Ga0451576_1684726 Ga0451576_1684726_102_464 120
1062 3300050507 nmdc:mga05p37_1689629_c1 nmdc:mga05p37_1689629_c1_177_539 120
1063 3300050507 nmdc:mga05p37_448926_c1 nmdc:mga05p37_448926_c1_969_1331 120
1064 3300050508 nmdc:mga09592_1260904_c1 nmdc:mga09592_1260904_c1_235_597 120
1065 3300050511 nmdc:mga08y16_399159_c1 nmdc:mga08y16_399159_c1_885_1247 120
1066 3300050515 nmdc:mga0a205_506359_c1 nmdc:mga0a205_506359_c1_278_640 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

2

105

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9287 2 118
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9251 2 120
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8845 2 118
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8504 2 120
8avi-assembly1.cif.gz_B crystal structure of isdg from bacillus cereus in complex with heme 0.7765 4 120
ID Description Score Start End Superfamily
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9346 3 120 3.30.70.100
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9194 3 120 3.30.70.100
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7711 1 119 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7483 2 117 3.30.70.100
4dpoB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7472 3 116 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4R2I8P8-F1-model_v4 Uncharacterized protein YbaA (DUF1428 family) 0.9604 3 120
AF-A0A2W7C8D6-F1-model_v4 RNA signal recognition particle 0.9591 3 120
AF-A0A6J4S241-F1-model_v4 RNA signal recognition particle 4.5S RNA 0.9583 2 120
AF-A0A442F9M7-F1-model_v4 DUF1428 family protein 0.958 3 120
AF-A0A2P9AJ88-F1-model_v4 RNA signal recognition particle 4.5S RNA 0.9576 3 120

Feature Viewer

pLDDT pTM Quality
91.56 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map