F489393
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1066 | 372 | 1062 | 359 |
Family's Representative Sequence
| Representative Sequence | 3300005530|Ga0070679_100075972|Ga0070679_1000759722 |
| Length | 420 |
| Sequence | MATDIWQPAQAALFFPGPEAKASNMIAWLVECGQFHSRSRFTSAAFQPPLLYTGVFTAMKNRQPIGILGATGMVGQRYIQLLENHPFFEITWLAASDRSSGKAYGEAAKWRLDTPLPERIARMTVSPAEPEGAPKVIFASVDAAIAREMEPKFAAAGCAVISNSSAFRMAPNVPLVIPEVNSDHLHLIEEQPWRKDSGGYIVTNPNCSTIGLVMALKPIEERFGIEQIFATTMQAVSGAGYPGVASMDILDNVVPYIGGEEEKMESETLKLLGALDGHAVKPLAAGMTAHCNRVPVIDGHTECVSIKLGKKLGREVTQEDILAAWAEFQPLAGLNLPFAPGQPVEWSALPDRPQPRLDRNRGRGMAVTVGRLRPCNLLDWKFVLLSHNTVRGAAGATILNAEMLASLGKLEPATAVATHV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 2 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 3 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 115 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 190 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 192 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 201 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 214 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 235 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 236 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 237 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 238 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 239 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 240 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 241 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 242 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 243 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 244 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 312 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 313 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 314 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 315 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 322 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 323 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 325 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 326 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 327 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 346 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 364 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 365 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 366 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 367 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 368 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 369 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 370 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 372 | 8055632911 | Paenibacillus radicibacter N1-5-1-14 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.44 |
| Metatranscriptomes | 0.19 |
| Isolates | 0.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0 |
| Rhizoplane | 2.81 |
| Rhizosphere | 95.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10011800 | 3300001991 | Unclassified | 1580 |
| 2 | JGI25406J46586_10005411 | 3300003203 | Bacteria | 5923 |
| 3 | Ga0065704_10090535 | 3300005289 | Unclassified | 2780 |
| 4 | Ga0065712_10091258 | 3300005290 | Unclassified | 2382 |
| 5 | Ga0065707_10001119 | 3300005295 | Bacteria | 8234 |
| 6 | Ga0070658_10000048 | 3300005327 | Bacteria | 122132 |
| 7 | Ga0070658_10016381 | 3300005327 | Bacteria | 5931 |
| 8 | Ga0070658_10042434 | 3300005327 | Bacteria | 3674 |
| 9 | Ga0070658_10119728 | 3300005327 | Bacteria | 2187 |
| 10 | Ga0070683_100007811 | 3300005329 | Bacteria | 9058 |
| 11 | Ga0070683_100008501 | 3300005329 | Bacteria | 8721 |
| 12 | Ga0070683_100011715 | 3300005329 | Bacteria | 7593 |
| 13 | Ga0070683_100118401 | 3300005329 | Unclassified | 2501 |
| 14 | Ga0070683_100172114 | 3300005329 | Unclassified | 2055 |
| 15 | Ga0070683_100382503 | 3300005329 | Unclassified | 1341 |
| 16 | Ga0070690_100003413 | 3300005330 | Bacteria | 8689 |
| 17 | Ga0070670_100001371 | 3300005331 | Bacteria | 19499 |
| 18 | Ga0070670_100323744 | 3300005331 | Unclassified | 1351 |
| 19 | Ga0070670_100371546 | 3300005331 | Bacteria | 1259 |
| 20 | Ga0070677_10002326 | 3300005333 | Bacteria | 6073 |
| 21 | Ga0068869_100000150 | 3300005334 | Bacteria | 34437 |
| 22 | Ga0070666_10054200 | 3300005335 | Bacteria | 2705 |
| 23 | Ga0070666_10077700 | 3300005335 | Bacteria | 2265 |
| 24 | Ga0070680_100002837 | 3300005336 | Bacteria | 12876 |
| 25 | Ga0070680_100012003 | 3300005336 | Bacteria | 6720 |
| 26 | Ga0070680_100051607 | 3300005336 | Unclassified | 3356 |
| 27 | Ga0070680_100095609 | 3300005336 | Bacteria | 2463 |
| 28 | Ga0068868_100001048 | 3300005338 | Bacteria | 18896 |
| 29 | Ga0068868_100002969 | 3300005338 | Bacteria | 11774 |
| 30 | Ga0068868_100104213 | 3300005338 | Bacteria | 2298 |
| 31 | Ga0068868_100346532 | 3300005338 | Unclassified | 1271 |
| 32 | Ga0070660_100010244 | 3300005339 | Bacteria | 6615 |
| 33 | Ga0070660_100032029 | 3300005339 | Bacteria | 3953 |
| 34 | Ga0070689_100342525 | 3300005340 | Unclassified | 1252 |
| 35 | Ga0070691_10066505 | 3300005341 | Bacteria | 1742 |
| 36 | Ga0070661_100016773 | 3300005344 | Bacteria | 5185 |
| 37 | Ga0070661_100026896 | 3300005344 | Bacteria | 4141 |
| 38 | Ga0070668_100069089 | 3300005347 | Bacteria | 2748 |
| 39 | Ga0070675_100009318 | 3300005354 | Bacteria | 7634 |
| 40 | Ga0070675_100207461 | 3300005354 | Unclassified | 1702 |
| 41 | Ga0070675_100253119 | 3300005354 | Bacteria | 1542 |
| 42 | Ga0070671_100000679 | 3300005355 | Bacteria | 24402 |
| 43 | Ga0070671_100006131 | 3300005355 | Bacteria | 9576 |
| 44 | Ga0070671_100021203 | 3300005355 | Bacteria | 5305 |
| 45 | Ga0070671_100032834 | 3300005355 | Bacteria | 4290 |
| 46 | Ga0070671_100098145 | 3300005355 | Bacteria | 2457 |
| 47 | Ga0070674_100015728 | 3300005356 | Bacteria | 4730 |
| 48 | Ga0070673_100027927 | 3300005364 | Bacteria | 4190 |
| 49 | Ga0070688_100126243 | 3300005365 | Bacteria | 1720 |
| 50 | Ga0070659_100001855 | 3300005366 | Bacteria | 15194 |
| 51 | Ga0070659_100007704 | 3300005366 | Bacteria | 7832 |
| 52 | Ga0070659_100093945 | 3300005366 | Bacteria | 2407 |
| 53 | Ga0070659_100321695 | 3300005366 | Bacteria | 1293 |
| 54 | Ga0070667_100007254 | 3300005367 | Bacteria | 9211 |
| 55 | Ga0070667_100028591 | 3300005367 | Bacteria | 4642 |
| 56 | Ga0070667_100099279 | 3300005367 | Unclassified | 2513 |
| 57 | Ga0070709_10020442 | 3300005434 | Bacteria | 3841 |
| 58 | Ga0070714_100012873 | 3300005435 | Bacteria | 6687 |
| 59 | Ga0070714_100057585 | 3300005435 | Bacteria | 3327 |
| 60 | Ga0070713_100030864 | 3300005436 | Bacteria | 4262 |
| 61 | Ga0070713_100054118 | 3300005436 | Unclassified | 3328 |
| 62 | Ga0070713_100067642 | 3300005436 | Bacteria | 3008 |
| 63 | Ga0070713_100117097 | 3300005436 | Bacteria | 2331 |
| 64 | Ga0070710_10052253 | 3300005437 | Unclassified | 2298 |
| 65 | Ga0070710_10077580 | 3300005437 | Bacteria | 1931 |
| 66 | Ga0070711_100001578 | 3300005439 | Bacteria | 12540 |
| 67 | Ga0070711_100003134 | 3300005439 | Bacteria | 9586 |
| 68 | Ga0070711_100009637 | 3300005439 | Bacteria | 5952 |
| 69 | Ga0070711_100079522 | 3300005439 | Bacteria | 2332 |
| 70 | Ga0070694_100057648 | 3300005444 | Bacteria | 2641 |
| 71 | Ga0070708_100024498 | 3300005445 | Bacteria | 5151 |
| 72 | Ga0070708_100034419 | 3300005445 | Bacteria | 4408 |
| 73 | Ga0070708_100061577 | 3300005445 | Unclassified | 3353 |
| 74 | Ga0070663_100026503 | 3300005455 | Bacteria | 3927 |
| 75 | Ga0070663_100093285 | 3300005455 | Bacteria | 2233 |
| 76 | Ga0070662_100038077 | 3300005457 | Bacteria | 3414 |
| 77 | Ga0070681_10000514 | 3300005458 | Bacteria | 31694 |
| 78 | Ga0070681_10010407 | 3300005458 | Bacteria | 9186 |
| 79 | Ga0070681_10051656 | 3300005458 | Bacteria | 4100 |
| 80 | Ga0070681_10173043 | 3300005458 | Bacteria | 2081 |
| 81 | Ga0070681_10226871 | 3300005458 | Unclassified | 1782 |
| 82 | Ga0070706_100000509 | 3300005467 | Bacteria | 45647 |
| 83 | Ga0070706_100001098 | 3300005467 | Bacteria | 29248 |
| 84 | Ga0070706_100038175 | 3300005467 | Bacteria | 4434 |
| 85 | Ga0070707_100001894 | 3300005468 | Bacteria | 20046 |
| 86 | Ga0070707_100008854 | 3300005468 | Bacteria | 9333 |
| 87 | Ga0070707_100021182 | 3300005468 | Bacteria | 6143 |
| 88 | Ga0070707_100044371 | 3300005468 | Unclassified | 4256 |
| 89 | Ga0070707_100128880 | 3300005468 | Archaea | 2459 |
| 90 | Ga0070698_100007264 | 3300005471 | Bacteria | 12000 |
| 91 | Ga0070698_100300686 | 3300005471 | Bacteria | 1535 |
| 92 | Ga0070699_100001428 | 3300005518 | Bacteria | 21945 |
| 93 | Ga0070699_100014915 | 3300005518 | Bacteria | 6681 |
| 94 | Ga0070699_100028220 | 3300005518 | Bacteria | 4841 |
| 95 | Ga0070699_100125696 | 3300005518 | Unclassified | 2257 |
| 96 | Ga0070699_100262862 | 3300005518 | Unclassified | 1544 |
| 97 | Ga0070699_100263534 | 3300005518 | Bacteria | 1541 |
| 98 | Ga0070699_100279899 | 3300005518 | Bacteria | 1494 |
| 99 | Ga0070679_100001505 | 3300005530 | Bacteria | 20715 |
| 100 | Ga0070679_100005422 | 3300005530 | Bacteria | 11821 |
| 101 | Ga0070679_100010655 | 3300005530 | Bacteria | 8724 |
| 102 | Ga0070679_100049509 | 3300005530 | Bacteria | 4185 |
| 103 | Ga0070679_100073747 | 3300005530 | Bacteria | 3404 |
| 104 | Ga0070679_100075972 | 3300005530 | Bacteria | 3349 |
| 105 | Ga0070679_100076842 | 3300005530 | Bacteria | 3328 |
| 106 | Ga0070679_100491511 | 3300005530 | Bacteria | 1171 |
| 107 | Ga0070684_100000615 | 3300005535 | Bacteria | 24555 |
| 108 | Ga0070684_100005285 | 3300005535 | Bacteria | 9881 |
| 109 | Ga0070684_100030864 | 3300005535 | Bacteria | 4558 |
| 110 | Ga0070697_100012833 | 3300005536 | Bacteria | 6563 |
| 111 | Ga0070697_100046211 | 3300005536 | Bacteria | 3529 |
| 112 | Ga0068853_100000021 | 3300005539 | Bacteria | 149283 |
| 113 | Ga0068853_100000530 | 3300005539 | Bacteria | 25896 |
| 114 | Ga0068853_100004354 | 3300005539 | Bacteria | 10959 |
| 115 | Ga0068853_100123557 | 3300005539 | Bacteria | 2311 |
| 116 | Ga0070672_100022363 | 3300005543 | Bacteria | 4644 |
| 117 | Ga0070686_100005851 | 3300005544 | Bacteria | 6814 |
| 118 | Ga0070695_100101656 | 3300005545 | Unclassified | 1937 |
| 119 | Ga0070695_100281244 | 3300005545 | Bacteria | 1222 |
| 120 | Ga0070696_100049197 | 3300005546 | Unclassified | 2928 |
| 121 | Ga0070693_100084193 | 3300005547 | Bacteria | 1903 |
| 122 | Ga0070665_100003253 | 3300005548 | Bacteria | 17456 |
| 123 | Ga0070665_100011303 | 3300005548 | Bacteria | 9029 |
| 124 | Ga0070665_100203379 | 3300005548 | Bacteria | 1981 |
| 125 | Ga0070665_100301789 | 3300005548 | Bacteria | 1604 |
| 126 | Ga0070665_100365480 | 3300005548 | Bacteria | 1449 |
| 127 | Ga0070704_100063711 | 3300005549 | Bacteria | 2647 |
| 128 | Ga0068855_100003888 | 3300005563 | Bacteria | 18249 |
| 129 | Ga0068855_100004226 | 3300005563 | Bacteria | 17533 |
| 130 | Ga0068855_100009115 | 3300005563 | Bacteria | 11986 |
| 131 | Ga0068855_100016084 | 3300005563 | Bacteria | 8997 |
| 132 | Ga0068855_100024264 | 3300005563 | Bacteria | 7261 |
| 133 | Ga0068855_100042381 | 3300005563 | Bacteria | 5393 |
| 134 | Ga0068855_100042577 | 3300005563 | Bacteria | 5380 |
| 135 | Ga0068855_100044346 | 3300005563 | Bacteria | 5263 |
| 136 | Ga0068855_100047785 | 3300005563 | Bacteria | 5054 |
| 137 | Ga0068855_100070217 | 3300005563 | Bacteria | 4075 |
| 138 | Ga0068855_100234072 | 3300005563 | Bacteria | 2055 |
| 139 | Ga0068855_100339224 | 3300005563 | Bacteria | 1657 |
| 140 | Ga0070664_100115697 | 3300005564 | Unclassified | 2344 |
| 141 | Ga0070664_100118583 | 3300005564 | Unclassified | 2315 |
| 142 | Ga0068857_100000546 | 3300005577 | Bacteria | 27403 |
| 143 | Ga0068857_100006714 | 3300005577 | Bacteria | 9892 |
| 144 | Ga0068857_100034505 | 3300005577 | Bacteria | 4475 |
| 145 | Ga0068857_100099984 | 3300005577 | Bacteria | 2602 |
| 146 | Ga0068857_100362345 | 3300005577 | Bacteria | 1344 |
| 147 | Ga0068854_100000058 | 3300005578 | Bacteria | 82001 |
| 148 | Ga0068856_100003679 | 3300005614 | Bacteria | 15383 |
| 149 | Ga0068856_100006800 | 3300005614 | Bacteria | 11195 |
| 150 | Ga0068856_100011402 | 3300005614 | Bacteria | 8621 |
| 151 | Ga0068856_100031462 | 3300005614 | Bacteria | 5191 |
| 152 | Ga0068856_100035677 | 3300005614 | Bacteria | 4874 |
| 153 | Ga0068856_100045450 | 3300005614 | Bacteria | 4324 |
| 154 | Ga0068856_100293219 | 3300005614 | Bacteria | 1643 |
| 155 | Ga0068852_100000015 | 3300005616 | Bacteria | 134085 |
| 156 | Ga0068852_100001731 | 3300005616 | Bacteria | 14875 |
| 157 | Ga0068852_100021040 | 3300005616 | Bacteria | 5198 |
| 158 | Ga0068852_100044115 | 3300005616 | Bacteria | 3785 |
| 159 | Ga0068852_100084535 | 3300005616 | Bacteria | 2824 |
| 160 | Ga0068852_100140064 | 3300005616 | Bacteria | 2238 |
| 161 | Ga0068852_100191105 | 3300005616 | Bacteria | 1932 |
| 162 | Ga0068859_100008509 | 3300005617 | Bacteria | 10383 |
| 163 | Ga0068859_100057196 | 3300005617 | Bacteria | 3928 |
| 164 | Ga0068859_100144400 | 3300005617 | Bacteria | 2454 |
| 165 | Ga0068859_100290861 | 3300005617 | Unclassified | 1727 |
| 166 | Ga0068859_100476660 | 3300005617 | Unclassified | 1343 |
| 167 | Ga0068864_100000358 | 3300005618 | Bacteria | 40190 |
| 168 | Ga0068864_100004818 | 3300005618 | Bacteria | 11061 |
| 169 | Ga0068866_10074774 | 3300005718 | Bacteria | 1802 |
| 170 | Ga0068851_10060668 | 3300005834 | Bacteria | 1937 |
| 171 | Ga0068851_10087750 | 3300005834 | Unclassified | 1634 |
| 172 | Ga0068870_10059368 | 3300005840 | Unclassified | 2050 |
| 173 | Ga0068870_10213089 | 3300005840 | Bacteria | 1178 |
| 174 | Ga0068863_100002705 | 3300005841 | Bacteria | 17510 |
| 175 | Ga0068863_100024932 | 3300005841 | Bacteria | 5705 |
| 176 | Ga0068858_100001959 | 3300005842 | Bacteria | 21012 |
| 177 | Ga0068860_100000809 | 3300005843 | Bacteria | 35018 |
| 178 | Ga0068860_100069366 | 3300005843 | Bacteria | 3350 |
| 179 | Ga0068862_100050254 | 3300005844 | Bacteria | 3563 |
| 180 | Ga0068862_100052937 | 3300005844 | Unclassified | 3474 |
| 181 | Ga0068862_100060611 | 3300005844 | Bacteria | 3251 |
| 182 | Ga0068862_100176540 | 3300005844 | Unclassified | 1915 |
| 183 | Ga0068862_100239065 | 3300005844 | Bacteria | 1650 |
| 184 | Ga0081540_1017614 | 3300005983 | Bacteria | 4414 |
| 185 | Ga0081539_10001697 | 3300005985 | Bacteria | 35528 |
| 186 | Ga0070717_10002932 | 3300006028 | Bacteria | 12112 |
| 187 | Ga0070717_10003518 | 3300006028 | Bacteria | 11223 |
| 188 | Ga0070715_10039657 | 3300006163 | Bacteria | 1963 |
| 189 | Ga0070716_100000278 | 3300006173 | Bacteria | 20754 |
| 190 | Ga0070716_100003816 | 3300006173 | Bacteria | 7150 |
| 191 | Ga0070712_100001997 | 3300006175 | Bacteria | 12488 |
| 192 | Ga0070712_100084158 | 3300006175 | Unclassified | 2312 |
| 193 | Ga0070712_100137033 | 3300006175 | Bacteria | 1862 |
| 194 | Ga0070712_100168455 | 3300006175 | Bacteria | 1697 |
| 195 | Ga0097621_100022382 | 3300006237 | Bacteria | 4906 |
| 196 | Ga0097621_100098149 | 3300006237 | Bacteria | 2460 |
| 197 | Ga0068871_100003433 | 3300006358 | Bacteria | 10897 |
| 198 | Ga0068871_100022353 | 3300006358 | Bacteria | 4875 |
| 199 | Ga0075428_100026112 | 3300006844 | Bacteria | 6467 |
| 200 | Ga0075428_100186843 | 3300006844 | Bacteria | 2242 |
| 201 | Ga0075430_100087245 | 3300006846 | Unclassified | 2611 |
| 202 | Ga0075431_100205288 | 3300006847 | Bacteria | 2015 |
| 203 | Ga0075433_10042358 | 3300006852 | Unclassified | 3950 |
| 204 | Ga0075433_10083064 | 3300006852 | Bacteria | 2826 |
| 205 | Ga0075434_100092569 | 3300006871 | Bacteria | 3026 |
| 206 | Ga0075434_100260111 | 3300006871 | Unclassified | 1754 |
| 207 | Ga0075429_100086347 | 3300006880 | Bacteria | 2735 |
| 208 | Ga0068865_100054418 | 3300006881 | Bacteria | 2780 |
| 209 | Ga0075436_100016127 | 3300006914 | Bacteria | 5115 |
| 210 | Ga0097620_100008509 | 3300006931 | Bacteria | 10383 |
| 211 | Ga0097620_100057194 | 3300006931 | Bacteria | 3928 |
| 212 | Ga0097620_100144394 | 3300006931 | Bacteria | 2454 |
| 213 | Ga0097620_100290839 | 3300006931 | Unclassified | 1727 |
| 214 | Ga0097620_100476657 | 3300006931 | Unclassified | 1343 |
| 215 | Ga0105240_10000181 | 3300009093 | Bacteria | 128067 |
| 216 | Ga0105240_10000296 | 3300009093 | Bacteria | 96854 |
| 217 | Ga0105240_10000694 | 3300009093 | Bacteria | 61854 |
| 218 | Ga0105240_10001490 | 3300009093 | Bacteria | 39873 |
| 219 | Ga0105240_10001725 | 3300009093 | Bacteria | 36900 |
| 220 | Ga0105240_10022759 | 3300009093 | Bacteria | 8301 |
| 221 | Ga0105240_10028160 | 3300009093 | Bacteria | 7345 |
| 222 | Ga0105240_10039509 | 3300009093 | Bacteria | 6041 |
| 223 | Ga0105240_10039789 | 3300009093 | Bacteria | 6018 |
| 224 | Ga0105240_10061115 | 3300009093 | Bacteria | 4695 |
| 225 | Ga0105240_10124534 | 3300009093 | Bacteria | 3099 |
| 226 | Ga0105240_10160249 | 3300009093 | Unclassified | 2673 |
| 227 | Ga0105240_10191445 | 3300009093 | Bacteria | 2405 |
| 228 | Ga0105240_10216876 | 3300009093 | Unclassified | 2232 |
| 229 | Ga0105240_10269362 | 3300009093 | Bacteria | 1961 |
| 230 | Ga0105240_10411878 | 3300009093 | Bacteria | 1520 |
| 231 | Ga0111539_10044235 | 3300009094 | Bacteria | 5335 |
| 232 | Ga0105245_10000670 | 3300009098 | Bacteria | 31023 |
| 233 | Ga0105245_10004060 | 3300009098 | Bacteria | 13008 |
| 234 | Ga0105245_10005477 | 3300009098 | Bacteria | 11150 |
| 235 | Ga0105245_10031511 | 3300009098 | Bacteria | 4693 |
| 236 | Ga0105245_10078822 | 3300009098 | Bacteria | 3007 |
| 237 | Ga0105245_10500063 | 3300009098 | Bacteria | 1232 |
| 238 | Ga0105247_10001310 | 3300009101 | Bacteria | 18251 |
| 239 | Ga0114129_10010664 | 3300009147 | Bacteria | 13103 |
| 240 | Ga0114129_10021718 | 3300009147 | Bacteria | 9109 |
| 241 | Ga0114129_10086192 | 3300009147 | Unclassified | 4356 |
| 242 | Ga0114129_10086217 | 3300009147 | Unclassified | 4355 |
| 243 | Ga0114129_10121493 | 3300009147 | Bacteria | 3594 |
| 244 | Ga0114129_10194709 | 3300009147 | Bacteria | 2750 |
| 245 | Ga0114129_10428194 | 3300009147 | Unclassified | 1739 |
| 246 | Ga0114129_10541489 | 3300009147 | Bacteria | 1515 |
| 247 | Ga0105241_10000076 | 3300009174 | Bacteria | 74496 |
| 248 | Ga0105241_10000890 | 3300009174 | Bacteria | 22539 |
| 249 | Ga0105241_10001486 | 3300009174 | Bacteria | 17962 |
| 250 | Ga0105241_10005735 | 3300009174 | Bacteria | 9169 |
| 251 | Ga0105241_10007208 | 3300009174 | Bacteria | 8184 |
| 252 | Ga0105241_10012112 | 3300009174 | Bacteria | 6332 |
| 253 | Ga0105242_10246326 | 3300009176 | Unclassified | 1609 |
| 254 | Ga0105242_10429211 | 3300009176 | Unclassified | 1240 |
| 255 | Ga0105248_10000002 | 3300009177 | Bacteria | 1054120 |
| 256 | Ga0105248_10000574 | 3300009177 | Bacteria | 41822 |
| 257 | Ga0105248_10070263 | 3300009177 | Bacteria | 3932 |
| 258 | Ga0105248_10119919 | 3300009177 | Bacteria | 2967 |
| 259 | Ga0105248_10141655 | 3300009177 | Bacteria | 2713 |
| 260 | Ga0105248_10228069 | 3300009177 | Bacteria | 2097 |
| 261 | Ga0105237_10002962 | 3300009545 | Bacteria | 20550 |
| 262 | Ga0105237_10022210 | 3300009545 | Bacteria | 6511 |
| 263 | Ga0105237_10029870 | 3300009545 | Bacteria | 5536 |
| 264 | Ga0105237_10029937 | 3300009545 | Bacteria | 5530 |
| 265 | Ga0105237_10041181 | 3300009545 | Bacteria | 4660 |
| 266 | Ga0105237_10060993 | 3300009545 | Unclassified | 3772 |
| 267 | Ga0105238_10000673 | 3300009551 | Bacteria | 35869 |
| 268 | Ga0105238_10001732 | 3300009551 | Bacteria | 21967 |
| 269 | Ga0105238_10002620 | 3300009551 | Bacteria | 17941 |
| 270 | Ga0105238_10021773 | 3300009551 | Bacteria | 6529 |
| 271 | Ga0105238_10022478 | 3300009551 | Bacteria | 6428 |
| 272 | Ga0105238_10022964 | 3300009551 | Bacteria | 6358 |
| 273 | Ga0105238_10034581 | 3300009551 | Bacteria | 5141 |
| 274 | Ga0105238_10078654 | 3300009551 | Unclassified | 3288 |
| 275 | Ga0105238_10095409 | 3300009551 | Bacteria | 2961 |
| 276 | Ga0105238_10099100 | 3300009551 | Bacteria | 2897 |
| 277 | Ga0105238_10117691 | 3300009551 | Unclassified | 2637 |
| 278 | Ga0105238_10215227 | 3300009551 | Bacteria | 1898 |
| 279 | Ga0105238_10369686 | 3300009551 | Bacteria | 1424 |
| 280 | Ga0105249_10011428 | 3300009553 | Bacteria | 7799 |
| 281 | Ga0105249_10015336 | 3300009553 | Bacteria | 6781 |
| 282 | Ga0105249_10028452 | 3300009553 | Bacteria | 5044 |
| 283 | Ga0105249_10089159 | 3300009553 | Unclassified | 2882 |
| 284 | Ga0105249_10465252 | 3300009553 | Bacteria | 1305 |
| 285 | Ga0105239_10001562 | 3300010375 | Bacteria | 30313 |
| 286 | Ga0105239_10013626 | 3300010375 | Bacteria | 9026 |
| 287 | Ga0105239_10021901 | 3300010375 | Bacteria | 7045 |
| 288 | Ga0105239_10094557 | 3300010375 | Bacteria | 3301 |
| 289 | Ga0105239_10145102 | 3300010375 | Unclassified | 2647 |
| 290 | Ga0105239_10411336 | 3300010375 | Unclassified | 1532 |
| 291 | Ga0105239_10506485 | 3300010375 | Unclassified | 1373 |
| 292 | Ga0105246_10001037 | 3300011119 | Bacteria | 15999 |
| 293 | Ga0105246_10084676 | 3300011119 | Unclassified | 2269 |
| 294 | Ga0105246_10130918 | 3300011119 | Unclassified | 1874 |
| 295 | Ga0105246_10191974 | 3300011119 | Unclassified | 1582 |
| 296 | Ga0157373_10006042 | 3300013100 | Bacteria | 9051 |
| 297 | Ga0157373_10012352 | 3300013100 | Bacteria | 6279 |
| 298 | Ga0157373_10139606 | 3300013100 | Bacteria | 1704 |
| 299 | Ga0157371_10137500 | 3300013102 | Unclassified | 1740 |
| 300 | Ga0157370_10000196 | 3300013104 | Bacteria | 75917 |
| 301 | Ga0157370_10009613 | 3300013104 | Bacteria | 10292 |
| 302 | Ga0157370_10018762 | 3300013104 | Bacteria | 6955 |
| 303 | Ga0157370_10047985 | 3300013104 | Bacteria | 4092 |
| 304 | Ga0157370_10049663 | 3300013104 | Bacteria | 4015 |
| 305 | Ga0157370_10052297 | 3300013104 | Bacteria | 3900 |
| 306 | Ga0157370_10053518 | 3300013104 | Bacteria | 3849 |
| 307 | Ga0157370_10057536 | 3300013104 | Bacteria | 3696 |
| 308 | Ga0157370_10107455 | 3300013104 | Bacteria | 2610 |
| 309 | Ga0157369_10000400 | 3300013105 | Bacteria | 57821 |
| 310 | Ga0157369_10001946 | 3300013105 | Bacteria | 24880 |
| 311 | Ga0157369_10003846 | 3300013105 | Bacteria | 17837 |
| 312 | Ga0157369_10008244 | 3300013105 | Bacteria | 11945 |
| 313 | Ga0157369_10021594 | 3300013105 | Bacteria | 7198 |
| 314 | Ga0157369_10022251 | 3300013105 | Bacteria | 7079 |
| 315 | Ga0157369_10023096 | 3300013105 | Bacteria | 6930 |
| 316 | Ga0157369_10024835 | 3300013105 | Bacteria | 6658 |
| 317 | Ga0157369_10033757 | 3300013105 | Bacteria | 5620 |
| 318 | Ga0157369_10095346 | 3300013105 | Bacteria | 3175 |
| 319 | Ga0157369_10123307 | 3300013105 | Bacteria | 2748 |
| 320 | Ga0157369_10132987 | 3300013105 | Unclassified | 2635 |
| 321 | Ga0157369_10149961 | 3300013105 | Bacteria | 2464 |
| 322 | Ga0157369_10166600 | 3300013105 | Bacteria | 2323 |
| 323 | Ga0157369_10427444 | 3300013105 | Bacteria | 1373 |
| 324 | Ga0157374_10000395 | 3300013296 | Bacteria | 39508 |
| 325 | Ga0157374_10016113 | 3300013296 | Bacteria | 6567 |
| 326 | Ga0157374_10022671 | 3300013296 | Bacteria | 5604 |
| 327 | Ga0157374_10041938 | 3300013296 | Bacteria | 4220 |
| 328 | Ga0157374_10092541 | 3300013296 | Bacteria | 2885 |
| 329 | Ga0157374_10488768 | 3300013296 | Bacteria | 1234 |
| 330 | Ga0157378_10001503 | 3300013297 | Bacteria | 21108 |
| 331 | Ga0157378_10003643 | 3300013297 | Bacteria | 13642 |
| 332 | Ga0157378_10005072 | 3300013297 | Bacteria | 11566 |
| 333 | Ga0157378_10011057 | 3300013297 | Bacteria | 7901 |
| 334 | Ga0157378_10012305 | 3300013297 | Bacteria | 7492 |
| 335 | Ga0157378_10018918 | 3300013297 | Bacteria | 6053 |
| 336 | Ga0157378_10026512 | 3300013297 | Bacteria | 5109 |
| 337 | Ga0157378_10086042 | 3300013297 | Bacteria | 2849 |
| 338 | Ga0163162_10000056 | 3300013306 | Bacteria | 109321 |
| 339 | Ga0163162_10805186 | 3300013306 | Bacteria | 1057 |
| 340 | Ga0157372_10000197 | 3300013307 | Bacteria | 66368 |
| 341 | Ga0157372_10011993 | 3300013307 | Bacteria | 9230 |
| 342 | Ga0157372_10012396 | 3300013307 | Bacteria | 9086 |
| 343 | Ga0157372_10012466 | 3300013307 | Bacteria | 9062 |
| 344 | Ga0157372_10018043 | 3300013307 | Bacteria | 7586 |
| 345 | Ga0157372_10029231 | 3300013307 | Bacteria | 6016 |
| 346 | Ga0157372_10030411 | 3300013307 | Bacteria | 5909 |
| 347 | Ga0157372_10035984 | 3300013307 | Bacteria | 5453 |
| 348 | Ga0157372_10038263 | 3300013307 | Bacteria | 5293 |
| 349 | Ga0157372_10052443 | 3300013307 | Bacteria | 4542 |
| 350 | Ga0157372_10064140 | 3300013307 | Bacteria | 4121 |
| 351 | Ga0157372_10076118 | 3300013307 | Bacteria | 3789 |
| 352 | Ga0157372_10123929 | 3300013307 | Bacteria | 2971 |
| 353 | Ga0157372_10132603 | 3300013307 | Bacteria | 2868 |
| 354 | Ga0157372_10144707 | 3300013307 | Bacteria | 2741 |
| 355 | Ga0157372_10220193 | 3300013307 | Bacteria | 2200 |
| 356 | Ga0157375_10002008 | 3300013308 | Bacteria | 17554 |
| 357 | Ga0157375_10018165 | 3300013308 | Bacteria | 6373 |
| 358 | Ga0157375_10111913 | 3300013308 | Unclassified | 2829 |
| 359 | Ga0157375_10128474 | 3300013308 | Bacteria | 2652 |
| 360 | Ga0157375_10292559 | 3300013308 | Unclassified | 1792 |
| 361 | Ga0163163_10001119 | 3300014325 | Bacteria | 22802 |
| 362 | Ga0163163_10008910 | 3300014325 | Bacteria | 8937 |
| 363 | Ga0163163_10100236 | 3300014325 | Unclassified | 2919 |
| 364 | Ga0157380_10003659 | 3300014326 | Bacteria | 10571 |
| 365 | Ga0157380_10136136 | 3300014326 | Bacteria | 2103 |
| 366 | Ga0157379_10000092 | 3300014968 | Bacteria | 60487 |
| 367 | Ga0157379_10030787 | 3300014968 | Bacteria | 4778 |
| 368 | Ga0157379_10030885 | 3300014968 | Bacteria | 4772 |
| 369 | Ga0157376_10000566 | 3300014969 | Bacteria | 23870 |
| 370 | Ga0157376_10008715 | 3300014969 | Bacteria | 7330 |
| 371 | Ga0157376_10022346 | 3300014969 | Bacteria | 4929 |
| 372 | Ga0157376_10134661 | 3300014969 | Bacteria | 2209 |
| 373 | Ga0163161_10012559 | 3300017792 | Bacteria | 5882 |
| 374 | Ga0228598_1000157 | 3300024227 | Bacteria | 11948 |
| 375 | Ga0209233_1010497 | 3300025261 | Bacteria | 2772 |
| 376 | Ga0209025_1002200 | 3300025294 | Bacteria | 21579 |
| 377 | Ga0207697_10004184 | 3300025315 | Bacteria | 6941 |
| 378 | Ga0207656_10043280 | 3300025321 | Bacteria | 1920 |
| 379 | Ga0207682_10042681 | 3300025893 | Bacteria | 1853 |
| 380 | Ga0207692_10004844 | 3300025898 | Archaea | 5356 |
| 381 | Ga0207692_10058978 | 3300025898 | Bacteria | 1980 |
| 382 | Ga0207710_10000400 | 3300025900 | Bacteria | 28981 |
| 383 | Ga0207688_10007105 | 3300025901 | Bacteria | 6090 |
| 384 | Ga0207680_10002832 | 3300025903 | Bacteria | 8129 |
| 385 | Ga0207685_10008369 | 3300025905 | Bacteria | 2942 |
| 386 | Ga0207699_10046993 | 3300025906 | Bacteria | 2528 |
| 387 | Ga0207699_10049879 | 3300025906 | Unclassified | 2465 |
| 388 | Ga0207645_10005089 | 3300025907 | Bacteria | 9624 |
| 389 | Ga0207705_10000048 | 3300025909 | Bacteria | 171848 |
| 390 | Ga0207705_10011775 | 3300025909 | Bacteria | 6321 |
| 391 | Ga0207705_10013354 | 3300025909 | Bacteria | 5924 |
| 392 | Ga0207705_10014834 | 3300025909 | Bacteria | 5603 |
| 393 | Ga0207705_10027295 | 3300025909 | Bacteria | 4072 |
| 394 | Ga0207705_10060544 | 3300025909 | Bacteria | 2734 |
| 395 | Ga0207684_10000753 | 3300025910 | Bacteria | 37762 |
| 396 | Ga0207684_10003222 | 3300025910 | Bacteria | 16019 |
| 397 | Ga0207684_10003763 | 3300025910 | Bacteria | 14669 |
| 398 | Ga0207684_10016799 | 3300025910 | Bacteria | 6283 |
| 399 | Ga0207684_10034984 | 3300025910 | Bacteria | 4266 |
| 400 | Ga0207684_10040343 | 3300025910 | Archaea | 3958 |
| 401 | Ga0207684_10179908 | 3300025910 | Unclassified | 1823 |
| 402 | Ga0207654_10000025 | 3300025911 | Bacteria | 143807 |
| 403 | Ga0207654_10000035 | 3300025911 | Bacteria | 112494 |
| 404 | Ga0207654_10000242 | 3300025911 | Bacteria | 33063 |
| 405 | Ga0207654_10001671 | 3300025911 | Bacteria | 11597 |
| 406 | Ga0207707_10010347 | 3300025912 | Bacteria | 8094 |
| 407 | Ga0207707_10023818 | 3300025912 | Bacteria | 5354 |
| 408 | Ga0207707_10046691 | 3300025912 | Bacteria | 3772 |
| 409 | Ga0207707_10125840 | 3300025912 | Bacteria | 2241 |
| 410 | Ga0207707_10127945 | 3300025912 | Bacteria | 2221 |
| 411 | Ga0207707_10261392 | 3300025912 | Bacteria | 1502 |
| 412 | Ga0207695_10000069 | 3300025913 | Bacteria | 319955 |
| 413 | Ga0207695_10000119 | 3300025913 | Bacteria | 235221 |
| 414 | Ga0207695_10000177 | 3300025913 | Bacteria | 185955 |
| 415 | Ga0207695_10000314 | 3300025913 | Bacteria | 116506 |
| 416 | Ga0207695_10003396 | 3300025913 | Bacteria | 22499 |
| 417 | Ga0207695_10013418 | 3300025913 | Bacteria | 9772 |
| 418 | Ga0207695_10020092 | 3300025913 | Bacteria | 7663 |
| 419 | Ga0207695_10022772 | 3300025913 | Bacteria | 7099 |
| 420 | Ga0207695_10033792 | 3300025913 | Bacteria | 5571 |
| 421 | Ga0207695_10037096 | 3300025913 | Bacteria | 5261 |
| 422 | Ga0207695_10099597 | 3300025913 | Bacteria | 2904 |
| 423 | Ga0207695_10125045 | 3300025913 | Bacteria | 2535 |
| 424 | Ga0207671_10000246 | 3300025914 | Bacteria | 81042 |
| 425 | Ga0207671_10008661 | 3300025914 | Bacteria | 8589 |
| 426 | Ga0207671_10159164 | 3300025914 | Bacteria | 1748 |
| 427 | Ga0207693_10003987 | 3300025915 | Bacteria | 12544 |
| 428 | Ga0207693_10005055 | 3300025915 | Bacteria | 11071 |
| 429 | Ga0207693_10006988 | 3300025915 | Bacteria | 9324 |
| 430 | Ga0207693_10043072 | 3300025915 | Unclassified | 3553 |
| 431 | Ga0207693_10123049 | 3300025915 | Bacteria | 2038 |
| 432 | Ga0207693_10273981 | 3300025915 | Bacteria | 1322 |
| 433 | Ga0207663_10004905 | 3300025916 | Bacteria | 6695 |
| 434 | Ga0207663_10005352 | 3300025916 | Bacteria | 6459 |
| 435 | Ga0207663_10083264 | 3300025916 | Bacteria | 2101 |
| 436 | Ga0207660_10001226 | 3300025917 | Bacteria | 17175 |
| 437 | Ga0207660_10026938 | 3300025917 | Unclassified | 3918 |
| 438 | Ga0207660_10056663 | 3300025917 | Bacteria | 2804 |
| 439 | Ga0207660_10067231 | 3300025917 | Unclassified | 2595 |
| 440 | Ga0207660_10114820 | 3300025917 | Bacteria | 2031 |
| 441 | Ga0207662_10004894 | 3300025918 | Bacteria | 7086 |
| 442 | Ga0207657_10014437 | 3300025919 | Bacteria | 7714 |
| 443 | Ga0207657_10064675 | 3300025919 | Bacteria | 3121 |
| 444 | Ga0207649_10003594 | 3300025920 | Bacteria | 8471 |
| 445 | Ga0207649_10069534 | 3300025920 | Bacteria | 2242 |
| 446 | Ga0207649_10159724 | 3300025920 | Bacteria | 1561 |
| 447 | Ga0207652_10002189 | 3300025921 | Bacteria | 16699 |
| 448 | Ga0207652_10015042 | 3300025921 | Bacteria | 6277 |
| 449 | Ga0207652_10046362 | 3300025921 | Bacteria | 3709 |
| 450 | Ga0207652_10057740 | 3300025921 | Bacteria | 3343 |
| 451 | Ga0207652_10104864 | 3300025921 | Bacteria | 2501 |
| 452 | Ga0207652_10195644 | 3300025921 | Bacteria | 1819 |
| 453 | Ga0207652_10387454 | 3300025921 | Bacteria | 1261 |
| 454 | Ga0207646_10002834 | 3300025922 | Bacteria | 20173 |
| 455 | Ga0207646_10031816 | 3300025922 | Bacteria | 4776 |
| 456 | Ga0207681_10018127 | 3300025923 | Unclassified | 4432 |
| 457 | Ga0207694_10000445 | 3300025924 | Bacteria | 38303 |
| 458 | Ga0207694_10001160 | 3300025924 | Bacteria | 22863 |
| 459 | Ga0207694_10002398 | 3300025924 | Bacteria | 15325 |
| 460 | Ga0207694_10003854 | 3300025924 | Bacteria | 11855 |
| 461 | Ga0207694_10037543 | 3300025924 | Bacteria | 3721 |
| 462 | Ga0207694_10219392 | 3300025924 | Bacteria | 1551 |
| 463 | Ga0207650_10001580 | 3300025925 | Bacteria | 16262 |
| 464 | Ga0207650_10184065 | 3300025925 | Unclassified | 1666 |
| 465 | Ga0207659_10060591 | 3300025926 | Bacteria | 2724 |
| 466 | Ga0207659_10078575 | 3300025926 | Unclassified | 2432 |
| 467 | Ga0207687_10003266 | 3300025927 | Bacteria | 10974 |
| 468 | Ga0207687_10003918 | 3300025927 | Bacteria | 9972 |
| 469 | Ga0207700_10007377 | 3300025928 | Bacteria | 6717 |
| 470 | Ga0207700_10073599 | 3300025928 | Bacteria | 2639 |
| 471 | Ga0207700_10203460 | 3300025928 | Bacteria | 1670 |
| 472 | Ga0207700_10257932 | 3300025928 | Bacteria | 1492 |
| 473 | Ga0207664_10024226 | 3300025929 | Bacteria | 4559 |
| 474 | Ga0207664_10052096 | 3300025929 | Bacteria | 3235 |
| 475 | Ga0207644_10050679 | 3300025931 | Bacteria | 2977 |
| 476 | Ga0207644_10058042 | 3300025931 | Bacteria | 2796 |
| 477 | Ga0207644_10102858 | 3300025931 | Unclassified | 2149 |
| 478 | Ga0207644_10177450 | 3300025931 | Bacteria | 1667 |
| 479 | Ga0207690_10001008 | 3300025932 | Bacteria | 17978 |
| 480 | Ga0207690_10153121 | 3300025932 | Bacteria | 1711 |
| 481 | Ga0207706_10003990 | 3300025933 | Bacteria | 13995 |
| 482 | Ga0207706_10095763 | 3300025933 | Bacteria | 2611 |
| 483 | Ga0207709_10046486 | 3300025935 | Bacteria | 2634 |
| 484 | Ga0207670_10100535 | 3300025936 | Unclassified | 2065 |
| 485 | Ga0207669_10160265 | 3300025937 | Bacteria | 1588 |
| 486 | Ga0207704_10287771 | 3300025938 | Unclassified | 1252 |
| 487 | Ga0207665_10000046 | 3300025939 | Bacteria | 78992 |
| 488 | Ga0207665_10002386 | 3300025939 | Bacteria | 12686 |
| 489 | Ga0207691_10029746 | 3300025940 | Bacteria | 5108 |
| 490 | Ga0207711_10000052 | 3300025941 | Bacteria | 138437 |
| 491 | Ga0207711_10003126 | 3300025941 | Bacteria | 14427 |
| 492 | Ga0207711_10034624 | 3300025941 | Bacteria | 4278 |
| 493 | Ga0207711_10042974 | 3300025941 | Bacteria | 3853 |
| 494 | Ga0207711_10394804 | 3300025941 | Unclassified | 1285 |
| 495 | Ga0207689_10000553 | 3300025942 | Bacteria | 35691 |
| 496 | Ga0207689_10399215 | 3300025942 | Unclassified | 1146 |
| 497 | Ga0207661_10014141 | 3300025944 | Bacteria | 5841 |
| 498 | Ga0207661_10030419 | 3300025944 | Bacteria | 4159 |
| 499 | Ga0207661_10062931 | 3300025944 | Bacteria | 3003 |
| 500 | Ga0207661_10200496 | 3300025944 | Bacteria | 1754 |
| 501 | Ga0207661_10340495 | 3300025944 | Unclassified | 1351 |
| 502 | Ga0207679_10049038 | 3300025945 | Bacteria | 3078 |
| 503 | Ga0207679_10111126 | 3300025945 | Bacteria | 2163 |
| 504 | Ga0207679_10155091 | 3300025945 | Unclassified | 1869 |
| 505 | Ga0207679_10311406 | 3300025945 | Unclassified | 1360 |
| 506 | Ga0207667_10003942 | 3300025949 | Bacteria | 18265 |
| 507 | Ga0207667_10018661 | 3300025949 | Bacteria | 7771 |
| 508 | Ga0207667_10019979 | 3300025949 | Bacteria | 7461 |
| 509 | Ga0207667_10027711 | 3300025949 | Bacteria | 6163 |
| 510 | Ga0207667_10031300 | 3300025949 | Bacteria | 5744 |
| 511 | Ga0207667_10066827 | 3300025949 | Bacteria | 3747 |
| 512 | Ga0207667_10069425 | 3300025949 | Bacteria | 3667 |
| 513 | Ga0207667_10098007 | 3300025949 | Bacteria | 3025 |
| 514 | Ga0207667_10118488 | 3300025949 | Bacteria | 2728 |
| 515 | Ga0207667_10225809 | 3300025949 | Bacteria | 1918 |
| 516 | Ga0207712_10012260 | 3300025961 | Bacteria | 5477 |
| 517 | Ga0207712_10014311 | 3300025961 | Bacteria | 5100 |
| 518 | Ga0207712_10026055 | 3300025961 | Unclassified | 3892 |
| 519 | Ga0207712_10047310 | 3300025961 | Unclassified | 2986 |
| 520 | Ga0207712_10092152 | 3300025961 | Bacteria | 2233 |
| 521 | Ga0207640_10000013 | 3300025981 | Bacteria | 224767 |
| 522 | Ga0207658_10004414 | 3300025986 | Bacteria | 9784 |
| 523 | Ga0207658_10025828 | 3300025986 | Bacteria | 4114 |
| 524 | Ga0207658_10130957 | 3300025986 | Bacteria | 2015 |
| 525 | Ga0207677_10000104 | 3300026023 | Bacteria | 70036 |
| 526 | Ga0207703_10001534 | 3300026035 | Bacteria | 20986 |
| 527 | Ga0207703_10171370 | 3300026035 | Bacteria | 1909 |
| 528 | Ga0207639_10000035 | 3300026041 | Bacteria | 149309 |
| 529 | Ga0207639_10008007 | 3300026041 | Bacteria | 7220 |
| 530 | Ga0207639_10018657 | 3300026041 | Bacteria | 4932 |
| 531 | Ga0207639_10091451 | 3300026041 | Bacteria | 2436 |
| 532 | Ga0207639_10106525 | 3300026041 | Bacteria | 2276 |
| 533 | Ga0207678_10000300 | 3300026067 | Bacteria | 44431 |
| 534 | Ga0207678_10019980 | 3300026067 | Bacteria | 5887 |
| 535 | Ga0207678_10030577 | 3300026067 | Bacteria | 4700 |
| 536 | Ga0207678_10044820 | 3300026067 | Bacteria | 3825 |
| 537 | Ga0207708_10026844 | 3300026075 | Bacteria | 4359 |
| 538 | Ga0207708_10033884 | 3300026075 | Bacteria | 3883 |
| 539 | Ga0207702_10000633 | 3300026078 | Bacteria | 38531 |
| 540 | Ga0207702_10032353 | 3300026078 | Bacteria | 4365 |
| 541 | Ga0207702_10036410 | 3300026078 | Bacteria | 4116 |
| 542 | Ga0207702_10043748 | 3300026078 | Bacteria | 3761 |
| 543 | Ga0207641_10048632 | 3300026088 | Bacteria | 3580 |
| 544 | Ga0207641_10151279 | 3300026088 | Bacteria | 2102 |
| 545 | Ga0207676_10005714 | 3300026095 | Bacteria | 8803 |
| 546 | Ga0207676_10005721 | 3300026095 | Bacteria | 8796 |
| 547 | Ga0207674_10001288 | 3300026116 | Bacteria | 32726 |
| 548 | Ga0207674_10001317 | 3300026116 | Bacteria | 32318 |
| 549 | Ga0207674_10004406 | 3300026116 | Bacteria | 16960 |
| 550 | Ga0207674_10113029 | 3300026116 | Bacteria | 2689 |
| 551 | Ga0207674_10117887 | 3300026116 | Bacteria | 2625 |
| 552 | Ga0207675_100013011 | 3300026118 | Bacteria | 7768 |
| 553 | Ga0207675_100034162 | 3300026118 | Bacteria | 4740 |
| 554 | Ga0207675_100153012 | 3300026118 | Bacteria | 2197 |
| 555 | Ga0207683_10000600 | 3300026121 | Bacteria | 33247 |
| 556 | Ga0207698_10000006 | 3300026142 | Bacteria | 291847 |
| 557 | Ga0207698_10010058 | 3300026142 | Bacteria | 6058 |
| 558 | Ga0207698_10024152 | 3300026142 | Bacteria | 4261 |
| 559 | Ga0207698_10092021 | 3300026142 | Bacteria | 2485 |
| 560 | Ga0268266_10018533 | 3300028379 | Bacteria | 5932 |
| 561 | Ga0268266_10028507 | 3300028379 | Bacteria | 4745 |
| 562 | Ga0268266_10032459 | 3300028379 | Bacteria | 4435 |
| 563 | Ga0268266_10104641 | 3300028379 | Bacteria | 2499 |
| 564 | Ga0268266_10124914 | 3300028379 | Bacteria | 2294 |
| 565 | Ga0268265_10041347 | 3300028380 | Bacteria | 3411 |
| 566 | Ga0268265_10123169 | 3300028380 | Bacteria | 2140 |
| 567 | Ga0268265_10181063 | 3300028380 | Unclassified | 1810 |
| 568 | Ga0268265_10230538 | 3300028380 | Bacteria | 1627 |
| 569 | Ga0268265_10240959 | 3300028380 | Bacteria | 1596 |
| 570 | Ga0268265_10316621 | 3300028380 | Archaea | 1411 |
| 571 | Ga0268264_10000877 | 3300028381 | Bacteria | 31797 |
| 572 | Ga0268264_10142864 | 3300028381 | Bacteria | 2136 |
| 573 | Ga0265326_10028802 | 3300028558 | Archaea | 1582 |
| 574 | Ga0265318_10000618 | 3300028577 | Bacteria | 24601 |
| 575 | Ga0265318_10021651 | 3300028577 | Bacteria | 2580 |
| 576 | Ga0265318_10067317 | 3300028577 | Bacteria | 1329 |
| 577 | Ga0265336_10000499 | 3300028666 | Bacteria | 22942 |
| 578 | Ga0265338_10001617 | 3300028800 | Bacteria | 36047 |
| 579 | Ga0265338_10012926 | 3300028800 | Bacteria | 9480 |
| 580 | Ga0265338_10036504 | 3300028800 | Bacteria | 4701 |
| 581 | Ga0265760_10002262 | 3300031090 | Bacteria | 5632 |
| 582 | Ga0265760_10002525 | 3300031090 | Bacteria | 5339 |
| 583 | Ga0265330_10000146 | 3300031235 | Archaea | 57212 |
| 584 | Ga0265330_10000326 | 3300031235 | Bacteria | 34208 |
| 585 | Ga0265330_10001479 | 3300031235 | Bacteria | 13663 |
| 586 | Ga0265330_10061853 | 3300031235 | Bacteria | 1628 |
| 587 | Ga0265332_10033129 | 3300031238 | Bacteria | 2250 |
| 588 | Ga0265328_10004527 | 3300031239 | Bacteria | 6031 |
| 589 | Ga0265328_10022033 | 3300031239 | Bacteria | 2427 |
| 590 | Ga0265320_10000061 | 3300031240 | Bacteria | 101367 |
| 591 | Ga0265325_10000499 | 3300031241 | Bacteria | 28359 |
| 592 | Ga0265325_10001354 | 3300031241 | Bacteria | 17356 |
| 593 | Ga0265325_10010096 | 3300031241 | Bacteria | 5484 |
| 594 | Ga0265325_10018685 | 3300031241 | Bacteria | 3843 |
| 595 | Ga0265325_10036674 | 3300031241 | Bacteria | 2596 |
| 596 | Ga0265325_10094888 | 3300031241 | Bacteria | 1467 |
| 597 | Ga0265329_10000191 | 3300031242 | Bacteria | 31583 |
| 598 | Ga0265329_10010007 | 3300031242 | Bacteria | 3506 |
| 599 | Ga0265340_10004674 | 3300031247 | Bacteria | 7620 |
| 600 | Ga0265340_10011027 | 3300031247 | Bacteria | 4818 |
| 601 | Ga0265340_10014095 | 3300031247 | Bacteria | 4184 |
| 602 | Ga0265340_10028336 | 3300031247 | Bacteria | 2818 |
| 603 | Ga0265339_10001146 | 3300031249 | Bacteria | 19997 |
| 604 | Ga0265339_10001171 | 3300031249 | Bacteria | 19815 |
| 605 | Ga0265339_10010487 | 3300031249 | Bacteria | 5754 |
| 606 | Ga0265339_10010510 | 3300031249 | Bacteria | 5749 |
| 607 | Ga0265339_10013928 | 3300031249 | Bacteria | 4866 |
| 608 | Ga0265339_10032033 | 3300031249 | Bacteria | 2967 |
| 609 | Ga0265339_10052954 | 3300031249 | Bacteria | 2208 |
| 610 | Ga0265339_10060633 | 3300031249 | Bacteria | 2039 |
| 611 | Ga0265339_10082668 | 3300031249 | Unclassified | 1695 |
| 612 | Ga0265331_10000192 | 3300031250 | Bacteria | 75526 |
| 613 | Ga0265316_10000637 | 3300031344 | Bacteria | 39071 |
| 614 | Ga0265316_10007744 | 3300031344 | Bacteria | 10064 |
| 615 | Ga0265316_10010292 | 3300031344 | Bacteria | 8530 |
| 616 | Ga0265316_10010346 | 3300031344 | Bacteria | 8507 |
| 617 | Ga0265316_10011796 | 3300031344 | Bacteria | 7862 |
| 618 | Ga0265316_10021272 | 3300031344 | Bacteria | 5499 |
| 619 | Ga0265316_10039382 | 3300031344 | Archaea | 3796 |
| 620 | Ga0265316_10050157 | 3300031344 | Bacteria | 3284 |
| 621 | Ga0265316_10121064 | 3300031344 | Bacteria | 1976 |
| 622 | Ga0265316_10132300 | 3300031344 | Unclassified | 1878 |
| 623 | Ga0265316_10139972 | 3300031344 | Bacteria | 1818 |
| 624 | Ga0307408_100019522 | 3300031548 | Unclassified | 4565 |
| 625 | Ga0307408_100033771 | 3300031548 | Bacteria | 3577 |
| 626 | Ga0307408_100222509 | 3300031548 | Bacteria | 1541 |
| 627 | Ga0265313_10001060 | 3300031595 | Bacteria | 26699 |
| 628 | Ga0265313_10004284 | 3300031595 | Bacteria | 11046 |
| 629 | Ga0265313_10004287 | 3300031595 | Bacteria | 11043 |
| 630 | Ga0265313_10014216 | 3300031595 | Bacteria | 4719 |
| 631 | Ga0265313_10018175 | 3300031595 | Bacteria | 3959 |
| 632 | Ga0265313_10054029 | 3300031595 | Unclassified | 1909 |
| 633 | Ga0316579_10031757 | 3300031691 | Bacteria | 2419 |
| 634 | Ga0265314_10000063 | 3300031711 | Bacteria | 159305 |
| 635 | Ga0265314_10004281 | 3300031711 | Bacteria | 13345 |
| 636 | Ga0265314_10005188 | 3300031711 | Bacteria | 11829 |
| 637 | Ga0265314_10019331 | 3300031711 | Bacteria | 5279 |
| 638 | Ga0265314_10079951 | 3300031711 | Bacteria | 2160 |
| 639 | Ga0265314_10157913 | 3300031711 | Unclassified | 1383 |
| 640 | Ga0265342_10000046 | 3300031712 | Archaea | 130926 |
| 641 | Ga0265342_10000566 | 3300031712 | Bacteria | 39108 |
| 642 | Ga0265342_10001150 | 3300031712 | Bacteria | 25234 |
| 643 | Ga0265342_10001677 | 3300031712 | Bacteria | 20343 |
| 644 | Ga0265342_10016834 | 3300031712 | Bacteria | 4766 |
| 645 | Ga0265342_10058962 | 3300031712 | Bacteria | 2268 |
| 646 | Ga0265342_10100849 | 3300031712 | Bacteria | 1644 |
| 647 | Ga0316576_10056371 | 3300031727 | Unclassified | 2870 |
| 648 | Ga0316576_10110042 | 3300031727 | Unclassified | 2065 |
| 649 | Ga0307405_10027146 | 3300031731 | Unclassified | 3315 |
| 650 | Ga0307405_10058848 | 3300031731 | Bacteria | 2420 |
| 651 | Ga0307413_10008587 | 3300031824 | Unclassified | 4836 |
| 652 | Ga0307413_10028482 | 3300031824 | Bacteria | 3112 |
| 653 | Ga0307410_10020710 | 3300031852 | Bacteria | 4030 |
| 654 | Ga0307410_10080258 | 3300031852 | Bacteria | 2288 |
| 655 | Ga0307410_10200920 | 3300031852 | Bacteria | 1522 |
| 656 | Ga0307406_10015879 | 3300031901 | Unclassified | 4366 |
| 657 | Ga0307406_10032648 | 3300031901 | Bacteria | 3180 |
| 658 | Ga0307407_10013586 | 3300031903 | Unclassified | 3958 |
| 659 | Ga0307407_10159379 | 3300031903 | Unclassified | 1475 |
| 660 | Ga0307412_10045049 | 3300031911 | Bacteria | 2881 |
| 661 | Ga0307412_10051452 | 3300031911 | Unclassified | 2722 |
| 662 | Ga0307409_100001000 | 3300031995 | Bacteria | 13232 |
| 663 | Ga0307409_100039280 | 3300031995 | Bacteria | 3510 |
| 664 | Ga0307416_100004875 | 3300032002 | Bacteria | 8171 |
| 665 | Ga0307416_100070247 | 3300032002 | Bacteria | 2903 |
| 666 | Ga0307416_100151987 | 3300032002 | Unclassified | 2125 |
| 667 | Ga0307414_10054027 | 3300032004 | Bacteria | 2805 |
| 668 | Ga0307414_10075652 | 3300032004 | Unclassified | 2444 |
| 669 | Ga0307411_10004428 | 3300032005 | Bacteria | 6725 |
| 670 | Ga0307411_10008588 | 3300032005 | Bacteria | 5304 |
| 671 | Ga0307415_100000717 | 3300032126 | Bacteria | 14833 |
| 672 | Ga0307415_100075843 | 3300032126 | Bacteria | 2381 |
| 673 | Ga0307510_10024239 | 3300033180 | Bacteria | 7014 |
| 674 | Ga0307510_10091011 | 3300033180 | Bacteria | 2895 |
| 675 | Ga0373926_0003327 | 3300035083 | Bacteria | 5170 |
| 676 | Ga0373926_0010705 | 3300035083 | Bacteria | 3077 |
| 677 | Ga0373926_0046154 | 3300035083 | Unclassified | 1563 |
| 678 | Ga0373926_0068325 | 3300035083 | Bacteria | 1302 |
| 679 | Ga0373951_0051588 | 3300035091 | Bacteria | 1013 |
| 680 | Ga0373923_0011760 | 3300035111 | Bacteria | 3221 |
| 681 | Ga0373923_0039547 | 3300035111 | Unclassified | 1937 |
| 682 | Ga0373936_0012750 | 3300035113 | Bacteria | 3202 |
| 683 | Ga0373936_0015254 | 3300035113 | Unclassified | 2943 |
| 684 | Ga0373936_0130329 | 3300035113 | Bacteria | 1080 |
| 685 | Ga0373945_0002909 | 3300035116 | Bacteria | 5378 |
| 686 | Ga0373954_0064741 | 3300035118 | Bacteria | 1729 |
| 687 | Ga0373954_0115703 | 3300035118 | Bacteria | 1299 |
| 688 | Ga0373954_0135955 | 3300035118 | Bacteria | 1198 |
| 689 | Ga0373943_0005065 | 3300035170 | Bacteria | 5944 |
| 690 | Ga0373946_0004512 | 3300035171 | Bacteria | 4988 |
| 691 | Ga0373946_0044571 | 3300035171 | Bacteria | 1832 |
| 692 | Ga0373946_0070731 | 3300035171 | Unclassified | 1506 |
| 693 | Ga0373946_0083760 | 3300035171 | Bacteria | 1401 |
| 694 | Ga0373955_0003383 | 3300035172 | Bacteria | 7012 |
| 695 | Ga0373961_0010964 | 3300035241 | Bacteria | 2242 |
| 696 | Ga0373924_0003556 | 3300035410 | Bacteria | 5366 |
| 697 | Ga0373924_0032929 | 3300035410 | Bacteria | 2090 |
| 698 | Ga0373935_0002525 | 3300035692 | Bacteria | 10489 |
| 699 | Ga0373935_0013104 | 3300035692 | Bacteria | 4997 |
| 700 | Ga0373935_0177597 | 3300035692 | Unclassified | 1460 |
| 701 | Ga0373927_0004121 | 3300035695 | Bacteria | 10233 |
| 702 | Ga0373927_0014400 | 3300035695 | Bacteria | 5236 |
| 703 | Ga0373927_0019115 | 3300035695 | Bacteria | 4493 |
| 704 | Ga0373933_0062995 | 3300035724 | Bacteria | 2241 |
| 705 | Ga0373947_0008015 | 3300035725 | Bacteria | 6093 |
| 706 | Ga0373947_0042749 | 3300035725 | Unclassified | 2705 |
| 707 | Ga0373947_0045925 | 3300035725 | Bacteria | 2614 |
| 708 | Ga0373947_0053647 | 3300035725 | Unclassified | 2431 |
| 709 | Ga0373937_0000027 | 3300036401 | Bacteria | 123975 |
| 710 | Ga0373937_0018796 | 3300036401 | Bacteria | 6178 |
| 711 | Ga0373937_0081139 | 3300036401 | Unclassified | 3000 |
| 712 | Ga0373937_0229379 | 3300036401 | Bacteria | 1749 |
| 713 | Ga0373937_0256368 | 3300036401 | Bacteria | 1649 |
| 714 | Ga0316584_0270706 | 3300036712 | Unclassified | 1236 |
| 715 | Ga0373925_0005912 | 3300037068 | Archaea | 9076 |
| 716 | Ga0373925_0012705 | 3300037068 | Bacteria | 6099 |
| 717 | Ga0373925_0019564 | 3300037068 | Bacteria | 4926 |
| 718 | Ga0373925_0027057 | 3300037068 | Bacteria | 4200 |
| 719 | Ga0373925_0053177 | 3300037068 | Bacteria | 3026 |
| 720 | Ga0373925_0055172 | 3300037068 | Bacteria | 2973 |
| 721 | Ga0373925_0143742 | 3300037068 | Bacteria | 1869 |
| 722 | Ga0395898_0014459 | 3300037466 | Bacteria | 8106 |
| 723 | Ga0395905_0073057 | 3300037471 | Bacteria | 3215 |
| 724 | Ga0395905_0109723 | 3300037471 | Unclassified | 2591 |
| 725 | Ga0395905_0132846 | 3300037471 | Unclassified | 2341 |
| 726 | Ga0395901_0391090 | 3300038443 | Bacteria | 1430 |
| 727 | Ga0242420_007223 | 3300038996 | Unclassified | 1777 |
| 728 | Ga0400489_60259 | 3300039093 | Bacteria | 1964 |
| 729 | Ga0436361_0128003 | 3300039447 | Bacteria | 8766 |
| 730 | Ga0436361_0798862 | 3300039447 | Bacteria | 2606 |
| 731 | Ga0436361_1043667 | 3300039447 | Bacteria | 10285 |
| 732 | Ga0436363_0117531 | 3300039450 | Bacteria | 2646 |
| 733 | Ga0436363_1446693 | 3300039450 | Unclassified | 2348 |
| 734 | Ga0436362_0169000 | 3300039453 | Unclassified | 1641 |
| 735 | Ga0436362_0803045 | 3300039453 | Bacteria | 2152 |
| 736 | Ga0451577_0000980 | 3300042876 | Bacteria | 41601 |
| 737 | Ga0451577_0024043 | 3300042876 | Bacteria | 5547 |
| 738 | Ga0451577_0069109 | 3300042876 | Bacteria | 3150 |
| 739 | Ga0451577_0076721 | 3300042876 | Bacteria | 2979 |
| 740 | Ga0451577_0085984 | 3300042876 | Bacteria | 2805 |
| 741 | Ga0451577_0153210 | 3300042876 | Archaea | 2074 |
| 742 | Ga0453683_0000448 | 3300044673 | Bacteria | 47323 |
| 743 | Ga0453683_0009560 | 3300044673 | Bacteria | 6468 |
| 744 | Ga0453683_0012738 | 3300044673 | Bacteria | 5505 |
| 745 | Ga0453683_0017952 | 3300044673 | Unclassified | 4545 |
| 746 | Ga0453683_0049163 | 3300044673 | Bacteria | 2644 |
| 747 | Ga0453683_0256895 | 3300044673 | Unclassified | 1114 |
| 748 | Ga0466966_0006756 | 3300044684 | Bacteria | 7596 |
| 749 | Ga0466963_0004074 | 3300044694 | Bacteria | 8455 |
| 750 | Ga0466963_0012206 | 3300044694 | Bacteria | 5253 |
| 751 | Ga0453684_0000013 | 3300044712 | Archaea | 1034059 |
| 752 | Ga0453684_0000290 | 3300044712 | Archaea | 215468 |
| 753 | Ga0453684_0001875 | 3300044712 | Bacteria | 54679 |
| 754 | Ga0453684_0003962 | 3300044712 | Archaea | 32375 |
| 755 | Ga0453684_0005714 | 3300044712 | Bacteria | 24355 |
| 756 | Ga0453684_0006656 | 3300044712 | Bacteria | 21822 |
| 757 | Ga0453684_0010733 | 3300044712 | Archaea | 15561 |
| 758 | Ga0453684_0013684 | 3300044712 | Bacteria | 13145 |
| 759 | Ga0453684_0014791 | 3300044712 | Bacteria | 12436 |
| 760 | Ga0453684_0017793 | 3300044712 | Archaea | 10968 |
| 761 | Ga0453684_0018277 | 3300044712 | Bacteria | 10773 |
| 762 | Ga0453684_0026428 | 3300044712 | Archaea | 8383 |
| 763 | Ga0453684_0027657 | 3300044712 | Bacteria | 8122 |
| 764 | Ga0453684_0032290 | 3300044712 | Bacteria | 7333 |
| 765 | Ga0453684_0037563 | 3300044712 | Bacteria | 6646 |
| 766 | Ga0453684_0054483 | 3300044712 | Archaea | 5209 |
| 767 | Ga0453684_0074179 | 3300044712 | Bacteria | 4285 |
| 768 | Ga0453684_0103137 | 3300044712 | Archaea | 3486 |
| 769 | Ga0453684_0109595 | 3300044712 | Archaea | 3358 |
| 770 | Ga0453684_0110411 | 3300044712 | Bacteria | 3342 |
| 771 | Ga0453684_0124289 | 3300044712 | Bacteria | 3108 |
| 772 | Ga0453684_0133166 | 3300044712 | Unclassified | 2980 |
| 773 | Ga0453684_0167749 | 3300044712 | Unclassified | 2590 |
| 774 | Ga0453684_0170072 | 3300044712 | Bacteria | 2569 |
| 775 | Ga0453684_0171385 | 3300044712 | Bacteria | 2557 |
| 776 | Ga0453684_0211257 | 3300044712 | Unclassified | 2255 |
| 777 | Ga0453684_0226155 | 3300044712 | Bacteria | 2163 |
| 778 | Ga0466970_0103284 | 3300044765 | Bacteria | 1553 |
| 779 | Ga0466959_0006034 | 3300045049 | Bacteria | 8364 |
| 780 | Ga0451576_0002465 | 3300045051 | Bacteria | 27543 |
| 781 | Ga0451576_0028360 | 3300045051 | Bacteria | 5998 |
| 782 | Ga0451576_0065326 | 3300045051 | Bacteria | 3789 |
| 783 | Ga0451576_0145484 | 3300045051 | Unclassified | 2471 |
| 784 | Ga0451576_0273915 | 3300045051 | Bacteria | 1764 |
| 785 | Ga0495617_055962 | 3300046452 | Bacteria | 1308 |
| 786 | Ga0495592_0007856 | 3300046454 | Bacteria | 7994 |
| 787 | Ga0495592_0318709 | 3300046454 | Unclassified | 1005 |
| 788 | Ga0495603_0000838 | 3300046455 | Bacteria | 17637 |
| 789 | Ga0495629_0000010 | 3300046459 | Bacteria | 340114 |
| 790 | Ga0495629_0000549 | 3300046459 | Bacteria | 30752 |
| 791 | Ga0495629_0005512 | 3300046459 | Bacteria | 9445 |
| 792 | Ga0495629_0008527 | 3300046459 | Bacteria | 7547 |
| 793 | Ga0495629_0141762 | 3300046459 | Bacteria | 1672 |
| 794 | Ga0495651_0000658 | 3300046462 | Bacteria | 26766 |
| 795 | Ga0495651_0011762 | 3300046462 | Bacteria | 6726 |
| 796 | Ga0495651_0021531 | 3300046462 | Bacteria | 5011 |
| 797 | Ga0495651_0057297 | 3300046462 | Unclassified | 2991 |
| 798 | Ga0495651_0089900 | 3300046462 | Bacteria | 2304 |
| 799 | Ga0495653_0003436 | 3300046463 | Bacteria | 12740 |
| 800 | Ga0495653_0006642 | 3300046463 | Bacteria | 9494 |
| 801 | Ga0495653_0068710 | 3300046463 | Bacteria | 2657 |
| 802 | Ga0495650_0000022 | 3300046471 | Bacteria | 530747 |
| 803 | Ga0495650_0008987 | 3300046471 | Bacteria | 5745 |
| 804 | Ga0495580_0001908 | 3300046472 | Bacteria | 18328 |
| 805 | Ga0495580_0003312 | 3300046472 | Bacteria | 13776 |
| 806 | Ga0495580_0031675 | 3300046472 | Bacteria | 3820 |
| 807 | Ga0495580_0066817 | 3300046472 | Bacteria | 2516 |
| 808 | Ga0495580_0097816 | 3300046472 | Unclassified | 2041 |
| 809 | Ga0495582_0001438 | 3300046473 | Archaea | 13432 |
| 810 | Ga0495582_0017581 | 3300046473 | Bacteria | 3912 |
| 811 | Ga0495582_0048449 | 3300046473 | Bacteria | 2340 |
| 812 | Ga0495582_0056162 | 3300046473 | Bacteria | 2170 |
| 813 | Ga0495582_0147651 | 3300046473 | Bacteria | 1334 |
| 814 | Ga0495639_0000249 | 3300046475 | Bacteria | 26734 |
| 815 | Ga0495639_0001981 | 3300046475 | Archaea | 9065 |
| 816 | Ga0495639_0026133 | 3300046475 | Bacteria | 2579 |
| 817 | Ga0495662_0000291 | 3300046476 | Bacteria | 21682 |
| 818 | Ga0495664_0002624 | 3300046477 | Bacteria | 9671 |
| 819 | Ga0495664_0032560 | 3300046477 | Unclassified | 3060 |
| 820 | Ga0495664_0037708 | 3300046477 | Bacteria | 2853 |
| 821 | Ga0495664_0097179 | 3300046477 | Bacteria | 1772 |
| 822 | Ga0495585_0067024 | 3300046492 | Bacteria | 1965 |
| 823 | Ga0495594_0000436 | 3300046499 | Bacteria | 21014 |
| 824 | Ga0495594_0000734 | 3300046499 | Bacteria | 16832 |
| 825 | Ga0495594_0002977 | 3300046499 | Bacteria | 8781 |
| 826 | Ga0495594_0067731 | 3300046499 | Unclassified | 1982 |
| 827 | Ga0495594_0079980 | 3300046499 | Unclassified | 1825 |
| 828 | Ga0495594_0132343 | 3300046499 | Bacteria | 1413 |
| 829 | Ga0495606_0034364 | 3300046507 | Bacteria | 3482 |
| 830 | Ga0495606_0106330 | 3300046507 | Bacteria | 1699 |
| 831 | Ga0495608_0008806 | 3300046511 | Bacteria | 7061 |
| 832 | Ga0495608_0037768 | 3300046511 | Bacteria | 3247 |
| 833 | Ga0495608_0048209 | 3300046511 | Bacteria | 2831 |
| 834 | Ga0495616_0123570 | 3300046513 | Bacteria | 1192 |
| 835 | Ga0495618_0029659 | 3300046514 | Unclassified | 3413 |
| 836 | Ga0495618_0264413 | 3300046514 | Bacteria | 1076 |
| 837 | Ga0495628_0001512 | 3300046516 | Bacteria | 21320 |
| 838 | Ga0495628_0009956 | 3300046516 | Bacteria | 8091 |
| 839 | Ga0495628_0034751 | 3300046516 | Bacteria | 4053 |
| 840 | Ga0495628_0068322 | 3300046516 | Unclassified | 2773 |
| 841 | Ga0495628_0242059 | 3300046516 | Bacteria | 1349 |
| 842 | Ga0495630_0003954 | 3300046517 | Bacteria | 10358 |
| 843 | Ga0495630_0004124 | 3300046517 | Bacteria | 10180 |
| 844 | Ga0495630_0012339 | 3300046517 | Bacteria | 6201 |
| 845 | Ga0495630_0017612 | 3300046517 | Bacteria | 5236 |
| 846 | Ga0495630_0026040 | 3300046517 | Bacteria | 4329 |
| 847 | Ga0495644_0000029 | 3300046523 | Bacteria | 66705 |
| 848 | Ga0495648_0128709 | 3300046524 | Bacteria | 1349 |
| 849 | Ga0495666_0002504 | 3300046526 | Bacteria | 9119 |
| 850 | Ga0495666_0005235 | 3300046526 | Bacteria | 6549 |
| 851 | Ga0495666_0134939 | 3300046526 | Eukaryota | 1152 |
| 852 | Ga0495642_0018911 | 3300046528 | Bacteria | 2697 |
| 853 | Ga0495652_0030394 | 3300046529 | Bacteria | 4739 |
| 854 | Ga0495652_0094030 | 3300046529 | Bacteria | 2446 |
| 855 | Ga0495652_0135402 | 3300046529 | Bacteria | 1944 |
| 856 | Ga0495652_0152458 | 3300046529 | Archaea | 1804 |
| 857 | Ga0495665_0000484 | 3300046531 | Bacteria | 20010 |
| 858 | Ga0495665_0004823 | 3300046531 | Bacteria | 7276 |
| 859 | Ga0495665_0097205 | 3300046531 | Bacteria | 1546 |
| 860 | Ga0495665_0148424 | 3300046531 | Unclassified | 1224 |
| 861 | Ga0495640_0093476 | 3300046533 | Bacteria | 1981 |
| 862 | Ga0495586_0001355 | 3300046535 | Bacteria | 13604 |
| 863 | Ga0495586_0004223 | 3300046535 | Bacteria | 7695 |
| 864 | Ga0495586_0009290 | 3300046535 | Bacteria | 5229 |
| 865 | Ga0495586_0037530 | 3300046535 | Bacteria | 2601 |
| 866 | Ga0495587_0016807 | 3300046536 | Bacteria | 4549 |
| 867 | Ga0495587_0020882 | 3300046536 | Bacteria | 4039 |
| 868 | Ga0495587_0022747 | 3300046536 | Bacteria | 3857 |
| 869 | Ga0495587_0028962 | 3300046536 | Bacteria | 3364 |
| 870 | Ga0495609_0009088 | 3300046538 | Bacteria | 4826 |
| 871 | Ga0495645_0001181 | 3300046543 | Bacteria | 17818 |
| 872 | Ga0495645_0013258 | 3300046543 | Bacteria | 5825 |
| 873 | Ga0495645_0014496 | 3300046543 | Bacteria | 5594 |
| 874 | Ga0495645_0036085 | 3300046543 | Bacteria | 3604 |
| 875 | Ga0495645_0130900 | 3300046543 | Bacteria | 1758 |
| 876 | Ga0495622_0010336 | 3300046557 | Bacteria | 4315 |
| 877 | Ga0495667_0000793 | 3300046559 | Bacteria | 20322 |
| 878 | Ga0495667_0000984 | 3300046559 | Bacteria | 18434 |
| 879 | Ga0495667_0018030 | 3300046559 | Bacteria | 4768 |
| 880 | Ga0495668_0039641 | 3300046616 | Bacteria | 2630 |
| 881 | Ga0495634_0103632 | 3300046642 | Bacteria | 1836 |
| 882 | Ga0495625_0001054 | 3300046660 | Bacteria | 36147 |
| 883 | Ga0495625_0004927 | 3300046660 | Bacteria | 12418 |
| 884 | Ga0495625_0005873 | 3300046660 | Bacteria | 11061 |
| 885 | Ga0495635_0000717 | 3300046663 | Bacteria | 21406 |
| 886 | Ga0495635_0028423 | 3300046663 | Bacteria | 3887 |
| 887 | Ga0495635_0032572 | 3300046663 | Bacteria | 3616 |
| 888 | Ga0495635_0078400 | 3300046663 | Bacteria | 2261 |
| 889 | Ga0495635_0154029 | 3300046663 | Bacteria | 1565 |
| 890 | Ga0495661_0043011 | 3300046665 | Bacteria | 2780 |
| 891 | Ga0495657_0016262 | 3300046675 | Bacteria | 5423 |
| 892 | Ga0495599_0004359 | 3300046678 | Bacteria | 8379 |
| 893 | Ga0495623_0017932 | 3300046679 | Bacteria | 4574 |
| 894 | Ga0495623_0045738 | 3300046679 | Bacteria | 2779 |
| 895 | Ga0495623_0160585 | 3300046679 | Bacteria | 1321 |
| 896 | Ga0495646_0021775 | 3300046680 | Bacteria | 4049 |
| 897 | Ga0495646_0043322 | 3300046680 | Bacteria | 2756 |
| 898 | Ga0495646_0052180 | 3300046680 | Unclassified | 2471 |
| 899 | Ga0495658_0011831 | 3300046683 | Archaea | 4401 |
| 900 | Ga0495658_0173154 | 3300046683 | Bacteria | 1337 |
| 901 | Ga0495669_0001929 | 3300046684 | Bacteria | 8517 |
| 902 | Ga0495669_0034699 | 3300046684 | Unclassified | 2224 |
| 903 | Ga0495669_0060757 | 3300046684 | Bacteria | 1709 |
| 904 | Ga0495613_0001436 | 3300046689 | Bacteria | 18186 |
| 905 | Ga0495613_0039718 | 3300046689 | Bacteria | 3489 |
| 906 | Ga0495613_0071294 | 3300046689 | Bacteria | 2533 |
| 907 | Ga0495613_0142960 | 3300046689 | Bacteria | 1708 |
| 908 | Ga0495624_0000779 | 3300046690 | Bacteria | 25125 |
| 909 | Ga0495624_0055158 | 3300046690 | Unclassified | 2504 |
| 910 | Ga0495624_0128111 | 3300046690 | Bacteria | 1557 |
| 911 | Ga0495670_0022110 | 3300046691 | Bacteria | 3140 |
| 912 | Ga0495600_0013097 | 3300046809 | Bacteria | 5204 |
| 913 | Ga0495600_0021800 | 3300046809 | Bacteria | 4108 |
| 914 | Ga0495600_0025304 | 3300046809 | Bacteria | 3825 |
| 915 | Ga0495600_0032715 | 3300046809 | Bacteria | 3375 |
| 916 | Ga0495600_0068140 | 3300046809 | Bacteria | 2325 |
| 917 | Ga0495600_0117752 | 3300046809 | Bacteria | 1728 |
| 918 | Ga0495581_0013657 | 3300047315 | Bacteria | 4709 |
| 919 | Ga0495581_0032396 | 3300047315 | Bacteria | 3026 |
| 920 | Ga0495581_0090742 | 3300047315 | Bacteria | 1772 |
| 921 | Ga0495604_0000517 | 3300047317 | Bacteria | 33961 |
| 922 | Ga0495604_0009578 | 3300047317 | Bacteria | 7661 |
| 923 | Ga0495604_0041593 | 3300047317 | Bacteria | 3605 |
| 924 | Ga0495604_0088006 | 3300047317 | Unclassified | 2312 |
| 925 | Ga0495604_0134676 | 3300047317 | Bacteria | 1772 |
| 926 | Ga0495604_0239794 | 3300047317 | Bacteria | 1240 |
| 927 | Ga0495674_0002381 | 3300047319 | Bacteria | 18399 |
| 928 | Ga0495674_0018431 | 3300047319 | Bacteria | 6498 |
| 929 | Ga0495674_0022808 | 3300047319 | Bacteria | 5769 |
| 930 | Ga0495674_0057923 | 3300047319 | Bacteria | 3389 |
| 931 | Ga0495674_0156533 | 3300047319 | Bacteria | 1908 |
| 932 | Ga0495672_0007773 | 3300047320 | Bacteria | 8017 |
| 933 | Ga0495676_0015675 | 3300047321 | Bacteria | 6739 |
| 934 | Ga0495676_0054425 | 3300047321 | Archaea | 3182 |
| 935 | Ga0495676_0137024 | 3300047321 | Bacteria | 1759 |
| 936 | Ga0495680_0001356 | 3300047322 | Bacteria | 26600 |
| 937 | Ga0495680_0003859 | 3300047322 | Bacteria | 14516 |
| 938 | Ga0495680_0004805 | 3300047322 | Bacteria | 12825 |
| 939 | Ga0495680_0005651 | 3300047322 | Bacteria | 11714 |
| 940 | Ga0495675_0000556 | 3300047444 | Bacteria | 24036 |
| 941 | Ga0495675_0001775 | 3300047444 | Bacteria | 12859 |
| 942 | Ga0495675_0004033 | 3300047444 | Bacteria | 8902 |
| 943 | Ga0495675_0004321 | 3300047444 | Bacteria | 8596 |
| 944 | Ga0495677_0020615 | 3300047445 | Bacteria | 2390 |
| 945 | Ga0495684_0000847 | 3300047471 | Bacteria | 24711 |
| 946 | Ga0495684_0002044 | 3300047471 | Bacteria | 16237 |
| 947 | Ga0495684_0036168 | 3300047471 | Bacteria | 3787 |
| 948 | Ga0495684_0048495 | 3300047471 | Unclassified | 3247 |
| 949 | Ga0495684_0054816 | 3300047471 | Bacteria | 3041 |
| 950 | Ga0495684_0104708 | 3300047471 | Unclassified | 2138 |
| 951 | Ga0495686_0000921 | 3300047472 | Bacteria | 36769 |
| 952 | Ga0495686_0006475 | 3300047472 | Bacteria | 8955 |
| 953 | Ga0495686_0007402 | 3300047472 | Bacteria | 8235 |
| 954 | Ga0495593_0022830 | 3300047673 | Unclassified | 3481 |
| 955 | Ga0495593_0032721 | 3300047673 | Bacteria | 2833 |
| 956 | Ga0495602_0052799 | 3300048088 | Unclassified | 3606 |
| 957 | Ga0495614_0060705 | 3300048089 | Unclassified | 1624 |
| 958 | Ga0495614_0178509 | 3300048089 | Unclassified | 955 |
| 959 | Ga0496100_0007143 | 3300048903 | Bacteria | 6135 |
| 960 | Ga0496100_0117485 | 3300048903 | Bacteria | 1857 |
| 961 | Ga0496101_0269495 | 3300048904 | Bacteria | 1329 |
| 962 | Ga0496102_0169648 | 3300048905 | Bacteria | 2054 |
| 963 | Ga0496104_0037599 | 3300048907 | Bacteria | 4526 |
| 964 | Ga0496104_0038068 | 3300048907 | Bacteria | 4499 |
| 965 | Ga0496104_0065734 | 3300048907 | Bacteria | 3442 |
| 966 | Ga0496104_0204983 | 3300048907 | Bacteria | 1884 |
| 967 | Ga0496104_0245159 | 3300048907 | Bacteria | 1704 |
| 968 | Ga0496105_0002243 | 3300048908 | Bacteria | 14004 |
| 969 | Ga0496105_0004369 | 3300048908 | Bacteria | 10646 |
| 970 | Ga0496105_0018968 | 3300048908 | Bacteria | 5542 |
| 971 | Ga0496105_0221731 | 3300048908 | Bacteria | 1539 |
| 972 | Ga0496106_0241077 | 3300048909 | Bacteria | 1445 |
| 973 | Ga0496107_0048827 | 3300048910 | Bacteria | 3050 |
| 974 | Ga0496107_0110738 | 3300048910 | Bacteria | 2018 |
| 975 | Ga0496109_0240214 | 3300048912 | Archaea | 1705 |
| 976 | Ga0496110_0366833 | 3300048913 | Archaea | 1312 |
| 977 | Ga0496112_0006448 | 3300048915 | Bacteria | 10300 |
| 978 | Ga0496112_0036921 | 3300048915 | Bacteria | 4767 |
| 979 | Ga0496112_0069641 | 3300048915 | Bacteria | 3475 |
| 980 | Ga0496112_0120789 | 3300048915 | Unclassified | 2590 |
| 981 | Ga0496112_0152413 | 3300048915 | Bacteria | 2279 |
| 982 | Ga0496113_0007620 | 3300048916 | Bacteria | 6983 |
| 983 | Ga0496113_0159620 | 3300048916 | Archaea | 1782 |
| 984 | Ga0496114_0085552 | 3300048917 | Bacteria | 2671 |
| 985 | Ga0496114_0151174 | 3300048917 | Bacteria | 2014 |
| 986 | Ga0496115_0049868 | 3300048918 | Bacteria | 3352 |
| 987 | Ga0496115_0176175 | 3300048918 | Bacteria | 1768 |
| 988 | Ga0496115_0224855 | 3300048918 | Bacteria | 1548 |
| 989 | Ga0496116_0070732 | 3300048919 | Bacteria | 2213 |
| 990 | Ga0496126_0000005 | 3300048929 | Bacteria | 891906 |
| 991 | Ga0496126_0000010 | 3300048929 | Bacteria | 744888 |
| 992 | Ga0496126_0001435 | 3300048929 | Bacteria | 37410 |
| 993 | Ga0496126_0013795 | 3300048929 | Bacteria | 8194 |
| 994 | Ga0496126_0103576 | 3300048929 | Bacteria | 2487 |
| 995 | Ga0495682_0017494 | 3300049460 | Bacteria | 2705 |
| 996 | Ga0501292_004648 | 3300049515 | Bacteria | 1887 |
| 997 | Ga0501299_001928 | 3300049522 | Bacteria | 2801 |
| 998 | Ga0501303_002650 | 3300049526 | Bacteria | 1394 |
| 999 | Ga0501031_0003660 | 3300049568 | Bacteria | 9897 |
| 1000 | Ga0501033_0027441 | 3300049570 | Bacteria | 4280 |
| 1001 | Ga0501033_0038983 | 3300049570 | Bacteria | 3550 |
| 1002 | Ga0501034_0008118 | 3300049571 | Bacteria | 11135 |
| 1003 | Ga0501036_0001740 | 3300049572 | Bacteria | 16908 |
| 1004 | Ga0501037_0057094 | 3300049573 | Bacteria | 2850 |
| 1005 | Ga0501039_0164079 | 3300049575 | Bacteria | 1747 |
| 1006 | Ga0501040_0085599 | 3300049576 | Bacteria | 2188 |
| 1007 | Ga0501042_0061938 | 3300049578 | Bacteria | 2672 |
| 1008 | Ga0501043_0002753 | 3300049579 | Bacteria | 14702 |
| 1009 | Ga0501046_0000437 | 3300049580 | Bacteria | 41896 |
| 1010 | Ga0501047_0000776 | 3300049581 | Bacteria | 33383 |
| 1011 | Ga0501047_0009635 | 3300049581 | Bacteria | 9131 |
| 1012 | Ga0501048_0063884 | 3300049582 | Bacteria | 2603 |
| 1013 | Ga0501071_0043967 | 3300049587 | Bacteria | 3204 |
| 1014 | Ga0501072_0039810 | 3300049588 | Bacteria | 3690 |
| 1015 | Ga0501072_0071107 | 3300049588 | Bacteria | 2749 |
| 1016 | Ga0501073_0000891 | 3300049589 | Bacteria | 21395 |
| 1017 | Ga0501075_0012046 | 3300049591 | Bacteria | 6140 |
| 1018 | Ga0501075_0191723 | 3300049591 | Archaea | 1559 |
| 1019 | Ga0501075_0226064 | 3300049591 | Bacteria | 1427 |
| 1020 | Ga0501076_0019283 | 3300049592 | Bacteria | 5211 |
| 1021 | Ga0501077_0000408 | 3300049593 | Bacteria | 25947 |
| 1022 | Ga0501234_024327 | 3300049707 | Bacteria | 970 |
| 1023 | Ga0501080_0310988 | 3300049742 | Archaea | 1428 |
| 1024 | Ga0501081_0025930 | 3300049743 | Bacteria | 3948 |
| 1025 | Ga0501083_0051828 | 3300049744 | Bacteria | 2759 |
| 1026 | Ga0501035_0075520 | 3300049822 | Bacteria | 2981 |
| 1027 | Ga0501044_0025248 | 3300049823 | Bacteria | 6299 |
| 1028 | Ga0501044_0043453 | 3300049823 | Bacteria | 4667 |
| 1029 | Ga0501044_0062913 | 3300049823 | Bacteria | 3792 |
| 1030 | nmdc:mga05p37_10176_c1 | 3300050507 | Bacteria | 11163 |
| 1031 | nmdc:mga05p37_143694_c1 | 3300050507 | Bacteria | 2922 |
| 1032 | nmdc:mga05p37_170830_c1 | 3300050507 | Bacteria | 2651 |
| 1033 | nmdc:mga05p37_96413_c1 | 3300050507 | Bacteria | 3644 |
| 1034 | nmdc:mga05p37_96535_c1 | 3300050507 | Unclassified | 3641 |
| 1035 | nmdc:mga09592_261873_c1 | 3300050508 | Bacteria | 1500 |
| 1036 | nmdc:mga09592_40233_c1 | 3300050508 | Bacteria | 3590 |
| 1037 | nmdc:mga0qj67_83908_c1 | 3300050509 | Bacteria | 2554 |
| 1038 | nmdc:mga06r32_156210_c1 | 3300050510 | Bacteria | 2262 |
| 1039 | nmdc:mga06r32_213809_c1 | 3300050510 | Bacteria | 1916 |
| 1040 | nmdc:mga08y16_279080_c1 | 3300050511 | Bacteria | 1724 |
| 1041 | nmdc:mga08y16_413286_c1 | 3300050511 | Bacteria | 1379 |
| 1042 | nmdc:mga0n895_76663_c1 | 3300050512 | Bacteria | 3324 |
| 1043 | nmdc:mga0rr50_164718_c1 | 3300050513 | Bacteria | 1802 |
| 1044 | nmdc:mga08x19_29023_c1 | 3300050514 | Bacteria | 3469 |
| 1045 | nmdc:mga08x19_68665_c1 | 3300050514 | Bacteria | 2307 |
| 1046 | nmdc:mga0a205_101094_c1 | 3300050515 | Unclassified | 2782 |
| 1047 | nmdc:mga0a205_166408_c1 | 3300050515 | Bacteria | 2100 |
| 1048 | Ga0495612_0005445 | 3300053078 | Bacteria | 5262 |
| 1049 | Ga0495595_0092803 | 3300053084 | Bacteria | 1450 |
| 1050 | Ga0495619_0068242 | 3300053085 | Bacteria | 2375 |
| 1051 | Ga0500643_018194 | 3300053087 | Bacteria | 2336 |
| 1052 | Ga0500651_0000003 | 3300053093 | Bacteria | 422045 |
| 1053 | Ga0500595_000005 | 3300053119 | Bacteria | 340896 |
| 1054 | Ga0500595_002307 | 3300053119 | Bacteria | 9546 |
| 1055 | Ga0500595_016340 | 3300053119 | Bacteria | 2766 |
| 1056 | Ga0500661_001353 | 3300055283 | Bacteria | 4573 |
| 1057 | Ga0590071_000712 | 3300059421 | Bacteria | 9413 |
| 1058 | Ga0590075_000427 | 3300059424 | Bacteria | 11426 |
| 1059 | Ga0590077_001032 | 3300059426 | Bacteria | 6958 |
| 1060 | Ga0501082_0218858 | 3300060353 | Bacteria | 1657 |
| 1061 | Ga0501082_0233725 | 3300060353 | Bacteria | 1600 |
| 1062 | Ga0466962_0060217 | 3300061719 | Bacteria | 1812 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035091 | Ga0373951_0051588 | Ga0373951_0051588_133_993 | 281 |
| 2 | 3300025938 | Ga0207704_10287771 | Ga0207704_102877711 | 282 |
| 3 | 3300025942 | Ga0207689_10399215 | Ga0207689_103992152 | 282 |
| 4 | 3300013307 | Ga0157372_10012466 | Ga0157372_100124667 | 283 |
| 5 | 3300035113 | Ga0373936_0130329 | Ga0373936_0130329_189_1067 | 283 |
| 6 | 3300013306 | Ga0163162_10805186 | Ga0163162_108051861 | 286 |
| 7 | 3300049707 | Ga0501234_024327 | Ga0501234_024327_60_935 | 288 |
| 8 | 3300025925 | Ga0207650_10184065 | Ga0207650_101840652 | 289 |
| 9 | 3300035118 | Ga0373954_0115703 | Ga0373954_0115703_271_1203 | 290 |
| 10 | 3300046454 | Ga0495592_0318709 | Ga0495592_0318709_46_978 | 290 |
| 11 | 3300046514 | Ga0495618_0264413 | Ga0495618_0264413_61_993 | 290 |
| 12 | 3300046536 | Ga0495587_0028962 | Ga0495587_0028962_24_956 | 290 |
| 13 | 3300048089 | Ga0495614_0178509 | Ga0495614_0178509_32_937 | 292 |
| 14 | 3300036401 | Ga0373937_0256368 | Ga0373937_0256368_727_1620 | 294 |
| 15 | 3300050511 | nmdc:mga08y16_413286_c1 | nmdc:mga08y16_413286_c1_17_910 | 294 |
| 16 | 3300009098 | Ga0105245_10500063 | Ga0105245_105000631 | 298 |
| 17 | 3300050507 | nmdc:mga05p37_143694_c1 | nmdc:mga05p37_143694_c1_26_973 | 312 |
| 18 | 3300031852 | Ga0307410_10200920 | Ga0307410_102009202 | 324 |
| 19 | 3300005330 | Ga0070690_100003413 | Ga0070690_1000034133 | 325 |
| 20 | 3300005544 | Ga0070686_100005851 | Ga0070686_1000058513 | 325 |
| 21 | 3300009177 | Ga0105248_10141655 | Ga0105248_101416554 | 325 |
| 22 | 3300013297 | Ga0157378_10003643 | Ga0157378_100036433 | 325 |
| 23 | 3300025918 | Ga0207662_10004894 | Ga0207662_100048942 | 325 |
| 24 | 3300025941 | Ga0207711_10394804 | Ga0207711_103948041 | 325 |
| 25 | 3300031344 | Ga0265316_10050157 | Ga0265316_100501573 | 329 |
| 26 | 3300053119 | Ga0500595_002307 | Ga0500595_002307_1029_2105 | 329 |
| 27 | 3300049515 | Ga0501292_004648 | Ga0501292_004648_395_1399 | 331 |
| 28 | 3300049522 | Ga0501299_001928 | Ga0501299_001928_110_1114 | 331 |
| 29 | 3300049526 | Ga0501303_002650 | Ga0501303_002650_315_1319 | 331 |
| 30 | 3300009177 | Ga0105248_10000002 | Ga0105248_10000002141 | 332 |
| 31 | 3300025941 | Ga0207711_10000052 | Ga0207711_100000527 | 332 |
| 32 | 3300038443 | Ga0395901_0391090 | Ga0395901_0391090_383_1408 | 332 |
| 33 | 3300048918 | Ga0496115_0176175 | Ga0496115_0176175_30_1076 | 332 |
| 34 | 3300050514 | nmdc:mga08x19_68665_c1 | nmdc:mga08x19_68665_c1_1057_2064 | 332 |
| 35 | 3300005366 | Ga0070659_100001855 | Ga0070659_10000185515 | 333 |
| 36 | 3300013296 | Ga0157374_10022671 | Ga0157374_100226713 | 333 |
| 37 | 3300014969 | Ga0157376_10134661 | Ga0157376_101346612 | 333 |
| 38 | 3300025932 | Ga0207690_10001008 | Ga0207690_100010089 | 333 |
| 39 | 3300025961 | Ga0207712_10092152 | Ga0207712_100921521 | 333 |
| 40 | 3300035083 | Ga0373926_0068325 | Ga0373926_0068325_138_1199 | 333 |
| 41 | 3300035111 | Ga0373923_0039547 | Ga0373923_0039547_391_1452 | 333 |
| 42 | 3300035118 | Ga0373954_0135955 | Ga0373954_0135955_86_1147 | 333 |
| 43 | 3300035692 | Ga0373935_0002525 | Ga0373935_0002525_467_1528 | 333 |
| 44 | 3300035695 | Ga0373927_0014400 | Ga0373927_0014400_3260_4321 | 333 |
| 45 | 3300035725 | Ga0373947_0053647 | Ga0373947_0053647_467_1528 | 333 |
| 46 | 3300036401 | Ga0373937_0081139 | Ga0373937_0081139_802_1863 | 333 |
| 47 | 3300037471 | Ga0395905_0109723 | Ga0395905_0109723_393_1409 | 333 |
| 48 | 3300046462 | Ga0495651_0000658 | Ga0495651_0000658_17621_18682 | 333 |
| 49 | 3300046462 | Ga0495651_0021531 | Ga0495651_0021531_1163_2224 | 333 |
| 50 | 3300046462 | Ga0495651_0057297 | Ga0495651_0057297_1122_2183 | 333 |
| 51 | 3300046463 | Ga0495653_0006642 | Ga0495653_0006642_4098_5159 | 333 |
| 52 | 3300046472 | Ga0495580_0097816 | Ga0495580_0097816_929_1990 | 333 |
| 53 | 3300046477 | Ga0495664_0032560 | Ga0495664_0032560_1200_2261 | 333 |
| 54 | 3300046511 | Ga0495608_0008806 | Ga0495608_0008806_2574_3635 | 333 |
| 55 | 3300046511 | Ga0495608_0048209 | Ga0495608_0048209_1550_2611 | 333 |
| 56 | 3300046514 | Ga0495618_0029659 | Ga0495618_0029659_491_1552 | 333 |
| 57 | 3300046516 | Ga0495628_0009956 | Ga0495628_0009956_4707_5768 | 333 |
| 58 | 3300046516 | Ga0495628_0034751 | Ga0495628_0034751_2716_3777 | 333 |
| 59 | 3300046516 | Ga0495628_0068322 | Ga0495628_0068322_783_1844 | 333 |
| 60 | 3300046517 | Ga0495630_0012339 | Ga0495630_0012339_730_1791 | 333 |
| 61 | 3300046517 | Ga0495630_0017612 | Ga0495630_0017612_508_1569 | 333 |
| 62 | 3300046517 | Ga0495630_0026040 | Ga0495630_0026040_1645_2706 | 333 |
| 63 | 3300046529 | Ga0495652_0135402 | Ga0495652_0135402_872_1933 | 333 |
| 64 | 3300046535 | Ga0495586_0009290 | Ga0495586_0009290_3234_4295 | 333 |
| 65 | 3300046535 | Ga0495586_0037530 | Ga0495586_0037530_531_1592 | 333 |
| 66 | 3300046536 | Ga0495587_0016807 | Ga0495587_0016807_449_1510 | 333 |
| 67 | 3300046543 | Ga0495645_0014496 | Ga0495645_0014496_3557_4618 | 333 |
| 68 | 3300046543 | Ga0495645_0036085 | Ga0495645_0036085_771_1832 | 333 |
| 69 | 3300046559 | Ga0495667_0000793 | Ga0495667_0000793_2737_3798 | 333 |
| 70 | 3300046559 | Ga0495667_0000984 | Ga0495667_0000984_9247_10308 | 333 |
| 71 | 3300046642 | Ga0495634_0103632 | Ga0495634_0103632_147_1208 | 333 |
| 72 | 3300046663 | Ga0495635_0028423 | Ga0495635_0028423_1256_2317 | 333 |
| 73 | 3300046663 | Ga0495635_0154029 | Ga0495635_0154029_135_1196 | 333 |
| 74 | 3300046675 | Ga0495657_0016262 | Ga0495657_0016262_3607_4668 | 333 |
| 75 | 3300046678 | Ga0495599_0004359 | Ga0495599_0004359_1643_2704 | 333 |
| 76 | 3300046680 | Ga0495646_0021775 | Ga0495646_0021775_2454_3515 | 333 |
| 77 | 3300046680 | Ga0495646_0052180 | Ga0495646_0052180_944_2005 | 333 |
| 78 | 3300046689 | Ga0495613_0071294 | Ga0495613_0071294_1187_2248 | 333 |
| 79 | 3300046690 | Ga0495624_0055158 | Ga0495624_0055158_197_1258 | 333 |
| 80 | 3300046809 | Ga0495600_0013097 | Ga0495600_0013097_3167_4228 | 333 |
| 81 | 3300046809 | Ga0495600_0021800 | Ga0495600_0021800_747_1808 | 333 |
| 82 | 3300047317 | Ga0495604_0041593 | Ga0495604_0041593_2147_3208 | 333 |
| 83 | 3300047317 | Ga0495604_0088006 | Ga0495604_0088006_339_1400 | 333 |
| 84 | 3300047317 | Ga0495604_0134676 | Ga0495604_0134676_636_1697 | 333 |
| 85 | 3300047319 | Ga0495674_0018431 | Ga0495674_0018431_859_1920 | 333 |
| 86 | 3300047319 | Ga0495674_0022808 | Ga0495674_0022808_1952_3013 | 333 |
| 87 | 3300047319 | Ga0495674_0057923 | Ga0495674_0057923_1822_2883 | 333 |
| 88 | 3300047321 | Ga0495676_0137024 | Ga0495676_0137024_320_1381 | 333 |
| 89 | 3300047322 | Ga0495680_0001356 | Ga0495680_0001356_22792_23853 | 333 |
| 90 | 3300047322 | Ga0495680_0003859 | Ga0495680_0003859_12478_13539 | 333 |
| 91 | 3300047444 | Ga0495675_0000556 | Ga0495675_0000556_7036_8097 | 333 |
| 92 | 3300047444 | Ga0495675_0004321 | Ga0495675_0004321_885_1946 | 333 |
| 93 | 3300047471 | Ga0495684_0000847 | Ga0495684_0000847_13868_14929 | 333 |
| 94 | 3300047471 | Ga0495684_0048495 | Ga0495684_0048495_1964_3025 | 333 |
| 95 | 3300047471 | Ga0495684_0104708 | Ga0495684_0104708_676_1737 | 333 |
| 96 | 3300047673 | Ga0495593_0022830 | Ga0495593_0022830_907_1968 | 333 |
| 97 | 3300048088 | Ga0495602_0052799 | Ga0495602_0052799_2398_3459 | 333 |
| 98 | 3300048089 | Ga0495614_0060705 | Ga0495614_0060705_78_1139 | 333 |
| 99 | 3300053078 | Ga0495612_0005445 | Ga0495612_0005445_966_2027 | 333 |
| 100 | 3300059421 | Ga0590071_000712 | Ga0590071_000712_5677_6720 | 333 |
| 101 | 3300059424 | Ga0590075_000427 | Ga0590075_000427_7661_8704 | 333 |
| 102 | 3300059426 | Ga0590077_001032 | Ga0590077_001032_2436_3479 | 333 |
| 103 | 3300005327 | Ga0070658_10016381 | Ga0070658_100163814 | 334 |
| 104 | 3300005366 | Ga0070659_100007704 | Ga0070659_1000077046 | 334 |
| 105 | 3300005539 | Ga0068853_100004354 | Ga0068853_1000043545 | 334 |
| 106 | 3300005563 | Ga0068855_100042381 | Ga0068855_1000423812 | 334 |
| 107 | 3300005563 | Ga0068855_100042577 | Ga0068855_1000425775 | 334 |
| 108 | 3300005563 | Ga0068855_100339224 | Ga0068855_1003392242 | 334 |
| 109 | 3300005834 | Ga0068851_10060668 | Ga0068851_100606683 | 334 |
| 110 | 3300025909 | Ga0207705_10013354 | Ga0207705_100133544 | 334 |
| 111 | 3300025909 | Ga0207705_10060544 | Ga0207705_100605442 | 334 |
| 112 | 3300025920 | Ga0207649_10003594 | Ga0207649_100035943 | 334 |
| 113 | 3300025924 | Ga0207694_10003854 | Ga0207694_100038545 | 334 |
| 114 | 3300025924 | Ga0207694_10219392 | Ga0207694_102193922 | 334 |
| 115 | 3300025932 | Ga0207690_10153121 | Ga0207690_101531212 | 334 |
| 116 | 3300025986 | Ga0207658_10130957 | Ga0207658_101309572 | 334 |
| 117 | 3300046452 | Ga0495617_055962 | Ga0495617_055962_18_1085 | 334 |
| 118 | 3300046513 | Ga0495616_0123570 | Ga0495616_0123570_25_1092 | 334 |
| 119 | 3300036712 | Ga0316584_0270706 | Ga0316584_0270706_118_1167 | 335 |
| 120 | 3300049587 | Ga0501071_0043967 | Ga0501071_0043967_1933_2952 | 335 |
| 121 | 3300031235 | Ga0265330_10000146 | Ga0265330_1000014612 | 336 |
| 122 | 3300031344 | Ga0265316_10039382 | Ga0265316_100393822 | 336 |
| 123 | 3300031712 | Ga0265342_10000046 | Ga0265342_1000004679 | 336 |
| 124 | 3300042876 | Ga0451577_0153210 | Ga0451577_0153210_673_1692 | 336 |
| 125 | 3300044712 | Ga0453684_0000013 | Ga0453684_0000013_338581_339600 | 336 |
| 126 | 3300044712 | Ga0453684_0000290 | Ga0453684_0000290_111318_112337 | 336 |
| 127 | 3300044712 | Ga0453684_0003962 | Ga0453684_0003962_27706_28725 | 336 |
| 128 | 3300044712 | Ga0453684_0010733 | Ga0453684_0010733_814_1833 | 336 |
| 129 | 3300044712 | Ga0453684_0017793 | Ga0453684_0017793_1916_2935 | 336 |
| 130 | 3300044712 | Ga0453684_0026428 | Ga0453684_0026428_5844_6863 | 336 |
| 131 | 3300044712 | Ga0453684_0054483 | Ga0453684_0054483_1513_2532 | 336 |
| 132 | 3300044712 | Ga0453684_0103137 | Ga0453684_0103137_23_1042 | 336 |
| 133 | 3300044712 | Ga0453684_0109595 | Ga0453684_0109595_887_1903 | 336 |
| 134 | 3300028558 | Ga0265326_10028802 | Ga0265326_100288022 | 337 |
| 135 | 3300005333 | Ga0070677_10002326 | Ga0070677_100023262 | 339 |
| 136 | 3300005467 | Ga0070706_100000509 | Ga0070706_1000005098 | 339 |
| 137 | 3300005564 | Ga0070664_100115697 | Ga0070664_1001156972 | 339 |
| 138 | 3300006028 | Ga0070717_10003518 | Ga0070717_1000351812 | 339 |
| 139 | 3300025910 | Ga0207684_10000753 | Ga0207684_100007538 | 339 |
| 140 | 3300025945 | Ga0207679_10049038 | Ga0207679_100490382 | 339 |
| 141 | 3300028800 | Ga0265338_10012926 | Ga0265338_1001292610 | 339 |
| 142 | 3300031239 | Ga0265328_10004527 | Ga0265328_100045277 | 339 |
| 143 | 3300031241 | Ga0265325_10094888 | Ga0265325_100948881 | 339 |
| 144 | 3300031249 | Ga0265339_10010487 | Ga0265339_100104873 | 339 |
| 145 | 3300031344 | Ga0265316_10021272 | Ga0265316_100212727 | 339 |
| 146 | 3300031711 | Ga0265314_10005188 | Ga0265314_1000518811 | 339 |
| 147 | 3300031712 | Ga0265342_10016834 | Ga0265342_100168345 | 339 |
| 148 | 3300046473 | Ga0495582_0048449 | Ga0495582_0048449_1006_2106 | 340 |
| 149 | 3300013297 | Ga0157378_10005072 | Ga0157378_100050729 | 341 |
| 150 | 3300048907 | Ga0496104_0204983 | Ga0496104_0204983_56_1156 | 341 |
| 151 | 3300005354 | Ga0070675_100207461 | Ga0070675_1002074612 | 342 |
| 152 | 3300005617 | Ga0068859_100290861 | Ga0068859_1002908612 | 342 |
| 153 | 3300006931 | Ga0097620_100290839 | Ga0097620_1002908392 | 342 |
| 154 | 3300025913 | Ga0207695_10099597 | Ga0207695_100995971 | 342 |
| 155 | 3300044694 | Ga0466963_0012206 | Ga0466963_0012206_1525_2580 | 342 |
| 156 | 3300046499 | Ga0495594_0079980 | Ga0495594_0079980_715_1755 | 343 |
| 157 | iso_pu_bacteria | 2884215851 | 2884218013 | 343 |
| 158 | 3300005614 | Ga0068856_100293219 | Ga0068856_1002932192 | 344 |
| 159 | 3300013307 | Ga0157372_10052443 | Ga0157372_100524432 | 344 |
| 160 | 3300031691 | Ga0316579_10031757 | Ga0316579_100317572 | 344 |
| 161 | 3300031712 | Ga0265342_10058962 | Ga0265342_100589622 | 344 |
| 162 | 3300031727 | Ga0316576_10110042 | Ga0316576_101100422 | 344 |
| 163 | 3300035171 | Ga0373946_0044571 | Ga0373946_0044571_238_1305 | 344 |
| 164 | 3300037068 | Ga0373925_0005912 | Ga0373925_0005912_5470_6537 | 344 |
| 165 | 3300039447 | Ga0436361_0128003 | Ga0436361_0128003_5733_6794 | 344 |
| 166 | 3300039447 | Ga0436361_0798862 | Ga0436361_0798862_193_1254 | 344 |
| 167 | 3300039447 | Ga0436361_1043667 | Ga0436361_1043667_3308_4369 | 344 |
| 168 | 3300039453 | Ga0436362_0169000 | Ga0436362_0169000_36_1097 | 344 |
| 169 | 3300046459 | Ga0495629_0000010 | Ga0495629_0000010_211520_212596 | 344 |
| 170 | 3300046463 | Ga0495653_0068710 | Ga0495653_0068710_361_1416 | 344 |
| 171 | 3300046475 | Ga0495639_0001981 | Ga0495639_0001981_5263_6330 | 344 |
| 172 | 3300046526 | Ga0495666_0002504 | Ga0495666_0002504_1773_2840 | 344 |
| 173 | 3300046535 | Ga0495586_0001355 | Ga0495586_0001355_7215_8282 | 344 |
| 174 | 3300046557 | Ga0495622_0010336 | Ga0495622_0010336_2646_3713 | 344 |
| 175 | 3300046663 | Ga0495635_0000717 | Ga0495635_0000717_7238_8293 | 344 |
| 176 | 3300046683 | Ga0495658_0011831 | Ga0495658_0011831_2068_3135 | 344 |
| 177 | 3300046690 | Ga0495624_0128111 | Ga0495624_0128111_246_1301 | 344 |
| 178 | 3300046809 | Ga0495600_0025304 | Ga0495600_0025304_1981_3036 | 344 |
| 179 | 3300047321 | Ga0495676_0054425 | Ga0495676_0054425_395_1462 | 344 |
| 180 | 3300047322 | Ga0495680_0004805 | Ga0495680_0004805_8192_9247 | 344 |
| 181 | 3300047471 | Ga0495684_0036168 | Ga0495684_0036168_1812_2867 | 344 |
| 182 | 3300053085 | Ga0495619_0068242 | Ga0495619_0068242_299_1354 | 344 |
| 183 | 3300003203 | JGI25406J46586_10005411 | JGI25406J46586_100054113 | 345 |
| 184 | 3300005468 | Ga0070707_100021182 | Ga0070707_1000211821 | 345 |
| 185 | 3300005545 | Ga0070695_100281244 | Ga0070695_1002812441 | 345 |
| 186 | 3300005577 | Ga0068857_100099984 | Ga0068857_1000999842 | 345 |
| 187 | 3300005617 | Ga0068859_100057196 | Ga0068859_1000571962 | 345 |
| 188 | 3300005985 | Ga0081539_10001697 | Ga0081539_1000169725 | 345 |
| 189 | 3300006852 | Ga0075433_10042358 | Ga0075433_100423585 | 345 |
| 190 | 3300006931 | Ga0097620_100057194 | Ga0097620_1000571942 | 345 |
| 191 | 3300009147 | Ga0114129_10010664 | Ga0114129_1001066411 | 345 |
| 192 | 3300009176 | Ga0105242_10246326 | Ga0105242_102463262 | 345 |
| 193 | 3300009551 | Ga0105238_10369686 | Ga0105238_103696862 | 345 |
| 194 | 3300010375 | Ga0105239_10145102 | Ga0105239_101451021 | 345 |
| 195 | 3300013297 | Ga0157378_10086042 | Ga0157378_100860423 | 345 |
| 196 | 3300014969 | Ga0157376_10022346 | Ga0157376_100223463 | 345 |
| 197 | 3300025914 | Ga0207671_10159164 | Ga0207671_101591642 | 345 |
| 198 | 3300025935 | Ga0207709_10046486 | Ga0207709_100464862 | 345 |
| 199 | 3300026116 | Ga0207674_10117887 | Ga0207674_101178872 | 345 |
| 200 | 3300028380 | Ga0268265_10240959 | Ga0268265_102409591 | 345 |
| 201 | 3300028666 | Ga0265336_10000499 | Ga0265336_100004998 | 345 |
| 202 | 3300031548 | Ga0307408_100222509 | Ga0307408_1002225091 | 345 |
| 203 | 3300031852 | Ga0307410_10080258 | Ga0307410_100802582 | 345 |
| 204 | 3300031911 | Ga0307412_10045049 | Ga0307412_100450492 | 345 |
| 205 | 3300032004 | Ga0307414_10054027 | Ga0307414_100540272 | 345 |
| 206 | 3300037471 | Ga0395905_0132846 | Ga0395905_0132846_506_1558 | 345 |
| 207 | 3300038996 | Ga0242420_007223 | Ga0242420_007223_80_1126 | 345 |
| 208 | 3300044673 | Ga0453683_0017952 | Ga0453683_0017952_308_1363 | 345 |
| 209 | 3300044673 | Ga0453683_0256895 | Ga0453683_0256895_16_1062 | 345 |
| 210 | 3300044712 | Ga0453684_0074179 | Ga0453684_0074179_920_1975 | 345 |
| 211 | 3300044712 | Ga0453684_0133166 | Ga0453684_0133166_1053_2108 | 345 |
| 212 | 3300044712 | Ga0453684_0167749 | Ga0453684_0167749_292_1347 | 345 |
| 213 | 3300045051 | Ga0451576_0065326 | Ga0451576_0065326_741_1796 | 345 |
| 214 | 3300048905 | Ga0496102_0169648 | Ga0496102_0169648_944_1990 | 345 |
| 215 | 3300048909 | Ga0496106_0241077 | Ga0496106_0241077_47_1093 | 345 |
| 216 | 3300048929 | Ga0496126_0103576 | Ga0496126_0103576_519_1583 | 345 |
| 217 | 3300050515 | nmdc:mga0a205_166408_c1 | nmdc:mga0a205_166408_c1_722_1768 | 345 |
| 218 | iso_pu_bacteria | 2818991459 | 2819670947 | 345 |
| 219 | iso_pu_bacteria | 2904113452 | 2904114493 | 345 |
| 220 | 3300005329 | Ga0070683_100008501 | Ga0070683_1000085019 | 346 |
| 221 | 3300005329 | Ga0070683_100011715 | Ga0070683_1000117156 | 346 |
| 222 | 3300005331 | Ga0070670_100001371 | Ga0070670_10000137110 | 346 |
| 223 | 3300005331 | Ga0070670_100371546 | Ga0070670_1003715461 | 346 |
| 224 | 3300005334 | Ga0068869_100000150 | Ga0068869_10000015027 | 346 |
| 225 | 3300005335 | Ga0070666_10054200 | Ga0070666_100542002 | 346 |
| 226 | 3300005335 | Ga0070666_10077700 | Ga0070666_100777001 | 346 |
| 227 | 3300005336 | Ga0070680_100012003 | Ga0070680_1000120033 | 346 |
| 228 | 3300005338 | Ga0068868_100001048 | Ga0068868_10000104817 | 346 |
| 229 | 3300005338 | Ga0068868_100002969 | Ga0068868_1000029697 | 346 |
| 230 | 3300005338 | Ga0068868_100346532 | Ga0068868_1003465321 | 346 |
| 231 | 3300005339 | Ga0070660_100010244 | Ga0070660_1000102447 | 346 |
| 232 | 3300005340 | Ga0070689_100342525 | Ga0070689_1003425251 | 346 |
| 233 | 3300005344 | Ga0070661_100016773 | Ga0070661_1000167732 | 346 |
| 234 | 3300005344 | Ga0070661_100026896 | Ga0070661_1000268963 | 346 |
| 235 | 3300005347 | Ga0070668_100069089 | Ga0070668_1000690892 | 346 |
| 236 | 3300005354 | Ga0070675_100009318 | Ga0070675_1000093185 | 346 |
| 237 | 3300005355 | Ga0070671_100006131 | Ga0070671_1000061317 | 346 |
| 238 | 3300005355 | Ga0070671_100021203 | Ga0070671_1000212032 | 346 |
| 239 | 3300005355 | Ga0070671_100032834 | Ga0070671_1000328343 | 346 |
| 240 | 3300005364 | Ga0070673_100027927 | Ga0070673_1000279271 | 346 |
| 241 | 3300005366 | Ga0070659_100321695 | Ga0070659_1003216951 | 346 |
| 242 | 3300005367 | Ga0070667_100007254 | Ga0070667_1000072546 | 346 |
| 243 | 3300005367 | Ga0070667_100028591 | Ga0070667_1000285912 | 346 |
| 244 | 3300005435 | Ga0070714_100012873 | Ga0070714_1000128733 | 346 |
| 245 | 3300005435 | Ga0070714_100057585 | Ga0070714_1000575854 | 346 |
| 246 | 3300005436 | Ga0070713_100067642 | Ga0070713_1000676423 | 346 |
| 247 | 3300005457 | Ga0070662_100038077 | Ga0070662_1000380773 | 346 |
| 248 | 3300005458 | Ga0070681_10173043 | Ga0070681_101730432 | 346 |
| 249 | 3300005530 | Ga0070679_100010655 | Ga0070679_1000106558 | 346 |
| 250 | 3300005530 | Ga0070679_100049509 | Ga0070679_1000495092 | 346 |
| 251 | 3300005530 | Ga0070679_100491511 | Ga0070679_1004915111 | 346 |
| 252 | 3300005535 | Ga0070684_100000615 | Ga0070684_1000006159 | 346 |
| 253 | 3300005535 | Ga0070684_100005285 | Ga0070684_10000528510 | 346 |
| 254 | 3300005535 | Ga0070684_100030864 | Ga0070684_1000308642 | 346 |
| 255 | 3300005539 | Ga0068853_100000021 | Ga0068853_10000002144 | 346 |
| 256 | 3300005539 | Ga0068853_100000530 | Ga0068853_10000053021 | 346 |
| 257 | 3300005543 | Ga0070672_100022363 | Ga0070672_1000223632 | 346 |
| 258 | 3300005545 | Ga0070695_100101656 | Ga0070695_1001016562 | 346 |
| 259 | 3300005547 | Ga0070693_100084193 | Ga0070693_1000841932 | 346 |
| 260 | 3300005548 | Ga0070665_100003253 | Ga0070665_10000325319 | 346 |
| 261 | 3300005548 | Ga0070665_100203379 | Ga0070665_1002033792 | 346 |
| 262 | 3300005563 | Ga0068855_100003888 | Ga0068855_1000038882 | 346 |
| 263 | 3300005563 | Ga0068855_100004226 | Ga0068855_1000042267 | 346 |
| 264 | 3300005563 | Ga0068855_100024264 | Ga0068855_1000242645 | 346 |
| 265 | 3300005577 | Ga0068857_100000546 | Ga0068857_10000054617 | 346 |
| 266 | 3300005577 | Ga0068857_100362345 | Ga0068857_1003623451 | 346 |
| 267 | 3300005578 | Ga0068854_100000058 | Ga0068854_10000005832 | 346 |
| 268 | 3300005614 | Ga0068856_100011402 | Ga0068856_1000114022 | 346 |
| 269 | 3300005614 | Ga0068856_100031462 | Ga0068856_1000314625 | 346 |
| 270 | 3300005614 | Ga0068856_100035677 | Ga0068856_1000356772 | 346 |
| 271 | 3300005614 | Ga0068856_100045450 | Ga0068856_1000454502 | 346 |
| 272 | 3300005616 | Ga0068852_100000015 | Ga0068852_100000015102 | 346 |
| 273 | 3300005616 | Ga0068852_100001731 | Ga0068852_10000173114 | 346 |
| 274 | 3300005616 | Ga0068852_100140064 | Ga0068852_1001400642 | 346 |
| 275 | 3300005616 | Ga0068852_100191105 | Ga0068852_1001911052 | 346 |
| 276 | 3300005617 | Ga0068859_100008509 | Ga0068859_1000085092 | 346 |
| 277 | 3300005618 | Ga0068864_100000358 | Ga0068864_10000035817 | 346 |
| 278 | 3300005834 | Ga0068851_10087750 | Ga0068851_100877502 | 346 |
| 279 | 3300005840 | Ga0068870_10059368 | Ga0068870_100593681 | 346 |
| 280 | 3300005841 | Ga0068863_100002705 | Ga0068863_1000027055 | 346 |
| 281 | 3300005842 | Ga0068858_100001959 | Ga0068858_10000195921 | 346 |
| 282 | 3300005843 | Ga0068860_100000809 | Ga0068860_10000080931 | 346 |
| 283 | 3300005843 | Ga0068860_100069366 | Ga0068860_1000693662 | 346 |
| 284 | 3300005844 | Ga0068862_100050254 | Ga0068862_1000502542 | 346 |
| 285 | 3300005983 | Ga0081540_1017614 | Ga0081540_10176142 | 346 |
| 286 | 3300006237 | Ga0097621_100022382 | Ga0097621_1000223824 | 346 |
| 287 | 3300006237 | Ga0097621_100098149 | Ga0097621_1000981491 | 346 |
| 288 | 3300006358 | Ga0068871_100003433 | Ga0068871_10000343310 | 346 |
| 289 | 3300006358 | Ga0068871_100022353 | Ga0068871_1000223534 | 346 |
| 290 | 3300006844 | Ga0075428_100026112 | Ga0075428_1000261124 | 346 |
| 291 | 3300006847 | Ga0075431_100205288 | Ga0075431_1002052882 | 346 |
| 292 | 3300006881 | Ga0068865_100054418 | Ga0068865_1000544182 | 346 |
| 293 | 3300006914 | Ga0075436_100016127 | Ga0075436_1000161273 | 346 |
| 294 | 3300006931 | Ga0097620_100008509 | Ga0097620_1000085092 | 346 |
| 295 | 3300009093 | Ga0105240_10000181 | Ga0105240_1000018190 | 346 |
| 296 | 3300009093 | Ga0105240_10000296 | Ga0105240_1000029680 | 346 |
| 297 | 3300009093 | Ga0105240_10001490 | Ga0105240_1000149014 | 346 |
| 298 | 3300009093 | Ga0105240_10001725 | Ga0105240_1000172519 | 346 |
| 299 | 3300009093 | Ga0105240_10022759 | Ga0105240_100227593 | 346 |
| 300 | 3300009093 | Ga0105240_10028160 | Ga0105240_100281605 | 346 |
| 301 | 3300009093 | Ga0105240_10039789 | Ga0105240_100397896 | 346 |
| 302 | 3300009093 | Ga0105240_10216876 | Ga0105240_102168762 | 346 |
| 303 | 3300009098 | Ga0105245_10000670 | Ga0105245_1000067017 | 346 |
| 304 | 3300009098 | Ga0105245_10004060 | Ga0105245_100040607 | 346 |
| 305 | 3300009098 | Ga0105245_10031511 | Ga0105245_100315113 | 346 |
| 306 | 3300009098 | Ga0105245_10078822 | Ga0105245_100788223 | 346 |
| 307 | 3300009101 | Ga0105247_10001310 | Ga0105247_100013109 | 346 |
| 308 | 3300009147 | Ga0114129_10121493 | Ga0114129_101214932 | 346 |
| 309 | 3300009174 | Ga0105241_10000076 | Ga0105241_1000007632 | 346 |
| 310 | 3300009174 | Ga0105241_10000890 | Ga0105241_1000089016 | 346 |
| 311 | 3300009174 | Ga0105241_10005735 | Ga0105241_100057357 | 346 |
| 312 | 3300009174 | Ga0105241_10007208 | Ga0105241_100072086 | 346 |
| 313 | 3300009174 | Ga0105241_10012112 | Ga0105241_100121124 | 346 |
| 314 | 3300009176 | Ga0105242_10429211 | Ga0105242_104292111 | 346 |
| 315 | 3300009177 | Ga0105248_10000574 | Ga0105248_1000057414 | 346 |
| 316 | 3300009177 | Ga0105248_10070263 | Ga0105248_100702635 | 346 |
| 317 | 3300009177 | Ga0105248_10119919 | Ga0105248_101199192 | 346 |
| 318 | 3300009545 | Ga0105237_10002962 | Ga0105237_1000296213 | 346 |
| 319 | 3300009545 | Ga0105237_10022210 | Ga0105237_100222102 | 346 |
| 320 | 3300009545 | Ga0105237_10029937 | Ga0105237_100299372 | 346 |
| 321 | 3300009545 | Ga0105237_10060993 | Ga0105237_100609932 | 346 |
| 322 | 3300009551 | Ga0105238_10000673 | Ga0105238_1000067311 | 346 |
| 323 | 3300009551 | Ga0105238_10001732 | Ga0105238_1000173212 | 346 |
| 324 | 3300009551 | Ga0105238_10022478 | Ga0105238_100224782 | 346 |
| 325 | 3300009551 | Ga0105238_10022964 | Ga0105238_100229644 | 346 |
| 326 | 3300009551 | Ga0105238_10099100 | Ga0105238_100991002 | 346 |
| 327 | 3300009551 | Ga0105238_10215227 | Ga0105238_102152272 | 346 |
| 328 | 3300009553 | Ga0105249_10011428 | Ga0105249_100114286 | 346 |
| 329 | 3300009553 | Ga0105249_10015336 | Ga0105249_100153362 | 346 |
| 330 | 3300009553 | Ga0105249_10465252 | Ga0105249_104652522 | 346 |
| 331 | 3300010375 | Ga0105239_10001562 | Ga0105239_100015628 | 346 |
| 332 | 3300010375 | Ga0105239_10013626 | Ga0105239_100136261 | 346 |
| 333 | 3300010375 | Ga0105239_10021901 | Ga0105239_100219012 | 346 |
| 334 | 3300010375 | Ga0105239_10094557 | Ga0105239_100945572 | 346 |
| 335 | 3300010375 | Ga0105239_10411336 | Ga0105239_104113362 | 346 |
| 336 | 3300010375 | Ga0105239_10506485 | Ga0105239_105064851 | 346 |
| 337 | 3300011119 | Ga0105246_10001037 | Ga0105246_100010377 | 346 |
| 338 | 3300011119 | Ga0105246_10191974 | Ga0105246_101919741 | 346 |
| 339 | 3300013100 | Ga0157373_10139606 | Ga0157373_101396061 | 346 |
| 340 | 3300013102 | Ga0157371_10137500 | Ga0157371_101375002 | 346 |
| 341 | 3300013104 | Ga0157370_10000196 | Ga0157370_1000019629 | 346 |
| 342 | 3300013104 | Ga0157370_10047985 | Ga0157370_100479852 | 346 |
| 343 | 3300013104 | Ga0157370_10052297 | Ga0157370_100522972 | 346 |
| 344 | 3300013104 | Ga0157370_10107455 | Ga0157370_101074553 | 346 |
| 345 | 3300013105 | Ga0157369_10000400 | Ga0157369_1000040026 | 346 |
| 346 | 3300013105 | Ga0157369_10001946 | Ga0157369_1000194617 | 346 |
| 347 | 3300013105 | Ga0157369_10008244 | Ga0157369_100082443 | 346 |
| 348 | 3300013105 | Ga0157369_10021594 | Ga0157369_100215946 | 346 |
| 349 | 3300013105 | Ga0157369_10024835 | Ga0157369_100248352 | 346 |
| 350 | 3300013105 | Ga0157369_10123307 | Ga0157369_101233072 | 346 |
| 351 | 3300013105 | Ga0157369_10166600 | Ga0157369_101666002 | 346 |
| 352 | 3300013296 | Ga0157374_10016113 | Ga0157374_100161132 | 346 |
| 353 | 3300013296 | Ga0157374_10092541 | Ga0157374_100925411 | 346 |
| 354 | 3300013296 | Ga0157374_10488768 | Ga0157374_104887681 | 346 |
| 355 | 3300013297 | Ga0157378_10001503 | Ga0157378_100015039 | 346 |
| 356 | 3300013297 | Ga0157378_10012305 | Ga0157378_100123057 | 346 |
| 357 | 3300013297 | Ga0157378_10018918 | Ga0157378_100189182 | 346 |
| 358 | 3300013297 | Ga0157378_10026512 | Ga0157378_100265124 | 346 |
| 359 | 3300013307 | Ga0157372_10000197 | Ga0157372_1000019730 | 346 |
| 360 | 3300013307 | Ga0157372_10012396 | Ga0157372_100123966 | 346 |
| 361 | 3300013307 | Ga0157372_10029231 | Ga0157372_100292316 | 346 |
| 362 | 3300013307 | Ga0157372_10030411 | Ga0157372_100304114 | 346 |
| 363 | 3300013307 | Ga0157372_10064140 | Ga0157372_100641402 | 346 |
| 364 | 3300013307 | Ga0157372_10144707 | Ga0157372_101447072 | 346 |
| 365 | 3300013308 | Ga0157375_10002008 | Ga0157375_100020082 | 346 |
| 366 | 3300013308 | Ga0157375_10018165 | Ga0157375_100181651 | 346 |
| 367 | 3300013308 | Ga0157375_10111913 | Ga0157375_101119132 | 346 |
| 368 | 3300013308 | Ga0157375_10128474 | Ga0157375_101284742 | 346 |
| 369 | 3300014325 | Ga0163163_10001119 | Ga0163163_100011199 | 346 |
| 370 | 3300014968 | Ga0157379_10000092 | Ga0157379_1000009233 | 346 |
| 371 | 3300014969 | Ga0157376_10000566 | Ga0157376_100005668 | 346 |
| 372 | 3300014969 | Ga0157376_10008715 | Ga0157376_100087155 | 346 |
| 373 | 3300017792 | Ga0163161_10012559 | Ga0163161_100125592 | 346 |
| 374 | 3300025261 | Ga0209233_1010497 | Ga0209233_10104972 | 346 |
| 375 | 3300025900 | Ga0207710_10000400 | Ga0207710_100004008 | 346 |
| 376 | 3300025907 | Ga0207645_10005089 | Ga0207645_100050897 | 346 |
| 377 | 3300025911 | Ga0207654_10000025 | Ga0207654_1000002564 | 346 |
| 378 | 3300025911 | Ga0207654_10000035 | Ga0207654_1000003537 | 346 |
| 379 | 3300025911 | Ga0207654_10000242 | Ga0207654_100002428 | 346 |
| 380 | 3300025912 | Ga0207707_10127945 | Ga0207707_101279452 | 346 |
| 381 | 3300025913 | Ga0207695_10000069 | Ga0207695_10000069246 | 346 |
| 382 | 3300025913 | Ga0207695_10000119 | Ga0207695_10000119199 | 346 |
| 383 | 3300025913 | Ga0207695_10000314 | Ga0207695_1000031433 | 346 |
| 384 | 3300025913 | Ga0207695_10003396 | Ga0207695_1000339611 | 346 |
| 385 | 3300025913 | Ga0207695_10020092 | Ga0207695_100200926 | 346 |
| 386 | 3300025913 | Ga0207695_10037096 | Ga0207695_100370962 | 346 |
| 387 | 3300025913 | Ga0207695_10125045 | Ga0207695_101250452 | 346 |
| 388 | 3300025914 | Ga0207671_10000246 | Ga0207671_1000024660 | 346 |
| 389 | 3300025914 | Ga0207671_10008661 | Ga0207671_100086617 | 346 |
| 390 | 3300025915 | Ga0207693_10123049 | Ga0207693_101230492 | 346 |
| 391 | 3300025919 | Ga0207657_10064675 | Ga0207657_100646751 | 346 |
| 392 | 3300025920 | Ga0207649_10159724 | Ga0207649_101597242 | 346 |
| 393 | 3300025921 | Ga0207652_10015042 | Ga0207652_100150425 | 346 |
| 394 | 3300025921 | Ga0207652_10195644 | Ga0207652_101956441 | 346 |
| 395 | 3300025923 | Ga0207681_10018127 | Ga0207681_100181273 | 346 |
| 396 | 3300025924 | Ga0207694_10000445 | Ga0207694_1000044522 | 346 |
| 397 | 3300025924 | Ga0207694_10001160 | Ga0207694_1000116021 | 346 |
| 398 | 3300025924 | Ga0207694_10002398 | Ga0207694_100023987 | 346 |
| 399 | 3300025925 | Ga0207650_10001580 | Ga0207650_100015808 | 346 |
| 400 | 3300025926 | Ga0207659_10060591 | Ga0207659_100605911 | 346 |
| 401 | 3300025927 | Ga0207687_10003918 | Ga0207687_100039186 | 346 |
| 402 | 3300025929 | Ga0207664_10024226 | Ga0207664_100242261 | 346 |
| 403 | 3300025931 | Ga0207644_10050679 | Ga0207644_100506793 | 346 |
| 404 | 3300025931 | Ga0207644_10058042 | Ga0207644_100580421 | 346 |
| 405 | 3300025933 | Ga0207706_10003990 | Ga0207706_100039907 | 346 |
| 406 | 3300025933 | Ga0207706_10095763 | Ga0207706_100957633 | 346 |
| 407 | 3300025936 | Ga0207670_10100535 | Ga0207670_101005352 | 346 |
| 408 | 3300025940 | Ga0207691_10029746 | Ga0207691_100297462 | 346 |
| 409 | 3300025941 | Ga0207711_10003126 | Ga0207711_100031269 | 346 |
| 410 | 3300025941 | Ga0207711_10042974 | Ga0207711_100429741 | 346 |
| 411 | 3300025942 | Ga0207689_10000553 | Ga0207689_1000055317 | 346 |
| 412 | 3300025944 | Ga0207661_10014141 | Ga0207661_100141412 | 346 |
| 413 | 3300025944 | Ga0207661_10030419 | Ga0207661_100304192 | 346 |
| 414 | 3300025945 | Ga0207679_10311406 | Ga0207679_103114062 | 346 |
| 415 | 3300025949 | Ga0207667_10003942 | Ga0207667_100039422 | 346 |
| 416 | 3300025949 | Ga0207667_10019979 | Ga0207667_100199797 | 346 |
| 417 | 3300025949 | Ga0207667_10069425 | Ga0207667_100694252 | 346 |
| 418 | 3300025949 | Ga0207667_10098007 | Ga0207667_100980072 | 346 |
| 419 | 3300025949 | Ga0207667_10118488 | Ga0207667_101184882 | 346 |
| 420 | 3300025961 | Ga0207712_10014311 | Ga0207712_100143115 | 346 |
| 421 | 3300025961 | Ga0207712_10026055 | Ga0207712_100260553 | 346 |
| 422 | 3300025961 | Ga0207712_10047310 | Ga0207712_100473102 | 346 |
| 423 | 3300025981 | Ga0207640_10000013 | Ga0207640_1000001329 | 346 |
| 424 | 3300025986 | Ga0207658_10004414 | Ga0207658_100044142 | 346 |
| 425 | 3300025986 | Ga0207658_10025828 | Ga0207658_100258281 | 346 |
| 426 | 3300026023 | Ga0207677_10000104 | Ga0207677_1000010434 | 346 |
| 427 | 3300026035 | Ga0207703_10001534 | Ga0207703_100015345 | 346 |
| 428 | 3300026035 | Ga0207703_10171370 | Ga0207703_101713702 | 346 |
| 429 | 3300026041 | Ga0207639_10000035 | Ga0207639_1000003541 | 346 |
| 430 | 3300026041 | Ga0207639_10008007 | Ga0207639_100080076 | 346 |
| 431 | 3300026041 | Ga0207639_10018657 | Ga0207639_100186573 | 346 |
| 432 | 3300026041 | Ga0207639_10106525 | Ga0207639_101065252 | 346 |
| 433 | 3300026067 | Ga0207678_10030577 | Ga0207678_100305774 | 346 |
| 434 | 3300026075 | Ga0207708_10026844 | Ga0207708_100268443 | 346 |
| 435 | 3300026078 | Ga0207702_10000633 | Ga0207702_100006337 | 346 |
| 436 | 3300026078 | Ga0207702_10032353 | Ga0207702_100323532 | 346 |
| 437 | 3300026078 | Ga0207702_10043748 | Ga0207702_100437483 | 346 |
| 438 | 3300026088 | Ga0207641_10151279 | Ga0207641_101512792 | 346 |
| 439 | 3300026095 | Ga0207676_10005714 | Ga0207676_100057148 | 346 |
| 440 | 3300026116 | Ga0207674_10001288 | Ga0207674_1000128825 | 346 |
| 441 | 3300026118 | Ga0207675_100034162 | Ga0207675_1000341625 | 346 |
| 442 | 3300026121 | Ga0207683_10000600 | Ga0207683_100006005 | 346 |
| 443 | 3300026142 | Ga0207698_10000006 | Ga0207698_1000000629 | 346 |
| 444 | 3300026142 | Ga0207698_10092021 | Ga0207698_100920212 | 346 |
| 445 | 3300028379 | Ga0268266_10018533 | Ga0268266_100185333 | 346 |
| 446 | 3300028380 | Ga0268265_10041347 | Ga0268265_100413472 | 346 |
| 447 | 3300028380 | Ga0268265_10123169 | Ga0268265_101231692 | 346 |
| 448 | 3300028380 | Ga0268265_10316621 | Ga0268265_103166212 | 346 |
| 449 | 3300028381 | Ga0268264_10000877 | Ga0268264_1000087727 | 346 |
| 450 | 3300028381 | Ga0268264_10142864 | Ga0268264_101428641 | 346 |
| 451 | 3300028577 | Ga0265318_10021651 | Ga0265318_100216512 | 346 |
| 452 | 3300028577 | Ga0265318_10067317 | Ga0265318_100673171 | 346 |
| 453 | 3300028800 | Ga0265338_10036504 | Ga0265338_100365042 | 346 |
| 454 | 3300031235 | Ga0265330_10000326 | Ga0265330_1000032614 | 346 |
| 455 | 3300031235 | Ga0265330_10001479 | Ga0265330_100014793 | 346 |
| 456 | 3300031235 | Ga0265330_10061853 | Ga0265330_100618531 | 346 |
| 457 | 3300031238 | Ga0265332_10033129 | Ga0265332_100331292 | 346 |
| 458 | 3300031239 | Ga0265328_10022033 | Ga0265328_100220332 | 346 |
| 459 | 3300031241 | Ga0265325_10000499 | Ga0265325_100004998 | 346 |
| 460 | 3300031241 | Ga0265325_10001354 | Ga0265325_100013542 | 346 |
| 461 | 3300031241 | Ga0265325_10036674 | Ga0265325_100366742 | 346 |
| 462 | 3300031242 | Ga0265329_10010007 | Ga0265329_100100073 | 346 |
| 463 | 3300031247 | Ga0265340_10011027 | Ga0265340_100110273 | 346 |
| 464 | 3300031247 | Ga0265340_10014095 | Ga0265340_100140952 | 346 |
| 465 | 3300031247 | Ga0265340_10028336 | Ga0265340_100283363 | 346 |
| 466 | 3300031249 | Ga0265339_10001146 | Ga0265339_100011467 | 346 |
| 467 | 3300031249 | Ga0265339_10010510 | Ga0265339_100105104 | 346 |
| 468 | 3300031249 | Ga0265339_10013928 | Ga0265339_100139284 | 346 |
| 469 | 3300031249 | Ga0265339_10052954 | Ga0265339_100529542 | 346 |
| 470 | 3300031249 | Ga0265339_10060633 | Ga0265339_100606332 | 346 |
| 471 | 3300031344 | Ga0265316_10010292 | Ga0265316_100102923 | 346 |
| 472 | 3300031344 | Ga0265316_10010346 | Ga0265316_100103465 | 346 |
| 473 | 3300031344 | Ga0265316_10011796 | Ga0265316_100117963 | 346 |
| 474 | 3300031344 | Ga0265316_10121064 | Ga0265316_101210642 | 346 |
| 475 | 3300031344 | Ga0265316_10139972 | Ga0265316_101399722 | 346 |
| 476 | 3300031595 | Ga0265313_10001060 | Ga0265313_1000106014 | 346 |
| 477 | 3300031595 | Ga0265313_10004287 | Ga0265313_100042874 | 346 |
| 478 | 3300031595 | Ga0265313_10014216 | Ga0265313_100142162 | 346 |
| 479 | 3300031595 | Ga0265313_10018175 | Ga0265313_100181752 | 346 |
| 480 | 3300031711 | Ga0265314_10000063 | Ga0265314_1000006363 | 346 |
| 481 | 3300031711 | Ga0265314_10019331 | Ga0265314_100193311 | 346 |
| 482 | 3300031711 | Ga0265314_10079951 | Ga0265314_100799512 | 346 |
| 483 | 3300031711 | Ga0265314_10157913 | Ga0265314_101579131 | 346 |
| 484 | 3300031712 | Ga0265342_10001150 | Ga0265342_100011509 | 346 |
| 485 | 3300031712 | Ga0265342_10100849 | Ga0265342_101008492 | 346 |
| 486 | 3300035118 | Ga0373954_0064741 | Ga0373954_0064741_15_1115 | 346 |
| 487 | 3300036401 | Ga0373937_0229379 | Ga0373937_0229379_582_1682 | 346 |
| 488 | 3300037471 | Ga0395905_0073057 | Ga0395905_0073057_1241_2299 | 346 |
| 489 | 3300039093 | Ga0400489_60259 | Ga0400489_60259_624_1670 | 346 |
| 490 | 3300044694 | Ga0466963_0004074 | Ga0466963_0004074_7302_8432 | 346 |
| 491 | 3300044712 | Ga0453684_0013684 | Ga0453684_0013684_9944_11002 | 346 |
| 492 | 3300044712 | Ga0453684_0014791 | Ga0453684_0014791_1714_2772 | 346 |
| 493 | 3300045049 | Ga0466959_0006034 | Ga0466959_0006034_1604_2653 | 346 |
| 494 | 3300045051 | Ga0451576_0273915 | Ga0451576_0273915_130_1188 | 346 |
| 495 | 3300046459 | Ga0495629_0005512 | Ga0495629_0005512_7787_8944 | 346 |
| 496 | 3300046459 | Ga0495629_0141762 | Ga0495629_0141762_465_1553 | 346 |
| 497 | 3300046529 | Ga0495652_0030394 | Ga0495652_0030394_1428_2585 | 346 |
| 498 | 3300046536 | Ga0495587_0020882 | Ga0495587_0020882_2259_3416 | 346 |
| 499 | 3300046543 | Ga0495645_0013258 | Ga0495645_0013258_2710_3867 | 346 |
| 500 | 3300046543 | Ga0495645_0130900 | Ga0495645_0130900_237_1364 | 346 |
| 501 | 3300046689 | Ga0495613_0039718 | Ga0495613_0039718_2150_3238 | 346 |
| 502 | 3300047471 | Ga0495684_0054816 | Ga0495684_0054816_1807_2964 | 346 |
| 503 | 3300047472 | Ga0495686_0000921 | Ga0495686_0000921_34078_35169 | 346 |
| 504 | 3300047472 | Ga0495686_0007402 | Ga0495686_0007402_1040_2161 | 346 |
| 505 | 3300048903 | Ga0496100_0007143 | Ga0496100_0007143_2311_3465 | 346 |
| 506 | 3300048904 | Ga0496101_0269495 | Ga0496101_0269495_95_1183 | 346 |
| 507 | 3300048907 | Ga0496104_0037599 | Ga0496104_0037599_1104_2258 | 346 |
| 508 | 3300048907 | Ga0496104_0245159 | Ga0496104_0245159_168_1265 | 346 |
| 509 | 3300048908 | Ga0496105_0004369 | Ga0496105_0004369_5250_6404 | 346 |
| 510 | 3300048908 | Ga0496105_0221731 | Ga0496105_0221731_147_1244 | 346 |
| 511 | 3300048910 | Ga0496107_0048827 | Ga0496107_0048827_1127_2281 | 346 |
| 512 | 3300048910 | Ga0496107_0110738 | Ga0496107_0110738_773_1870 | 346 |
| 513 | 3300048915 | Ga0496112_0036921 | Ga0496112_0036921_1436_2533 | 346 |
| 514 | 3300048917 | Ga0496114_0085552 | Ga0496114_0085552_1003_2091 | 346 |
| 515 | 3300048918 | Ga0496115_0049868 | Ga0496115_0049868_392_1480 | 346 |
| 516 | 3300048929 | Ga0496126_0000005 | Ga0496126_0000005_812278_813399 | 346 |
| 517 | 3300048929 | Ga0496126_0013795 | Ga0496126_0013795_4166_5239 | 346 |
| 518 | 3300050510 | nmdc:mga06r32_156210_c1 | nmdc:mga06r32_156210_c1_536_1594 | 346 |
| 519 | 3300053084 | Ga0495595_0092803 | Ga0495595_0092803_227_1384 | 346 |
| 520 | 3300005289 | Ga0065704_10090535 | Ga0065704_100905351 | 347 |
| 521 | 3300005295 | Ga0065707_10001119 | Ga0065707_100011196 | 347 |
| 522 | 3300005327 | Ga0070658_10000048 | Ga0070658_1000004843 | 347 |
| 523 | 3300005327 | Ga0070658_10042434 | Ga0070658_100424343 | 347 |
| 524 | 3300005327 | Ga0070658_10119728 | Ga0070658_101197282 | 347 |
| 525 | 3300005329 | Ga0070683_100007811 | Ga0070683_1000078116 | 347 |
| 526 | 3300005329 | Ga0070683_100118401 | Ga0070683_1001184012 | 347 |
| 527 | 3300005329 | Ga0070683_100172114 | Ga0070683_1001721141 | 347 |
| 528 | 3300005336 | Ga0070680_100002837 | Ga0070680_1000028377 | 347 |
| 529 | 3300005336 | Ga0070680_100051607 | Ga0070680_1000516073 | 347 |
| 530 | 3300005336 | Ga0070680_100095609 | Ga0070680_1000956092 | 347 |
| 531 | 3300005339 | Ga0070660_100032029 | Ga0070660_1000320292 | 347 |
| 532 | 3300005341 | Ga0070691_10066505 | Ga0070691_100665052 | 347 |
| 533 | 3300005355 | Ga0070671_100000679 | Ga0070671_1000006799 | 347 |
| 534 | 3300005365 | Ga0070688_100126243 | Ga0070688_1001262431 | 347 |
| 535 | 3300005366 | Ga0070659_100093945 | Ga0070659_1000939452 | 347 |
| 536 | 3300005436 | Ga0070713_100054118 | Ga0070713_1000541183 | 347 |
| 537 | 3300005437 | Ga0070710_10052253 | Ga0070710_100522532 | 347 |
| 538 | 3300005437 | Ga0070710_10077580 | Ga0070710_100775801 | 347 |
| 539 | 3300005439 | Ga0070711_100001578 | Ga0070711_10000157811 | 347 |
| 540 | 3300005439 | Ga0070711_100003134 | Ga0070711_1000031342 | 347 |
| 541 | 3300005439 | Ga0070711_100009637 | Ga0070711_1000096374 | 347 |
| 542 | 3300005455 | Ga0070663_100026503 | Ga0070663_1000265032 | 347 |
| 543 | 3300005455 | Ga0070663_100093285 | Ga0070663_1000932852 | 347 |
| 544 | 3300005458 | Ga0070681_10000514 | Ga0070681_1000051411 | 347 |
| 545 | 3300005458 | Ga0070681_10010407 | Ga0070681_100104076 | 347 |
| 546 | 3300005458 | Ga0070681_10051656 | Ga0070681_100516562 | 347 |
| 547 | 3300005458 | Ga0070681_10226871 | Ga0070681_102268711 | 347 |
| 548 | 3300005468 | Ga0070707_100008854 | Ga0070707_1000088543 | 347 |
| 549 | 3300005468 | Ga0070707_100128880 | Ga0070707_1001288802 | 347 |
| 550 | 3300005471 | Ga0070698_100300686 | Ga0070698_1003006861 | 347 |
| 551 | 3300005518 | Ga0070699_100001428 | Ga0070699_1000014285 | 347 |
| 552 | 3300005518 | Ga0070699_100262862 | Ga0070699_1002628621 | 347 |
| 553 | 3300005518 | Ga0070699_100263534 | Ga0070699_1002635342 | 347 |
| 554 | 3300005518 | Ga0070699_100279899 | Ga0070699_1002798991 | 347 |
| 555 | 3300005530 | Ga0070679_100001505 | Ga0070679_10000150514 | 347 |
| 556 | 3300005530 | Ga0070679_100005422 | Ga0070679_1000054223 | 347 |
| 557 | 3300005530 | Ga0070679_100073747 | Ga0070679_1000737472 | 347 |
| 558 | 3300005530 | Ga0070679_100076842 | Ga0070679_1000768421 | 347 |
| 559 | 3300005539 | Ga0068853_100123557 | Ga0068853_1001235571 | 347 |
| 560 | 3300005548 | Ga0070665_100011303 | Ga0070665_1000113038 | 347 |
| 561 | 3300005548 | Ga0070665_100301789 | Ga0070665_1003017892 | 347 |
| 562 | 3300005548 | Ga0070665_100365480 | Ga0070665_1003654801 | 347 |
| 563 | 3300005563 | Ga0068855_100009115 | Ga0068855_10000911510 | 347 |
| 564 | 3300005563 | Ga0068855_100044346 | Ga0068855_1000443462 | 347 |
| 565 | 3300005563 | Ga0068855_100047785 | Ga0068855_1000477854 | 347 |
| 566 | 3300005563 | Ga0068855_100070217 | Ga0068855_1000702175 | 347 |
| 567 | 3300005563 | Ga0068855_100234072 | Ga0068855_1002340722 | 347 |
| 568 | 3300005564 | Ga0070664_100118583 | Ga0070664_1001185832 | 347 |
| 569 | 3300005577 | Ga0068857_100034505 | Ga0068857_1000345052 | 347 |
| 570 | 3300005614 | Ga0068856_100006800 | Ga0068856_10000680013 | 347 |
| 571 | 3300005616 | Ga0068852_100021040 | Ga0068852_1000210406 | 347 |
| 572 | 3300005616 | Ga0068852_100044115 | Ga0068852_1000441153 | 347 |
| 573 | 3300005616 | Ga0068852_100084535 | Ga0068852_1000845352 | 347 |
| 574 | 3300005618 | Ga0068864_100004818 | Ga0068864_1000048184 | 347 |
| 575 | 3300005841 | Ga0068863_100024932 | Ga0068863_1000249327 | 347 |
| 576 | 3300005844 | Ga0068862_100239065 | Ga0068862_1002390652 | 347 |
| 577 | 3300006028 | Ga0070717_10002932 | Ga0070717_1000293210 | 347 |
| 578 | 3300006163 | Ga0070715_10039657 | Ga0070715_100396572 | 347 |
| 579 | 3300006173 | Ga0070716_100000278 | Ga0070716_10000027814 | 347 |
| 580 | 3300006173 | Ga0070716_100003816 | Ga0070716_1000038164 | 347 |
| 581 | 3300006175 | Ga0070712_100001997 | Ga0070712_1000019979 | 347 |
| 582 | 3300006175 | Ga0070712_100084158 | Ga0070712_1000841582 | 347 |
| 583 | 3300006175 | Ga0070712_100137033 | Ga0070712_1001370332 | 347 |
| 584 | 3300006175 | Ga0070712_100168455 | Ga0070712_1001684551 | 347 |
| 585 | 3300006846 | Ga0075430_100087245 | Ga0075430_1000872452 | 347 |
| 586 | 3300006852 | Ga0075433_10083064 | Ga0075433_100830641 | 347 |
| 587 | 3300006871 | Ga0075434_100092569 | Ga0075434_1000925693 | 347 |
| 588 | 3300006871 | Ga0075434_100260111 | Ga0075434_1002601111 | 347 |
| 589 | 3300009093 | Ga0105240_10000694 | Ga0105240_1000069429 | 347 |
| 590 | 3300009093 | Ga0105240_10039509 | Ga0105240_100395091 | 347 |
| 591 | 3300009093 | Ga0105240_10061115 | Ga0105240_100611155 | 347 |
| 592 | 3300009093 | Ga0105240_10124534 | Ga0105240_101245342 | 347 |
| 593 | 3300009093 | Ga0105240_10160249 | Ga0105240_101602492 | 347 |
| 594 | 3300009093 | Ga0105240_10191445 | Ga0105240_101914452 | 347 |
| 595 | 3300009093 | Ga0105240_10269362 | Ga0105240_102693622 | 347 |
| 596 | 3300009093 | Ga0105240_10411878 | Ga0105240_104118781 | 347 |
| 597 | 3300009098 | Ga0105245_10005477 | Ga0105245_100054777 | 347 |
| 598 | 3300009147 | Ga0114129_10086217 | Ga0114129_100862172 | 347 |
| 599 | 3300009147 | Ga0114129_10194709 | Ga0114129_101947092 | 347 |
| 600 | 3300009147 | Ga0114129_10428194 | Ga0114129_104281941 | 347 |
| 601 | 3300009147 | Ga0114129_10541489 | Ga0114129_105414891 | 347 |
| 602 | 3300009174 | Ga0105241_10001486 | Ga0105241_1000148615 | 347 |
| 603 | 3300009177 | Ga0105248_10228069 | Ga0105248_102280692 | 347 |
| 604 | 3300009545 | Ga0105237_10029870 | Ga0105237_100298703 | 347 |
| 605 | 3300009545 | Ga0105237_10041181 | Ga0105237_100411812 | 347 |
| 606 | 3300009551 | Ga0105238_10002620 | Ga0105238_1000262015 | 347 |
| 607 | 3300009551 | Ga0105238_10021773 | Ga0105238_100217733 | 347 |
| 608 | 3300009551 | Ga0105238_10034581 | Ga0105238_100345815 | 347 |
| 609 | 3300009551 | Ga0105238_10078654 | Ga0105238_100786541 | 347 |
| 610 | 3300009551 | Ga0105238_10095409 | Ga0105238_100954092 | 347 |
| 611 | 3300009551 | Ga0105238_10117691 | Ga0105238_101176912 | 347 |
| 612 | 3300009553 | Ga0105249_10028452 | Ga0105249_100284523 | 347 |
| 613 | 3300009553 | Ga0105249_10089159 | Ga0105249_100891593 | 347 |
| 614 | 3300011119 | Ga0105246_10084676 | Ga0105246_100846761 | 347 |
| 615 | 3300013100 | Ga0157373_10006042 | Ga0157373_100060427 | 347 |
| 616 | 3300013100 | Ga0157373_10012352 | Ga0157373_100123522 | 347 |
| 617 | 3300013104 | Ga0157370_10009613 | Ga0157370_100096132 | 347 |
| 618 | 3300013104 | Ga0157370_10018762 | Ga0157370_100187624 | 347 |
| 619 | 3300013104 | Ga0157370_10049663 | Ga0157370_100496634 | 347 |
| 620 | 3300013104 | Ga0157370_10053518 | Ga0157370_100535182 | 347 |
| 621 | 3300013104 | Ga0157370_10057536 | Ga0157370_100575364 | 347 |
| 622 | 3300013105 | Ga0157369_10003846 | Ga0157369_1000384618 | 347 |
| 623 | 3300013105 | Ga0157369_10022251 | Ga0157369_100222512 | 347 |
| 624 | 3300013105 | Ga0157369_10023096 | Ga0157369_100230962 | 347 |
| 625 | 3300013105 | Ga0157369_10033757 | Ga0157369_100337574 | 347 |
| 626 | 3300013105 | Ga0157369_10095346 | Ga0157369_100953463 | 347 |
| 627 | 3300013105 | Ga0157369_10132987 | Ga0157369_101329872 | 347 |
| 628 | 3300013105 | Ga0157369_10427444 | Ga0157369_104274441 | 347 |
| 629 | 3300013296 | Ga0157374_10000395 | Ga0157374_1000039521 | 347 |
| 630 | 3300013296 | Ga0157374_10041938 | Ga0157374_100419382 | 347 |
| 631 | 3300013306 | Ga0163162_10000056 | Ga0163162_1000005620 | 347 |
| 632 | 3300013307 | Ga0157372_10011993 | Ga0157372_100119932 | 347 |
| 633 | 3300013307 | Ga0157372_10018043 | Ga0157372_100180435 | 347 |
| 634 | 3300013307 | Ga0157372_10035984 | Ga0157372_100359846 | 347 |
| 635 | 3300013307 | Ga0157372_10038263 | Ga0157372_100382633 | 347 |
| 636 | 3300013307 | Ga0157372_10076118 | Ga0157372_100761182 | 347 |
| 637 | 3300013307 | Ga0157372_10123929 | Ga0157372_101239292 | 347 |
| 638 | 3300013307 | Ga0157372_10220193 | Ga0157372_102201933 | 347 |
| 639 | 3300014325 | Ga0163163_10008910 | Ga0163163_1000891010 | 347 |
| 640 | 3300014325 | Ga0163163_10100236 | Ga0163163_101002362 | 347 |
| 641 | 3300014326 | Ga0157380_10136136 | Ga0157380_101361362 | 347 |
| 642 | 3300014968 | Ga0157379_10030787 | Ga0157379_100307874 | 347 |
| 643 | 3300014968 | Ga0157379_10030885 | Ga0157379_100308855 | 347 |
| 644 | 3300024227 | Ga0228598_1000157 | Ga0228598_10001572 | 347 |
| 645 | 3300025321 | Ga0207656_10043280 | Ga0207656_100432802 | 347 |
| 646 | 3300025898 | Ga0207692_10004844 | Ga0207692_100048443 | 347 |
| 647 | 3300025898 | Ga0207692_10058978 | Ga0207692_100589782 | 347 |
| 648 | 3300025903 | Ga0207680_10002832 | Ga0207680_100028326 | 347 |
| 649 | 3300025905 | Ga0207685_10008369 | Ga0207685_100083692 | 347 |
| 650 | 3300025906 | Ga0207699_10046993 | Ga0207699_100469932 | 347 |
| 651 | 3300025909 | Ga0207705_10000048 | Ga0207705_1000004871 | 347 |
| 652 | 3300025909 | Ga0207705_10011775 | Ga0207705_100117755 | 347 |
| 653 | 3300025909 | Ga0207705_10014834 | Ga0207705_100148345 | 347 |
| 654 | 3300025909 | Ga0207705_10027295 | Ga0207705_100272954 | 347 |
| 655 | 3300025910 | Ga0207684_10016799 | Ga0207684_100167995 | 347 |
| 656 | 3300025910 | Ga0207684_10040343 | Ga0207684_100403432 | 347 |
| 657 | 3300025910 | Ga0207684_10179908 | Ga0207684_101799082 | 347 |
| 658 | 3300025911 | Ga0207654_10001671 | Ga0207654_100016718 | 347 |
| 659 | 3300025912 | Ga0207707_10010347 | Ga0207707_100103479 | 347 |
| 660 | 3300025912 | Ga0207707_10046691 | Ga0207707_100466914 | 347 |
| 661 | 3300025912 | Ga0207707_10125840 | Ga0207707_101258402 | 347 |
| 662 | 3300025912 | Ga0207707_10261392 | Ga0207707_102613921 | 347 |
| 663 | 3300025913 | Ga0207695_10013418 | Ga0207695_1001341811 | 347 |
| 664 | 3300025913 | Ga0207695_10022772 | Ga0207695_100227727 | 347 |
| 665 | 3300025913 | Ga0207695_10033792 | Ga0207695_100337923 | 347 |
| 666 | 3300025915 | Ga0207693_10003987 | Ga0207693_100039877 | 347 |
| 667 | 3300025915 | Ga0207693_10005055 | Ga0207693_100050558 | 347 |
| 668 | 3300025915 | Ga0207693_10006988 | Ga0207693_100069882 | 347 |
| 669 | 3300025915 | Ga0207693_10043072 | Ga0207693_100430721 | 347 |
| 670 | 3300025915 | Ga0207693_10273981 | Ga0207693_102739811 | 347 |
| 671 | 3300025916 | Ga0207663_10004905 | Ga0207663_100049055 | 347 |
| 672 | 3300025916 | Ga0207663_10005352 | Ga0207663_100053523 | 347 |
| 673 | 3300025917 | Ga0207660_10001226 | Ga0207660_100012264 | 347 |
| 674 | 3300025917 | Ga0207660_10026938 | Ga0207660_100269383 | 347 |
| 675 | 3300025917 | Ga0207660_10056663 | Ga0207660_100566632 | 347 |
| 676 | 3300025917 | Ga0207660_10067231 | Ga0207660_100672311 | 347 |
| 677 | 3300025917 | Ga0207660_10114820 | Ga0207660_101148201 | 347 |
| 678 | 3300025919 | Ga0207657_10014437 | Ga0207657_100144375 | 347 |
| 679 | 3300025921 | Ga0207652_10002189 | Ga0207652_1000218910 | 347 |
| 680 | 3300025921 | Ga0207652_10046362 | Ga0207652_100463622 | 347 |
| 681 | 3300025921 | Ga0207652_10057740 | Ga0207652_100577402 | 347 |
| 682 | 3300025921 | Ga0207652_10104864 | Ga0207652_101048641 | 347 |
| 683 | 3300025921 | Ga0207652_10387454 | Ga0207652_103874541 | 347 |
| 684 | 3300025922 | Ga0207646_10031816 | Ga0207646_100318162 | 347 |
| 685 | 3300025924 | Ga0207694_10037543 | Ga0207694_100375434 | 347 |
| 686 | 3300025927 | Ga0207687_10003266 | Ga0207687_100032662 | 347 |
| 687 | 3300025928 | Ga0207700_10007377 | Ga0207700_100073775 | 347 |
| 688 | 3300025928 | Ga0207700_10073599 | Ga0207700_100735991 | 347 |
| 689 | 3300025928 | Ga0207700_10203460 | Ga0207700_102034602 | 347 |
| 690 | 3300025929 | Ga0207664_10052096 | Ga0207664_100520963 | 347 |
| 691 | 3300025931 | Ga0207644_10177450 | Ga0207644_101774501 | 347 |
| 692 | 3300025939 | Ga0207665_10000046 | Ga0207665_100000468 | 347 |
| 693 | 3300025939 | Ga0207665_10002386 | Ga0207665_100023864 | 347 |
| 694 | 3300025941 | Ga0207711_10034624 | Ga0207711_100346241 | 347 |
| 695 | 3300025944 | Ga0207661_10062931 | Ga0207661_100629311 | 347 |
| 696 | 3300025945 | Ga0207679_10155091 | Ga0207679_101550912 | 347 |
| 697 | 3300025949 | Ga0207667_10018661 | Ga0207667_100186615 | 347 |
| 698 | 3300025949 | Ga0207667_10031300 | Ga0207667_100313002 | 347 |
| 699 | 3300025949 | Ga0207667_10066827 | Ga0207667_100668272 | 347 |
| 700 | 3300025949 | Ga0207667_10225809 | Ga0207667_102258092 | 347 |
| 701 | 3300025961 | Ga0207712_10012260 | Ga0207712_100122605 | 347 |
| 702 | 3300026067 | Ga0207678_10000300 | Ga0207678_1000030027 | 347 |
| 703 | 3300026067 | Ga0207678_10019980 | Ga0207678_100199805 | 347 |
| 704 | 3300026067 | Ga0207678_10044820 | Ga0207678_100448202 | 347 |
| 705 | 3300026078 | Ga0207702_10036410 | Ga0207702_100364104 | 347 |
| 706 | 3300026088 | Ga0207641_10048632 | Ga0207641_100486324 | 347 |
| 707 | 3300026095 | Ga0207676_10005721 | Ga0207676_100057216 | 347 |
| 708 | 3300026116 | Ga0207674_10001317 | Ga0207674_1000131726 | 347 |
| 709 | 3300026116 | Ga0207674_10113029 | Ga0207674_101130292 | 347 |
| 710 | 3300026118 | Ga0207675_100013011 | Ga0207675_1000130114 | 347 |
| 711 | 3300026142 | Ga0207698_10024152 | Ga0207698_100241522 | 347 |
| 712 | 3300028379 | Ga0268266_10028507 | Ga0268266_100285073 | 347 |
| 713 | 3300028379 | Ga0268266_10032459 | Ga0268266_100324592 | 347 |
| 714 | 3300028379 | Ga0268266_10124914 | Ga0268266_101249141 | 347 |
| 715 | 3300031090 | Ga0265760_10002262 | Ga0265760_100022622 | 347 |
| 716 | 3300031090 | Ga0265760_10002525 | Ga0265760_100025253 | 347 |
| 717 | 3300031548 | Ga0307408_100019522 | Ga0307408_1000195222 | 347 |
| 718 | 3300031727 | Ga0316576_10056371 | Ga0316576_100563712 | 347 |
| 719 | 3300031731 | Ga0307405_10027146 | Ga0307405_100271463 | 347 |
| 720 | 3300031731 | Ga0307405_10058848 | Ga0307405_100588481 | 347 |
| 721 | 3300031824 | Ga0307413_10008587 | Ga0307413_100085872 | 347 |
| 722 | 3300031824 | Ga0307413_10028482 | Ga0307413_100284822 | 347 |
| 723 | 3300031852 | Ga0307410_10020710 | Ga0307410_100207102 | 347 |
| 724 | 3300031901 | Ga0307406_10015879 | Ga0307406_100158794 | 347 |
| 725 | 3300031903 | Ga0307407_10013586 | Ga0307407_100135863 | 347 |
| 726 | 3300031911 | Ga0307412_10051452 | Ga0307412_100514522 | 347 |
| 727 | 3300031995 | Ga0307409_100001000 | Ga0307409_1000010007 | 347 |
| 728 | 3300032002 | Ga0307416_100004875 | Ga0307416_1000048754 | 347 |
| 729 | 3300032002 | Ga0307416_100070247 | Ga0307416_1000702472 | 347 |
| 730 | 3300032002 | Ga0307416_100151987 | Ga0307416_1001519872 | 347 |
| 731 | 3300032004 | Ga0307414_10075652 | Ga0307414_100756522 | 347 |
| 732 | 3300032005 | Ga0307411_10004428 | Ga0307411_100044283 | 347 |
| 733 | 3300032126 | Ga0307415_100000717 | Ga0307415_10000071717 | 347 |
| 734 | 3300032126 | Ga0307415_100075843 | Ga0307415_1000758431 | 347 |
| 735 | 3300033180 | Ga0307510_10091011 | Ga0307510_100910112 | 347 |
| 736 | 3300035083 | Ga0373926_0003327 | Ga0373926_0003327_688_1758 | 347 |
| 737 | 3300035083 | Ga0373926_0010705 | Ga0373926_0010705_1741_2811 | 347 |
| 738 | 3300035083 | Ga0373926_0046154 | Ga0373926_0046154_80_1150 | 347 |
| 739 | 3300035111 | Ga0373923_0011760 | Ga0373923_0011760_1879_2949 | 347 |
| 740 | 3300035113 | Ga0373936_0012750 | Ga0373936_0012750_1738_2808 | 347 |
| 741 | 3300035113 | Ga0373936_0015254 | Ga0373936_0015254_279_1331 | 347 |
| 742 | 3300035116 | Ga0373945_0002909 | Ga0373945_0002909_3028_4098 | 347 |
| 743 | 3300035170 | Ga0373943_0005065 | Ga0373943_0005065_1978_3048 | 347 |
| 744 | 3300035171 | Ga0373946_0004512 | Ga0373946_0004512_3571_4641 | 347 |
| 745 | 3300035171 | Ga0373946_0070731 | Ga0373946_0070731_399_1469 | 347 |
| 746 | 3300035171 | Ga0373946_0083760 | Ga0373946_0083760_100_1170 | 347 |
| 747 | 3300035172 | Ga0373955_0003383 | Ga0373955_0003383_3777_4847 | 347 |
| 748 | 3300035241 | Ga0373961_0010964 | Ga0373961_0010964_439_1500 | 347 |
| 749 | 3300035410 | Ga0373924_0003556 | Ga0373924_0003556_2935_4005 | 347 |
| 750 | 3300035410 | Ga0373924_0032929 | Ga0373924_0032929_585_1655 | 347 |
| 751 | 3300035692 | Ga0373935_0013104 | Ga0373935_0013104_479_1549 | 347 |
| 752 | 3300035692 | Ga0373935_0177597 | Ga0373935_0177597_324_1376 | 347 |
| 753 | 3300035695 | Ga0373927_0004121 | Ga0373927_0004121_1125_2195 | 347 |
| 754 | 3300035695 | Ga0373927_0019115 | Ga0373927_0019115_521_1591 | 347 |
| 755 | 3300035724 | Ga0373933_0062995 | Ga0373933_0062995_485_1537 | 347 |
| 756 | 3300035725 | Ga0373947_0008015 | Ga0373947_0008015_4398_5468 | 347 |
| 757 | 3300035725 | Ga0373947_0042749 | Ga0373947_0042749_246_1298 | 347 |
| 758 | 3300035725 | Ga0373947_0045925 | Ga0373947_0045925_1133_2203 | 347 |
| 759 | 3300036401 | Ga0373937_0000027 | Ga0373937_0000027_10962_12032 | 347 |
| 760 | 3300036401 | Ga0373937_0018796 | Ga0373937_0018796_2838_3908 | 347 |
| 761 | 3300037068 | Ga0373925_0012705 | Ga0373925_0012705_3284_4336 | 347 |
| 762 | 3300037068 | Ga0373925_0019564 | Ga0373925_0019564_3662_4732 | 347 |
| 763 | 3300037068 | Ga0373925_0027057 | Ga0373925_0027057_2644_3696 | 347 |
| 764 | 3300037068 | Ga0373925_0053177 | Ga0373925_0053177_742_1812 | 347 |
| 765 | 3300037068 | Ga0373925_0055172 | Ga0373925_0055172_803_1873 | 347 |
| 766 | 3300037068 | Ga0373925_0143742 | Ga0373925_0143742_404_1456 | 347 |
| 767 | 3300037466 | Ga0395898_0014459 | Ga0395898_0014459_4075_5130 | 347 |
| 768 | 3300039453 | Ga0436362_0803045 | Ga0436362_0803045_309_1361 | 347 |
| 769 | 3300042876 | Ga0451577_0024043 | Ga0451577_0024043_2364_3425 | 347 |
| 770 | 3300042876 | Ga0451577_0076721 | Ga0451577_0076721_298_1359 | 347 |
| 771 | 3300042876 | Ga0451577_0085984 | Ga0451577_0085984_1194_2255 | 347 |
| 772 | 3300044673 | Ga0453683_0000448 | Ga0453683_0000448_20126_21187 | 347 |
| 773 | 3300044673 | Ga0453683_0012738 | Ga0453683_0012738_3684_4745 | 347 |
| 774 | 3300044673 | Ga0453683_0049163 | Ga0453683_0049163_925_1986 | 347 |
| 775 | 3300044712 | Ga0453684_0001875 | Ga0453684_0001875_44772_45833 | 347 |
| 776 | 3300044712 | Ga0453684_0005714 | Ga0453684_0005714_19139_20200 | 347 |
| 777 | 3300044712 | Ga0453684_0018277 | Ga0453684_0018277_3063_4124 | 347 |
| 778 | 3300044712 | Ga0453684_0027657 | Ga0453684_0027657_6171_7232 | 347 |
| 779 | 3300044712 | Ga0453684_0032290 | Ga0453684_0032290_3091_4152 | 347 |
| 780 | 3300044712 | Ga0453684_0110411 | Ga0453684_0110411_1692_2753 | 347 |
| 781 | 3300044712 | Ga0453684_0124289 | Ga0453684_0124289_1737_2798 | 347 |
| 782 | 3300044712 | Ga0453684_0170072 | Ga0453684_0170072_211_1272 | 347 |
| 783 | 3300044712 | Ga0453684_0211257 | Ga0453684_0211257_223_1284 | 347 |
| 784 | 3300045051 | Ga0451576_0002465 | Ga0451576_0002465_126_1187 | 347 |
| 785 | 3300045051 | Ga0451576_0028360 | Ga0451576_0028360_11_1072 | 347 |
| 786 | 3300046454 | Ga0495592_0007856 | Ga0495592_0007856_5781_6887 | 347 |
| 787 | 3300046455 | Ga0495603_0000838 | Ga0495603_0000838_7003_8109 | 347 |
| 788 | 3300046459 | Ga0495629_0000549 | Ga0495629_0000549_9910_11016 | 347 |
| 789 | 3300046459 | Ga0495629_0008527 | Ga0495629_0008527_3574_4680 | 347 |
| 790 | 3300046462 | Ga0495651_0011762 | Ga0495651_0011762_731_1837 | 347 |
| 791 | 3300046462 | Ga0495651_0089900 | Ga0495651_0089900_26_1081 | 347 |
| 792 | 3300046463 | Ga0495653_0003436 | Ga0495653_0003436_4539_5645 | 347 |
| 793 | 3300046471 | Ga0495650_0000022 | Ga0495650_0000022_349527_350627 | 347 |
| 794 | 3300046471 | Ga0495650_0008987 | Ga0495650_0008987_4433_5539 | 347 |
| 795 | 3300046472 | Ga0495580_0001908 | Ga0495580_0001908_13127_14179 | 347 |
| 796 | 3300046472 | Ga0495580_0003312 | Ga0495580_0003312_4164_5216 | 347 |
| 797 | 3300046472 | Ga0495580_0031675 | Ga0495580_0031675_2616_3722 | 347 |
| 798 | 3300046472 | Ga0495580_0066817 | Ga0495580_0066817_89_1159 | 347 |
| 799 | 3300046473 | Ga0495582_0001438 | Ga0495582_0001438_3185_4237 | 347 |
| 800 | 3300046473 | Ga0495582_0017581 | Ga0495582_0017581_1114_2220 | 347 |
| 801 | 3300046473 | Ga0495582_0056162 | Ga0495582_0056162_828_1898 | 347 |
| 802 | 3300046473 | Ga0495582_0147651 | Ga0495582_0147651_151_1221 | 347 |
| 803 | 3300046475 | Ga0495639_0000249 | Ga0495639_0000249_22674_23780 | 347 |
| 804 | 3300046475 | Ga0495639_0026133 | Ga0495639_0026133_715_1785 | 347 |
| 805 | 3300046476 | Ga0495662_0000291 | Ga0495662_0000291_3996_5102 | 347 |
| 806 | 3300046477 | Ga0495664_0002624 | Ga0495664_0002624_7526_8581 | 347 |
| 807 | 3300046477 | Ga0495664_0037708 | Ga0495664_0037708_1478_2578 | 347 |
| 808 | 3300046477 | Ga0495664_0097179 | Ga0495664_0097179_47_1153 | 347 |
| 809 | 3300046492 | Ga0495585_0067024 | Ga0495585_0067024_400_1506 | 347 |
| 810 | 3300046499 | Ga0495594_0000436 | Ga0495594_0000436_15794_16900 | 347 |
| 811 | 3300046499 | Ga0495594_0000734 | Ga0495594_0000734_5410_6516 | 347 |
| 812 | 3300046499 | Ga0495594_0002977 | Ga0495594_0002977_5361_6467 | 347 |
| 813 | 3300046499 | Ga0495594_0067731 | Ga0495594_0067731_636_1706 | 347 |
| 814 | 3300046507 | Ga0495606_0034364 | Ga0495606_0034364_461_1561 | 347 |
| 815 | 3300046507 | Ga0495606_0106330 | Ga0495606_0106330_491_1597 | 347 |
| 816 | 3300046511 | Ga0495608_0037768 | Ga0495608_0037768_583_1689 | 347 |
| 817 | 3300046516 | Ga0495628_0242059 | Ga0495628_0242059_197_1267 | 347 |
| 818 | 3300046517 | Ga0495630_0003954 | Ga0495630_0003954_7394_8464 | 347 |
| 819 | 3300046517 | Ga0495630_0004124 | Ga0495630_0004124_4618_5724 | 347 |
| 820 | 3300046523 | Ga0495644_0000029 | Ga0495644_0000029_9722_10828 | 347 |
| 821 | 3300046524 | Ga0495648_0128709 | Ga0495648_0128709_126_1226 | 347 |
| 822 | 3300046526 | Ga0495666_0005235 | Ga0495666_0005235_4069_5175 | 347 |
| 823 | 3300046526 | Ga0495666_0134939 | Ga0495666_0134939_20_1072 | 347 |
| 824 | 3300046528 | Ga0495642_0018911 | Ga0495642_0018911_1148_2254 | 347 |
| 825 | 3300046529 | Ga0495652_0094030 | Ga0495652_0094030_1230_2330 | 347 |
| 826 | 3300046529 | Ga0495652_0152458 | Ga0495652_0152458_76_1131 | 347 |
| 827 | 3300046531 | Ga0495665_0000484 | Ga0495665_0000484_2529_3635 | 347 |
| 828 | 3300046531 | Ga0495665_0004823 | Ga0495665_0004823_929_1999 | 347 |
| 829 | 3300046531 | Ga0495665_0097205 | Ga0495665_0097205_113_1165 | 347 |
| 830 | 3300046531 | Ga0495665_0148424 | Ga0495665_0148424_56_1108 | 347 |
| 831 | 3300046536 | Ga0495587_0022747 | Ga0495587_0022747_1008_2114 | 347 |
| 832 | 3300046538 | Ga0495609_0009088 | Ga0495609_0009088_3388_4494 | 347 |
| 833 | 3300046559 | Ga0495667_0018030 | Ga0495667_0018030_708_1814 | 347 |
| 834 | 3300046616 | Ga0495668_0039641 | Ga0495668_0039641_300_1406 | 347 |
| 835 | 3300046660 | Ga0495625_0001054 | Ga0495625_0001054_16624_17730 | 347 |
| 836 | 3300046660 | Ga0495625_0004927 | Ga0495625_0004927_1444_2550 | 347 |
| 837 | 3300046660 | Ga0495625_0005873 | Ga0495625_0005873_9828_10928 | 347 |
| 838 | 3300046663 | Ga0495635_0032572 | Ga0495635_0032572_43_1095 | 347 |
| 839 | 3300046665 | Ga0495661_0043011 | Ga0495661_0043011_472_1572 | 347 |
| 840 | 3300046679 | Ga0495623_0017932 | Ga0495623_0017932_3492_4562 | 347 |
| 841 | 3300046679 | Ga0495623_0045738 | Ga0495623_0045738_1364_2470 | 347 |
| 842 | 3300046679 | Ga0495623_0160585 | Ga0495623_0160585_230_1282 | 347 |
| 843 | 3300046683 | Ga0495658_0173154 | Ga0495658_0173154_91_1197 | 347 |
| 844 | 3300046684 | Ga0495669_0001929 | Ga0495669_0001929_2106_3212 | 347 |
| 845 | 3300046684 | Ga0495669_0034699 | Ga0495669_0034699_178_1233 | 347 |
| 846 | 3300046684 | Ga0495669_0060757 | Ga0495669_0060757_587_1639 | 347 |
| 847 | 3300046689 | Ga0495613_0001436 | Ga0495613_0001436_3786_4892 | 347 |
| 848 | 3300046689 | Ga0495613_0142960 | Ga0495613_0142960_556_1662 | 347 |
| 849 | 3300046690 | Ga0495624_0000779 | Ga0495624_0000779_6231_7337 | 347 |
| 850 | 3300046691 | Ga0495670_0022110 | Ga0495670_0022110_1294_2400 | 347 |
| 851 | 3300046809 | Ga0495600_0032715 | Ga0495600_0032715_2237_3343 | 347 |
| 852 | 3300046809 | Ga0495600_0068140 | Ga0495600_0068140_576_1682 | 347 |
| 853 | 3300046809 | Ga0495600_0117752 | Ga0495600_0117752_41_1141 | 347 |
| 854 | 3300047315 | Ga0495581_0013657 | Ga0495581_0013657_1024_2130 | 347 |
| 855 | 3300047315 | Ga0495581_0032396 | Ga0495581_0032396_42_1112 | 347 |
| 856 | 3300047315 | Ga0495581_0090742 | Ga0495581_0090742_620_1726 | 347 |
| 857 | 3300047317 | Ga0495604_0009578 | Ga0495604_0009578_1586_2686 | 347 |
| 858 | 3300047317 | Ga0495604_0239794 | Ga0495604_0239794_106_1161 | 347 |
| 859 | 3300047319 | Ga0495674_0002381 | Ga0495674_0002381_828_1928 | 347 |
| 860 | 3300047320 | Ga0495672_0007773 | Ga0495672_0007773_2649_3752 | 347 |
| 861 | 3300047322 | Ga0495680_0005651 | Ga0495680_0005651_6770_7876 | 347 |
| 862 | 3300047444 | Ga0495675_0001775 | Ga0495675_0001775_8793_9899 | 347 |
| 863 | 3300047444 | Ga0495675_0004033 | Ga0495675_0004033_1791_2846 | 347 |
| 864 | 3300047445 | Ga0495677_0020615 | Ga0495677_0020615_461_1567 | 347 |
| 865 | 3300048903 | Ga0496100_0117485 | Ga0496100_0117485_647_1726 | 347 |
| 866 | 3300048907 | Ga0496104_0038068 | Ga0496104_0038068_283_1383 | 347 |
| 867 | 3300048907 | Ga0496104_0065734 | Ga0496104_0065734_2238_3308 | 347 |
| 868 | 3300048908 | Ga0496105_0002243 | Ga0496105_0002243_1315_2385 | 347 |
| 869 | 3300048908 | Ga0496105_0018968 | Ga0496105_0018968_1995_3095 | 347 |
| 870 | 3300048913 | Ga0496110_0366833 | Ga0496110_0366833_168_1223 | 347 |
| 871 | 3300048915 | Ga0496112_0006448 | Ga0496112_0006448_7510_8580 | 347 |
| 872 | 3300048915 | Ga0496112_0120789 | Ga0496112_0120789_508_1563 | 347 |
| 873 | 3300048915 | Ga0496112_0152413 | Ga0496112_0152413_1123_2202 | 347 |
| 874 | 3300048916 | Ga0496113_0007620 | Ga0496113_0007620_3042_4112 | 347 |
| 875 | 3300048917 | Ga0496114_0151174 | Ga0496114_0151174_472_1572 | 347 |
| 876 | 3300048918 | Ga0496115_0224855 | Ga0496115_0224855_215_1270 | 347 |
| 877 | 3300048929 | Ga0496126_0000010 | Ga0496126_0000010_287915_289042 | 347 |
| 878 | 3300048929 | Ga0496126_0001435 | Ga0496126_0001435_26827_27927 | 347 |
| 879 | 3300049460 | Ga0495682_0017494 | Ga0495682_0017494_612_1712 | 347 |
| 880 | 3300049568 | Ga0501031_0003660 | Ga0501031_0003660_1330_2436 | 347 |
| 881 | 3300049570 | Ga0501033_0027441 | Ga0501033_0027441_49_1155 | 347 |
| 882 | 3300049570 | Ga0501033_0038983 | Ga0501033_0038983_2160_3269 | 347 |
| 883 | 3300049571 | Ga0501034_0008118 | Ga0501034_0008118_8926_10032 | 347 |
| 884 | 3300049572 | Ga0501036_0001740 | Ga0501036_0001740_4649_5755 | 347 |
| 885 | 3300049573 | Ga0501037_0057094 | Ga0501037_0057094_1123_2229 | 347 |
| 886 | 3300049579 | Ga0501043_0002753 | Ga0501043_0002753_119_1225 | 347 |
| 887 | 3300049580 | Ga0501046_0000437 | Ga0501046_0000437_18777_19883 | 347 |
| 888 | 3300049581 | Ga0501047_0000776 | Ga0501047_0000776_2536_3642 | 347 |
| 889 | 3300049581 | Ga0501047_0009635 | Ga0501047_0009635_452_1561 | 347 |
| 890 | 3300049588 | Ga0501072_0071107 | Ga0501072_0071107_1513_2574 | 347 |
| 891 | 3300049589 | Ga0501073_0000891 | Ga0501073_0000891_10515_11621 | 347 |
| 892 | 3300049591 | Ga0501075_0191723 | Ga0501075_0191723_319_1380 | 347 |
| 893 | 3300049593 | Ga0501077_0000408 | Ga0501077_0000408_19643_20704 | 347 |
| 894 | 3300049742 | Ga0501080_0310988 | Ga0501080_0310988_323_1384 | 347 |
| 895 | 3300049743 | Ga0501081_0025930 | Ga0501081_0025930_1116_2177 | 347 |
| 896 | 3300049744 | Ga0501083_0051828 | Ga0501083_0051828_67_1128 | 347 |
| 897 | 3300049822 | Ga0501035_0075520 | Ga0501035_0075520_669_1775 | 347 |
| 898 | 3300049823 | Ga0501044_0025248 | Ga0501044_0025248_5126_6232 | 347 |
| 899 | 3300049823 | Ga0501044_0043453 | Ga0501044_0043453_577_1683 | 347 |
| 900 | 3300049823 | Ga0501044_0062913 | Ga0501044_0062913_675_1784 | 347 |
| 901 | 3300050507 | nmdc:mga05p37_96413_c1 | nmdc:mga05p37_96413_c1_125_1186 | 347 |
| 902 | 3300050507 | nmdc:mga05p37_96535_c1 | nmdc:mga05p37_96535_c1_1510_2571 | 347 |
| 903 | 3300050508 | nmdc:mga09592_261873_c1 | nmdc:mga09592_261873_c1_327_1388 | 347 |
| 904 | 3300050509 | nmdc:mga0qj67_83908_c1 | nmdc:mga0qj67_83908_c1_1367_2428 | 347 |
| 905 | 3300050510 | nmdc:mga06r32_213809_c1 | nmdc:mga06r32_213809_c1_44_1105 | 347 |
| 906 | 3300050512 | nmdc:mga0n895_76663_c1 | nmdc:mga0n895_76663_c1_1632_2687 | 347 |
| 907 | 3300050513 | nmdc:mga0rr50_164718_c1 | nmdc:mga0rr50_164718_c1_209_1261 | 347 |
| 908 | 3300050514 | nmdc:mga08x19_29023_c1 | nmdc:mga08x19_29023_c1_702_1754 | 347 |
| 909 | 3300050515 | nmdc:mga0a205_101094_c1 | nmdc:mga0a205_101094_c1_1432_2493 | 347 |
| 910 | 3300053087 | Ga0500643_018194 | Ga0500643_018194_297_1397 | 347 |
| 911 | 3300053093 | Ga0500651_0000003 | Ga0500651_0000003_130026_131126 | 347 |
| 912 | 3300053119 | Ga0500595_000005 | Ga0500595_000005_213079_214179 | 347 |
| 913 | 3300053119 | Ga0500595_016340 | Ga0500595_016340_284_1384 | 347 |
| 914 | 3300055283 | Ga0500661_001353 | Ga0500661_001353_1935_3035 | 347 |
| 915 | 3300005354 | Ga0070675_100253119 | Ga0070675_1002531192 | 348 |
| 916 | 3300005436 | Ga0070713_100117097 | Ga0070713_1001170972 | 348 |
| 917 | 3300005439 | Ga0070711_100079522 | Ga0070711_1000795222 | 348 |
| 918 | 3300005445 | Ga0070708_100024498 | Ga0070708_1000244984 | 348 |
| 919 | 3300005445 | Ga0070708_100034419 | Ga0070708_1000344193 | 348 |
| 920 | 3300005445 | Ga0070708_100061577 | Ga0070708_1000615772 | 348 |
| 921 | 3300005467 | Ga0070706_100001098 | Ga0070706_10000109818 | 348 |
| 922 | 3300005467 | Ga0070706_100038175 | Ga0070706_1000381754 | 348 |
| 923 | 3300005468 | Ga0070707_100001894 | Ga0070707_10000189419 | 348 |
| 924 | 3300005471 | Ga0070698_100007264 | Ga0070698_1000072642 | 348 |
| 925 | 3300005518 | Ga0070699_100014915 | Ga0070699_1000149154 | 348 |
| 926 | 3300005518 | Ga0070699_100028220 | Ga0070699_1000282204 | 348 |
| 927 | 3300005536 | Ga0070697_100012833 | Ga0070697_1000128335 | 348 |
| 928 | 3300005536 | Ga0070697_100046211 | Ga0070697_1000462113 | 348 |
| 929 | 3300005549 | Ga0070704_100063711 | Ga0070704_1000637112 | 348 |
| 930 | 3300005617 | Ga0068859_100476660 | Ga0068859_1004766602 | 348 |
| 931 | 3300005718 | Ga0068866_10074774 | Ga0068866_100747742 | 348 |
| 932 | 3300005840 | Ga0068870_10213089 | Ga0068870_102130891 | 348 |
| 933 | 3300005844 | Ga0068862_100052937 | Ga0068862_1000529372 | 348 |
| 934 | 3300006844 | Ga0075428_100186843 | Ga0075428_1001868432 | 348 |
| 935 | 3300006880 | Ga0075429_100086347 | Ga0075429_1000863472 | 348 |
| 936 | 3300006931 | Ga0097620_100476657 | Ga0097620_1004766572 | 348 |
| 937 | 3300009147 | Ga0114129_10021718 | Ga0114129_100217184 | 348 |
| 938 | 3300011119 | Ga0105246_10130918 | Ga0105246_101309182 | 348 |
| 939 | 3300013297 | Ga0157378_10011057 | Ga0157378_100110575 | 348 |
| 940 | 3300025893 | Ga0207682_10042681 | Ga0207682_100426812 | 348 |
| 941 | 3300025910 | Ga0207684_10003222 | Ga0207684_1000322212 | 348 |
| 942 | 3300025910 | Ga0207684_10003763 | Ga0207684_1000376311 | 348 |
| 943 | 3300025910 | Ga0207684_10034984 | Ga0207684_100349844 | 348 |
| 944 | 3300025916 | Ga0207663_10083264 | Ga0207663_100832642 | 348 |
| 945 | 3300025922 | Ga0207646_10002834 | Ga0207646_100028343 | 348 |
| 946 | 3300025928 | Ga0207700_10257932 | Ga0207700_102579322 | 348 |
| 947 | 3300028380 | Ga0268265_10181063 | Ga0268265_101810631 | 348 |
| 948 | 3300028800 | Ga0265338_10001617 | Ga0265338_1000161721 | 348 |
| 949 | 3300031241 | Ga0265325_10018685 | Ga0265325_100186853 | 348 |
| 950 | 3300031249 | Ga0265339_10032033 | Ga0265339_100320332 | 348 |
| 951 | 3300031249 | Ga0265339_10082668 | Ga0265339_100826682 | 348 |
| 952 | 3300031344 | Ga0265316_10007744 | Ga0265316_1000774412 | 348 |
| 953 | 3300031344 | Ga0265316_10132300 | Ga0265316_101323002 | 348 |
| 954 | 3300031595 | Ga0265313_10054029 | Ga0265313_100540292 | 348 |
| 955 | 3300031711 | Ga0265314_10004281 | Ga0265314_1000428110 | 348 |
| 956 | 3300031712 | Ga0265342_10001677 | Ga0265342_100016774 | 348 |
| 957 | 3300033180 | Ga0307510_10024239 | Ga0307510_100242395 | 348 |
| 958 | 3300039450 | Ga0436363_0117531 | Ga0436363_0117531_215_1276 | 348 |
| 959 | 3300039450 | Ga0436363_1446693 | Ga0436363_1446693_22_1089 | 348 |
| 960 | 3300044684 | Ga0466966_0006756 | Ga0466966_0006756_1503_2570 | 348 |
| 961 | 3300044765 | Ga0466970_0103284 | Ga0466970_0103284_74_1141 | 348 |
| 962 | 3300045051 | Ga0451576_0145484 | Ga0451576_0145484_327_1391 | 348 |
| 963 | 3300047472 | Ga0495686_0006475 | Ga0495686_0006475_3568_4674 | 348 |
| 964 | 3300050507 | nmdc:mga05p37_10176_c1 | nmdc:mga05p37_10176_c1_5753_6799 | 348 |
| 965 | 3300050508 | nmdc:mga09592_40233_c1 | nmdc:mga09592_40233_c1_1579_2625 | 348 |
| 966 | 3300061719 | Ga0466962_0060217 | Ga0466962_0060217_15_1082 | 348 |
| 967 | 3300005434 | Ga0070709_10020442 | Ga0070709_100204423 | 349 |
| 968 | 3300005436 | Ga0070713_100030864 | Ga0070713_1000308644 | 349 |
| 969 | 3300005444 | Ga0070694_100057648 | Ga0070694_1000576482 | 349 |
| 970 | 3300005468 | Ga0070707_100044371 | Ga0070707_1000443712 | 349 |
| 971 | 3300005518 | Ga0070699_100125696 | Ga0070699_1001256961 | 349 |
| 972 | 3300005546 | Ga0070696_100049197 | Ga0070696_1000491973 | 349 |
| 973 | 3300005617 | Ga0068859_100144400 | Ga0068859_1001444001 | 349 |
| 974 | 3300005844 | Ga0068862_100060611 | Ga0068862_1000606112 | 349 |
| 975 | 3300006931 | Ga0097620_100144394 | Ga0097620_1001443941 | 349 |
| 976 | 3300009094 | Ga0111539_10044235 | Ga0111539_100442351 | 349 |
| 977 | 3300014326 | Ga0157380_10003659 | Ga0157380_100036592 | 349 |
| 978 | 3300025294 | Ga0209025_1002200 | Ga0209025_100220015 | 349 |
| 979 | 3300025906 | Ga0207699_10049879 | Ga0207699_100498792 | 349 |
| 980 | 3300025912 | Ga0207707_10023818 | Ga0207707_100238184 | 349 |
| 981 | 3300026075 | Ga0207708_10033884 | Ga0207708_100338843 | 349 |
| 982 | 3300026118 | Ga0207675_100153012 | Ga0207675_1001530122 | 349 |
| 983 | 3300028380 | Ga0268265_10230538 | Ga0268265_102305382 | 349 |
| 984 | 3300028577 | Ga0265318_10000618 | Ga0265318_100006188 | 349 |
| 985 | 3300031240 | Ga0265320_10000061 | Ga0265320_1000006119 | 349 |
| 986 | 3300031241 | Ga0265325_10010096 | Ga0265325_100100964 | 349 |
| 987 | 3300031242 | Ga0265329_10000191 | Ga0265329_1000019116 | 349 |
| 988 | 3300031247 | Ga0265340_10004674 | Ga0265340_100046742 | 349 |
| 989 | 3300031249 | Ga0265339_10001171 | Ga0265339_1000117114 | 349 |
| 990 | 3300031250 | Ga0265331_10000192 | Ga0265331_1000019256 | 349 |
| 991 | 3300031344 | Ga0265316_10000637 | Ga0265316_1000063723 | 349 |
| 992 | 3300031595 | Ga0265313_10004284 | Ga0265313_100042848 | 349 |
| 993 | 3300031712 | Ga0265342_10000566 | Ga0265342_1000056623 | 349 |
| 994 | 3300046516 | Ga0495628_0001512 | Ga0495628_0001512_18330_19442 | 349 |
| 995 | 3300046533 | Ga0495640_0093476 | Ga0495640_0093476_448_1560 | 349 |
| 996 | 3300046535 | Ga0495586_0004223 | Ga0495586_0004223_4277_5389 | 349 |
| 997 | 3300046543 | Ga0495645_0001181 | Ga0495645_0001181_785_1897 | 349 |
| 998 | 3300046663 | Ga0495635_0078400 | Ga0495635_0078400_247_1359 | 349 |
| 999 | 3300046680 | Ga0495646_0043322 | Ga0495646_0043322_1153_2265 | 349 |
| 1000 | 3300047317 | Ga0495604_0000517 | Ga0495604_0000517_19687_20799 | 349 |
| 1001 | 3300047319 | Ga0495674_0156533 | Ga0495674_0156533_550_1662 | 349 |
| 1002 | 3300047321 | Ga0495676_0015675 | Ga0495676_0015675_4547_5659 | 349 |
| 1003 | 3300047471 | Ga0495684_0002044 | Ga0495684_0002044_14660_15772 | 349 |
| 1004 | 3300047673 | Ga0495593_0032721 | Ga0495593_0032721_1494_2606 | 349 |
| 1005 | 3300048912 | Ga0496109_0240214 | Ga0496109_0240214_231_1310 | 349 |
| 1006 | 3300048915 | Ga0496112_0069641 | Ga0496112_0069641_22_1101 | 349 |
| 1007 | 3300048916 | Ga0496113_0159620 | Ga0496113_0159620_665_1744 | 349 |
| 1008 | 3300049575 | Ga0501039_0164079 | Ga0501039_0164079_683_1732 | 349 |
| 1009 | 3300049576 | Ga0501040_0085599 | Ga0501040_0085599_1046_2095 | 349 |
| 1010 | 3300049578 | Ga0501042_0061938 | Ga0501042_0061938_351_1400 | 349 |
| 1011 | 3300049582 | Ga0501048_0063884 | Ga0501048_0063884_1172_2221 | 349 |
| 1012 | 3300049588 | Ga0501072_0039810 | Ga0501072_0039810_303_1352 | 349 |
| 1013 | 3300049591 | Ga0501075_0012046 | Ga0501075_0012046_4783_5832 | 349 |
| 1014 | 3300049591 | Ga0501075_0226064 | Ga0501075_0226064_22_1071 | 349 |
| 1015 | 3300049592 | Ga0501076_0019283 | Ga0501076_0019283_2556_3605 | 349 |
| 1016 | 3300050507 | nmdc:mga05p37_170830_c1 | nmdc:mga05p37_170830_c1_1385_2434 | 349 |
| 1017 | 3300050511 | nmdc:mga08y16_279080_c1 | nmdc:mga08y16_279080_c1_313_1362 | 349 |
| 1018 | 3300060353 | Ga0501082_0218858 | Ga0501082_0218858_113_1162 | 349 |
| 1019 | 3300060353 | Ga0501082_0233725 | Ga0501082_0233725_276_1340 | 349 |
| 1020 | iso_pu_bacteria | 8055632911 | 8055637738 | 349 |
| 1021 | 3300005563 | Ga0068855_100016084 | Ga0068855_1000160847 | 351 |
| 1022 | 3300025920 | Ga0207649_10069534 | Ga0207649_100695341 | 351 |
| 1023 | 3300025949 | Ga0207667_10027711 | Ga0207667_100277113 | 351 |
| 1024 | 3300026041 | Ga0207639_10091451 | Ga0207639_100914511 | 351 |
| 1025 | 3300026142 | Ga0207698_10010058 | Ga0207698_100100582 | 351 |
| 1026 | 3300028379 | Ga0268266_10104641 | Ga0268266_101046412 | 351 |
| 1027 | 3300025913 | Ga0207695_10000177 | Ga0207695_10000177119 | 352 |
| 1028 | 3300044712 | Ga0453684_0226155 | Ga0453684_0226155_536_1612 | 352 |
| 1029 | 3300005530 | Ga0070679_100075972 | Ga0070679_1000759722 | 353 |
| 1030 | 3300005577 | Ga0068857_100006714 | Ga0068857_1000067145 | 353 |
| 1031 | 3300005614 | Ga0068856_100003679 | Ga0068856_1000036798 | 353 |
| 1032 | 3300013105 | Ga0157369_10149961 | Ga0157369_101499612 | 353 |
| 1033 | 3300013307 | Ga0157372_10132603 | Ga0157372_101326033 | 353 |
| 1034 | 3300025944 | Ga0207661_10200496 | Ga0207661_102004962 | 353 |
| 1035 | 3300026116 | Ga0207674_10004406 | Ga0207674_1000440610 | 353 |
| 1036 | 3300042876 | Ga0451577_0000980 | Ga0451577_0000980_36791_37918 | 353 |
| 1037 | 3300042876 | Ga0451577_0069109 | Ga0451577_0069109_1223_2344 | 353 |
| 1038 | 3300044712 | Ga0453684_0006656 | Ga0453684_0006656_2238_3365 | 353 |
| 1039 | 3300044712 | Ga0453684_0171385 | Ga0453684_0171385_1233_2360 | 353 |
| 1040 | 3300009147 | Ga0114129_10086192 | Ga0114129_100861923 | 354 |
| 1041 | 3300044673 | Ga0453683_0009560 | Ga0453683_0009560_1583_2803 | 354 |
| 1042 | 3300044712 | Ga0453684_0037563 | Ga0453684_0037563_291_1448 | 354 |
| 1043 | 3300031548 | Ga0307408_100033771 | Ga0307408_1000337713 | 355 |
| 1044 | 3300031901 | Ga0307406_10032648 | Ga0307406_100326483 | 355 |
| 1045 | 3300031903 | Ga0307407_10159379 | Ga0307407_101593792 | 355 |
| 1046 | 3300031995 | Ga0307409_100039280 | Ga0307409_1000392803 | 355 |
| 1047 | 3300032005 | Ga0307411_10008588 | Ga0307411_100085884 | 355 |
| 1048 | 3300001991 | JGI24743J22301_10011800 | JGI24743J22301_100118001 | 356 |
| 1049 | 3300005290 | Ga0065712_10091258 | Ga0065712_100912582 | 356 |
| 1050 | 3300005329 | Ga0070683_100382503 | Ga0070683_1003825031 | 356 |
| 1051 | 3300005331 | Ga0070670_100323744 | Ga0070670_1003237442 | 356 |
| 1052 | 3300005338 | Ga0068868_100104213 | Ga0068868_1001042131 | 356 |
| 1053 | 3300005355 | Ga0070671_100098145 | Ga0070671_1000981452 | 356 |
| 1054 | 3300005356 | Ga0070674_100015728 | Ga0070674_1000157284 | 356 |
| 1055 | 3300005367 | Ga0070667_100099279 | Ga0070667_1000992792 | 356 |
| 1056 | 3300005844 | Ga0068862_100176540 | Ga0068862_1001765401 | 356 |
| 1057 | 3300013308 | Ga0157375_10292559 | Ga0157375_102925591 | 356 |
| 1058 | 3300025315 | Ga0207697_10004184 | Ga0207697_100041842 | 356 |
| 1059 | 3300025901 | Ga0207688_10007105 | Ga0207688_100071053 | 356 |
| 1060 | 3300025926 | Ga0207659_10078575 | Ga0207659_100785752 | 356 |
| 1061 | 3300025931 | Ga0207644_10102858 | Ga0207644_101028582 | 356 |
| 1062 | 3300025937 | Ga0207669_10160265 | Ga0207669_101602652 | 356 |
| 1063 | 3300025944 | Ga0207661_10340495 | Ga0207661_103404951 | 356 |
| 1064 | 3300025945 | Ga0207679_10111126 | Ga0207679_101111262 | 356 |
| 1065 | 3300046499 | Ga0495594_0132343 | Ga0495594_0132343_62_1132 | 356 |
| 1066 | 3300048919 | Ga0496116_0070732 | Ga0496116_0070732_178_1311 | 356 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zic-assembly2.cif.gz_E | crystal structure of aspartate semialdehyde dehydrogenase with nadp from trichophyton rubrum | 0.9741 | 12 | 355 |
| 4zhs-assembly1.cif.gz_D | crystal structure of aspartate semialdehyde dehydrogenase from trichophyton rubrum | 0.9727 | 12 | 355 |
| 6c8w-assembly1.cif.gz_A | crystal structure of aspartate semialdehyde dehydrogenase with nadp from blastomyces dermatitidis | 0.9718 | 10 | 355 |
| 4zhs-assembly1.cif.gz_C | crystal structure of aspartate semialdehyde dehydrogenase from trichophyton rubrum | 0.9708 | 12 | 355 |
| 2ep5-assembly1.cif.gz_D | structural study of project id st1242 from sulfolobus tokodaii strain7 | 0.9707 | 10 | 355 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57658_3_151_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9827 | 9 | 150 | 3.40.50.720 |
| af_P78780_5_150_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9698 | 14 | 155 | 3.30.360.10 |
| 1ys4B02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9676 | 156 | 332 | 3.30.360.10 |
| 2ep5C01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9626 | 10 | 155 | 3.40.50.720 |
| 1ys4B02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.962 | 156 | 332 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5IYS8-F1-model_v4 | Aspartate-semialdehyde dehydrogenase | 1.001 | 265 | 355 |
GO:0004073
GO:0009086 GO:0009088 GO:0046983 |
| AF-A0A1V6KCB6-F1-model_v4 | Aspartate-semialdehyde dehydrogenase | 0.9994 | 281 | 356 |
GO:0004073
GO:0009086 GO:0009088 |
| AF-A0A3N5GGW9-F1-model_v4 | Aspartate-semialdehyde dehydrogenase | 0.9993 | 271 | 355 |
GO:0004073
GO:0009086 GO:0009088 GO:0046983 |
| AF-A0A497K989-F1-model_v4 | Aspartate-semialdehyde dehydrogenase | 0.9991 | 249 | 355 |
GO:0004073
GO:0009086 GO:0009088 GO:0046983 |
| AF-A0A522ESS5-F1-model_v4 | Aspartate-semialdehyde dehydrogenase | 0.9976 | 280 | 356 |
GO:0004073
GO:0009086 GO:0009088 GO:0046983 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar