F489393

General Info

Members Datasets Scaffolds Average Seq Length
1066 372 1062 359

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100075972|Ga0070679_1000759722
Length 420
Sequence MATDIWQPAQAALFFPGPEAKASNMIAWLVECGQFHSRSRFTSAAFQPPLLYTGVFTAMKNRQPIGILGATGMVGQRYIQLLENHPFFEITWLAASDRSSGKAYGEAAKWRLDTPLPERIARMTVSPAEPEGAPKVIFASVDAAIAREMEPKFAAAGCAVISNSSAFRMAPNVPLVIPEVNSDHLHLIEEQPWRKDSGGYIVTNPNCSTIGLVMALKPIEERFGIEQIFATTMQAVSGAGYPGVASMDILDNVVPYIGGEEEKMESETLKLLGALDGHAVKPLAAGMTAHCNRVPVIDGHTECVSIKLGKKLGREVTQEDILAAWAEFQPLAGLNLPFAPGQPVEWSALPDRPQPRLDRNRGRGMAVTVGRLRPCNLLDWKFVLLSHNTVRGAAGATILNAEMLASLGKLEPATAVATHV

Samples

Sample ID Description Type Environment
1 2818991459 Paenibacillus sp. 597 Isolate Unclassified
2 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
3 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
181 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
182 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
187 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
188 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
189 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
190 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
197 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
235 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
253 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
268 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
269 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
270 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
271 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
288 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
289 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
290 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
293 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
306 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
307 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
323 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
324 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
325 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
326 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
327 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
340 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
344 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
345 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
358 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
359 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
360 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
361 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
362 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
363 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
364 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
365 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
366 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
367 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
368 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
369 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
372 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.19
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 2.81
Rhizosphere 95.12
Stem 0
Stem Tuber 0
Unclassified 1.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10011800 3300001991 Unclassified 1580
2 JGI25406J46586_10005411 3300003203 Bacteria 5923
3 Ga0065704_10090535 3300005289 Unclassified 2780
4 Ga0065712_10091258 3300005290 Unclassified 2382
5 Ga0065707_10001119 3300005295 Bacteria 8234
6 Ga0070658_10000048 3300005327 Bacteria 122132
7 Ga0070658_10016381 3300005327 Bacteria 5931
8 Ga0070658_10042434 3300005327 Bacteria 3674
9 Ga0070658_10119728 3300005327 Bacteria 2187
10 Ga0070683_100007811 3300005329 Bacteria 9058
11 Ga0070683_100008501 3300005329 Bacteria 8721
12 Ga0070683_100011715 3300005329 Bacteria 7593
13 Ga0070683_100118401 3300005329 Unclassified 2501
14 Ga0070683_100172114 3300005329 Unclassified 2055
15 Ga0070683_100382503 3300005329 Unclassified 1341
16 Ga0070690_100003413 3300005330 Bacteria 8689
17 Ga0070670_100001371 3300005331 Bacteria 19499
18 Ga0070670_100323744 3300005331 Unclassified 1351
19 Ga0070670_100371546 3300005331 Bacteria 1259
20 Ga0070677_10002326 3300005333 Bacteria 6073
21 Ga0068869_100000150 3300005334 Bacteria 34437
22 Ga0070666_10054200 3300005335 Bacteria 2705
23 Ga0070666_10077700 3300005335 Bacteria 2265
24 Ga0070680_100002837 3300005336 Bacteria 12876
25 Ga0070680_100012003 3300005336 Bacteria 6720
26 Ga0070680_100051607 3300005336 Unclassified 3356
27 Ga0070680_100095609 3300005336 Bacteria 2463
28 Ga0068868_100001048 3300005338 Bacteria 18896
29 Ga0068868_100002969 3300005338 Bacteria 11774
30 Ga0068868_100104213 3300005338 Bacteria 2298
31 Ga0068868_100346532 3300005338 Unclassified 1271
32 Ga0070660_100010244 3300005339 Bacteria 6615
33 Ga0070660_100032029 3300005339 Bacteria 3953
34 Ga0070689_100342525 3300005340 Unclassified 1252
35 Ga0070691_10066505 3300005341 Bacteria 1742
36 Ga0070661_100016773 3300005344 Bacteria 5185
37 Ga0070661_100026896 3300005344 Bacteria 4141
38 Ga0070668_100069089 3300005347 Bacteria 2748
39 Ga0070675_100009318 3300005354 Bacteria 7634
40 Ga0070675_100207461 3300005354 Unclassified 1702
41 Ga0070675_100253119 3300005354 Bacteria 1542
42 Ga0070671_100000679 3300005355 Bacteria 24402
43 Ga0070671_100006131 3300005355 Bacteria 9576
44 Ga0070671_100021203 3300005355 Bacteria 5305
45 Ga0070671_100032834 3300005355 Bacteria 4290
46 Ga0070671_100098145 3300005355 Bacteria 2457
47 Ga0070674_100015728 3300005356 Bacteria 4730
48 Ga0070673_100027927 3300005364 Bacteria 4190
49 Ga0070688_100126243 3300005365 Bacteria 1720
50 Ga0070659_100001855 3300005366 Bacteria 15194
51 Ga0070659_100007704 3300005366 Bacteria 7832
52 Ga0070659_100093945 3300005366 Bacteria 2407
53 Ga0070659_100321695 3300005366 Bacteria 1293
54 Ga0070667_100007254 3300005367 Bacteria 9211
55 Ga0070667_100028591 3300005367 Bacteria 4642
56 Ga0070667_100099279 3300005367 Unclassified 2513
57 Ga0070709_10020442 3300005434 Bacteria 3841
58 Ga0070714_100012873 3300005435 Bacteria 6687
59 Ga0070714_100057585 3300005435 Bacteria 3327
60 Ga0070713_100030864 3300005436 Bacteria 4262
61 Ga0070713_100054118 3300005436 Unclassified 3328
62 Ga0070713_100067642 3300005436 Bacteria 3008
63 Ga0070713_100117097 3300005436 Bacteria 2331
64 Ga0070710_10052253 3300005437 Unclassified 2298
65 Ga0070710_10077580 3300005437 Bacteria 1931
66 Ga0070711_100001578 3300005439 Bacteria 12540
67 Ga0070711_100003134 3300005439 Bacteria 9586
68 Ga0070711_100009637 3300005439 Bacteria 5952
69 Ga0070711_100079522 3300005439 Bacteria 2332
70 Ga0070694_100057648 3300005444 Bacteria 2641
71 Ga0070708_100024498 3300005445 Bacteria 5151
72 Ga0070708_100034419 3300005445 Bacteria 4408
73 Ga0070708_100061577 3300005445 Unclassified 3353
74 Ga0070663_100026503 3300005455 Bacteria 3927
75 Ga0070663_100093285 3300005455 Bacteria 2233
76 Ga0070662_100038077 3300005457 Bacteria 3414
77 Ga0070681_10000514 3300005458 Bacteria 31694
78 Ga0070681_10010407 3300005458 Bacteria 9186
79 Ga0070681_10051656 3300005458 Bacteria 4100
80 Ga0070681_10173043 3300005458 Bacteria 2081
81 Ga0070681_10226871 3300005458 Unclassified 1782
82 Ga0070706_100000509 3300005467 Bacteria 45647
83 Ga0070706_100001098 3300005467 Bacteria 29248
84 Ga0070706_100038175 3300005467 Bacteria 4434
85 Ga0070707_100001894 3300005468 Bacteria 20046
86 Ga0070707_100008854 3300005468 Bacteria 9333
87 Ga0070707_100021182 3300005468 Bacteria 6143
88 Ga0070707_100044371 3300005468 Unclassified 4256
89 Ga0070707_100128880 3300005468 Archaea 2459
90 Ga0070698_100007264 3300005471 Bacteria 12000
91 Ga0070698_100300686 3300005471 Bacteria 1535
92 Ga0070699_100001428 3300005518 Bacteria 21945
93 Ga0070699_100014915 3300005518 Bacteria 6681
94 Ga0070699_100028220 3300005518 Bacteria 4841
95 Ga0070699_100125696 3300005518 Unclassified 2257
96 Ga0070699_100262862 3300005518 Unclassified 1544
97 Ga0070699_100263534 3300005518 Bacteria 1541
98 Ga0070699_100279899 3300005518 Bacteria 1494
99 Ga0070679_100001505 3300005530 Bacteria 20715
100 Ga0070679_100005422 3300005530 Bacteria 11821
101 Ga0070679_100010655 3300005530 Bacteria 8724
102 Ga0070679_100049509 3300005530 Bacteria 4185
103 Ga0070679_100073747 3300005530 Bacteria 3404
104 Ga0070679_100075972 3300005530 Bacteria 3349
105 Ga0070679_100076842 3300005530 Bacteria 3328
106 Ga0070679_100491511 3300005530 Bacteria 1171
107 Ga0070684_100000615 3300005535 Bacteria 24555
108 Ga0070684_100005285 3300005535 Bacteria 9881
109 Ga0070684_100030864 3300005535 Bacteria 4558
110 Ga0070697_100012833 3300005536 Bacteria 6563
111 Ga0070697_100046211 3300005536 Bacteria 3529
112 Ga0068853_100000021 3300005539 Bacteria 149283
113 Ga0068853_100000530 3300005539 Bacteria 25896
114 Ga0068853_100004354 3300005539 Bacteria 10959
115 Ga0068853_100123557 3300005539 Bacteria 2311
116 Ga0070672_100022363 3300005543 Bacteria 4644
117 Ga0070686_100005851 3300005544 Bacteria 6814
118 Ga0070695_100101656 3300005545 Unclassified 1937
119 Ga0070695_100281244 3300005545 Bacteria 1222
120 Ga0070696_100049197 3300005546 Unclassified 2928
121 Ga0070693_100084193 3300005547 Bacteria 1903
122 Ga0070665_100003253 3300005548 Bacteria 17456
123 Ga0070665_100011303 3300005548 Bacteria 9029
124 Ga0070665_100203379 3300005548 Bacteria 1981
125 Ga0070665_100301789 3300005548 Bacteria 1604
126 Ga0070665_100365480 3300005548 Bacteria 1449
127 Ga0070704_100063711 3300005549 Bacteria 2647
128 Ga0068855_100003888 3300005563 Bacteria 18249
129 Ga0068855_100004226 3300005563 Bacteria 17533
130 Ga0068855_100009115 3300005563 Bacteria 11986
131 Ga0068855_100016084 3300005563 Bacteria 8997
132 Ga0068855_100024264 3300005563 Bacteria 7261
133 Ga0068855_100042381 3300005563 Bacteria 5393
134 Ga0068855_100042577 3300005563 Bacteria 5380
135 Ga0068855_100044346 3300005563 Bacteria 5263
136 Ga0068855_100047785 3300005563 Bacteria 5054
137 Ga0068855_100070217 3300005563 Bacteria 4075
138 Ga0068855_100234072 3300005563 Bacteria 2055
139 Ga0068855_100339224 3300005563 Bacteria 1657
140 Ga0070664_100115697 3300005564 Unclassified 2344
141 Ga0070664_100118583 3300005564 Unclassified 2315
142 Ga0068857_100000546 3300005577 Bacteria 27403
143 Ga0068857_100006714 3300005577 Bacteria 9892
144 Ga0068857_100034505 3300005577 Bacteria 4475
145 Ga0068857_100099984 3300005577 Bacteria 2602
146 Ga0068857_100362345 3300005577 Bacteria 1344
147 Ga0068854_100000058 3300005578 Bacteria 82001
148 Ga0068856_100003679 3300005614 Bacteria 15383
149 Ga0068856_100006800 3300005614 Bacteria 11195
150 Ga0068856_100011402 3300005614 Bacteria 8621
151 Ga0068856_100031462 3300005614 Bacteria 5191
152 Ga0068856_100035677 3300005614 Bacteria 4874
153 Ga0068856_100045450 3300005614 Bacteria 4324
154 Ga0068856_100293219 3300005614 Bacteria 1643
155 Ga0068852_100000015 3300005616 Bacteria 134085
156 Ga0068852_100001731 3300005616 Bacteria 14875
157 Ga0068852_100021040 3300005616 Bacteria 5198
158 Ga0068852_100044115 3300005616 Bacteria 3785
159 Ga0068852_100084535 3300005616 Bacteria 2824
160 Ga0068852_100140064 3300005616 Bacteria 2238
161 Ga0068852_100191105 3300005616 Bacteria 1932
162 Ga0068859_100008509 3300005617 Bacteria 10383
163 Ga0068859_100057196 3300005617 Bacteria 3928
164 Ga0068859_100144400 3300005617 Bacteria 2454
165 Ga0068859_100290861 3300005617 Unclassified 1727
166 Ga0068859_100476660 3300005617 Unclassified 1343
167 Ga0068864_100000358 3300005618 Bacteria 40190
168 Ga0068864_100004818 3300005618 Bacteria 11061
169 Ga0068866_10074774 3300005718 Bacteria 1802
170 Ga0068851_10060668 3300005834 Bacteria 1937
171 Ga0068851_10087750 3300005834 Unclassified 1634
172 Ga0068870_10059368 3300005840 Unclassified 2050
173 Ga0068870_10213089 3300005840 Bacteria 1178
174 Ga0068863_100002705 3300005841 Bacteria 17510
175 Ga0068863_100024932 3300005841 Bacteria 5705
176 Ga0068858_100001959 3300005842 Bacteria 21012
177 Ga0068860_100000809 3300005843 Bacteria 35018
178 Ga0068860_100069366 3300005843 Bacteria 3350
179 Ga0068862_100050254 3300005844 Bacteria 3563
180 Ga0068862_100052937 3300005844 Unclassified 3474
181 Ga0068862_100060611 3300005844 Bacteria 3251
182 Ga0068862_100176540 3300005844 Unclassified 1915
183 Ga0068862_100239065 3300005844 Bacteria 1650
184 Ga0081540_1017614 3300005983 Bacteria 4414
185 Ga0081539_10001697 3300005985 Bacteria 35528
186 Ga0070717_10002932 3300006028 Bacteria 12112
187 Ga0070717_10003518 3300006028 Bacteria 11223
188 Ga0070715_10039657 3300006163 Bacteria 1963
189 Ga0070716_100000278 3300006173 Bacteria 20754
190 Ga0070716_100003816 3300006173 Bacteria 7150
191 Ga0070712_100001997 3300006175 Bacteria 12488
192 Ga0070712_100084158 3300006175 Unclassified 2312
193 Ga0070712_100137033 3300006175 Bacteria 1862
194 Ga0070712_100168455 3300006175 Bacteria 1697
195 Ga0097621_100022382 3300006237 Bacteria 4906
196 Ga0097621_100098149 3300006237 Bacteria 2460
197 Ga0068871_100003433 3300006358 Bacteria 10897
198 Ga0068871_100022353 3300006358 Bacteria 4875
199 Ga0075428_100026112 3300006844 Bacteria 6467
200 Ga0075428_100186843 3300006844 Bacteria 2242
201 Ga0075430_100087245 3300006846 Unclassified 2611
202 Ga0075431_100205288 3300006847 Bacteria 2015
203 Ga0075433_10042358 3300006852 Unclassified 3950
204 Ga0075433_10083064 3300006852 Bacteria 2826
205 Ga0075434_100092569 3300006871 Bacteria 3026
206 Ga0075434_100260111 3300006871 Unclassified 1754
207 Ga0075429_100086347 3300006880 Bacteria 2735
208 Ga0068865_100054418 3300006881 Bacteria 2780
209 Ga0075436_100016127 3300006914 Bacteria 5115
210 Ga0097620_100008509 3300006931 Bacteria 10383
211 Ga0097620_100057194 3300006931 Bacteria 3928
212 Ga0097620_100144394 3300006931 Bacteria 2454
213 Ga0097620_100290839 3300006931 Unclassified 1727
214 Ga0097620_100476657 3300006931 Unclassified 1343
215 Ga0105240_10000181 3300009093 Bacteria 128067
216 Ga0105240_10000296 3300009093 Bacteria 96854
217 Ga0105240_10000694 3300009093 Bacteria 61854
218 Ga0105240_10001490 3300009093 Bacteria 39873
219 Ga0105240_10001725 3300009093 Bacteria 36900
220 Ga0105240_10022759 3300009093 Bacteria 8301
221 Ga0105240_10028160 3300009093 Bacteria 7345
222 Ga0105240_10039509 3300009093 Bacteria 6041
223 Ga0105240_10039789 3300009093 Bacteria 6018
224 Ga0105240_10061115 3300009093 Bacteria 4695
225 Ga0105240_10124534 3300009093 Bacteria 3099
226 Ga0105240_10160249 3300009093 Unclassified 2673
227 Ga0105240_10191445 3300009093 Bacteria 2405
228 Ga0105240_10216876 3300009093 Unclassified 2232
229 Ga0105240_10269362 3300009093 Bacteria 1961
230 Ga0105240_10411878 3300009093 Bacteria 1520
231 Ga0111539_10044235 3300009094 Bacteria 5335
232 Ga0105245_10000670 3300009098 Bacteria 31023
233 Ga0105245_10004060 3300009098 Bacteria 13008
234 Ga0105245_10005477 3300009098 Bacteria 11150
235 Ga0105245_10031511 3300009098 Bacteria 4693
236 Ga0105245_10078822 3300009098 Bacteria 3007
237 Ga0105245_10500063 3300009098 Bacteria 1232
238 Ga0105247_10001310 3300009101 Bacteria 18251
239 Ga0114129_10010664 3300009147 Bacteria 13103
240 Ga0114129_10021718 3300009147 Bacteria 9109
241 Ga0114129_10086192 3300009147 Unclassified 4356
242 Ga0114129_10086217 3300009147 Unclassified 4355
243 Ga0114129_10121493 3300009147 Bacteria 3594
244 Ga0114129_10194709 3300009147 Bacteria 2750
245 Ga0114129_10428194 3300009147 Unclassified 1739
246 Ga0114129_10541489 3300009147 Bacteria 1515
247 Ga0105241_10000076 3300009174 Bacteria 74496
248 Ga0105241_10000890 3300009174 Bacteria 22539
249 Ga0105241_10001486 3300009174 Bacteria 17962
250 Ga0105241_10005735 3300009174 Bacteria 9169
251 Ga0105241_10007208 3300009174 Bacteria 8184
252 Ga0105241_10012112 3300009174 Bacteria 6332
253 Ga0105242_10246326 3300009176 Unclassified 1609
254 Ga0105242_10429211 3300009176 Unclassified 1240
255 Ga0105248_10000002 3300009177 Bacteria 1054120
256 Ga0105248_10000574 3300009177 Bacteria 41822
257 Ga0105248_10070263 3300009177 Bacteria 3932
258 Ga0105248_10119919 3300009177 Bacteria 2967
259 Ga0105248_10141655 3300009177 Bacteria 2713
260 Ga0105248_10228069 3300009177 Bacteria 2097
261 Ga0105237_10002962 3300009545 Bacteria 20550
262 Ga0105237_10022210 3300009545 Bacteria 6511
263 Ga0105237_10029870 3300009545 Bacteria 5536
264 Ga0105237_10029937 3300009545 Bacteria 5530
265 Ga0105237_10041181 3300009545 Bacteria 4660
266 Ga0105237_10060993 3300009545 Unclassified 3772
267 Ga0105238_10000673 3300009551 Bacteria 35869
268 Ga0105238_10001732 3300009551 Bacteria 21967
269 Ga0105238_10002620 3300009551 Bacteria 17941
270 Ga0105238_10021773 3300009551 Bacteria 6529
271 Ga0105238_10022478 3300009551 Bacteria 6428
272 Ga0105238_10022964 3300009551 Bacteria 6358
273 Ga0105238_10034581 3300009551 Bacteria 5141
274 Ga0105238_10078654 3300009551 Unclassified 3288
275 Ga0105238_10095409 3300009551 Bacteria 2961
276 Ga0105238_10099100 3300009551 Bacteria 2897
277 Ga0105238_10117691 3300009551 Unclassified 2637
278 Ga0105238_10215227 3300009551 Bacteria 1898
279 Ga0105238_10369686 3300009551 Bacteria 1424
280 Ga0105249_10011428 3300009553 Bacteria 7799
281 Ga0105249_10015336 3300009553 Bacteria 6781
282 Ga0105249_10028452 3300009553 Bacteria 5044
283 Ga0105249_10089159 3300009553 Unclassified 2882
284 Ga0105249_10465252 3300009553 Bacteria 1305
285 Ga0105239_10001562 3300010375 Bacteria 30313
286 Ga0105239_10013626 3300010375 Bacteria 9026
287 Ga0105239_10021901 3300010375 Bacteria 7045
288 Ga0105239_10094557 3300010375 Bacteria 3301
289 Ga0105239_10145102 3300010375 Unclassified 2647
290 Ga0105239_10411336 3300010375 Unclassified 1532
291 Ga0105239_10506485 3300010375 Unclassified 1373
292 Ga0105246_10001037 3300011119 Bacteria 15999
293 Ga0105246_10084676 3300011119 Unclassified 2269
294 Ga0105246_10130918 3300011119 Unclassified 1874
295 Ga0105246_10191974 3300011119 Unclassified 1582
296 Ga0157373_10006042 3300013100 Bacteria 9051
297 Ga0157373_10012352 3300013100 Bacteria 6279
298 Ga0157373_10139606 3300013100 Bacteria 1704
299 Ga0157371_10137500 3300013102 Unclassified 1740
300 Ga0157370_10000196 3300013104 Bacteria 75917
301 Ga0157370_10009613 3300013104 Bacteria 10292
302 Ga0157370_10018762 3300013104 Bacteria 6955
303 Ga0157370_10047985 3300013104 Bacteria 4092
304 Ga0157370_10049663 3300013104 Bacteria 4015
305 Ga0157370_10052297 3300013104 Bacteria 3900
306 Ga0157370_10053518 3300013104 Bacteria 3849
307 Ga0157370_10057536 3300013104 Bacteria 3696
308 Ga0157370_10107455 3300013104 Bacteria 2610
309 Ga0157369_10000400 3300013105 Bacteria 57821
310 Ga0157369_10001946 3300013105 Bacteria 24880
311 Ga0157369_10003846 3300013105 Bacteria 17837
312 Ga0157369_10008244 3300013105 Bacteria 11945
313 Ga0157369_10021594 3300013105 Bacteria 7198
314 Ga0157369_10022251 3300013105 Bacteria 7079
315 Ga0157369_10023096 3300013105 Bacteria 6930
316 Ga0157369_10024835 3300013105 Bacteria 6658
317 Ga0157369_10033757 3300013105 Bacteria 5620
318 Ga0157369_10095346 3300013105 Bacteria 3175
319 Ga0157369_10123307 3300013105 Bacteria 2748
320 Ga0157369_10132987 3300013105 Unclassified 2635
321 Ga0157369_10149961 3300013105 Bacteria 2464
322 Ga0157369_10166600 3300013105 Bacteria 2323
323 Ga0157369_10427444 3300013105 Bacteria 1373
324 Ga0157374_10000395 3300013296 Bacteria 39508
325 Ga0157374_10016113 3300013296 Bacteria 6567
326 Ga0157374_10022671 3300013296 Bacteria 5604
327 Ga0157374_10041938 3300013296 Bacteria 4220
328 Ga0157374_10092541 3300013296 Bacteria 2885
329 Ga0157374_10488768 3300013296 Bacteria 1234
330 Ga0157378_10001503 3300013297 Bacteria 21108
331 Ga0157378_10003643 3300013297 Bacteria 13642
332 Ga0157378_10005072 3300013297 Bacteria 11566
333 Ga0157378_10011057 3300013297 Bacteria 7901
334 Ga0157378_10012305 3300013297 Bacteria 7492
335 Ga0157378_10018918 3300013297 Bacteria 6053
336 Ga0157378_10026512 3300013297 Bacteria 5109
337 Ga0157378_10086042 3300013297 Bacteria 2849
338 Ga0163162_10000056 3300013306 Bacteria 109321
339 Ga0163162_10805186 3300013306 Bacteria 1057
340 Ga0157372_10000197 3300013307 Bacteria 66368
341 Ga0157372_10011993 3300013307 Bacteria 9230
342 Ga0157372_10012396 3300013307 Bacteria 9086
343 Ga0157372_10012466 3300013307 Bacteria 9062
344 Ga0157372_10018043 3300013307 Bacteria 7586
345 Ga0157372_10029231 3300013307 Bacteria 6016
346 Ga0157372_10030411 3300013307 Bacteria 5909
347 Ga0157372_10035984 3300013307 Bacteria 5453
348 Ga0157372_10038263 3300013307 Bacteria 5293
349 Ga0157372_10052443 3300013307 Bacteria 4542
350 Ga0157372_10064140 3300013307 Bacteria 4121
351 Ga0157372_10076118 3300013307 Bacteria 3789
352 Ga0157372_10123929 3300013307 Bacteria 2971
353 Ga0157372_10132603 3300013307 Bacteria 2868
354 Ga0157372_10144707 3300013307 Bacteria 2741
355 Ga0157372_10220193 3300013307 Bacteria 2200
356 Ga0157375_10002008 3300013308 Bacteria 17554
357 Ga0157375_10018165 3300013308 Bacteria 6373
358 Ga0157375_10111913 3300013308 Unclassified 2829
359 Ga0157375_10128474 3300013308 Bacteria 2652
360 Ga0157375_10292559 3300013308 Unclassified 1792
361 Ga0163163_10001119 3300014325 Bacteria 22802
362 Ga0163163_10008910 3300014325 Bacteria 8937
363 Ga0163163_10100236 3300014325 Unclassified 2919
364 Ga0157380_10003659 3300014326 Bacteria 10571
365 Ga0157380_10136136 3300014326 Bacteria 2103
366 Ga0157379_10000092 3300014968 Bacteria 60487
367 Ga0157379_10030787 3300014968 Bacteria 4778
368 Ga0157379_10030885 3300014968 Bacteria 4772
369 Ga0157376_10000566 3300014969 Bacteria 23870
370 Ga0157376_10008715 3300014969 Bacteria 7330
371 Ga0157376_10022346 3300014969 Bacteria 4929
372 Ga0157376_10134661 3300014969 Bacteria 2209
373 Ga0163161_10012559 3300017792 Bacteria 5882
374 Ga0228598_1000157 3300024227 Bacteria 11948
375 Ga0209233_1010497 3300025261 Bacteria 2772
376 Ga0209025_1002200 3300025294 Bacteria 21579
377 Ga0207697_10004184 3300025315 Bacteria 6941
378 Ga0207656_10043280 3300025321 Bacteria 1920
379 Ga0207682_10042681 3300025893 Bacteria 1853
380 Ga0207692_10004844 3300025898 Archaea 5356
381 Ga0207692_10058978 3300025898 Bacteria 1980
382 Ga0207710_10000400 3300025900 Bacteria 28981
383 Ga0207688_10007105 3300025901 Bacteria 6090
384 Ga0207680_10002832 3300025903 Bacteria 8129
385 Ga0207685_10008369 3300025905 Bacteria 2942
386 Ga0207699_10046993 3300025906 Bacteria 2528
387 Ga0207699_10049879 3300025906 Unclassified 2465
388 Ga0207645_10005089 3300025907 Bacteria 9624
389 Ga0207705_10000048 3300025909 Bacteria 171848
390 Ga0207705_10011775 3300025909 Bacteria 6321
391 Ga0207705_10013354 3300025909 Bacteria 5924
392 Ga0207705_10014834 3300025909 Bacteria 5603
393 Ga0207705_10027295 3300025909 Bacteria 4072
394 Ga0207705_10060544 3300025909 Bacteria 2734
395 Ga0207684_10000753 3300025910 Bacteria 37762
396 Ga0207684_10003222 3300025910 Bacteria 16019
397 Ga0207684_10003763 3300025910 Bacteria 14669
398 Ga0207684_10016799 3300025910 Bacteria 6283
399 Ga0207684_10034984 3300025910 Bacteria 4266
400 Ga0207684_10040343 3300025910 Archaea 3958
401 Ga0207684_10179908 3300025910 Unclassified 1823
402 Ga0207654_10000025 3300025911 Bacteria 143807
403 Ga0207654_10000035 3300025911 Bacteria 112494
404 Ga0207654_10000242 3300025911 Bacteria 33063
405 Ga0207654_10001671 3300025911 Bacteria 11597
406 Ga0207707_10010347 3300025912 Bacteria 8094
407 Ga0207707_10023818 3300025912 Bacteria 5354
408 Ga0207707_10046691 3300025912 Bacteria 3772
409 Ga0207707_10125840 3300025912 Bacteria 2241
410 Ga0207707_10127945 3300025912 Bacteria 2221
411 Ga0207707_10261392 3300025912 Bacteria 1502
412 Ga0207695_10000069 3300025913 Bacteria 319955
413 Ga0207695_10000119 3300025913 Bacteria 235221
414 Ga0207695_10000177 3300025913 Bacteria 185955
415 Ga0207695_10000314 3300025913 Bacteria 116506
416 Ga0207695_10003396 3300025913 Bacteria 22499
417 Ga0207695_10013418 3300025913 Bacteria 9772
418 Ga0207695_10020092 3300025913 Bacteria 7663
419 Ga0207695_10022772 3300025913 Bacteria 7099
420 Ga0207695_10033792 3300025913 Bacteria 5571
421 Ga0207695_10037096 3300025913 Bacteria 5261
422 Ga0207695_10099597 3300025913 Bacteria 2904
423 Ga0207695_10125045 3300025913 Bacteria 2535
424 Ga0207671_10000246 3300025914 Bacteria 81042
425 Ga0207671_10008661 3300025914 Bacteria 8589
426 Ga0207671_10159164 3300025914 Bacteria 1748
427 Ga0207693_10003987 3300025915 Bacteria 12544
428 Ga0207693_10005055 3300025915 Bacteria 11071
429 Ga0207693_10006988 3300025915 Bacteria 9324
430 Ga0207693_10043072 3300025915 Unclassified 3553
431 Ga0207693_10123049 3300025915 Bacteria 2038
432 Ga0207693_10273981 3300025915 Bacteria 1322
433 Ga0207663_10004905 3300025916 Bacteria 6695
434 Ga0207663_10005352 3300025916 Bacteria 6459
435 Ga0207663_10083264 3300025916 Bacteria 2101
436 Ga0207660_10001226 3300025917 Bacteria 17175
437 Ga0207660_10026938 3300025917 Unclassified 3918
438 Ga0207660_10056663 3300025917 Bacteria 2804
439 Ga0207660_10067231 3300025917 Unclassified 2595
440 Ga0207660_10114820 3300025917 Bacteria 2031
441 Ga0207662_10004894 3300025918 Bacteria 7086
442 Ga0207657_10014437 3300025919 Bacteria 7714
443 Ga0207657_10064675 3300025919 Bacteria 3121
444 Ga0207649_10003594 3300025920 Bacteria 8471
445 Ga0207649_10069534 3300025920 Bacteria 2242
446 Ga0207649_10159724 3300025920 Bacteria 1561
447 Ga0207652_10002189 3300025921 Bacteria 16699
448 Ga0207652_10015042 3300025921 Bacteria 6277
449 Ga0207652_10046362 3300025921 Bacteria 3709
450 Ga0207652_10057740 3300025921 Bacteria 3343
451 Ga0207652_10104864 3300025921 Bacteria 2501
452 Ga0207652_10195644 3300025921 Bacteria 1819
453 Ga0207652_10387454 3300025921 Bacteria 1261
454 Ga0207646_10002834 3300025922 Bacteria 20173
455 Ga0207646_10031816 3300025922 Bacteria 4776
456 Ga0207681_10018127 3300025923 Unclassified 4432
457 Ga0207694_10000445 3300025924 Bacteria 38303
458 Ga0207694_10001160 3300025924 Bacteria 22863
459 Ga0207694_10002398 3300025924 Bacteria 15325
460 Ga0207694_10003854 3300025924 Bacteria 11855
461 Ga0207694_10037543 3300025924 Bacteria 3721
462 Ga0207694_10219392 3300025924 Bacteria 1551
463 Ga0207650_10001580 3300025925 Bacteria 16262
464 Ga0207650_10184065 3300025925 Unclassified 1666
465 Ga0207659_10060591 3300025926 Bacteria 2724
466 Ga0207659_10078575 3300025926 Unclassified 2432
467 Ga0207687_10003266 3300025927 Bacteria 10974
468 Ga0207687_10003918 3300025927 Bacteria 9972
469 Ga0207700_10007377 3300025928 Bacteria 6717
470 Ga0207700_10073599 3300025928 Bacteria 2639
471 Ga0207700_10203460 3300025928 Bacteria 1670
472 Ga0207700_10257932 3300025928 Bacteria 1492
473 Ga0207664_10024226 3300025929 Bacteria 4559
474 Ga0207664_10052096 3300025929 Bacteria 3235
475 Ga0207644_10050679 3300025931 Bacteria 2977
476 Ga0207644_10058042 3300025931 Bacteria 2796
477 Ga0207644_10102858 3300025931 Unclassified 2149
478 Ga0207644_10177450 3300025931 Bacteria 1667
479 Ga0207690_10001008 3300025932 Bacteria 17978
480 Ga0207690_10153121 3300025932 Bacteria 1711
481 Ga0207706_10003990 3300025933 Bacteria 13995
482 Ga0207706_10095763 3300025933 Bacteria 2611
483 Ga0207709_10046486 3300025935 Bacteria 2634
484 Ga0207670_10100535 3300025936 Unclassified 2065
485 Ga0207669_10160265 3300025937 Bacteria 1588
486 Ga0207704_10287771 3300025938 Unclassified 1252
487 Ga0207665_10000046 3300025939 Bacteria 78992
488 Ga0207665_10002386 3300025939 Bacteria 12686
489 Ga0207691_10029746 3300025940 Bacteria 5108
490 Ga0207711_10000052 3300025941 Bacteria 138437
491 Ga0207711_10003126 3300025941 Bacteria 14427
492 Ga0207711_10034624 3300025941 Bacteria 4278
493 Ga0207711_10042974 3300025941 Bacteria 3853
494 Ga0207711_10394804 3300025941 Unclassified 1285
495 Ga0207689_10000553 3300025942 Bacteria 35691
496 Ga0207689_10399215 3300025942 Unclassified 1146
497 Ga0207661_10014141 3300025944 Bacteria 5841
498 Ga0207661_10030419 3300025944 Bacteria 4159
499 Ga0207661_10062931 3300025944 Bacteria 3003
500 Ga0207661_10200496 3300025944 Bacteria 1754
501 Ga0207661_10340495 3300025944 Unclassified 1351
502 Ga0207679_10049038 3300025945 Bacteria 3078
503 Ga0207679_10111126 3300025945 Bacteria 2163
504 Ga0207679_10155091 3300025945 Unclassified 1869
505 Ga0207679_10311406 3300025945 Unclassified 1360
506 Ga0207667_10003942 3300025949 Bacteria 18265
507 Ga0207667_10018661 3300025949 Bacteria 7771
508 Ga0207667_10019979 3300025949 Bacteria 7461
509 Ga0207667_10027711 3300025949 Bacteria 6163
510 Ga0207667_10031300 3300025949 Bacteria 5744
511 Ga0207667_10066827 3300025949 Bacteria 3747
512 Ga0207667_10069425 3300025949 Bacteria 3667
513 Ga0207667_10098007 3300025949 Bacteria 3025
514 Ga0207667_10118488 3300025949 Bacteria 2728
515 Ga0207667_10225809 3300025949 Bacteria 1918
516 Ga0207712_10012260 3300025961 Bacteria 5477
517 Ga0207712_10014311 3300025961 Bacteria 5100
518 Ga0207712_10026055 3300025961 Unclassified 3892
519 Ga0207712_10047310 3300025961 Unclassified 2986
520 Ga0207712_10092152 3300025961 Bacteria 2233
521 Ga0207640_10000013 3300025981 Bacteria 224767
522 Ga0207658_10004414 3300025986 Bacteria 9784
523 Ga0207658_10025828 3300025986 Bacteria 4114
524 Ga0207658_10130957 3300025986 Bacteria 2015
525 Ga0207677_10000104 3300026023 Bacteria 70036
526 Ga0207703_10001534 3300026035 Bacteria 20986
527 Ga0207703_10171370 3300026035 Bacteria 1909
528 Ga0207639_10000035 3300026041 Bacteria 149309
529 Ga0207639_10008007 3300026041 Bacteria 7220
530 Ga0207639_10018657 3300026041 Bacteria 4932
531 Ga0207639_10091451 3300026041 Bacteria 2436
532 Ga0207639_10106525 3300026041 Bacteria 2276
533 Ga0207678_10000300 3300026067 Bacteria 44431
534 Ga0207678_10019980 3300026067 Bacteria 5887
535 Ga0207678_10030577 3300026067 Bacteria 4700
536 Ga0207678_10044820 3300026067 Bacteria 3825
537 Ga0207708_10026844 3300026075 Bacteria 4359
538 Ga0207708_10033884 3300026075 Bacteria 3883
539 Ga0207702_10000633 3300026078 Bacteria 38531
540 Ga0207702_10032353 3300026078 Bacteria 4365
541 Ga0207702_10036410 3300026078 Bacteria 4116
542 Ga0207702_10043748 3300026078 Bacteria 3761
543 Ga0207641_10048632 3300026088 Bacteria 3580
544 Ga0207641_10151279 3300026088 Bacteria 2102
545 Ga0207676_10005714 3300026095 Bacteria 8803
546 Ga0207676_10005721 3300026095 Bacteria 8796
547 Ga0207674_10001288 3300026116 Bacteria 32726
548 Ga0207674_10001317 3300026116 Bacteria 32318
549 Ga0207674_10004406 3300026116 Bacteria 16960
550 Ga0207674_10113029 3300026116 Bacteria 2689
551 Ga0207674_10117887 3300026116 Bacteria 2625
552 Ga0207675_100013011 3300026118 Bacteria 7768
553 Ga0207675_100034162 3300026118 Bacteria 4740
554 Ga0207675_100153012 3300026118 Bacteria 2197
555 Ga0207683_10000600 3300026121 Bacteria 33247
556 Ga0207698_10000006 3300026142 Bacteria 291847
557 Ga0207698_10010058 3300026142 Bacteria 6058
558 Ga0207698_10024152 3300026142 Bacteria 4261
559 Ga0207698_10092021 3300026142 Bacteria 2485
560 Ga0268266_10018533 3300028379 Bacteria 5932
561 Ga0268266_10028507 3300028379 Bacteria 4745
562 Ga0268266_10032459 3300028379 Bacteria 4435
563 Ga0268266_10104641 3300028379 Bacteria 2499
564 Ga0268266_10124914 3300028379 Bacteria 2294
565 Ga0268265_10041347 3300028380 Bacteria 3411
566 Ga0268265_10123169 3300028380 Bacteria 2140
567 Ga0268265_10181063 3300028380 Unclassified 1810
568 Ga0268265_10230538 3300028380 Bacteria 1627
569 Ga0268265_10240959 3300028380 Bacteria 1596
570 Ga0268265_10316621 3300028380 Archaea 1411
571 Ga0268264_10000877 3300028381 Bacteria 31797
572 Ga0268264_10142864 3300028381 Bacteria 2136
573 Ga0265326_10028802 3300028558 Archaea 1582
574 Ga0265318_10000618 3300028577 Bacteria 24601
575 Ga0265318_10021651 3300028577 Bacteria 2580
576 Ga0265318_10067317 3300028577 Bacteria 1329
577 Ga0265336_10000499 3300028666 Bacteria 22942
578 Ga0265338_10001617 3300028800 Bacteria 36047
579 Ga0265338_10012926 3300028800 Bacteria 9480
580 Ga0265338_10036504 3300028800 Bacteria 4701
581 Ga0265760_10002262 3300031090 Bacteria 5632
582 Ga0265760_10002525 3300031090 Bacteria 5339
583 Ga0265330_10000146 3300031235 Archaea 57212
584 Ga0265330_10000326 3300031235 Bacteria 34208
585 Ga0265330_10001479 3300031235 Bacteria 13663
586 Ga0265330_10061853 3300031235 Bacteria 1628
587 Ga0265332_10033129 3300031238 Bacteria 2250
588 Ga0265328_10004527 3300031239 Bacteria 6031
589 Ga0265328_10022033 3300031239 Bacteria 2427
590 Ga0265320_10000061 3300031240 Bacteria 101367
591 Ga0265325_10000499 3300031241 Bacteria 28359
592 Ga0265325_10001354 3300031241 Bacteria 17356
593 Ga0265325_10010096 3300031241 Bacteria 5484
594 Ga0265325_10018685 3300031241 Bacteria 3843
595 Ga0265325_10036674 3300031241 Bacteria 2596
596 Ga0265325_10094888 3300031241 Bacteria 1467
597 Ga0265329_10000191 3300031242 Bacteria 31583
598 Ga0265329_10010007 3300031242 Bacteria 3506
599 Ga0265340_10004674 3300031247 Bacteria 7620
600 Ga0265340_10011027 3300031247 Bacteria 4818
601 Ga0265340_10014095 3300031247 Bacteria 4184
602 Ga0265340_10028336 3300031247 Bacteria 2818
603 Ga0265339_10001146 3300031249 Bacteria 19997
604 Ga0265339_10001171 3300031249 Bacteria 19815
605 Ga0265339_10010487 3300031249 Bacteria 5754
606 Ga0265339_10010510 3300031249 Bacteria 5749
607 Ga0265339_10013928 3300031249 Bacteria 4866
608 Ga0265339_10032033 3300031249 Bacteria 2967
609 Ga0265339_10052954 3300031249 Bacteria 2208
610 Ga0265339_10060633 3300031249 Bacteria 2039
611 Ga0265339_10082668 3300031249 Unclassified 1695
612 Ga0265331_10000192 3300031250 Bacteria 75526
613 Ga0265316_10000637 3300031344 Bacteria 39071
614 Ga0265316_10007744 3300031344 Bacteria 10064
615 Ga0265316_10010292 3300031344 Bacteria 8530
616 Ga0265316_10010346 3300031344 Bacteria 8507
617 Ga0265316_10011796 3300031344 Bacteria 7862
618 Ga0265316_10021272 3300031344 Bacteria 5499
619 Ga0265316_10039382 3300031344 Archaea 3796
620 Ga0265316_10050157 3300031344 Bacteria 3284
621 Ga0265316_10121064 3300031344 Bacteria 1976
622 Ga0265316_10132300 3300031344 Unclassified 1878
623 Ga0265316_10139972 3300031344 Bacteria 1818
624 Ga0307408_100019522 3300031548 Unclassified 4565
625 Ga0307408_100033771 3300031548 Bacteria 3577
626 Ga0307408_100222509 3300031548 Bacteria 1541
627 Ga0265313_10001060 3300031595 Bacteria 26699
628 Ga0265313_10004284 3300031595 Bacteria 11046
629 Ga0265313_10004287 3300031595 Bacteria 11043
630 Ga0265313_10014216 3300031595 Bacteria 4719
631 Ga0265313_10018175 3300031595 Bacteria 3959
632 Ga0265313_10054029 3300031595 Unclassified 1909
633 Ga0316579_10031757 3300031691 Bacteria 2419
634 Ga0265314_10000063 3300031711 Bacteria 159305
635 Ga0265314_10004281 3300031711 Bacteria 13345
636 Ga0265314_10005188 3300031711 Bacteria 11829
637 Ga0265314_10019331 3300031711 Bacteria 5279
638 Ga0265314_10079951 3300031711 Bacteria 2160
639 Ga0265314_10157913 3300031711 Unclassified 1383
640 Ga0265342_10000046 3300031712 Archaea 130926
641 Ga0265342_10000566 3300031712 Bacteria 39108
642 Ga0265342_10001150 3300031712 Bacteria 25234
643 Ga0265342_10001677 3300031712 Bacteria 20343
644 Ga0265342_10016834 3300031712 Bacteria 4766
645 Ga0265342_10058962 3300031712 Bacteria 2268
646 Ga0265342_10100849 3300031712 Bacteria 1644
647 Ga0316576_10056371 3300031727 Unclassified 2870
648 Ga0316576_10110042 3300031727 Unclassified 2065
649 Ga0307405_10027146 3300031731 Unclassified 3315
650 Ga0307405_10058848 3300031731 Bacteria 2420
651 Ga0307413_10008587 3300031824 Unclassified 4836
652 Ga0307413_10028482 3300031824 Bacteria 3112
653 Ga0307410_10020710 3300031852 Bacteria 4030
654 Ga0307410_10080258 3300031852 Bacteria 2288
655 Ga0307410_10200920 3300031852 Bacteria 1522
656 Ga0307406_10015879 3300031901 Unclassified 4366
657 Ga0307406_10032648 3300031901 Bacteria 3180
658 Ga0307407_10013586 3300031903 Unclassified 3958
659 Ga0307407_10159379 3300031903 Unclassified 1475
660 Ga0307412_10045049 3300031911 Bacteria 2881
661 Ga0307412_10051452 3300031911 Unclassified 2722
662 Ga0307409_100001000 3300031995 Bacteria 13232
663 Ga0307409_100039280 3300031995 Bacteria 3510
664 Ga0307416_100004875 3300032002 Bacteria 8171
665 Ga0307416_100070247 3300032002 Bacteria 2903
666 Ga0307416_100151987 3300032002 Unclassified 2125
667 Ga0307414_10054027 3300032004 Bacteria 2805
668 Ga0307414_10075652 3300032004 Unclassified 2444
669 Ga0307411_10004428 3300032005 Bacteria 6725
670 Ga0307411_10008588 3300032005 Bacteria 5304
671 Ga0307415_100000717 3300032126 Bacteria 14833
672 Ga0307415_100075843 3300032126 Bacteria 2381
673 Ga0307510_10024239 3300033180 Bacteria 7014
674 Ga0307510_10091011 3300033180 Bacteria 2895
675 Ga0373926_0003327 3300035083 Bacteria 5170
676 Ga0373926_0010705 3300035083 Bacteria 3077
677 Ga0373926_0046154 3300035083 Unclassified 1563
678 Ga0373926_0068325 3300035083 Bacteria 1302
679 Ga0373951_0051588 3300035091 Bacteria 1013
680 Ga0373923_0011760 3300035111 Bacteria 3221
681 Ga0373923_0039547 3300035111 Unclassified 1937
682 Ga0373936_0012750 3300035113 Bacteria 3202
683 Ga0373936_0015254 3300035113 Unclassified 2943
684 Ga0373936_0130329 3300035113 Bacteria 1080
685 Ga0373945_0002909 3300035116 Bacteria 5378
686 Ga0373954_0064741 3300035118 Bacteria 1729
687 Ga0373954_0115703 3300035118 Bacteria 1299
688 Ga0373954_0135955 3300035118 Bacteria 1198
689 Ga0373943_0005065 3300035170 Bacteria 5944
690 Ga0373946_0004512 3300035171 Bacteria 4988
691 Ga0373946_0044571 3300035171 Bacteria 1832
692 Ga0373946_0070731 3300035171 Unclassified 1506
693 Ga0373946_0083760 3300035171 Bacteria 1401
694 Ga0373955_0003383 3300035172 Bacteria 7012
695 Ga0373961_0010964 3300035241 Bacteria 2242
696 Ga0373924_0003556 3300035410 Bacteria 5366
697 Ga0373924_0032929 3300035410 Bacteria 2090
698 Ga0373935_0002525 3300035692 Bacteria 10489
699 Ga0373935_0013104 3300035692 Bacteria 4997
700 Ga0373935_0177597 3300035692 Unclassified 1460
701 Ga0373927_0004121 3300035695 Bacteria 10233
702 Ga0373927_0014400 3300035695 Bacteria 5236
703 Ga0373927_0019115 3300035695 Bacteria 4493
704 Ga0373933_0062995 3300035724 Bacteria 2241
705 Ga0373947_0008015 3300035725 Bacteria 6093
706 Ga0373947_0042749 3300035725 Unclassified 2705
707 Ga0373947_0045925 3300035725 Bacteria 2614
708 Ga0373947_0053647 3300035725 Unclassified 2431
709 Ga0373937_0000027 3300036401 Bacteria 123975
710 Ga0373937_0018796 3300036401 Bacteria 6178
711 Ga0373937_0081139 3300036401 Unclassified 3000
712 Ga0373937_0229379 3300036401 Bacteria 1749
713 Ga0373937_0256368 3300036401 Bacteria 1649
714 Ga0316584_0270706 3300036712 Unclassified 1236
715 Ga0373925_0005912 3300037068 Archaea 9076
716 Ga0373925_0012705 3300037068 Bacteria 6099
717 Ga0373925_0019564 3300037068 Bacteria 4926
718 Ga0373925_0027057 3300037068 Bacteria 4200
719 Ga0373925_0053177 3300037068 Bacteria 3026
720 Ga0373925_0055172 3300037068 Bacteria 2973
721 Ga0373925_0143742 3300037068 Bacteria 1869
722 Ga0395898_0014459 3300037466 Bacteria 8106
723 Ga0395905_0073057 3300037471 Bacteria 3215
724 Ga0395905_0109723 3300037471 Unclassified 2591
725 Ga0395905_0132846 3300037471 Unclassified 2341
726 Ga0395901_0391090 3300038443 Bacteria 1430
727 Ga0242420_007223 3300038996 Unclassified 1777
728 Ga0400489_60259 3300039093 Bacteria 1964
729 Ga0436361_0128003 3300039447 Bacteria 8766
730 Ga0436361_0798862 3300039447 Bacteria 2606
731 Ga0436361_1043667 3300039447 Bacteria 10285
732 Ga0436363_0117531 3300039450 Bacteria 2646
733 Ga0436363_1446693 3300039450 Unclassified 2348
734 Ga0436362_0169000 3300039453 Unclassified 1641
735 Ga0436362_0803045 3300039453 Bacteria 2152
736 Ga0451577_0000980 3300042876 Bacteria 41601
737 Ga0451577_0024043 3300042876 Bacteria 5547
738 Ga0451577_0069109 3300042876 Bacteria 3150
739 Ga0451577_0076721 3300042876 Bacteria 2979
740 Ga0451577_0085984 3300042876 Bacteria 2805
741 Ga0451577_0153210 3300042876 Archaea 2074
742 Ga0453683_0000448 3300044673 Bacteria 47323
743 Ga0453683_0009560 3300044673 Bacteria 6468
744 Ga0453683_0012738 3300044673 Bacteria 5505
745 Ga0453683_0017952 3300044673 Unclassified 4545
746 Ga0453683_0049163 3300044673 Bacteria 2644
747 Ga0453683_0256895 3300044673 Unclassified 1114
748 Ga0466966_0006756 3300044684 Bacteria 7596
749 Ga0466963_0004074 3300044694 Bacteria 8455
750 Ga0466963_0012206 3300044694 Bacteria 5253
751 Ga0453684_0000013 3300044712 Archaea 1034059
752 Ga0453684_0000290 3300044712 Archaea 215468
753 Ga0453684_0001875 3300044712 Bacteria 54679
754 Ga0453684_0003962 3300044712 Archaea 32375
755 Ga0453684_0005714 3300044712 Bacteria 24355
756 Ga0453684_0006656 3300044712 Bacteria 21822
757 Ga0453684_0010733 3300044712 Archaea 15561
758 Ga0453684_0013684 3300044712 Bacteria 13145
759 Ga0453684_0014791 3300044712 Bacteria 12436
760 Ga0453684_0017793 3300044712 Archaea 10968
761 Ga0453684_0018277 3300044712 Bacteria 10773
762 Ga0453684_0026428 3300044712 Archaea 8383
763 Ga0453684_0027657 3300044712 Bacteria 8122
764 Ga0453684_0032290 3300044712 Bacteria 7333
765 Ga0453684_0037563 3300044712 Bacteria 6646
766 Ga0453684_0054483 3300044712 Archaea 5209
767 Ga0453684_0074179 3300044712 Bacteria 4285
768 Ga0453684_0103137 3300044712 Archaea 3486
769 Ga0453684_0109595 3300044712 Archaea 3358
770 Ga0453684_0110411 3300044712 Bacteria 3342
771 Ga0453684_0124289 3300044712 Bacteria 3108
772 Ga0453684_0133166 3300044712 Unclassified 2980
773 Ga0453684_0167749 3300044712 Unclassified 2590
774 Ga0453684_0170072 3300044712 Bacteria 2569
775 Ga0453684_0171385 3300044712 Bacteria 2557
776 Ga0453684_0211257 3300044712 Unclassified 2255
777 Ga0453684_0226155 3300044712 Bacteria 2163
778 Ga0466970_0103284 3300044765 Bacteria 1553
779 Ga0466959_0006034 3300045049 Bacteria 8364
780 Ga0451576_0002465 3300045051 Bacteria 27543
781 Ga0451576_0028360 3300045051 Bacteria 5998
782 Ga0451576_0065326 3300045051 Bacteria 3789
783 Ga0451576_0145484 3300045051 Unclassified 2471
784 Ga0451576_0273915 3300045051 Bacteria 1764
785 Ga0495617_055962 3300046452 Bacteria 1308
786 Ga0495592_0007856 3300046454 Bacteria 7994
787 Ga0495592_0318709 3300046454 Unclassified 1005
788 Ga0495603_0000838 3300046455 Bacteria 17637
789 Ga0495629_0000010 3300046459 Bacteria 340114
790 Ga0495629_0000549 3300046459 Bacteria 30752
791 Ga0495629_0005512 3300046459 Bacteria 9445
792 Ga0495629_0008527 3300046459 Bacteria 7547
793 Ga0495629_0141762 3300046459 Bacteria 1672
794 Ga0495651_0000658 3300046462 Bacteria 26766
795 Ga0495651_0011762 3300046462 Bacteria 6726
796 Ga0495651_0021531 3300046462 Bacteria 5011
797 Ga0495651_0057297 3300046462 Unclassified 2991
798 Ga0495651_0089900 3300046462 Bacteria 2304
799 Ga0495653_0003436 3300046463 Bacteria 12740
800 Ga0495653_0006642 3300046463 Bacteria 9494
801 Ga0495653_0068710 3300046463 Bacteria 2657
802 Ga0495650_0000022 3300046471 Bacteria 530747
803 Ga0495650_0008987 3300046471 Bacteria 5745
804 Ga0495580_0001908 3300046472 Bacteria 18328
805 Ga0495580_0003312 3300046472 Bacteria 13776
806 Ga0495580_0031675 3300046472 Bacteria 3820
807 Ga0495580_0066817 3300046472 Bacteria 2516
808 Ga0495580_0097816 3300046472 Unclassified 2041
809 Ga0495582_0001438 3300046473 Archaea 13432
810 Ga0495582_0017581 3300046473 Bacteria 3912
811 Ga0495582_0048449 3300046473 Bacteria 2340
812 Ga0495582_0056162 3300046473 Bacteria 2170
813 Ga0495582_0147651 3300046473 Bacteria 1334
814 Ga0495639_0000249 3300046475 Bacteria 26734
815 Ga0495639_0001981 3300046475 Archaea 9065
816 Ga0495639_0026133 3300046475 Bacteria 2579
817 Ga0495662_0000291 3300046476 Bacteria 21682
818 Ga0495664_0002624 3300046477 Bacteria 9671
819 Ga0495664_0032560 3300046477 Unclassified 3060
820 Ga0495664_0037708 3300046477 Bacteria 2853
821 Ga0495664_0097179 3300046477 Bacteria 1772
822 Ga0495585_0067024 3300046492 Bacteria 1965
823 Ga0495594_0000436 3300046499 Bacteria 21014
824 Ga0495594_0000734 3300046499 Bacteria 16832
825 Ga0495594_0002977 3300046499 Bacteria 8781
826 Ga0495594_0067731 3300046499 Unclassified 1982
827 Ga0495594_0079980 3300046499 Unclassified 1825
828 Ga0495594_0132343 3300046499 Bacteria 1413
829 Ga0495606_0034364 3300046507 Bacteria 3482
830 Ga0495606_0106330 3300046507 Bacteria 1699
831 Ga0495608_0008806 3300046511 Bacteria 7061
832 Ga0495608_0037768 3300046511 Bacteria 3247
833 Ga0495608_0048209 3300046511 Bacteria 2831
834 Ga0495616_0123570 3300046513 Bacteria 1192
835 Ga0495618_0029659 3300046514 Unclassified 3413
836 Ga0495618_0264413 3300046514 Bacteria 1076
837 Ga0495628_0001512 3300046516 Bacteria 21320
838 Ga0495628_0009956 3300046516 Bacteria 8091
839 Ga0495628_0034751 3300046516 Bacteria 4053
840 Ga0495628_0068322 3300046516 Unclassified 2773
841 Ga0495628_0242059 3300046516 Bacteria 1349
842 Ga0495630_0003954 3300046517 Bacteria 10358
843 Ga0495630_0004124 3300046517 Bacteria 10180
844 Ga0495630_0012339 3300046517 Bacteria 6201
845 Ga0495630_0017612 3300046517 Bacteria 5236
846 Ga0495630_0026040 3300046517 Bacteria 4329
847 Ga0495644_0000029 3300046523 Bacteria 66705
848 Ga0495648_0128709 3300046524 Bacteria 1349
849 Ga0495666_0002504 3300046526 Bacteria 9119
850 Ga0495666_0005235 3300046526 Bacteria 6549
851 Ga0495666_0134939 3300046526 Eukaryota 1152
852 Ga0495642_0018911 3300046528 Bacteria 2697
853 Ga0495652_0030394 3300046529 Bacteria 4739
854 Ga0495652_0094030 3300046529 Bacteria 2446
855 Ga0495652_0135402 3300046529 Bacteria 1944
856 Ga0495652_0152458 3300046529 Archaea 1804
857 Ga0495665_0000484 3300046531 Bacteria 20010
858 Ga0495665_0004823 3300046531 Bacteria 7276
859 Ga0495665_0097205 3300046531 Bacteria 1546
860 Ga0495665_0148424 3300046531 Unclassified 1224
861 Ga0495640_0093476 3300046533 Bacteria 1981
862 Ga0495586_0001355 3300046535 Bacteria 13604
863 Ga0495586_0004223 3300046535 Bacteria 7695
864 Ga0495586_0009290 3300046535 Bacteria 5229
865 Ga0495586_0037530 3300046535 Bacteria 2601
866 Ga0495587_0016807 3300046536 Bacteria 4549
867 Ga0495587_0020882 3300046536 Bacteria 4039
868 Ga0495587_0022747 3300046536 Bacteria 3857
869 Ga0495587_0028962 3300046536 Bacteria 3364
870 Ga0495609_0009088 3300046538 Bacteria 4826
871 Ga0495645_0001181 3300046543 Bacteria 17818
872 Ga0495645_0013258 3300046543 Bacteria 5825
873 Ga0495645_0014496 3300046543 Bacteria 5594
874 Ga0495645_0036085 3300046543 Bacteria 3604
875 Ga0495645_0130900 3300046543 Bacteria 1758
876 Ga0495622_0010336 3300046557 Bacteria 4315
877 Ga0495667_0000793 3300046559 Bacteria 20322
878 Ga0495667_0000984 3300046559 Bacteria 18434
879 Ga0495667_0018030 3300046559 Bacteria 4768
880 Ga0495668_0039641 3300046616 Bacteria 2630
881 Ga0495634_0103632 3300046642 Bacteria 1836
882 Ga0495625_0001054 3300046660 Bacteria 36147
883 Ga0495625_0004927 3300046660 Bacteria 12418
884 Ga0495625_0005873 3300046660 Bacteria 11061
885 Ga0495635_0000717 3300046663 Bacteria 21406
886 Ga0495635_0028423 3300046663 Bacteria 3887
887 Ga0495635_0032572 3300046663 Bacteria 3616
888 Ga0495635_0078400 3300046663 Bacteria 2261
889 Ga0495635_0154029 3300046663 Bacteria 1565
890 Ga0495661_0043011 3300046665 Bacteria 2780
891 Ga0495657_0016262 3300046675 Bacteria 5423
892 Ga0495599_0004359 3300046678 Bacteria 8379
893 Ga0495623_0017932 3300046679 Bacteria 4574
894 Ga0495623_0045738 3300046679 Bacteria 2779
895 Ga0495623_0160585 3300046679 Bacteria 1321
896 Ga0495646_0021775 3300046680 Bacteria 4049
897 Ga0495646_0043322 3300046680 Bacteria 2756
898 Ga0495646_0052180 3300046680 Unclassified 2471
899 Ga0495658_0011831 3300046683 Archaea 4401
900 Ga0495658_0173154 3300046683 Bacteria 1337
901 Ga0495669_0001929 3300046684 Bacteria 8517
902 Ga0495669_0034699 3300046684 Unclassified 2224
903 Ga0495669_0060757 3300046684 Bacteria 1709
904 Ga0495613_0001436 3300046689 Bacteria 18186
905 Ga0495613_0039718 3300046689 Bacteria 3489
906 Ga0495613_0071294 3300046689 Bacteria 2533
907 Ga0495613_0142960 3300046689 Bacteria 1708
908 Ga0495624_0000779 3300046690 Bacteria 25125
909 Ga0495624_0055158 3300046690 Unclassified 2504
910 Ga0495624_0128111 3300046690 Bacteria 1557
911 Ga0495670_0022110 3300046691 Bacteria 3140
912 Ga0495600_0013097 3300046809 Bacteria 5204
913 Ga0495600_0021800 3300046809 Bacteria 4108
914 Ga0495600_0025304 3300046809 Bacteria 3825
915 Ga0495600_0032715 3300046809 Bacteria 3375
916 Ga0495600_0068140 3300046809 Bacteria 2325
917 Ga0495600_0117752 3300046809 Bacteria 1728
918 Ga0495581_0013657 3300047315 Bacteria 4709
919 Ga0495581_0032396 3300047315 Bacteria 3026
920 Ga0495581_0090742 3300047315 Bacteria 1772
921 Ga0495604_0000517 3300047317 Bacteria 33961
922 Ga0495604_0009578 3300047317 Bacteria 7661
923 Ga0495604_0041593 3300047317 Bacteria 3605
924 Ga0495604_0088006 3300047317 Unclassified 2312
925 Ga0495604_0134676 3300047317 Bacteria 1772
926 Ga0495604_0239794 3300047317 Bacteria 1240
927 Ga0495674_0002381 3300047319 Bacteria 18399
928 Ga0495674_0018431 3300047319 Bacteria 6498
929 Ga0495674_0022808 3300047319 Bacteria 5769
930 Ga0495674_0057923 3300047319 Bacteria 3389
931 Ga0495674_0156533 3300047319 Bacteria 1908
932 Ga0495672_0007773 3300047320 Bacteria 8017
933 Ga0495676_0015675 3300047321 Bacteria 6739
934 Ga0495676_0054425 3300047321 Archaea 3182
935 Ga0495676_0137024 3300047321 Bacteria 1759
936 Ga0495680_0001356 3300047322 Bacteria 26600
937 Ga0495680_0003859 3300047322 Bacteria 14516
938 Ga0495680_0004805 3300047322 Bacteria 12825
939 Ga0495680_0005651 3300047322 Bacteria 11714
940 Ga0495675_0000556 3300047444 Bacteria 24036
941 Ga0495675_0001775 3300047444 Bacteria 12859
942 Ga0495675_0004033 3300047444 Bacteria 8902
943 Ga0495675_0004321 3300047444 Bacteria 8596
944 Ga0495677_0020615 3300047445 Bacteria 2390
945 Ga0495684_0000847 3300047471 Bacteria 24711
946 Ga0495684_0002044 3300047471 Bacteria 16237
947 Ga0495684_0036168 3300047471 Bacteria 3787
948 Ga0495684_0048495 3300047471 Unclassified 3247
949 Ga0495684_0054816 3300047471 Bacteria 3041
950 Ga0495684_0104708 3300047471 Unclassified 2138
951 Ga0495686_0000921 3300047472 Bacteria 36769
952 Ga0495686_0006475 3300047472 Bacteria 8955
953 Ga0495686_0007402 3300047472 Bacteria 8235
954 Ga0495593_0022830 3300047673 Unclassified 3481
955 Ga0495593_0032721 3300047673 Bacteria 2833
956 Ga0495602_0052799 3300048088 Unclassified 3606
957 Ga0495614_0060705 3300048089 Unclassified 1624
958 Ga0495614_0178509 3300048089 Unclassified 955
959 Ga0496100_0007143 3300048903 Bacteria 6135
960 Ga0496100_0117485 3300048903 Bacteria 1857
961 Ga0496101_0269495 3300048904 Bacteria 1329
962 Ga0496102_0169648 3300048905 Bacteria 2054
963 Ga0496104_0037599 3300048907 Bacteria 4526
964 Ga0496104_0038068 3300048907 Bacteria 4499
965 Ga0496104_0065734 3300048907 Bacteria 3442
966 Ga0496104_0204983 3300048907 Bacteria 1884
967 Ga0496104_0245159 3300048907 Bacteria 1704
968 Ga0496105_0002243 3300048908 Bacteria 14004
969 Ga0496105_0004369 3300048908 Bacteria 10646
970 Ga0496105_0018968 3300048908 Bacteria 5542
971 Ga0496105_0221731 3300048908 Bacteria 1539
972 Ga0496106_0241077 3300048909 Bacteria 1445
973 Ga0496107_0048827 3300048910 Bacteria 3050
974 Ga0496107_0110738 3300048910 Bacteria 2018
975 Ga0496109_0240214 3300048912 Archaea 1705
976 Ga0496110_0366833 3300048913 Archaea 1312
977 Ga0496112_0006448 3300048915 Bacteria 10300
978 Ga0496112_0036921 3300048915 Bacteria 4767
979 Ga0496112_0069641 3300048915 Bacteria 3475
980 Ga0496112_0120789 3300048915 Unclassified 2590
981 Ga0496112_0152413 3300048915 Bacteria 2279
982 Ga0496113_0007620 3300048916 Bacteria 6983
983 Ga0496113_0159620 3300048916 Archaea 1782
984 Ga0496114_0085552 3300048917 Bacteria 2671
985 Ga0496114_0151174 3300048917 Bacteria 2014
986 Ga0496115_0049868 3300048918 Bacteria 3352
987 Ga0496115_0176175 3300048918 Bacteria 1768
988 Ga0496115_0224855 3300048918 Bacteria 1548
989 Ga0496116_0070732 3300048919 Bacteria 2213
990 Ga0496126_0000005 3300048929 Bacteria 891906
991 Ga0496126_0000010 3300048929 Bacteria 744888
992 Ga0496126_0001435 3300048929 Bacteria 37410
993 Ga0496126_0013795 3300048929 Bacteria 8194
994 Ga0496126_0103576 3300048929 Bacteria 2487
995 Ga0495682_0017494 3300049460 Bacteria 2705
996 Ga0501292_004648 3300049515 Bacteria 1887
997 Ga0501299_001928 3300049522 Bacteria 2801
998 Ga0501303_002650 3300049526 Bacteria 1394
999 Ga0501031_0003660 3300049568 Bacteria 9897
1000 Ga0501033_0027441 3300049570 Bacteria 4280
1001 Ga0501033_0038983 3300049570 Bacteria 3550
1002 Ga0501034_0008118 3300049571 Bacteria 11135
1003 Ga0501036_0001740 3300049572 Bacteria 16908
1004 Ga0501037_0057094 3300049573 Bacteria 2850
1005 Ga0501039_0164079 3300049575 Bacteria 1747
1006 Ga0501040_0085599 3300049576 Bacteria 2188
1007 Ga0501042_0061938 3300049578 Bacteria 2672
1008 Ga0501043_0002753 3300049579 Bacteria 14702
1009 Ga0501046_0000437 3300049580 Bacteria 41896
1010 Ga0501047_0000776 3300049581 Bacteria 33383
1011 Ga0501047_0009635 3300049581 Bacteria 9131
1012 Ga0501048_0063884 3300049582 Bacteria 2603
1013 Ga0501071_0043967 3300049587 Bacteria 3204
1014 Ga0501072_0039810 3300049588 Bacteria 3690
1015 Ga0501072_0071107 3300049588 Bacteria 2749
1016 Ga0501073_0000891 3300049589 Bacteria 21395
1017 Ga0501075_0012046 3300049591 Bacteria 6140
1018 Ga0501075_0191723 3300049591 Archaea 1559
1019 Ga0501075_0226064 3300049591 Bacteria 1427
1020 Ga0501076_0019283 3300049592 Bacteria 5211
1021 Ga0501077_0000408 3300049593 Bacteria 25947
1022 Ga0501234_024327 3300049707 Bacteria 970
1023 Ga0501080_0310988 3300049742 Archaea 1428
1024 Ga0501081_0025930 3300049743 Bacteria 3948
1025 Ga0501083_0051828 3300049744 Bacteria 2759
1026 Ga0501035_0075520 3300049822 Bacteria 2981
1027 Ga0501044_0025248 3300049823 Bacteria 6299
1028 Ga0501044_0043453 3300049823 Bacteria 4667
1029 Ga0501044_0062913 3300049823 Bacteria 3792
1030 nmdc:mga05p37_10176_c1 3300050507 Bacteria 11163
1031 nmdc:mga05p37_143694_c1 3300050507 Bacteria 2922
1032 nmdc:mga05p37_170830_c1 3300050507 Bacteria 2651
1033 nmdc:mga05p37_96413_c1 3300050507 Bacteria 3644
1034 nmdc:mga05p37_96535_c1 3300050507 Unclassified 3641
1035 nmdc:mga09592_261873_c1 3300050508 Bacteria 1500
1036 nmdc:mga09592_40233_c1 3300050508 Bacteria 3590
1037 nmdc:mga0qj67_83908_c1 3300050509 Bacteria 2554
1038 nmdc:mga06r32_156210_c1 3300050510 Bacteria 2262
1039 nmdc:mga06r32_213809_c1 3300050510 Bacteria 1916
1040 nmdc:mga08y16_279080_c1 3300050511 Bacteria 1724
1041 nmdc:mga08y16_413286_c1 3300050511 Bacteria 1379
1042 nmdc:mga0n895_76663_c1 3300050512 Bacteria 3324
1043 nmdc:mga0rr50_164718_c1 3300050513 Bacteria 1802
1044 nmdc:mga08x19_29023_c1 3300050514 Bacteria 3469
1045 nmdc:mga08x19_68665_c1 3300050514 Bacteria 2307
1046 nmdc:mga0a205_101094_c1 3300050515 Unclassified 2782
1047 nmdc:mga0a205_166408_c1 3300050515 Bacteria 2100
1048 Ga0495612_0005445 3300053078 Bacteria 5262
1049 Ga0495595_0092803 3300053084 Bacteria 1450
1050 Ga0495619_0068242 3300053085 Bacteria 2375
1051 Ga0500643_018194 3300053087 Bacteria 2336
1052 Ga0500651_0000003 3300053093 Bacteria 422045
1053 Ga0500595_000005 3300053119 Bacteria 340896
1054 Ga0500595_002307 3300053119 Bacteria 9546
1055 Ga0500595_016340 3300053119 Bacteria 2766
1056 Ga0500661_001353 3300055283 Bacteria 4573
1057 Ga0590071_000712 3300059421 Bacteria 9413
1058 Ga0590075_000427 3300059424 Bacteria 11426
1059 Ga0590077_001032 3300059426 Bacteria 6958
1060 Ga0501082_0218858 3300060353 Bacteria 1657
1061 Ga0501082_0233725 3300060353 Bacteria 1600
1062 Ga0466962_0060217 3300061719 Bacteria 1812

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035091 Ga0373951_0051588 Ga0373951_0051588_133_993 281
2 3300025938 Ga0207704_10287771 Ga0207704_102877711 282
3 3300025942 Ga0207689_10399215 Ga0207689_103992152 282
4 3300013307 Ga0157372_10012466 Ga0157372_100124667 283
5 3300035113 Ga0373936_0130329 Ga0373936_0130329_189_1067 283
6 3300013306 Ga0163162_10805186 Ga0163162_108051861 286
7 3300049707 Ga0501234_024327 Ga0501234_024327_60_935 288
8 3300025925 Ga0207650_10184065 Ga0207650_101840652 289
9 3300035118 Ga0373954_0115703 Ga0373954_0115703_271_1203 290
10 3300046454 Ga0495592_0318709 Ga0495592_0318709_46_978 290
11 3300046514 Ga0495618_0264413 Ga0495618_0264413_61_993 290
12 3300046536 Ga0495587_0028962 Ga0495587_0028962_24_956 290
13 3300048089 Ga0495614_0178509 Ga0495614_0178509_32_937 292
14 3300036401 Ga0373937_0256368 Ga0373937_0256368_727_1620 294
15 3300050511 nmdc:mga08y16_413286_c1 nmdc:mga08y16_413286_c1_17_910 294
16 3300009098 Ga0105245_10500063 Ga0105245_105000631 298
17 3300050507 nmdc:mga05p37_143694_c1 nmdc:mga05p37_143694_c1_26_973 312
18 3300031852 Ga0307410_10200920 Ga0307410_102009202 324
19 3300005330 Ga0070690_100003413 Ga0070690_1000034133 325
20 3300005544 Ga0070686_100005851 Ga0070686_1000058513 325
21 3300009177 Ga0105248_10141655 Ga0105248_101416554 325
22 3300013297 Ga0157378_10003643 Ga0157378_100036433 325
23 3300025918 Ga0207662_10004894 Ga0207662_100048942 325
24 3300025941 Ga0207711_10394804 Ga0207711_103948041 325
25 3300031344 Ga0265316_10050157 Ga0265316_100501573 329
26 3300053119 Ga0500595_002307 Ga0500595_002307_1029_2105 329
27 3300049515 Ga0501292_004648 Ga0501292_004648_395_1399 331
28 3300049522 Ga0501299_001928 Ga0501299_001928_110_1114 331
29 3300049526 Ga0501303_002650 Ga0501303_002650_315_1319 331
30 3300009177 Ga0105248_10000002 Ga0105248_10000002141 332
31 3300025941 Ga0207711_10000052 Ga0207711_100000527 332
32 3300038443 Ga0395901_0391090 Ga0395901_0391090_383_1408 332
33 3300048918 Ga0496115_0176175 Ga0496115_0176175_30_1076 332
34 3300050514 nmdc:mga08x19_68665_c1 nmdc:mga08x19_68665_c1_1057_2064 332
35 3300005366 Ga0070659_100001855 Ga0070659_10000185515 333
36 3300013296 Ga0157374_10022671 Ga0157374_100226713 333
37 3300014969 Ga0157376_10134661 Ga0157376_101346612 333
38 3300025932 Ga0207690_10001008 Ga0207690_100010089 333
39 3300025961 Ga0207712_10092152 Ga0207712_100921521 333
40 3300035083 Ga0373926_0068325 Ga0373926_0068325_138_1199 333
41 3300035111 Ga0373923_0039547 Ga0373923_0039547_391_1452 333
42 3300035118 Ga0373954_0135955 Ga0373954_0135955_86_1147 333
43 3300035692 Ga0373935_0002525 Ga0373935_0002525_467_1528 333
44 3300035695 Ga0373927_0014400 Ga0373927_0014400_3260_4321 333
45 3300035725 Ga0373947_0053647 Ga0373947_0053647_467_1528 333
46 3300036401 Ga0373937_0081139 Ga0373937_0081139_802_1863 333
47 3300037471 Ga0395905_0109723 Ga0395905_0109723_393_1409 333
48 3300046462 Ga0495651_0000658 Ga0495651_0000658_17621_18682 333
49 3300046462 Ga0495651_0021531 Ga0495651_0021531_1163_2224 333
50 3300046462 Ga0495651_0057297 Ga0495651_0057297_1122_2183 333
51 3300046463 Ga0495653_0006642 Ga0495653_0006642_4098_5159 333
52 3300046472 Ga0495580_0097816 Ga0495580_0097816_929_1990 333
53 3300046477 Ga0495664_0032560 Ga0495664_0032560_1200_2261 333
54 3300046511 Ga0495608_0008806 Ga0495608_0008806_2574_3635 333
55 3300046511 Ga0495608_0048209 Ga0495608_0048209_1550_2611 333
56 3300046514 Ga0495618_0029659 Ga0495618_0029659_491_1552 333
57 3300046516 Ga0495628_0009956 Ga0495628_0009956_4707_5768 333
58 3300046516 Ga0495628_0034751 Ga0495628_0034751_2716_3777 333
59 3300046516 Ga0495628_0068322 Ga0495628_0068322_783_1844 333
60 3300046517 Ga0495630_0012339 Ga0495630_0012339_730_1791 333
61 3300046517 Ga0495630_0017612 Ga0495630_0017612_508_1569 333
62 3300046517 Ga0495630_0026040 Ga0495630_0026040_1645_2706 333
63 3300046529 Ga0495652_0135402 Ga0495652_0135402_872_1933 333
64 3300046535 Ga0495586_0009290 Ga0495586_0009290_3234_4295 333
65 3300046535 Ga0495586_0037530 Ga0495586_0037530_531_1592 333
66 3300046536 Ga0495587_0016807 Ga0495587_0016807_449_1510 333
67 3300046543 Ga0495645_0014496 Ga0495645_0014496_3557_4618 333
68 3300046543 Ga0495645_0036085 Ga0495645_0036085_771_1832 333
69 3300046559 Ga0495667_0000793 Ga0495667_0000793_2737_3798 333
70 3300046559 Ga0495667_0000984 Ga0495667_0000984_9247_10308 333
71 3300046642 Ga0495634_0103632 Ga0495634_0103632_147_1208 333
72 3300046663 Ga0495635_0028423 Ga0495635_0028423_1256_2317 333
73 3300046663 Ga0495635_0154029 Ga0495635_0154029_135_1196 333
74 3300046675 Ga0495657_0016262 Ga0495657_0016262_3607_4668 333
75 3300046678 Ga0495599_0004359 Ga0495599_0004359_1643_2704 333
76 3300046680 Ga0495646_0021775 Ga0495646_0021775_2454_3515 333
77 3300046680 Ga0495646_0052180 Ga0495646_0052180_944_2005 333
78 3300046689 Ga0495613_0071294 Ga0495613_0071294_1187_2248 333
79 3300046690 Ga0495624_0055158 Ga0495624_0055158_197_1258 333
80 3300046809 Ga0495600_0013097 Ga0495600_0013097_3167_4228 333
81 3300046809 Ga0495600_0021800 Ga0495600_0021800_747_1808 333
82 3300047317 Ga0495604_0041593 Ga0495604_0041593_2147_3208 333
83 3300047317 Ga0495604_0088006 Ga0495604_0088006_339_1400 333
84 3300047317 Ga0495604_0134676 Ga0495604_0134676_636_1697 333
85 3300047319 Ga0495674_0018431 Ga0495674_0018431_859_1920 333
86 3300047319 Ga0495674_0022808 Ga0495674_0022808_1952_3013 333
87 3300047319 Ga0495674_0057923 Ga0495674_0057923_1822_2883 333
88 3300047321 Ga0495676_0137024 Ga0495676_0137024_320_1381 333
89 3300047322 Ga0495680_0001356 Ga0495680_0001356_22792_23853 333
90 3300047322 Ga0495680_0003859 Ga0495680_0003859_12478_13539 333
91 3300047444 Ga0495675_0000556 Ga0495675_0000556_7036_8097 333
92 3300047444 Ga0495675_0004321 Ga0495675_0004321_885_1946 333
93 3300047471 Ga0495684_0000847 Ga0495684_0000847_13868_14929 333
94 3300047471 Ga0495684_0048495 Ga0495684_0048495_1964_3025 333
95 3300047471 Ga0495684_0104708 Ga0495684_0104708_676_1737 333
96 3300047673 Ga0495593_0022830 Ga0495593_0022830_907_1968 333
97 3300048088 Ga0495602_0052799 Ga0495602_0052799_2398_3459 333
98 3300048089 Ga0495614_0060705 Ga0495614_0060705_78_1139 333
99 3300053078 Ga0495612_0005445 Ga0495612_0005445_966_2027 333
100 3300059421 Ga0590071_000712 Ga0590071_000712_5677_6720 333
101 3300059424 Ga0590075_000427 Ga0590075_000427_7661_8704 333
102 3300059426 Ga0590077_001032 Ga0590077_001032_2436_3479 333
103 3300005327 Ga0070658_10016381 Ga0070658_100163814 334
104 3300005366 Ga0070659_100007704 Ga0070659_1000077046 334
105 3300005539 Ga0068853_100004354 Ga0068853_1000043545 334
106 3300005563 Ga0068855_100042381 Ga0068855_1000423812 334
107 3300005563 Ga0068855_100042577 Ga0068855_1000425775 334
108 3300005563 Ga0068855_100339224 Ga0068855_1003392242 334
109 3300005834 Ga0068851_10060668 Ga0068851_100606683 334
110 3300025909 Ga0207705_10013354 Ga0207705_100133544 334
111 3300025909 Ga0207705_10060544 Ga0207705_100605442 334
112 3300025920 Ga0207649_10003594 Ga0207649_100035943 334
113 3300025924 Ga0207694_10003854 Ga0207694_100038545 334
114 3300025924 Ga0207694_10219392 Ga0207694_102193922 334
115 3300025932 Ga0207690_10153121 Ga0207690_101531212 334
116 3300025986 Ga0207658_10130957 Ga0207658_101309572 334
117 3300046452 Ga0495617_055962 Ga0495617_055962_18_1085 334
118 3300046513 Ga0495616_0123570 Ga0495616_0123570_25_1092 334
119 3300036712 Ga0316584_0270706 Ga0316584_0270706_118_1167 335
120 3300049587 Ga0501071_0043967 Ga0501071_0043967_1933_2952 335
121 3300031235 Ga0265330_10000146 Ga0265330_1000014612 336
122 3300031344 Ga0265316_10039382 Ga0265316_100393822 336
123 3300031712 Ga0265342_10000046 Ga0265342_1000004679 336
124 3300042876 Ga0451577_0153210 Ga0451577_0153210_673_1692 336
125 3300044712 Ga0453684_0000013 Ga0453684_0000013_338581_339600 336
126 3300044712 Ga0453684_0000290 Ga0453684_0000290_111318_112337 336
127 3300044712 Ga0453684_0003962 Ga0453684_0003962_27706_28725 336
128 3300044712 Ga0453684_0010733 Ga0453684_0010733_814_1833 336
129 3300044712 Ga0453684_0017793 Ga0453684_0017793_1916_2935 336
130 3300044712 Ga0453684_0026428 Ga0453684_0026428_5844_6863 336
131 3300044712 Ga0453684_0054483 Ga0453684_0054483_1513_2532 336
132 3300044712 Ga0453684_0103137 Ga0453684_0103137_23_1042 336
133 3300044712 Ga0453684_0109595 Ga0453684_0109595_887_1903 336
134 3300028558 Ga0265326_10028802 Ga0265326_100288022 337
135 3300005333 Ga0070677_10002326 Ga0070677_100023262 339
136 3300005467 Ga0070706_100000509 Ga0070706_1000005098 339
137 3300005564 Ga0070664_100115697 Ga0070664_1001156972 339
138 3300006028 Ga0070717_10003518 Ga0070717_1000351812 339
139 3300025910 Ga0207684_10000753 Ga0207684_100007538 339
140 3300025945 Ga0207679_10049038 Ga0207679_100490382 339
141 3300028800 Ga0265338_10012926 Ga0265338_1001292610 339
142 3300031239 Ga0265328_10004527 Ga0265328_100045277 339
143 3300031241 Ga0265325_10094888 Ga0265325_100948881 339
144 3300031249 Ga0265339_10010487 Ga0265339_100104873 339
145 3300031344 Ga0265316_10021272 Ga0265316_100212727 339
146 3300031711 Ga0265314_10005188 Ga0265314_1000518811 339
147 3300031712 Ga0265342_10016834 Ga0265342_100168345 339
148 3300046473 Ga0495582_0048449 Ga0495582_0048449_1006_2106 340
149 3300013297 Ga0157378_10005072 Ga0157378_100050729 341
150 3300048907 Ga0496104_0204983 Ga0496104_0204983_56_1156 341
151 3300005354 Ga0070675_100207461 Ga0070675_1002074612 342
152 3300005617 Ga0068859_100290861 Ga0068859_1002908612 342
153 3300006931 Ga0097620_100290839 Ga0097620_1002908392 342
154 3300025913 Ga0207695_10099597 Ga0207695_100995971 342
155 3300044694 Ga0466963_0012206 Ga0466963_0012206_1525_2580 342
156 3300046499 Ga0495594_0079980 Ga0495594_0079980_715_1755 343
157 iso_pu_bacteria 2884215851 2884218013 343
158 3300005614 Ga0068856_100293219 Ga0068856_1002932192 344
159 3300013307 Ga0157372_10052443 Ga0157372_100524432 344
160 3300031691 Ga0316579_10031757 Ga0316579_100317572 344
161 3300031712 Ga0265342_10058962 Ga0265342_100589622 344
162 3300031727 Ga0316576_10110042 Ga0316576_101100422 344
163 3300035171 Ga0373946_0044571 Ga0373946_0044571_238_1305 344
164 3300037068 Ga0373925_0005912 Ga0373925_0005912_5470_6537 344
165 3300039447 Ga0436361_0128003 Ga0436361_0128003_5733_6794 344
166 3300039447 Ga0436361_0798862 Ga0436361_0798862_193_1254 344
167 3300039447 Ga0436361_1043667 Ga0436361_1043667_3308_4369 344
168 3300039453 Ga0436362_0169000 Ga0436362_0169000_36_1097 344
169 3300046459 Ga0495629_0000010 Ga0495629_0000010_211520_212596 344
170 3300046463 Ga0495653_0068710 Ga0495653_0068710_361_1416 344
171 3300046475 Ga0495639_0001981 Ga0495639_0001981_5263_6330 344
172 3300046526 Ga0495666_0002504 Ga0495666_0002504_1773_2840 344
173 3300046535 Ga0495586_0001355 Ga0495586_0001355_7215_8282 344
174 3300046557 Ga0495622_0010336 Ga0495622_0010336_2646_3713 344
175 3300046663 Ga0495635_0000717 Ga0495635_0000717_7238_8293 344
176 3300046683 Ga0495658_0011831 Ga0495658_0011831_2068_3135 344
177 3300046690 Ga0495624_0128111 Ga0495624_0128111_246_1301 344
178 3300046809 Ga0495600_0025304 Ga0495600_0025304_1981_3036 344
179 3300047321 Ga0495676_0054425 Ga0495676_0054425_395_1462 344
180 3300047322 Ga0495680_0004805 Ga0495680_0004805_8192_9247 344
181 3300047471 Ga0495684_0036168 Ga0495684_0036168_1812_2867 344
182 3300053085 Ga0495619_0068242 Ga0495619_0068242_299_1354 344
183 3300003203 JGI25406J46586_10005411 JGI25406J46586_100054113 345
184 3300005468 Ga0070707_100021182 Ga0070707_1000211821 345
185 3300005545 Ga0070695_100281244 Ga0070695_1002812441 345
186 3300005577 Ga0068857_100099984 Ga0068857_1000999842 345
187 3300005617 Ga0068859_100057196 Ga0068859_1000571962 345
188 3300005985 Ga0081539_10001697 Ga0081539_1000169725 345
189 3300006852 Ga0075433_10042358 Ga0075433_100423585 345
190 3300006931 Ga0097620_100057194 Ga0097620_1000571942 345
191 3300009147 Ga0114129_10010664 Ga0114129_1001066411 345
192 3300009176 Ga0105242_10246326 Ga0105242_102463262 345
193 3300009551 Ga0105238_10369686 Ga0105238_103696862 345
194 3300010375 Ga0105239_10145102 Ga0105239_101451021 345
195 3300013297 Ga0157378_10086042 Ga0157378_100860423 345
196 3300014969 Ga0157376_10022346 Ga0157376_100223463 345
197 3300025914 Ga0207671_10159164 Ga0207671_101591642 345
198 3300025935 Ga0207709_10046486 Ga0207709_100464862 345
199 3300026116 Ga0207674_10117887 Ga0207674_101178872 345
200 3300028380 Ga0268265_10240959 Ga0268265_102409591 345
201 3300028666 Ga0265336_10000499 Ga0265336_100004998 345
202 3300031548 Ga0307408_100222509 Ga0307408_1002225091 345
203 3300031852 Ga0307410_10080258 Ga0307410_100802582 345
204 3300031911 Ga0307412_10045049 Ga0307412_100450492 345
205 3300032004 Ga0307414_10054027 Ga0307414_100540272 345
206 3300037471 Ga0395905_0132846 Ga0395905_0132846_506_1558 345
207 3300038996 Ga0242420_007223 Ga0242420_007223_80_1126 345
208 3300044673 Ga0453683_0017952 Ga0453683_0017952_308_1363 345
209 3300044673 Ga0453683_0256895 Ga0453683_0256895_16_1062 345
210 3300044712 Ga0453684_0074179 Ga0453684_0074179_920_1975 345
211 3300044712 Ga0453684_0133166 Ga0453684_0133166_1053_2108 345
212 3300044712 Ga0453684_0167749 Ga0453684_0167749_292_1347 345
213 3300045051 Ga0451576_0065326 Ga0451576_0065326_741_1796 345
214 3300048905 Ga0496102_0169648 Ga0496102_0169648_944_1990 345
215 3300048909 Ga0496106_0241077 Ga0496106_0241077_47_1093 345
216 3300048929 Ga0496126_0103576 Ga0496126_0103576_519_1583 345
217 3300050515 nmdc:mga0a205_166408_c1 nmdc:mga0a205_166408_c1_722_1768 345
218 iso_pu_bacteria 2818991459 2819670947 345
219 iso_pu_bacteria 2904113452 2904114493 345
220 3300005329 Ga0070683_100008501 Ga0070683_1000085019 346
221 3300005329 Ga0070683_100011715 Ga0070683_1000117156 346
222 3300005331 Ga0070670_100001371 Ga0070670_10000137110 346
223 3300005331 Ga0070670_100371546 Ga0070670_1003715461 346
224 3300005334 Ga0068869_100000150 Ga0068869_10000015027 346
225 3300005335 Ga0070666_10054200 Ga0070666_100542002 346
226 3300005335 Ga0070666_10077700 Ga0070666_100777001 346
227 3300005336 Ga0070680_100012003 Ga0070680_1000120033 346
228 3300005338 Ga0068868_100001048 Ga0068868_10000104817 346
229 3300005338 Ga0068868_100002969 Ga0068868_1000029697 346
230 3300005338 Ga0068868_100346532 Ga0068868_1003465321 346
231 3300005339 Ga0070660_100010244 Ga0070660_1000102447 346
232 3300005340 Ga0070689_100342525 Ga0070689_1003425251 346
233 3300005344 Ga0070661_100016773 Ga0070661_1000167732 346
234 3300005344 Ga0070661_100026896 Ga0070661_1000268963 346
235 3300005347 Ga0070668_100069089 Ga0070668_1000690892 346
236 3300005354 Ga0070675_100009318 Ga0070675_1000093185 346
237 3300005355 Ga0070671_100006131 Ga0070671_1000061317 346
238 3300005355 Ga0070671_100021203 Ga0070671_1000212032 346
239 3300005355 Ga0070671_100032834 Ga0070671_1000328343 346
240 3300005364 Ga0070673_100027927 Ga0070673_1000279271 346
241 3300005366 Ga0070659_100321695 Ga0070659_1003216951 346
242 3300005367 Ga0070667_100007254 Ga0070667_1000072546 346
243 3300005367 Ga0070667_100028591 Ga0070667_1000285912 346
244 3300005435 Ga0070714_100012873 Ga0070714_1000128733 346
245 3300005435 Ga0070714_100057585 Ga0070714_1000575854 346
246 3300005436 Ga0070713_100067642 Ga0070713_1000676423 346
247 3300005457 Ga0070662_100038077 Ga0070662_1000380773 346
248 3300005458 Ga0070681_10173043 Ga0070681_101730432 346
249 3300005530 Ga0070679_100010655 Ga0070679_1000106558 346
250 3300005530 Ga0070679_100049509 Ga0070679_1000495092 346
251 3300005530 Ga0070679_100491511 Ga0070679_1004915111 346
252 3300005535 Ga0070684_100000615 Ga0070684_1000006159 346
253 3300005535 Ga0070684_100005285 Ga0070684_10000528510 346
254 3300005535 Ga0070684_100030864 Ga0070684_1000308642 346
255 3300005539 Ga0068853_100000021 Ga0068853_10000002144 346
256 3300005539 Ga0068853_100000530 Ga0068853_10000053021 346
257 3300005543 Ga0070672_100022363 Ga0070672_1000223632 346
258 3300005545 Ga0070695_100101656 Ga0070695_1001016562 346
259 3300005547 Ga0070693_100084193 Ga0070693_1000841932 346
260 3300005548 Ga0070665_100003253 Ga0070665_10000325319 346
261 3300005548 Ga0070665_100203379 Ga0070665_1002033792 346
262 3300005563 Ga0068855_100003888 Ga0068855_1000038882 346
263 3300005563 Ga0068855_100004226 Ga0068855_1000042267 346
264 3300005563 Ga0068855_100024264 Ga0068855_1000242645 346
265 3300005577 Ga0068857_100000546 Ga0068857_10000054617 346
266 3300005577 Ga0068857_100362345 Ga0068857_1003623451 346
267 3300005578 Ga0068854_100000058 Ga0068854_10000005832 346
268 3300005614 Ga0068856_100011402 Ga0068856_1000114022 346
269 3300005614 Ga0068856_100031462 Ga0068856_1000314625 346
270 3300005614 Ga0068856_100035677 Ga0068856_1000356772 346
271 3300005614 Ga0068856_100045450 Ga0068856_1000454502 346
272 3300005616 Ga0068852_100000015 Ga0068852_100000015102 346
273 3300005616 Ga0068852_100001731 Ga0068852_10000173114 346
274 3300005616 Ga0068852_100140064 Ga0068852_1001400642 346
275 3300005616 Ga0068852_100191105 Ga0068852_1001911052 346
276 3300005617 Ga0068859_100008509 Ga0068859_1000085092 346
277 3300005618 Ga0068864_100000358 Ga0068864_10000035817 346
278 3300005834 Ga0068851_10087750 Ga0068851_100877502 346
279 3300005840 Ga0068870_10059368 Ga0068870_100593681 346
280 3300005841 Ga0068863_100002705 Ga0068863_1000027055 346
281 3300005842 Ga0068858_100001959 Ga0068858_10000195921 346
282 3300005843 Ga0068860_100000809 Ga0068860_10000080931 346
283 3300005843 Ga0068860_100069366 Ga0068860_1000693662 346
284 3300005844 Ga0068862_100050254 Ga0068862_1000502542 346
285 3300005983 Ga0081540_1017614 Ga0081540_10176142 346
286 3300006237 Ga0097621_100022382 Ga0097621_1000223824 346
287 3300006237 Ga0097621_100098149 Ga0097621_1000981491 346
288 3300006358 Ga0068871_100003433 Ga0068871_10000343310 346
289 3300006358 Ga0068871_100022353 Ga0068871_1000223534 346
290 3300006844 Ga0075428_100026112 Ga0075428_1000261124 346
291 3300006847 Ga0075431_100205288 Ga0075431_1002052882 346
292 3300006881 Ga0068865_100054418 Ga0068865_1000544182 346
293 3300006914 Ga0075436_100016127 Ga0075436_1000161273 346
294 3300006931 Ga0097620_100008509 Ga0097620_1000085092 346
295 3300009093 Ga0105240_10000181 Ga0105240_1000018190 346
296 3300009093 Ga0105240_10000296 Ga0105240_1000029680 346
297 3300009093 Ga0105240_10001490 Ga0105240_1000149014 346
298 3300009093 Ga0105240_10001725 Ga0105240_1000172519 346
299 3300009093 Ga0105240_10022759 Ga0105240_100227593 346
300 3300009093 Ga0105240_10028160 Ga0105240_100281605 346
301 3300009093 Ga0105240_10039789 Ga0105240_100397896 346
302 3300009093 Ga0105240_10216876 Ga0105240_102168762 346
303 3300009098 Ga0105245_10000670 Ga0105245_1000067017 346
304 3300009098 Ga0105245_10004060 Ga0105245_100040607 346
305 3300009098 Ga0105245_10031511 Ga0105245_100315113 346
306 3300009098 Ga0105245_10078822 Ga0105245_100788223 346
307 3300009101 Ga0105247_10001310 Ga0105247_100013109 346
308 3300009147 Ga0114129_10121493 Ga0114129_101214932 346
309 3300009174 Ga0105241_10000076 Ga0105241_1000007632 346
310 3300009174 Ga0105241_10000890 Ga0105241_1000089016 346
311 3300009174 Ga0105241_10005735 Ga0105241_100057357 346
312 3300009174 Ga0105241_10007208 Ga0105241_100072086 346
313 3300009174 Ga0105241_10012112 Ga0105241_100121124 346
314 3300009176 Ga0105242_10429211 Ga0105242_104292111 346
315 3300009177 Ga0105248_10000574 Ga0105248_1000057414 346
316 3300009177 Ga0105248_10070263 Ga0105248_100702635 346
317 3300009177 Ga0105248_10119919 Ga0105248_101199192 346
318 3300009545 Ga0105237_10002962 Ga0105237_1000296213 346
319 3300009545 Ga0105237_10022210 Ga0105237_100222102 346
320 3300009545 Ga0105237_10029937 Ga0105237_100299372 346
321 3300009545 Ga0105237_10060993 Ga0105237_100609932 346
322 3300009551 Ga0105238_10000673 Ga0105238_1000067311 346
323 3300009551 Ga0105238_10001732 Ga0105238_1000173212 346
324 3300009551 Ga0105238_10022478 Ga0105238_100224782 346
325 3300009551 Ga0105238_10022964 Ga0105238_100229644 346
326 3300009551 Ga0105238_10099100 Ga0105238_100991002 346
327 3300009551 Ga0105238_10215227 Ga0105238_102152272 346
328 3300009553 Ga0105249_10011428 Ga0105249_100114286 346
329 3300009553 Ga0105249_10015336 Ga0105249_100153362 346
330 3300009553 Ga0105249_10465252 Ga0105249_104652522 346
331 3300010375 Ga0105239_10001562 Ga0105239_100015628 346
332 3300010375 Ga0105239_10013626 Ga0105239_100136261 346
333 3300010375 Ga0105239_10021901 Ga0105239_100219012 346
334 3300010375 Ga0105239_10094557 Ga0105239_100945572 346
335 3300010375 Ga0105239_10411336 Ga0105239_104113362 346
336 3300010375 Ga0105239_10506485 Ga0105239_105064851 346
337 3300011119 Ga0105246_10001037 Ga0105246_100010377 346
338 3300011119 Ga0105246_10191974 Ga0105246_101919741 346
339 3300013100 Ga0157373_10139606 Ga0157373_101396061 346
340 3300013102 Ga0157371_10137500 Ga0157371_101375002 346
341 3300013104 Ga0157370_10000196 Ga0157370_1000019629 346
342 3300013104 Ga0157370_10047985 Ga0157370_100479852 346
343 3300013104 Ga0157370_10052297 Ga0157370_100522972 346
344 3300013104 Ga0157370_10107455 Ga0157370_101074553 346
345 3300013105 Ga0157369_10000400 Ga0157369_1000040026 346
346 3300013105 Ga0157369_10001946 Ga0157369_1000194617 346
347 3300013105 Ga0157369_10008244 Ga0157369_100082443 346
348 3300013105 Ga0157369_10021594 Ga0157369_100215946 346
349 3300013105 Ga0157369_10024835 Ga0157369_100248352 346
350 3300013105 Ga0157369_10123307 Ga0157369_101233072 346
351 3300013105 Ga0157369_10166600 Ga0157369_101666002 346
352 3300013296 Ga0157374_10016113 Ga0157374_100161132 346
353 3300013296 Ga0157374_10092541 Ga0157374_100925411 346
354 3300013296 Ga0157374_10488768 Ga0157374_104887681 346
355 3300013297 Ga0157378_10001503 Ga0157378_100015039 346
356 3300013297 Ga0157378_10012305 Ga0157378_100123057 346
357 3300013297 Ga0157378_10018918 Ga0157378_100189182 346
358 3300013297 Ga0157378_10026512 Ga0157378_100265124 346
359 3300013307 Ga0157372_10000197 Ga0157372_1000019730 346
360 3300013307 Ga0157372_10012396 Ga0157372_100123966 346
361 3300013307 Ga0157372_10029231 Ga0157372_100292316 346
362 3300013307 Ga0157372_10030411 Ga0157372_100304114 346
363 3300013307 Ga0157372_10064140 Ga0157372_100641402 346
364 3300013307 Ga0157372_10144707 Ga0157372_101447072 346
365 3300013308 Ga0157375_10002008 Ga0157375_100020082 346
366 3300013308 Ga0157375_10018165 Ga0157375_100181651 346
367 3300013308 Ga0157375_10111913 Ga0157375_101119132 346
368 3300013308 Ga0157375_10128474 Ga0157375_101284742 346
369 3300014325 Ga0163163_10001119 Ga0163163_100011199 346
370 3300014968 Ga0157379_10000092 Ga0157379_1000009233 346
371 3300014969 Ga0157376_10000566 Ga0157376_100005668 346
372 3300014969 Ga0157376_10008715 Ga0157376_100087155 346
373 3300017792 Ga0163161_10012559 Ga0163161_100125592 346
374 3300025261 Ga0209233_1010497 Ga0209233_10104972 346
375 3300025900 Ga0207710_10000400 Ga0207710_100004008 346
376 3300025907 Ga0207645_10005089 Ga0207645_100050897 346
377 3300025911 Ga0207654_10000025 Ga0207654_1000002564 346
378 3300025911 Ga0207654_10000035 Ga0207654_1000003537 346
379 3300025911 Ga0207654_10000242 Ga0207654_100002428 346
380 3300025912 Ga0207707_10127945 Ga0207707_101279452 346
381 3300025913 Ga0207695_10000069 Ga0207695_10000069246 346
382 3300025913 Ga0207695_10000119 Ga0207695_10000119199 346
383 3300025913 Ga0207695_10000314 Ga0207695_1000031433 346
384 3300025913 Ga0207695_10003396 Ga0207695_1000339611 346
385 3300025913 Ga0207695_10020092 Ga0207695_100200926 346
386 3300025913 Ga0207695_10037096 Ga0207695_100370962 346
387 3300025913 Ga0207695_10125045 Ga0207695_101250452 346
388 3300025914 Ga0207671_10000246 Ga0207671_1000024660 346
389 3300025914 Ga0207671_10008661 Ga0207671_100086617 346
390 3300025915 Ga0207693_10123049 Ga0207693_101230492 346
391 3300025919 Ga0207657_10064675 Ga0207657_100646751 346
392 3300025920 Ga0207649_10159724 Ga0207649_101597242 346
393 3300025921 Ga0207652_10015042 Ga0207652_100150425 346
394 3300025921 Ga0207652_10195644 Ga0207652_101956441 346
395 3300025923 Ga0207681_10018127 Ga0207681_100181273 346
396 3300025924 Ga0207694_10000445 Ga0207694_1000044522 346
397 3300025924 Ga0207694_10001160 Ga0207694_1000116021 346
398 3300025924 Ga0207694_10002398 Ga0207694_100023987 346
399 3300025925 Ga0207650_10001580 Ga0207650_100015808 346
400 3300025926 Ga0207659_10060591 Ga0207659_100605911 346
401 3300025927 Ga0207687_10003918 Ga0207687_100039186 346
402 3300025929 Ga0207664_10024226 Ga0207664_100242261 346
403 3300025931 Ga0207644_10050679 Ga0207644_100506793 346
404 3300025931 Ga0207644_10058042 Ga0207644_100580421 346
405 3300025933 Ga0207706_10003990 Ga0207706_100039907 346
406 3300025933 Ga0207706_10095763 Ga0207706_100957633 346
407 3300025936 Ga0207670_10100535 Ga0207670_101005352 346
408 3300025940 Ga0207691_10029746 Ga0207691_100297462 346
409 3300025941 Ga0207711_10003126 Ga0207711_100031269 346
410 3300025941 Ga0207711_10042974 Ga0207711_100429741 346
411 3300025942 Ga0207689_10000553 Ga0207689_1000055317 346
412 3300025944 Ga0207661_10014141 Ga0207661_100141412 346
413 3300025944 Ga0207661_10030419 Ga0207661_100304192 346
414 3300025945 Ga0207679_10311406 Ga0207679_103114062 346
415 3300025949 Ga0207667_10003942 Ga0207667_100039422 346
416 3300025949 Ga0207667_10019979 Ga0207667_100199797 346
417 3300025949 Ga0207667_10069425 Ga0207667_100694252 346
418 3300025949 Ga0207667_10098007 Ga0207667_100980072 346
419 3300025949 Ga0207667_10118488 Ga0207667_101184882 346
420 3300025961 Ga0207712_10014311 Ga0207712_100143115 346
421 3300025961 Ga0207712_10026055 Ga0207712_100260553 346
422 3300025961 Ga0207712_10047310 Ga0207712_100473102 346
423 3300025981 Ga0207640_10000013 Ga0207640_1000001329 346
424 3300025986 Ga0207658_10004414 Ga0207658_100044142 346
425 3300025986 Ga0207658_10025828 Ga0207658_100258281 346
426 3300026023 Ga0207677_10000104 Ga0207677_1000010434 346
427 3300026035 Ga0207703_10001534 Ga0207703_100015345 346
428 3300026035 Ga0207703_10171370 Ga0207703_101713702 346
429 3300026041 Ga0207639_10000035 Ga0207639_1000003541 346
430 3300026041 Ga0207639_10008007 Ga0207639_100080076 346
431 3300026041 Ga0207639_10018657 Ga0207639_100186573 346
432 3300026041 Ga0207639_10106525 Ga0207639_101065252 346
433 3300026067 Ga0207678_10030577 Ga0207678_100305774 346
434 3300026075 Ga0207708_10026844 Ga0207708_100268443 346
435 3300026078 Ga0207702_10000633 Ga0207702_100006337 346
436 3300026078 Ga0207702_10032353 Ga0207702_100323532 346
437 3300026078 Ga0207702_10043748 Ga0207702_100437483 346
438 3300026088 Ga0207641_10151279 Ga0207641_101512792 346
439 3300026095 Ga0207676_10005714 Ga0207676_100057148 346
440 3300026116 Ga0207674_10001288 Ga0207674_1000128825 346
441 3300026118 Ga0207675_100034162 Ga0207675_1000341625 346
442 3300026121 Ga0207683_10000600 Ga0207683_100006005 346
443 3300026142 Ga0207698_10000006 Ga0207698_1000000629 346
444 3300026142 Ga0207698_10092021 Ga0207698_100920212 346
445 3300028379 Ga0268266_10018533 Ga0268266_100185333 346
446 3300028380 Ga0268265_10041347 Ga0268265_100413472 346
447 3300028380 Ga0268265_10123169 Ga0268265_101231692 346
448 3300028380 Ga0268265_10316621 Ga0268265_103166212 346
449 3300028381 Ga0268264_10000877 Ga0268264_1000087727 346
450 3300028381 Ga0268264_10142864 Ga0268264_101428641 346
451 3300028577 Ga0265318_10021651 Ga0265318_100216512 346
452 3300028577 Ga0265318_10067317 Ga0265318_100673171 346
453 3300028800 Ga0265338_10036504 Ga0265338_100365042 346
454 3300031235 Ga0265330_10000326 Ga0265330_1000032614 346
455 3300031235 Ga0265330_10001479 Ga0265330_100014793 346
456 3300031235 Ga0265330_10061853 Ga0265330_100618531 346
457 3300031238 Ga0265332_10033129 Ga0265332_100331292 346
458 3300031239 Ga0265328_10022033 Ga0265328_100220332 346
459 3300031241 Ga0265325_10000499 Ga0265325_100004998 346
460 3300031241 Ga0265325_10001354 Ga0265325_100013542 346
461 3300031241 Ga0265325_10036674 Ga0265325_100366742 346
462 3300031242 Ga0265329_10010007 Ga0265329_100100073 346
463 3300031247 Ga0265340_10011027 Ga0265340_100110273 346
464 3300031247 Ga0265340_10014095 Ga0265340_100140952 346
465 3300031247 Ga0265340_10028336 Ga0265340_100283363 346
466 3300031249 Ga0265339_10001146 Ga0265339_100011467 346
467 3300031249 Ga0265339_10010510 Ga0265339_100105104 346
468 3300031249 Ga0265339_10013928 Ga0265339_100139284 346
469 3300031249 Ga0265339_10052954 Ga0265339_100529542 346
470 3300031249 Ga0265339_10060633 Ga0265339_100606332 346
471 3300031344 Ga0265316_10010292 Ga0265316_100102923 346
472 3300031344 Ga0265316_10010346 Ga0265316_100103465 346
473 3300031344 Ga0265316_10011796 Ga0265316_100117963 346
474 3300031344 Ga0265316_10121064 Ga0265316_101210642 346
475 3300031344 Ga0265316_10139972 Ga0265316_101399722 346
476 3300031595 Ga0265313_10001060 Ga0265313_1000106014 346
477 3300031595 Ga0265313_10004287 Ga0265313_100042874 346
478 3300031595 Ga0265313_10014216 Ga0265313_100142162 346
479 3300031595 Ga0265313_10018175 Ga0265313_100181752 346
480 3300031711 Ga0265314_10000063 Ga0265314_1000006363 346
481 3300031711 Ga0265314_10019331 Ga0265314_100193311 346
482 3300031711 Ga0265314_10079951 Ga0265314_100799512 346
483 3300031711 Ga0265314_10157913 Ga0265314_101579131 346
484 3300031712 Ga0265342_10001150 Ga0265342_100011509 346
485 3300031712 Ga0265342_10100849 Ga0265342_101008492 346
486 3300035118 Ga0373954_0064741 Ga0373954_0064741_15_1115 346
487 3300036401 Ga0373937_0229379 Ga0373937_0229379_582_1682 346
488 3300037471 Ga0395905_0073057 Ga0395905_0073057_1241_2299 346
489 3300039093 Ga0400489_60259 Ga0400489_60259_624_1670 346
490 3300044694 Ga0466963_0004074 Ga0466963_0004074_7302_8432 346
491 3300044712 Ga0453684_0013684 Ga0453684_0013684_9944_11002 346
492 3300044712 Ga0453684_0014791 Ga0453684_0014791_1714_2772 346
493 3300045049 Ga0466959_0006034 Ga0466959_0006034_1604_2653 346
494 3300045051 Ga0451576_0273915 Ga0451576_0273915_130_1188 346
495 3300046459 Ga0495629_0005512 Ga0495629_0005512_7787_8944 346
496 3300046459 Ga0495629_0141762 Ga0495629_0141762_465_1553 346
497 3300046529 Ga0495652_0030394 Ga0495652_0030394_1428_2585 346
498 3300046536 Ga0495587_0020882 Ga0495587_0020882_2259_3416 346
499 3300046543 Ga0495645_0013258 Ga0495645_0013258_2710_3867 346
500 3300046543 Ga0495645_0130900 Ga0495645_0130900_237_1364 346
501 3300046689 Ga0495613_0039718 Ga0495613_0039718_2150_3238 346
502 3300047471 Ga0495684_0054816 Ga0495684_0054816_1807_2964 346
503 3300047472 Ga0495686_0000921 Ga0495686_0000921_34078_35169 346
504 3300047472 Ga0495686_0007402 Ga0495686_0007402_1040_2161 346
505 3300048903 Ga0496100_0007143 Ga0496100_0007143_2311_3465 346
506 3300048904 Ga0496101_0269495 Ga0496101_0269495_95_1183 346
507 3300048907 Ga0496104_0037599 Ga0496104_0037599_1104_2258 346
508 3300048907 Ga0496104_0245159 Ga0496104_0245159_168_1265 346
509 3300048908 Ga0496105_0004369 Ga0496105_0004369_5250_6404 346
510 3300048908 Ga0496105_0221731 Ga0496105_0221731_147_1244 346
511 3300048910 Ga0496107_0048827 Ga0496107_0048827_1127_2281 346
512 3300048910 Ga0496107_0110738 Ga0496107_0110738_773_1870 346
513 3300048915 Ga0496112_0036921 Ga0496112_0036921_1436_2533 346
514 3300048917 Ga0496114_0085552 Ga0496114_0085552_1003_2091 346
515 3300048918 Ga0496115_0049868 Ga0496115_0049868_392_1480 346
516 3300048929 Ga0496126_0000005 Ga0496126_0000005_812278_813399 346
517 3300048929 Ga0496126_0013795 Ga0496126_0013795_4166_5239 346
518 3300050510 nmdc:mga06r32_156210_c1 nmdc:mga06r32_156210_c1_536_1594 346
519 3300053084 Ga0495595_0092803 Ga0495595_0092803_227_1384 346
520 3300005289 Ga0065704_10090535 Ga0065704_100905351 347
521 3300005295 Ga0065707_10001119 Ga0065707_100011196 347
522 3300005327 Ga0070658_10000048 Ga0070658_1000004843 347
523 3300005327 Ga0070658_10042434 Ga0070658_100424343 347
524 3300005327 Ga0070658_10119728 Ga0070658_101197282 347
525 3300005329 Ga0070683_100007811 Ga0070683_1000078116 347
526 3300005329 Ga0070683_100118401 Ga0070683_1001184012 347
527 3300005329 Ga0070683_100172114 Ga0070683_1001721141 347
528 3300005336 Ga0070680_100002837 Ga0070680_1000028377 347
529 3300005336 Ga0070680_100051607 Ga0070680_1000516073 347
530 3300005336 Ga0070680_100095609 Ga0070680_1000956092 347
531 3300005339 Ga0070660_100032029 Ga0070660_1000320292 347
532 3300005341 Ga0070691_10066505 Ga0070691_100665052 347
533 3300005355 Ga0070671_100000679 Ga0070671_1000006799 347
534 3300005365 Ga0070688_100126243 Ga0070688_1001262431 347
535 3300005366 Ga0070659_100093945 Ga0070659_1000939452 347
536 3300005436 Ga0070713_100054118 Ga0070713_1000541183 347
537 3300005437 Ga0070710_10052253 Ga0070710_100522532 347
538 3300005437 Ga0070710_10077580 Ga0070710_100775801 347
539 3300005439 Ga0070711_100001578 Ga0070711_10000157811 347
540 3300005439 Ga0070711_100003134 Ga0070711_1000031342 347
541 3300005439 Ga0070711_100009637 Ga0070711_1000096374 347
542 3300005455 Ga0070663_100026503 Ga0070663_1000265032 347
543 3300005455 Ga0070663_100093285 Ga0070663_1000932852 347
544 3300005458 Ga0070681_10000514 Ga0070681_1000051411 347
545 3300005458 Ga0070681_10010407 Ga0070681_100104076 347
546 3300005458 Ga0070681_10051656 Ga0070681_100516562 347
547 3300005458 Ga0070681_10226871 Ga0070681_102268711 347
548 3300005468 Ga0070707_100008854 Ga0070707_1000088543 347
549 3300005468 Ga0070707_100128880 Ga0070707_1001288802 347
550 3300005471 Ga0070698_100300686 Ga0070698_1003006861 347
551 3300005518 Ga0070699_100001428 Ga0070699_1000014285 347
552 3300005518 Ga0070699_100262862 Ga0070699_1002628621 347
553 3300005518 Ga0070699_100263534 Ga0070699_1002635342 347
554 3300005518 Ga0070699_100279899 Ga0070699_1002798991 347
555 3300005530 Ga0070679_100001505 Ga0070679_10000150514 347
556 3300005530 Ga0070679_100005422 Ga0070679_1000054223 347
557 3300005530 Ga0070679_100073747 Ga0070679_1000737472 347
558 3300005530 Ga0070679_100076842 Ga0070679_1000768421 347
559 3300005539 Ga0068853_100123557 Ga0068853_1001235571 347
560 3300005548 Ga0070665_100011303 Ga0070665_1000113038 347
561 3300005548 Ga0070665_100301789 Ga0070665_1003017892 347
562 3300005548 Ga0070665_100365480 Ga0070665_1003654801 347
563 3300005563 Ga0068855_100009115 Ga0068855_10000911510 347
564 3300005563 Ga0068855_100044346 Ga0068855_1000443462 347
565 3300005563 Ga0068855_100047785 Ga0068855_1000477854 347
566 3300005563 Ga0068855_100070217 Ga0068855_1000702175 347
567 3300005563 Ga0068855_100234072 Ga0068855_1002340722 347
568 3300005564 Ga0070664_100118583 Ga0070664_1001185832 347
569 3300005577 Ga0068857_100034505 Ga0068857_1000345052 347
570 3300005614 Ga0068856_100006800 Ga0068856_10000680013 347
571 3300005616 Ga0068852_100021040 Ga0068852_1000210406 347
572 3300005616 Ga0068852_100044115 Ga0068852_1000441153 347
573 3300005616 Ga0068852_100084535 Ga0068852_1000845352 347
574 3300005618 Ga0068864_100004818 Ga0068864_1000048184 347
575 3300005841 Ga0068863_100024932 Ga0068863_1000249327 347
576 3300005844 Ga0068862_100239065 Ga0068862_1002390652 347
577 3300006028 Ga0070717_10002932 Ga0070717_1000293210 347
578 3300006163 Ga0070715_10039657 Ga0070715_100396572 347
579 3300006173 Ga0070716_100000278 Ga0070716_10000027814 347
580 3300006173 Ga0070716_100003816 Ga0070716_1000038164 347
581 3300006175 Ga0070712_100001997 Ga0070712_1000019979 347
582 3300006175 Ga0070712_100084158 Ga0070712_1000841582 347
583 3300006175 Ga0070712_100137033 Ga0070712_1001370332 347
584 3300006175 Ga0070712_100168455 Ga0070712_1001684551 347
585 3300006846 Ga0075430_100087245 Ga0075430_1000872452 347
586 3300006852 Ga0075433_10083064 Ga0075433_100830641 347
587 3300006871 Ga0075434_100092569 Ga0075434_1000925693 347
588 3300006871 Ga0075434_100260111 Ga0075434_1002601111 347
589 3300009093 Ga0105240_10000694 Ga0105240_1000069429 347
590 3300009093 Ga0105240_10039509 Ga0105240_100395091 347
591 3300009093 Ga0105240_10061115 Ga0105240_100611155 347
592 3300009093 Ga0105240_10124534 Ga0105240_101245342 347
593 3300009093 Ga0105240_10160249 Ga0105240_101602492 347
594 3300009093 Ga0105240_10191445 Ga0105240_101914452 347
595 3300009093 Ga0105240_10269362 Ga0105240_102693622 347
596 3300009093 Ga0105240_10411878 Ga0105240_104118781 347
597 3300009098 Ga0105245_10005477 Ga0105245_100054777 347
598 3300009147 Ga0114129_10086217 Ga0114129_100862172 347
599 3300009147 Ga0114129_10194709 Ga0114129_101947092 347
600 3300009147 Ga0114129_10428194 Ga0114129_104281941 347
601 3300009147 Ga0114129_10541489 Ga0114129_105414891 347
602 3300009174 Ga0105241_10001486 Ga0105241_1000148615 347
603 3300009177 Ga0105248_10228069 Ga0105248_102280692 347
604 3300009545 Ga0105237_10029870 Ga0105237_100298703 347
605 3300009545 Ga0105237_10041181 Ga0105237_100411812 347
606 3300009551 Ga0105238_10002620 Ga0105238_1000262015 347
607 3300009551 Ga0105238_10021773 Ga0105238_100217733 347
608 3300009551 Ga0105238_10034581 Ga0105238_100345815 347
609 3300009551 Ga0105238_10078654 Ga0105238_100786541 347
610 3300009551 Ga0105238_10095409 Ga0105238_100954092 347
611 3300009551 Ga0105238_10117691 Ga0105238_101176912 347
612 3300009553 Ga0105249_10028452 Ga0105249_100284523 347
613 3300009553 Ga0105249_10089159 Ga0105249_100891593 347
614 3300011119 Ga0105246_10084676 Ga0105246_100846761 347
615 3300013100 Ga0157373_10006042 Ga0157373_100060427 347
616 3300013100 Ga0157373_10012352 Ga0157373_100123522 347
617 3300013104 Ga0157370_10009613 Ga0157370_100096132 347
618 3300013104 Ga0157370_10018762 Ga0157370_100187624 347
619 3300013104 Ga0157370_10049663 Ga0157370_100496634 347
620 3300013104 Ga0157370_10053518 Ga0157370_100535182 347
621 3300013104 Ga0157370_10057536 Ga0157370_100575364 347
622 3300013105 Ga0157369_10003846 Ga0157369_1000384618 347
623 3300013105 Ga0157369_10022251 Ga0157369_100222512 347
624 3300013105 Ga0157369_10023096 Ga0157369_100230962 347
625 3300013105 Ga0157369_10033757 Ga0157369_100337574 347
626 3300013105 Ga0157369_10095346 Ga0157369_100953463 347
627 3300013105 Ga0157369_10132987 Ga0157369_101329872 347
628 3300013105 Ga0157369_10427444 Ga0157369_104274441 347
629 3300013296 Ga0157374_10000395 Ga0157374_1000039521 347
630 3300013296 Ga0157374_10041938 Ga0157374_100419382 347
631 3300013306 Ga0163162_10000056 Ga0163162_1000005620 347
632 3300013307 Ga0157372_10011993 Ga0157372_100119932 347
633 3300013307 Ga0157372_10018043 Ga0157372_100180435 347
634 3300013307 Ga0157372_10035984 Ga0157372_100359846 347
635 3300013307 Ga0157372_10038263 Ga0157372_100382633 347
636 3300013307 Ga0157372_10076118 Ga0157372_100761182 347
637 3300013307 Ga0157372_10123929 Ga0157372_101239292 347
638 3300013307 Ga0157372_10220193 Ga0157372_102201933 347
639 3300014325 Ga0163163_10008910 Ga0163163_1000891010 347
640 3300014325 Ga0163163_10100236 Ga0163163_101002362 347
641 3300014326 Ga0157380_10136136 Ga0157380_101361362 347
642 3300014968 Ga0157379_10030787 Ga0157379_100307874 347
643 3300014968 Ga0157379_10030885 Ga0157379_100308855 347
644 3300024227 Ga0228598_1000157 Ga0228598_10001572 347
645 3300025321 Ga0207656_10043280 Ga0207656_100432802 347
646 3300025898 Ga0207692_10004844 Ga0207692_100048443 347
647 3300025898 Ga0207692_10058978 Ga0207692_100589782 347
648 3300025903 Ga0207680_10002832 Ga0207680_100028326 347
649 3300025905 Ga0207685_10008369 Ga0207685_100083692 347
650 3300025906 Ga0207699_10046993 Ga0207699_100469932 347
651 3300025909 Ga0207705_10000048 Ga0207705_1000004871 347
652 3300025909 Ga0207705_10011775 Ga0207705_100117755 347
653 3300025909 Ga0207705_10014834 Ga0207705_100148345 347
654 3300025909 Ga0207705_10027295 Ga0207705_100272954 347
655 3300025910 Ga0207684_10016799 Ga0207684_100167995 347
656 3300025910 Ga0207684_10040343 Ga0207684_100403432 347
657 3300025910 Ga0207684_10179908 Ga0207684_101799082 347
658 3300025911 Ga0207654_10001671 Ga0207654_100016718 347
659 3300025912 Ga0207707_10010347 Ga0207707_100103479 347
660 3300025912 Ga0207707_10046691 Ga0207707_100466914 347
661 3300025912 Ga0207707_10125840 Ga0207707_101258402 347
662 3300025912 Ga0207707_10261392 Ga0207707_102613921 347
663 3300025913 Ga0207695_10013418 Ga0207695_1001341811 347
664 3300025913 Ga0207695_10022772 Ga0207695_100227727 347
665 3300025913 Ga0207695_10033792 Ga0207695_100337923 347
666 3300025915 Ga0207693_10003987 Ga0207693_100039877 347
667 3300025915 Ga0207693_10005055 Ga0207693_100050558 347
668 3300025915 Ga0207693_10006988 Ga0207693_100069882 347
669 3300025915 Ga0207693_10043072 Ga0207693_100430721 347
670 3300025915 Ga0207693_10273981 Ga0207693_102739811 347
671 3300025916 Ga0207663_10004905 Ga0207663_100049055 347
672 3300025916 Ga0207663_10005352 Ga0207663_100053523 347
673 3300025917 Ga0207660_10001226 Ga0207660_100012264 347
674 3300025917 Ga0207660_10026938 Ga0207660_100269383 347
675 3300025917 Ga0207660_10056663 Ga0207660_100566632 347
676 3300025917 Ga0207660_10067231 Ga0207660_100672311 347
677 3300025917 Ga0207660_10114820 Ga0207660_101148201 347
678 3300025919 Ga0207657_10014437 Ga0207657_100144375 347
679 3300025921 Ga0207652_10002189 Ga0207652_1000218910 347
680 3300025921 Ga0207652_10046362 Ga0207652_100463622 347
681 3300025921 Ga0207652_10057740 Ga0207652_100577402 347
682 3300025921 Ga0207652_10104864 Ga0207652_101048641 347
683 3300025921 Ga0207652_10387454 Ga0207652_103874541 347
684 3300025922 Ga0207646_10031816 Ga0207646_100318162 347
685 3300025924 Ga0207694_10037543 Ga0207694_100375434 347
686 3300025927 Ga0207687_10003266 Ga0207687_100032662 347
687 3300025928 Ga0207700_10007377 Ga0207700_100073775 347
688 3300025928 Ga0207700_10073599 Ga0207700_100735991 347
689 3300025928 Ga0207700_10203460 Ga0207700_102034602 347
690 3300025929 Ga0207664_10052096 Ga0207664_100520963 347
691 3300025931 Ga0207644_10177450 Ga0207644_101774501 347
692 3300025939 Ga0207665_10000046 Ga0207665_100000468 347
693 3300025939 Ga0207665_10002386 Ga0207665_100023864 347
694 3300025941 Ga0207711_10034624 Ga0207711_100346241 347
695 3300025944 Ga0207661_10062931 Ga0207661_100629311 347
696 3300025945 Ga0207679_10155091 Ga0207679_101550912 347
697 3300025949 Ga0207667_10018661 Ga0207667_100186615 347
698 3300025949 Ga0207667_10031300 Ga0207667_100313002 347
699 3300025949 Ga0207667_10066827 Ga0207667_100668272 347
700 3300025949 Ga0207667_10225809 Ga0207667_102258092 347
701 3300025961 Ga0207712_10012260 Ga0207712_100122605 347
702 3300026067 Ga0207678_10000300 Ga0207678_1000030027 347
703 3300026067 Ga0207678_10019980 Ga0207678_100199805 347
704 3300026067 Ga0207678_10044820 Ga0207678_100448202 347
705 3300026078 Ga0207702_10036410 Ga0207702_100364104 347
706 3300026088 Ga0207641_10048632 Ga0207641_100486324 347
707 3300026095 Ga0207676_10005721 Ga0207676_100057216 347
708 3300026116 Ga0207674_10001317 Ga0207674_1000131726 347
709 3300026116 Ga0207674_10113029 Ga0207674_101130292 347
710 3300026118 Ga0207675_100013011 Ga0207675_1000130114 347
711 3300026142 Ga0207698_10024152 Ga0207698_100241522 347
712 3300028379 Ga0268266_10028507 Ga0268266_100285073 347
713 3300028379 Ga0268266_10032459 Ga0268266_100324592 347
714 3300028379 Ga0268266_10124914 Ga0268266_101249141 347
715 3300031090 Ga0265760_10002262 Ga0265760_100022622 347
716 3300031090 Ga0265760_10002525 Ga0265760_100025253 347
717 3300031548 Ga0307408_100019522 Ga0307408_1000195222 347
718 3300031727 Ga0316576_10056371 Ga0316576_100563712 347
719 3300031731 Ga0307405_10027146 Ga0307405_100271463 347
720 3300031731 Ga0307405_10058848 Ga0307405_100588481 347
721 3300031824 Ga0307413_10008587 Ga0307413_100085872 347
722 3300031824 Ga0307413_10028482 Ga0307413_100284822 347
723 3300031852 Ga0307410_10020710 Ga0307410_100207102 347
724 3300031901 Ga0307406_10015879 Ga0307406_100158794 347
725 3300031903 Ga0307407_10013586 Ga0307407_100135863 347
726 3300031911 Ga0307412_10051452 Ga0307412_100514522 347
727 3300031995 Ga0307409_100001000 Ga0307409_1000010007 347
728 3300032002 Ga0307416_100004875 Ga0307416_1000048754 347
729 3300032002 Ga0307416_100070247 Ga0307416_1000702472 347
730 3300032002 Ga0307416_100151987 Ga0307416_1001519872 347
731 3300032004 Ga0307414_10075652 Ga0307414_100756522 347
732 3300032005 Ga0307411_10004428 Ga0307411_100044283 347
733 3300032126 Ga0307415_100000717 Ga0307415_10000071717 347
734 3300032126 Ga0307415_100075843 Ga0307415_1000758431 347
735 3300033180 Ga0307510_10091011 Ga0307510_100910112 347
736 3300035083 Ga0373926_0003327 Ga0373926_0003327_688_1758 347
737 3300035083 Ga0373926_0010705 Ga0373926_0010705_1741_2811 347
738 3300035083 Ga0373926_0046154 Ga0373926_0046154_80_1150 347
739 3300035111 Ga0373923_0011760 Ga0373923_0011760_1879_2949 347
740 3300035113 Ga0373936_0012750 Ga0373936_0012750_1738_2808 347
741 3300035113 Ga0373936_0015254 Ga0373936_0015254_279_1331 347
742 3300035116 Ga0373945_0002909 Ga0373945_0002909_3028_4098 347
743 3300035170 Ga0373943_0005065 Ga0373943_0005065_1978_3048 347
744 3300035171 Ga0373946_0004512 Ga0373946_0004512_3571_4641 347
745 3300035171 Ga0373946_0070731 Ga0373946_0070731_399_1469 347
746 3300035171 Ga0373946_0083760 Ga0373946_0083760_100_1170 347
747 3300035172 Ga0373955_0003383 Ga0373955_0003383_3777_4847 347
748 3300035241 Ga0373961_0010964 Ga0373961_0010964_439_1500 347
749 3300035410 Ga0373924_0003556 Ga0373924_0003556_2935_4005 347
750 3300035410 Ga0373924_0032929 Ga0373924_0032929_585_1655 347
751 3300035692 Ga0373935_0013104 Ga0373935_0013104_479_1549 347
752 3300035692 Ga0373935_0177597 Ga0373935_0177597_324_1376 347
753 3300035695 Ga0373927_0004121 Ga0373927_0004121_1125_2195 347
754 3300035695 Ga0373927_0019115 Ga0373927_0019115_521_1591 347
755 3300035724 Ga0373933_0062995 Ga0373933_0062995_485_1537 347
756 3300035725 Ga0373947_0008015 Ga0373947_0008015_4398_5468 347
757 3300035725 Ga0373947_0042749 Ga0373947_0042749_246_1298 347
758 3300035725 Ga0373947_0045925 Ga0373947_0045925_1133_2203 347
759 3300036401 Ga0373937_0000027 Ga0373937_0000027_10962_12032 347
760 3300036401 Ga0373937_0018796 Ga0373937_0018796_2838_3908 347
761 3300037068 Ga0373925_0012705 Ga0373925_0012705_3284_4336 347
762 3300037068 Ga0373925_0019564 Ga0373925_0019564_3662_4732 347
763 3300037068 Ga0373925_0027057 Ga0373925_0027057_2644_3696 347
764 3300037068 Ga0373925_0053177 Ga0373925_0053177_742_1812 347
765 3300037068 Ga0373925_0055172 Ga0373925_0055172_803_1873 347
766 3300037068 Ga0373925_0143742 Ga0373925_0143742_404_1456 347
767 3300037466 Ga0395898_0014459 Ga0395898_0014459_4075_5130 347
768 3300039453 Ga0436362_0803045 Ga0436362_0803045_309_1361 347
769 3300042876 Ga0451577_0024043 Ga0451577_0024043_2364_3425 347
770 3300042876 Ga0451577_0076721 Ga0451577_0076721_298_1359 347
771 3300042876 Ga0451577_0085984 Ga0451577_0085984_1194_2255 347
772 3300044673 Ga0453683_0000448 Ga0453683_0000448_20126_21187 347
773 3300044673 Ga0453683_0012738 Ga0453683_0012738_3684_4745 347
774 3300044673 Ga0453683_0049163 Ga0453683_0049163_925_1986 347
775 3300044712 Ga0453684_0001875 Ga0453684_0001875_44772_45833 347
776 3300044712 Ga0453684_0005714 Ga0453684_0005714_19139_20200 347
777 3300044712 Ga0453684_0018277 Ga0453684_0018277_3063_4124 347
778 3300044712 Ga0453684_0027657 Ga0453684_0027657_6171_7232 347
779 3300044712 Ga0453684_0032290 Ga0453684_0032290_3091_4152 347
780 3300044712 Ga0453684_0110411 Ga0453684_0110411_1692_2753 347
781 3300044712 Ga0453684_0124289 Ga0453684_0124289_1737_2798 347
782 3300044712 Ga0453684_0170072 Ga0453684_0170072_211_1272 347
783 3300044712 Ga0453684_0211257 Ga0453684_0211257_223_1284 347
784 3300045051 Ga0451576_0002465 Ga0451576_0002465_126_1187 347
785 3300045051 Ga0451576_0028360 Ga0451576_0028360_11_1072 347
786 3300046454 Ga0495592_0007856 Ga0495592_0007856_5781_6887 347
787 3300046455 Ga0495603_0000838 Ga0495603_0000838_7003_8109 347
788 3300046459 Ga0495629_0000549 Ga0495629_0000549_9910_11016 347
789 3300046459 Ga0495629_0008527 Ga0495629_0008527_3574_4680 347
790 3300046462 Ga0495651_0011762 Ga0495651_0011762_731_1837 347
791 3300046462 Ga0495651_0089900 Ga0495651_0089900_26_1081 347
792 3300046463 Ga0495653_0003436 Ga0495653_0003436_4539_5645 347
793 3300046471 Ga0495650_0000022 Ga0495650_0000022_349527_350627 347
794 3300046471 Ga0495650_0008987 Ga0495650_0008987_4433_5539 347
795 3300046472 Ga0495580_0001908 Ga0495580_0001908_13127_14179 347
796 3300046472 Ga0495580_0003312 Ga0495580_0003312_4164_5216 347
797 3300046472 Ga0495580_0031675 Ga0495580_0031675_2616_3722 347
798 3300046472 Ga0495580_0066817 Ga0495580_0066817_89_1159 347
799 3300046473 Ga0495582_0001438 Ga0495582_0001438_3185_4237 347
800 3300046473 Ga0495582_0017581 Ga0495582_0017581_1114_2220 347
801 3300046473 Ga0495582_0056162 Ga0495582_0056162_828_1898 347
802 3300046473 Ga0495582_0147651 Ga0495582_0147651_151_1221 347
803 3300046475 Ga0495639_0000249 Ga0495639_0000249_22674_23780 347
804 3300046475 Ga0495639_0026133 Ga0495639_0026133_715_1785 347
805 3300046476 Ga0495662_0000291 Ga0495662_0000291_3996_5102 347
806 3300046477 Ga0495664_0002624 Ga0495664_0002624_7526_8581 347
807 3300046477 Ga0495664_0037708 Ga0495664_0037708_1478_2578 347
808 3300046477 Ga0495664_0097179 Ga0495664_0097179_47_1153 347
809 3300046492 Ga0495585_0067024 Ga0495585_0067024_400_1506 347
810 3300046499 Ga0495594_0000436 Ga0495594_0000436_15794_16900 347
811 3300046499 Ga0495594_0000734 Ga0495594_0000734_5410_6516 347
812 3300046499 Ga0495594_0002977 Ga0495594_0002977_5361_6467 347
813 3300046499 Ga0495594_0067731 Ga0495594_0067731_636_1706 347
814 3300046507 Ga0495606_0034364 Ga0495606_0034364_461_1561 347
815 3300046507 Ga0495606_0106330 Ga0495606_0106330_491_1597 347
816 3300046511 Ga0495608_0037768 Ga0495608_0037768_583_1689 347
817 3300046516 Ga0495628_0242059 Ga0495628_0242059_197_1267 347
818 3300046517 Ga0495630_0003954 Ga0495630_0003954_7394_8464 347
819 3300046517 Ga0495630_0004124 Ga0495630_0004124_4618_5724 347
820 3300046523 Ga0495644_0000029 Ga0495644_0000029_9722_10828 347
821 3300046524 Ga0495648_0128709 Ga0495648_0128709_126_1226 347
822 3300046526 Ga0495666_0005235 Ga0495666_0005235_4069_5175 347
823 3300046526 Ga0495666_0134939 Ga0495666_0134939_20_1072 347
824 3300046528 Ga0495642_0018911 Ga0495642_0018911_1148_2254 347
825 3300046529 Ga0495652_0094030 Ga0495652_0094030_1230_2330 347
826 3300046529 Ga0495652_0152458 Ga0495652_0152458_76_1131 347
827 3300046531 Ga0495665_0000484 Ga0495665_0000484_2529_3635 347
828 3300046531 Ga0495665_0004823 Ga0495665_0004823_929_1999 347
829 3300046531 Ga0495665_0097205 Ga0495665_0097205_113_1165 347
830 3300046531 Ga0495665_0148424 Ga0495665_0148424_56_1108 347
831 3300046536 Ga0495587_0022747 Ga0495587_0022747_1008_2114 347
832 3300046538 Ga0495609_0009088 Ga0495609_0009088_3388_4494 347
833 3300046559 Ga0495667_0018030 Ga0495667_0018030_708_1814 347
834 3300046616 Ga0495668_0039641 Ga0495668_0039641_300_1406 347
835 3300046660 Ga0495625_0001054 Ga0495625_0001054_16624_17730 347
836 3300046660 Ga0495625_0004927 Ga0495625_0004927_1444_2550 347
837 3300046660 Ga0495625_0005873 Ga0495625_0005873_9828_10928 347
838 3300046663 Ga0495635_0032572 Ga0495635_0032572_43_1095 347
839 3300046665 Ga0495661_0043011 Ga0495661_0043011_472_1572 347
840 3300046679 Ga0495623_0017932 Ga0495623_0017932_3492_4562 347
841 3300046679 Ga0495623_0045738 Ga0495623_0045738_1364_2470 347
842 3300046679 Ga0495623_0160585 Ga0495623_0160585_230_1282 347
843 3300046683 Ga0495658_0173154 Ga0495658_0173154_91_1197 347
844 3300046684 Ga0495669_0001929 Ga0495669_0001929_2106_3212 347
845 3300046684 Ga0495669_0034699 Ga0495669_0034699_178_1233 347
846 3300046684 Ga0495669_0060757 Ga0495669_0060757_587_1639 347
847 3300046689 Ga0495613_0001436 Ga0495613_0001436_3786_4892 347
848 3300046689 Ga0495613_0142960 Ga0495613_0142960_556_1662 347
849 3300046690 Ga0495624_0000779 Ga0495624_0000779_6231_7337 347
850 3300046691 Ga0495670_0022110 Ga0495670_0022110_1294_2400 347
851 3300046809 Ga0495600_0032715 Ga0495600_0032715_2237_3343 347
852 3300046809 Ga0495600_0068140 Ga0495600_0068140_576_1682 347
853 3300046809 Ga0495600_0117752 Ga0495600_0117752_41_1141 347
854 3300047315 Ga0495581_0013657 Ga0495581_0013657_1024_2130 347
855 3300047315 Ga0495581_0032396 Ga0495581_0032396_42_1112 347
856 3300047315 Ga0495581_0090742 Ga0495581_0090742_620_1726 347
857 3300047317 Ga0495604_0009578 Ga0495604_0009578_1586_2686 347
858 3300047317 Ga0495604_0239794 Ga0495604_0239794_106_1161 347
859 3300047319 Ga0495674_0002381 Ga0495674_0002381_828_1928 347
860 3300047320 Ga0495672_0007773 Ga0495672_0007773_2649_3752 347
861 3300047322 Ga0495680_0005651 Ga0495680_0005651_6770_7876 347
862 3300047444 Ga0495675_0001775 Ga0495675_0001775_8793_9899 347
863 3300047444 Ga0495675_0004033 Ga0495675_0004033_1791_2846 347
864 3300047445 Ga0495677_0020615 Ga0495677_0020615_461_1567 347
865 3300048903 Ga0496100_0117485 Ga0496100_0117485_647_1726 347
866 3300048907 Ga0496104_0038068 Ga0496104_0038068_283_1383 347
867 3300048907 Ga0496104_0065734 Ga0496104_0065734_2238_3308 347
868 3300048908 Ga0496105_0002243 Ga0496105_0002243_1315_2385 347
869 3300048908 Ga0496105_0018968 Ga0496105_0018968_1995_3095 347
870 3300048913 Ga0496110_0366833 Ga0496110_0366833_168_1223 347
871 3300048915 Ga0496112_0006448 Ga0496112_0006448_7510_8580 347
872 3300048915 Ga0496112_0120789 Ga0496112_0120789_508_1563 347
873 3300048915 Ga0496112_0152413 Ga0496112_0152413_1123_2202 347
874 3300048916 Ga0496113_0007620 Ga0496113_0007620_3042_4112 347
875 3300048917 Ga0496114_0151174 Ga0496114_0151174_472_1572 347
876 3300048918 Ga0496115_0224855 Ga0496115_0224855_215_1270 347
877 3300048929 Ga0496126_0000010 Ga0496126_0000010_287915_289042 347
878 3300048929 Ga0496126_0001435 Ga0496126_0001435_26827_27927 347
879 3300049460 Ga0495682_0017494 Ga0495682_0017494_612_1712 347
880 3300049568 Ga0501031_0003660 Ga0501031_0003660_1330_2436 347
881 3300049570 Ga0501033_0027441 Ga0501033_0027441_49_1155 347
882 3300049570 Ga0501033_0038983 Ga0501033_0038983_2160_3269 347
883 3300049571 Ga0501034_0008118 Ga0501034_0008118_8926_10032 347
884 3300049572 Ga0501036_0001740 Ga0501036_0001740_4649_5755 347
885 3300049573 Ga0501037_0057094 Ga0501037_0057094_1123_2229 347
886 3300049579 Ga0501043_0002753 Ga0501043_0002753_119_1225 347
887 3300049580 Ga0501046_0000437 Ga0501046_0000437_18777_19883 347
888 3300049581 Ga0501047_0000776 Ga0501047_0000776_2536_3642 347
889 3300049581 Ga0501047_0009635 Ga0501047_0009635_452_1561 347
890 3300049588 Ga0501072_0071107 Ga0501072_0071107_1513_2574 347
891 3300049589 Ga0501073_0000891 Ga0501073_0000891_10515_11621 347
892 3300049591 Ga0501075_0191723 Ga0501075_0191723_319_1380 347
893 3300049593 Ga0501077_0000408 Ga0501077_0000408_19643_20704 347
894 3300049742 Ga0501080_0310988 Ga0501080_0310988_323_1384 347
895 3300049743 Ga0501081_0025930 Ga0501081_0025930_1116_2177 347
896 3300049744 Ga0501083_0051828 Ga0501083_0051828_67_1128 347
897 3300049822 Ga0501035_0075520 Ga0501035_0075520_669_1775 347
898 3300049823 Ga0501044_0025248 Ga0501044_0025248_5126_6232 347
899 3300049823 Ga0501044_0043453 Ga0501044_0043453_577_1683 347
900 3300049823 Ga0501044_0062913 Ga0501044_0062913_675_1784 347
901 3300050507 nmdc:mga05p37_96413_c1 nmdc:mga05p37_96413_c1_125_1186 347
902 3300050507 nmdc:mga05p37_96535_c1 nmdc:mga05p37_96535_c1_1510_2571 347
903 3300050508 nmdc:mga09592_261873_c1 nmdc:mga09592_261873_c1_327_1388 347
904 3300050509 nmdc:mga0qj67_83908_c1 nmdc:mga0qj67_83908_c1_1367_2428 347
905 3300050510 nmdc:mga06r32_213809_c1 nmdc:mga06r32_213809_c1_44_1105 347
906 3300050512 nmdc:mga0n895_76663_c1 nmdc:mga0n895_76663_c1_1632_2687 347
907 3300050513 nmdc:mga0rr50_164718_c1 nmdc:mga0rr50_164718_c1_209_1261 347
908 3300050514 nmdc:mga08x19_29023_c1 nmdc:mga08x19_29023_c1_702_1754 347
909 3300050515 nmdc:mga0a205_101094_c1 nmdc:mga0a205_101094_c1_1432_2493 347
910 3300053087 Ga0500643_018194 Ga0500643_018194_297_1397 347
911 3300053093 Ga0500651_0000003 Ga0500651_0000003_130026_131126 347
912 3300053119 Ga0500595_000005 Ga0500595_000005_213079_214179 347
913 3300053119 Ga0500595_016340 Ga0500595_016340_284_1384 347
914 3300055283 Ga0500661_001353 Ga0500661_001353_1935_3035 347
915 3300005354 Ga0070675_100253119 Ga0070675_1002531192 348
916 3300005436 Ga0070713_100117097 Ga0070713_1001170972 348
917 3300005439 Ga0070711_100079522 Ga0070711_1000795222 348
918 3300005445 Ga0070708_100024498 Ga0070708_1000244984 348
919 3300005445 Ga0070708_100034419 Ga0070708_1000344193 348
920 3300005445 Ga0070708_100061577 Ga0070708_1000615772 348
921 3300005467 Ga0070706_100001098 Ga0070706_10000109818 348
922 3300005467 Ga0070706_100038175 Ga0070706_1000381754 348
923 3300005468 Ga0070707_100001894 Ga0070707_10000189419 348
924 3300005471 Ga0070698_100007264 Ga0070698_1000072642 348
925 3300005518 Ga0070699_100014915 Ga0070699_1000149154 348
926 3300005518 Ga0070699_100028220 Ga0070699_1000282204 348
927 3300005536 Ga0070697_100012833 Ga0070697_1000128335 348
928 3300005536 Ga0070697_100046211 Ga0070697_1000462113 348
929 3300005549 Ga0070704_100063711 Ga0070704_1000637112 348
930 3300005617 Ga0068859_100476660 Ga0068859_1004766602 348
931 3300005718 Ga0068866_10074774 Ga0068866_100747742 348
932 3300005840 Ga0068870_10213089 Ga0068870_102130891 348
933 3300005844 Ga0068862_100052937 Ga0068862_1000529372 348
934 3300006844 Ga0075428_100186843 Ga0075428_1001868432 348
935 3300006880 Ga0075429_100086347 Ga0075429_1000863472 348
936 3300006931 Ga0097620_100476657 Ga0097620_1004766572 348
937 3300009147 Ga0114129_10021718 Ga0114129_100217184 348
938 3300011119 Ga0105246_10130918 Ga0105246_101309182 348
939 3300013297 Ga0157378_10011057 Ga0157378_100110575 348
940 3300025893 Ga0207682_10042681 Ga0207682_100426812 348
941 3300025910 Ga0207684_10003222 Ga0207684_1000322212 348
942 3300025910 Ga0207684_10003763 Ga0207684_1000376311 348
943 3300025910 Ga0207684_10034984 Ga0207684_100349844 348
944 3300025916 Ga0207663_10083264 Ga0207663_100832642 348
945 3300025922 Ga0207646_10002834 Ga0207646_100028343 348
946 3300025928 Ga0207700_10257932 Ga0207700_102579322 348
947 3300028380 Ga0268265_10181063 Ga0268265_101810631 348
948 3300028800 Ga0265338_10001617 Ga0265338_1000161721 348
949 3300031241 Ga0265325_10018685 Ga0265325_100186853 348
950 3300031249 Ga0265339_10032033 Ga0265339_100320332 348
951 3300031249 Ga0265339_10082668 Ga0265339_100826682 348
952 3300031344 Ga0265316_10007744 Ga0265316_1000774412 348
953 3300031344 Ga0265316_10132300 Ga0265316_101323002 348
954 3300031595 Ga0265313_10054029 Ga0265313_100540292 348
955 3300031711 Ga0265314_10004281 Ga0265314_1000428110 348
956 3300031712 Ga0265342_10001677 Ga0265342_100016774 348
957 3300033180 Ga0307510_10024239 Ga0307510_100242395 348
958 3300039450 Ga0436363_0117531 Ga0436363_0117531_215_1276 348
959 3300039450 Ga0436363_1446693 Ga0436363_1446693_22_1089 348
960 3300044684 Ga0466966_0006756 Ga0466966_0006756_1503_2570 348
961 3300044765 Ga0466970_0103284 Ga0466970_0103284_74_1141 348
962 3300045051 Ga0451576_0145484 Ga0451576_0145484_327_1391 348
963 3300047472 Ga0495686_0006475 Ga0495686_0006475_3568_4674 348
964 3300050507 nmdc:mga05p37_10176_c1 nmdc:mga05p37_10176_c1_5753_6799 348
965 3300050508 nmdc:mga09592_40233_c1 nmdc:mga09592_40233_c1_1579_2625 348
966 3300061719 Ga0466962_0060217 Ga0466962_0060217_15_1082 348
967 3300005434 Ga0070709_10020442 Ga0070709_100204423 349
968 3300005436 Ga0070713_100030864 Ga0070713_1000308644 349
969 3300005444 Ga0070694_100057648 Ga0070694_1000576482 349
970 3300005468 Ga0070707_100044371 Ga0070707_1000443712 349
971 3300005518 Ga0070699_100125696 Ga0070699_1001256961 349
972 3300005546 Ga0070696_100049197 Ga0070696_1000491973 349
973 3300005617 Ga0068859_100144400 Ga0068859_1001444001 349
974 3300005844 Ga0068862_100060611 Ga0068862_1000606112 349
975 3300006931 Ga0097620_100144394 Ga0097620_1001443941 349
976 3300009094 Ga0111539_10044235 Ga0111539_100442351 349
977 3300014326 Ga0157380_10003659 Ga0157380_100036592 349
978 3300025294 Ga0209025_1002200 Ga0209025_100220015 349
979 3300025906 Ga0207699_10049879 Ga0207699_100498792 349
980 3300025912 Ga0207707_10023818 Ga0207707_100238184 349
981 3300026075 Ga0207708_10033884 Ga0207708_100338843 349
982 3300026118 Ga0207675_100153012 Ga0207675_1001530122 349
983 3300028380 Ga0268265_10230538 Ga0268265_102305382 349
984 3300028577 Ga0265318_10000618 Ga0265318_100006188 349
985 3300031240 Ga0265320_10000061 Ga0265320_1000006119 349
986 3300031241 Ga0265325_10010096 Ga0265325_100100964 349
987 3300031242 Ga0265329_10000191 Ga0265329_1000019116 349
988 3300031247 Ga0265340_10004674 Ga0265340_100046742 349
989 3300031249 Ga0265339_10001171 Ga0265339_1000117114 349
990 3300031250 Ga0265331_10000192 Ga0265331_1000019256 349
991 3300031344 Ga0265316_10000637 Ga0265316_1000063723 349
992 3300031595 Ga0265313_10004284 Ga0265313_100042848 349
993 3300031712 Ga0265342_10000566 Ga0265342_1000056623 349
994 3300046516 Ga0495628_0001512 Ga0495628_0001512_18330_19442 349
995 3300046533 Ga0495640_0093476 Ga0495640_0093476_448_1560 349
996 3300046535 Ga0495586_0004223 Ga0495586_0004223_4277_5389 349
997 3300046543 Ga0495645_0001181 Ga0495645_0001181_785_1897 349
998 3300046663 Ga0495635_0078400 Ga0495635_0078400_247_1359 349
999 3300046680 Ga0495646_0043322 Ga0495646_0043322_1153_2265 349
1000 3300047317 Ga0495604_0000517 Ga0495604_0000517_19687_20799 349
1001 3300047319 Ga0495674_0156533 Ga0495674_0156533_550_1662 349
1002 3300047321 Ga0495676_0015675 Ga0495676_0015675_4547_5659 349
1003 3300047471 Ga0495684_0002044 Ga0495684_0002044_14660_15772 349
1004 3300047673 Ga0495593_0032721 Ga0495593_0032721_1494_2606 349
1005 3300048912 Ga0496109_0240214 Ga0496109_0240214_231_1310 349
1006 3300048915 Ga0496112_0069641 Ga0496112_0069641_22_1101 349
1007 3300048916 Ga0496113_0159620 Ga0496113_0159620_665_1744 349
1008 3300049575 Ga0501039_0164079 Ga0501039_0164079_683_1732 349
1009 3300049576 Ga0501040_0085599 Ga0501040_0085599_1046_2095 349
1010 3300049578 Ga0501042_0061938 Ga0501042_0061938_351_1400 349
1011 3300049582 Ga0501048_0063884 Ga0501048_0063884_1172_2221 349
1012 3300049588 Ga0501072_0039810 Ga0501072_0039810_303_1352 349
1013 3300049591 Ga0501075_0012046 Ga0501075_0012046_4783_5832 349
1014 3300049591 Ga0501075_0226064 Ga0501075_0226064_22_1071 349
1015 3300049592 Ga0501076_0019283 Ga0501076_0019283_2556_3605 349
1016 3300050507 nmdc:mga05p37_170830_c1 nmdc:mga05p37_170830_c1_1385_2434 349
1017 3300050511 nmdc:mga08y16_279080_c1 nmdc:mga08y16_279080_c1_313_1362 349
1018 3300060353 Ga0501082_0218858 Ga0501082_0218858_113_1162 349
1019 3300060353 Ga0501082_0233725 Ga0501082_0233725_276_1340 349
1020 iso_pu_bacteria 8055632911 8055637738 349
1021 3300005563 Ga0068855_100016084 Ga0068855_1000160847 351
1022 3300025920 Ga0207649_10069534 Ga0207649_100695341 351
1023 3300025949 Ga0207667_10027711 Ga0207667_100277113 351
1024 3300026041 Ga0207639_10091451 Ga0207639_100914511 351
1025 3300026142 Ga0207698_10010058 Ga0207698_100100582 351
1026 3300028379 Ga0268266_10104641 Ga0268266_101046412 351
1027 3300025913 Ga0207695_10000177 Ga0207695_10000177119 352
1028 3300044712 Ga0453684_0226155 Ga0453684_0226155_536_1612 352
1029 3300005530 Ga0070679_100075972 Ga0070679_1000759722 353
1030 3300005577 Ga0068857_100006714 Ga0068857_1000067145 353
1031 3300005614 Ga0068856_100003679 Ga0068856_1000036798 353
1032 3300013105 Ga0157369_10149961 Ga0157369_101499612 353
1033 3300013307 Ga0157372_10132603 Ga0157372_101326033 353
1034 3300025944 Ga0207661_10200496 Ga0207661_102004962 353
1035 3300026116 Ga0207674_10004406 Ga0207674_1000440610 353
1036 3300042876 Ga0451577_0000980 Ga0451577_0000980_36791_37918 353
1037 3300042876 Ga0451577_0069109 Ga0451577_0069109_1223_2344 353
1038 3300044712 Ga0453684_0006656 Ga0453684_0006656_2238_3365 353
1039 3300044712 Ga0453684_0171385 Ga0453684_0171385_1233_2360 353
1040 3300009147 Ga0114129_10086192 Ga0114129_100861923 354
1041 3300044673 Ga0453683_0009560 Ga0453683_0009560_1583_2803 354
1042 3300044712 Ga0453684_0037563 Ga0453684_0037563_291_1448 354
1043 3300031548 Ga0307408_100033771 Ga0307408_1000337713 355
1044 3300031901 Ga0307406_10032648 Ga0307406_100326483 355
1045 3300031903 Ga0307407_10159379 Ga0307407_101593792 355
1046 3300031995 Ga0307409_100039280 Ga0307409_1000392803 355
1047 3300032005 Ga0307411_10008588 Ga0307411_100085884 355
1048 3300001991 JGI24743J22301_10011800 JGI24743J22301_100118001 356
1049 3300005290 Ga0065712_10091258 Ga0065712_100912582 356
1050 3300005329 Ga0070683_100382503 Ga0070683_1003825031 356
1051 3300005331 Ga0070670_100323744 Ga0070670_1003237442 356
1052 3300005338 Ga0068868_100104213 Ga0068868_1001042131 356
1053 3300005355 Ga0070671_100098145 Ga0070671_1000981452 356
1054 3300005356 Ga0070674_100015728 Ga0070674_1000157284 356
1055 3300005367 Ga0070667_100099279 Ga0070667_1000992792 356
1056 3300005844 Ga0068862_100176540 Ga0068862_1001765401 356
1057 3300013308 Ga0157375_10292559 Ga0157375_102925591 356
1058 3300025315 Ga0207697_10004184 Ga0207697_100041842 356
1059 3300025901 Ga0207688_10007105 Ga0207688_100071053 356
1060 3300025926 Ga0207659_10078575 Ga0207659_100785752 356
1061 3300025931 Ga0207644_10102858 Ga0207644_101028582 356
1062 3300025937 Ga0207669_10160265 Ga0207669_101602652 356
1063 3300025944 Ga0207661_10340495 Ga0207661_103404951 356
1064 3300025945 Ga0207679_10111126 Ga0207679_101111262 356
1065 3300046499 Ga0495594_0132343 Ga0495594_0132343_62_1132 356
1066 3300048919 Ga0496116_0070732 Ga0496116_0070732_178_1311 356

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

64

188

0.95

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

216

391

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zic-assembly2.cif.gz_E crystal structure of aspartate semialdehyde dehydrogenase with nadp from trichophyton rubrum 0.9741 12 355
4zhs-assembly1.cif.gz_D crystal structure of aspartate semialdehyde dehydrogenase from trichophyton rubrum 0.9727 12 355
6c8w-assembly1.cif.gz_A crystal structure of aspartate semialdehyde dehydrogenase with nadp from blastomyces dermatitidis 0.9718 10 355
4zhs-assembly1.cif.gz_C crystal structure of aspartate semialdehyde dehydrogenase from trichophyton rubrum 0.9708 12 355
2ep5-assembly1.cif.gz_D structural study of project id st1242 from sulfolobus tokodaii strain7 0.9707 10 355
ID Description Score Start End Superfamily
af_Q57658_3_151_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9827 9 150 3.40.50.720
af_P78780_5_150_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9698 14 155 3.30.360.10
1ys4B02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9676 156 332 3.30.360.10
2ep5C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9626 10 155 3.40.50.720
1ys4B02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.962 156 332 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A7C5IYS8-F1-model_v4 Aspartate-semialdehyde dehydrogenase 1.001 265 355 GO:0004073
GO:0009086
GO:0009088
GO:0046983
AF-A0A1V6KCB6-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9994 281 356 GO:0004073
GO:0009086
GO:0009088
AF-A0A3N5GGW9-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9993 271 355 GO:0004073
GO:0009086
GO:0009088
GO:0046983
AF-A0A497K989-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9991 249 355 GO:0004073
GO:0009086
GO:0009088
GO:0046983
AF-A0A522ESS5-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9976 280 356 GO:0004073
GO:0009086
GO:0009088
GO:0046983

Feature Viewer

pLDDT pTM Quality
93.33 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map