F489343

General Info

Members Datasets Scaffolds Average Seq Length
1064 404 2126 88

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10177524|Ga0075433_101775242
Length 102
Sequence MKRSTYTDEQILAIVKEGEAGRKVADLCRSHGISEQTYYRWKAKYGGMELSEMQRLKQLEDENRRLKHIVAEQTLDIQALNAVVAKKWSAPSRGPVCDEPVG

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
116 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
120 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
121 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
215 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
216 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
222 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
230 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
235 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
236 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
237 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
240 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
241 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
242 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
243 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
244 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
249 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
250 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
251 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
253 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
255 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
259 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
266 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
267 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
268 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
269 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
270 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
271 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
272 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
273 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
274 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
275 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
276 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
277 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
278 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
279 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
280 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
281 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
282 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
283 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
284 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
285 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
286 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
287 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
288 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
289 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
290 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
291 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
292 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
293 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
294 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
295 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
296 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
297 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
298 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
299 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
300 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
301 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
302 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
303 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
304 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
305 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
306 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
309 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
310 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
311 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
312 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
313 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
314 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
315 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
316 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
317 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
321 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
322 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
323 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
324 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
325 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
326 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
327 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
328 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
329 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
330 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
333 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
334 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
335 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
336 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
337 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
338 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
339 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
340 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
341 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
342 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
345 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
368 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
369 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
370 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
371 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
372 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
373 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
374 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
375 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
376 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
377 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
378 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
379 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
380 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
381 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
382 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
390 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
398 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
399 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
403 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
404 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 1.5
Rhizosphere 97.65
Stem 0
Stem Tuber 0
Unclassified 15.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10177524 3300006852 Bacteria 1895
2 JGI24739J22299_10266415 3300001989 Bacteria 501
3 JGI24750J21931_1026287 3300002070 Bacteria 838
4 JGI24745J21846_1010174 3300002073 Bacteria 1069
5 JGI24748J21848_1011908 3300002074 Bacteria 1025
6 JGI24738J21930_10048949 3300002075 Bacteria 861
7 JGI24749J21850_1011346 3300002076 Bacteria 1251
8 JGI24749J21850_1011472 3300002076 Bacteria 1244
9 JGI24744J21845_10084781 3300002077 Bacteria 580
10 JGI24034J26672_10012518 3300002239 Bacteria 1279
11 JGI24742J22300_10016512 3300002244 Bacteria 1246
12 JGI24751J29686_10017613 3300002459 Bacteria 1477
13 JGI24751J29686_10126619 3300002459 Bacteria 537
14 Ga0058860_12052141 3300004801 Bacteria 531
15 Ga0065704_10816231 3300005289 Bacteria 520
16 Ga0065715_10206191 3300005293 Bacteria 1335
17 Ga0065715_10559367 3300005293 Bacteria 735
18 Ga0065715_10935716 3300005293 Bacteria 564
19 Ga0065715_11056628 3300005293 Bacteria 530
20 Ga0065707_10154356 3300005295 Bacteria 1624
21 Ga0065707_10187395 3300005295 Bacteria 1381
22 Ga0070676_10096332 3300005328 Bacteria 1821
23 Ga0070676_10226698 3300005328 Bacteria 1237
24 Ga0070676_10409838 3300005328 Bacteria 945
25 Ga0070676_10695783 3300005328 Bacteria 742
26 Ga0070683_100078772 3300005329 Bacteria 3083
27 Ga0070683_100131022 3300005329 Bacteria 2373
28 Ga0070683_100454541 3300005329 Bacteria 1222
29 Ga0070690_100008090 3300005330 Bacteria 6040
30 Ga0070690_100123800 3300005330 Bacteria 1738
31 Ga0070690_101352275 3300005330 Bacteria 572
32 Ga0070670_100074697 3300005331 Bacteria 2912
33 Ga0070670_100109278 3300005331 Bacteria 2383
34 Ga0070670_100359551 3300005331 Bacteria 1280
35 Ga0070670_100392682 3300005331 Unclassified 1224
36 Ga0070670_102176457 3300005331 Bacteria 511
37 Ga0070677_10161620 3300005333 Bacteria 1051
38 Ga0070677_10370079 3300005333 Bacteria 747
39 Ga0070677_10837580 3300005333 Bacteria 528
40 Ga0068869_100023556 3300005334 Bacteria 4254
41 Ga0068869_100090649 3300005334 Bacteria 2298
42 Ga0068869_100299510 3300005334 Bacteria 1298
43 Ga0068869_101649559 3300005334 Bacteria 572
44 Ga0070666_10043570 3300005335 Bacteria 3005
45 Ga0070666_10831291 3300005335 Bacteria 681
46 Ga0070666_10855169 3300005335 Bacteria 671
47 Ga0070666_11347649 3300005335 Bacteria 533
48 Ga0070680_100174485 3300005336 Bacteria 1809
49 Ga0070680_100238513 3300005336 Bacteria 1537
50 Ga0070680_100507951 3300005336 Bacteria 1031
51 Ga0070680_100536981 3300005336 Bacteria 1002
52 Ga0070682_100029078 3300005337 Bacteria 3326
53 Ga0070682_100105836 3300005337 Bacteria 1866
54 Ga0068868_100145778 3300005338 Bacteria 1947
55 Ga0068868_100342719 3300005338 Bacteria 1278
56 Ga0068868_100386728 3300005338 Bacteria 1205
57 Ga0068868_102410635 3300005338 Unclassified 503
58 Ga0070660_100037223 3300005339 Bacteria 3689
59 Ga0070660_100297337 3300005339 Bacteria 1323
60 Ga0070660_100530425 3300005339 Bacteria 981
61 Ga0070689_100027928 3300005340 Bacteria 4260
62 Ga0070689_100048972 3300005340 Bacteria 3261
63 Ga0070689_100816454 3300005340 Bacteria 821
64 Ga0070691_10055975 3300005341 Bacteria 1890
65 Ga0070691_10057126 3300005341 Bacteria 1872
66 Ga0070691_10932242 3300005341 Bacteria 538
67 Ga0070687_100000955 3300005343 Bacteria 9832
68 Ga0070687_100033857 3300005343 Bacteria 2525
69 Ga0070687_100138072 3300005343 Bacteria 1416
70 Ga0070687_101128869 3300005343 Unclassified 575
71 Ga0070687_101351380 3300005343 Unclassified 531
72 Ga0070661_100038173 3300005344 Bacteria 3495
73 Ga0070661_100344775 3300005344 Bacteria 1168
74 Ga0070661_101607048 3300005344 Bacteria 550
75 Ga0070692_10024218 3300005345 Bacteria 2982
76 Ga0070692_10103362 3300005345 Bacteria 1565
77 Ga0070668_100650894 3300005347 Bacteria 926
78 Ga0070668_101326534 3300005347 Unclassified 654
79 Ga0070668_101372365 3300005347 Bacteria 644
80 Ga0070669_100109319 3300005353 Bacteria 2096
81 Ga0070669_100316562 3300005353 Bacteria 1259
82 Ga0070669_100560082 3300005353 Bacteria 954
83 Ga0070669_101347021 3300005353 Unclassified 619
84 Ga0070675_100004802 3300005354 Bacteria 10310
85 Ga0070675_100118376 3300005354 Bacteria 2249
86 Ga0070675_100199593 3300005354 Bacteria 1736
87 Ga0070675_100253845 3300005354 Bacteria 1540
88 Ga0070675_100328381 3300005354 Bacteria 1352
89 Ga0070675_101942405 3300005354 Bacteria 543
90 Ga0070671_100179691 3300005355 Bacteria 1791
91 Ga0070671_100229799 3300005355 Bacteria 1574
92 Ga0070671_100318365 3300005355 Bacteria 1325
93 Ga0070671_101632433 3300005355 Unclassified 572
94 Ga0070674_100821028 3300005356 Bacteria 804
95 Ga0070674_101202495 3300005356 Bacteria 673
96 Ga0070673_100302069 3300005364 Bacteria 1409
97 Ga0070673_100314216 3300005364 Bacteria 1383
98 Ga0070673_100486947 3300005364 Bacteria 1114
99 Ga0070673_100671242 3300005364 Bacteria 950
100 Ga0070673_100897343 3300005364 Bacteria 822
101 Ga0070688_100063700 3300005365 Bacteria 2338
102 Ga0070688_100111240 3300005365 Bacteria 1822
103 Ga0070688_100767591 3300005365 Bacteria 752
104 Ga0070688_100981632 3300005365 Bacteria 670
105 Ga0070659_100113765 3300005366 Bacteria 2186
106 Ga0070659_100349647 3300005366 Bacteria 1240
107 Ga0070659_100498986 3300005366 Bacteria 1037
108 Ga0070667_100225281 3300005367 Bacteria 1670
109 Ga0070667_101187046 3300005367 Bacteria 714
110 Ga0070703_10004974 3300005406 Bacteria 3709
111 Ga0070703_10051971 3300005406 Bacteria 1313
112 Ga0070703_10101491 3300005406 Bacteria 1015
113 Ga0070709_11787129 3300005434 Bacteria 503
114 Ga0070701_10021491 3300005438 Bacteria 3081
115 Ga0070701_10066735 3300005438 Bacteria 1913
116 Ga0070701_10088687 3300005438 Bacteria 1690
117 Ga0070701_10855687 3300005438 Unclassified 624
118 Ga0070711_101060362 3300005439 Bacteria 697
119 Ga0070705_100085440 3300005440 Bacteria 1950
120 Ga0070705_100124783 3300005440 Bacteria 1669
121 Ga0070705_100134876 3300005440 Bacteria 1616
122 Ga0070705_100255333 3300005440 Bacteria 1233
123 Ga0070705_101168018 3300005440 Unclassified 633
124 Ga0070700_100046222 3300005441 Bacteria 2689
125 Ga0070700_100147780 3300005441 Bacteria 1604
126 Ga0070700_100165838 3300005441 Bacteria 1525
127 Ga0070700_100248851 3300005441 Bacteria 1274
128 Ga0070700_100651422 3300005441 Bacteria 832
129 Ga0070694_100012293 3300005444 Bacteria 5319
130 Ga0070694_100016000 3300005444 Bacteria 4720
131 Ga0070694_100132377 3300005444 Bacteria 1803
132 Ga0070694_100232751 3300005444 Bacteria 1387
133 Ga0070694_100468554 3300005444 Bacteria 997
134 Ga0070708_100023219 3300005445 Bacteria 5271
135 Ga0070708_100248277 3300005445 Bacteria 1671
136 Ga0070708_100324249 3300005445 Bacteria 1451
137 Ga0070708_100356529 3300005445 Bacteria 1378
138 Ga0070708_100459374 3300005445 Bacteria 1201
139 Ga0070708_100783155 3300005445 Unclassified 897
140 Ga0070663_100188150 3300005455 Bacteria 1605
141 Ga0070663_100549883 3300005455 Bacteria 965
142 Ga0070663_101493581 3300005455 Unclassified 600
143 Ga0070663_101959686 3300005455 Unclassified 527
144 Ga0070678_100218030 3300005456 Bacteria 1585
145 Ga0070678_100270009 3300005456 Bacteria 1434
146 Ga0070678_100370921 3300005456 Bacteria 1236
147 Ga0070662_100124487 3300005457 Bacteria 1979
148 Ga0070662_100302340 3300005457 Bacteria 1300
149 Ga0070662_100661499 3300005457 Bacteria 882
150 Ga0070662_101220080 3300005457 Unclassified 647
151 Ga0070681_10112839 3300005458 Bacteria 2658
152 Ga0070681_10127523 3300005458 Bacteria 2477
153 Ga0070681_10377448 3300005458 Bacteria 1328
154 Ga0070681_10969717 3300005458 Bacteria 770
155 Ga0070681_11125419 3300005458 Unclassified 706
156 Ga0070681_11635651 3300005458 Bacteria 570
157 Ga0068867_100197845 3300005459 Bacteria 1607
158 Ga0068867_100601866 3300005459 Bacteria 959
159 Ga0070685_10149309 3300005466 Bacteria 1480
160 Ga0070685_10535694 3300005466 Bacteria 834
161 Ga0070685_10590172 3300005466 Bacteria 798
162 Ga0070706_100159971 3300005467 Bacteria 2102
163 Ga0070706_100823841 3300005467 Bacteria 859
164 Ga0070706_100832824 3300005467 Bacteria 853
165 Ga0070706_101097586 3300005467 Bacteria 732
166 Ga0070706_101266614 3300005467 Unclassified 677
167 Ga0070706_101807235 3300005467 Unclassified 555
168 Ga0070707_100137998 3300005468 Unclassified 2372
169 Ga0070707_100433758 3300005468 Bacteria 1274
170 Ga0070707_101177628 3300005468 Bacteria 732
171 Ga0070707_101412710 3300005468 Unclassified 662
172 Ga0070698_100078722 3300005471 Bacteria 3294
173 Ga0070698_100173826 3300005471 Bacteria 2094
174 Ga0070698_101032220 3300005471 Bacteria 770
175 Ga0070698_101163061 3300005471 Bacteria 720
176 Ga0070698_101486611 3300005471 Bacteria 629
177 Ga0070698_102234686 3300005471 Bacteria 501
178 Ga0070699_100068492 3300005518 Bacteria 3082
179 Ga0070699_100096495 3300005518 Bacteria 2589
180 Ga0070699_100112158 3300005518 Bacteria 2395
181 Ga0070699_100829009 3300005518 Bacteria 847
182 Ga0070699_101097765 3300005518 Bacteria 730
183 Ga0070699_101150886 3300005518 Bacteria 712
184 Ga0070699_101278522 3300005518 Unclassified 673
185 Ga0070699_101823677 3300005518 Unclassified 557
186 Ga0070679_100145258 3300005530 Bacteria 2350
187 Ga0070679_100161780 3300005530 Bacteria 2213
188 Ga0070679_100223270 3300005530 Bacteria 1844
189 Ga0070679_100824852 3300005530 Unclassified 871
190 Ga0070684_100023645 3300005535 Bacteria 5144
191 Ga0070684_100567563 3300005535 Bacteria 1054
192 Ga0070684_100594538 3300005535 Unclassified 1028
193 Ga0070684_100596362 3300005535 Bacteria 1027
194 Ga0070697_100155274 3300005536 Bacteria 1931
195 Ga0070697_100283026 3300005536 Bacteria 1423
196 Ga0070697_100319945 3300005536 Bacteria 1336
197 Ga0070697_100432638 3300005536 Bacteria 1144
198 Ga0070697_100829856 3300005536 Bacteria 818
199 Ga0068853_100161593 3300005539 Bacteria 2022
200 Ga0068853_100345238 3300005539 Bacteria 1384
201 Ga0068853_100523405 3300005539 Bacteria 1121
202 Ga0070672_100048567 3300005543 Bacteria 3298
203 Ga0070672_100070253 3300005543 Bacteria 2782
204 Ga0070672_100274141 3300005543 Bacteria 1425
205 Ga0070672_101117543 3300005543 Bacteria 701
206 Ga0070672_101799012 3300005543 Bacteria 551
207 Ga0070686_100176863 3300005544 Bacteria 1513
208 Ga0070686_100223487 3300005544 Bacteria 1362
209 Ga0070686_100833542 3300005544 Bacteria 746
210 Ga0070686_100934119 3300005544 Unclassified 708
211 Ga0070686_101960053 3300005544 Bacteria 501
212 Ga0070695_100014665 3300005545 Bacteria 4724
213 Ga0070695_100155250 3300005545 Bacteria 1601
214 Ga0070695_100164193 3300005545 Bacteria 1562
215 Ga0070695_101173092 3300005545 Bacteria 631
216 Ga0070695_101259682 3300005545 Bacteria 610
217 Ga0070696_100131157 3300005546 Bacteria 1823
218 Ga0070696_100144497 3300005546 Bacteria 1741
219 Ga0070696_100146423 3300005546 Bacteria 1730
220 Ga0070696_100318739 3300005546 Bacteria 1196
221 Ga0070693_100017173 3300005547 Bacteria 3758
222 Ga0070693_100223989 3300005547 Bacteria 1234
223 Ga0070665_100326456 3300005548 Bacteria 1539
224 Ga0070704_100052210 3300005549 Bacteria 2883
225 Ga0070704_100067160 3300005549 Bacteria 2588
226 Ga0070704_100223487 3300005549 Bacteria 1532
227 Ga0070704_100303084 3300005549 Bacteria 1332
228 Ga0070704_100637418 3300005549 Unclassified 940
229 Ga0070704_100689679 3300005549 Unclassified 905
230 Ga0070704_100984953 3300005549 Unclassified 762
231 Ga0068855_100027115 3300005563 Bacteria 6854
232 Ga0068855_100093765 3300005563 Bacteria 3462
233 Ga0068855_100580796 3300005563 Bacteria 1210
234 Ga0070664_100242413 3300005564 Bacteria 1618
235 Ga0070664_100268426 3300005564 Bacteria 1536
236 Ga0070664_100294591 3300005564 Bacteria 1465
237 Ga0070664_101254267 3300005564 Bacteria 700
238 Ga0070664_101282653 3300005564 Bacteria 692
239 Ga0070664_101577715 3300005564 Bacteria 622
240 Ga0068857_100088462 3300005577 Bacteria 2771
241 Ga0068857_100262774 3300005577 Bacteria 1584
242 Ga0068857_100267502 3300005577 Bacteria 1570
243 Ga0068857_100347665 3300005577 Bacteria 1373
244 Ga0068857_100356397 3300005577 Bacteria 1355
245 Ga0068857_100445219 3300005577 Bacteria 1210
246 Ga0068857_101767641 3300005577 Bacteria 605
247 Ga0068854_100229498 3300005578 Bacteria 1473
248 Ga0068854_100349622 3300005578 Bacteria 1210
249 Ga0068854_100358931 3300005578 Unclassified 1195
250 Ga0068854_100364328 3300005578 Bacteria 1187
251 Ga0068856_100012950 3300005614 Bacteria 8075
252 Ga0068856_100520683 3300005614 Bacteria 1210
253 Ga0070702_100048137 3300005615 Bacteria 2425
254 Ga0070702_100058390 3300005615 Bacteria 2235
255 Ga0070702_100063399 3300005615 Bacteria 2158
256 Ga0070702_100521135 3300005615 Unclassified 877
257 Ga0070702_101854355 3300005615 Unclassified 505
258 Ga0068852_100252970 3300005616 Bacteria 1688
259 Ga0068852_102009356 3300005616 Bacteria 600
260 Ga0068852_102649599 3300005616 Bacteria 521
261 Ga0068859_100002936 3300005617 Bacteria 17301
262 Ga0068859_100066879 3300005617 Bacteria 3629
263 Ga0068859_100272917 3300005617 Bacteria 1783
264 Ga0068859_100373551 3300005617 Bacteria 1521
265 Ga0068859_100441466 3300005617 Bacteria 1398
266 Ga0068864_100037195 3300005618 Bacteria 4153
267 Ga0068864_100198208 3300005618 Bacteria 1843
268 Ga0068864_100480456 3300005618 Bacteria 1192
269 Ga0068864_101164304 3300005618 Bacteria 769
270 Ga0068866_10067847 3300005718 Bacteria 1873
271 Ga0068861_100014326 3300005719 Bacteria 5562
272 Ga0068861_100185263 3300005719 Bacteria 1736
273 Ga0068861_100326738 3300005719 Bacteria 1337
274 Ga0068870_10102358 3300005840 Bacteria 1621
275 Ga0068870_10112461 3300005840 Bacteria 1557
276 Ga0068870_10600535 3300005840 Bacteria 748
277 Ga0068870_11458532 3300005840 Bacteria 503
278 Ga0068863_100112267 3300005841 Bacteria 2596
279 Ga0068863_100219157 3300005841 Bacteria 1833
280 Ga0068863_100346152 3300005841 Bacteria 1447
281 Ga0068858_100007318 3300005842 Bacteria 10688
282 Ga0068858_100226453 3300005842 Bacteria 1772
283 Ga0068858_100288932 3300005842 Bacteria 1563
284 Ga0068860_100020802 3300005843 Bacteria 6357
285 Ga0068860_100222305 3300005843 Bacteria 1834
286 Ga0068860_100337336 3300005843 Bacteria 1482
287 Ga0068862_100020058 3300005844 Bacteria 5581
288 Ga0068862_100278032 3300005844 Bacteria 1533
289 Ga0068862_100337760 3300005844 Bacteria 1394
290 Ga0068862_100690907 3300005844 Bacteria 988
291 Ga0068862_101054340 3300005844 Unclassified 806
292 Ga0081455_10241461 3300005937 Bacteria 1327
293 Ga0081539_10083330 3300005985 Bacteria 1674
294 Ga0075364_10021432 3300006051 Bacteria 4072
295 Ga0075364_10082899 3300006051 Unclassified 2121
296 Ga0075364_10761395 3300006051 Bacteria 660
297 Ga0070715_10061784 3300006163 Bacteria 1646
298 Ga0070715_10074494 3300006163 Bacteria 1525
299 Ga0070715_10982328 3300006163 Unclassified 525
300 Ga0097621_100088856 3300006237 Bacteria 2582
301 Ga0097621_100182468 3300006237 Bacteria 1814
302 Ga0097621_100988600 3300006237 Bacteria 787
303 Ga0097621_101132018 3300006237 Bacteria 736
304 Ga0097621_101749948 3300006237 Bacteria 592
305 Ga0068871_100017662 3300006358 Bacteria 5403
306 Ga0068871_100259132 3300006358 Bacteria 1516
307 Ga0068871_100561513 3300006358 Unclassified 1035
308 Ga0075428_100002738 3300006844 Bacteria 19190
309 Ga0075428_100088281 3300006844 Unclassified 3382
310 Ga0075428_100199871 3300006844 Unclassified 2161
311 Ga0075428_100271945 3300006844 Bacteria 1823
312 Ga0075428_101183825 3300006844 Unclassified 806
313 Ga0075428_101258300 3300006844 Unclassified 779
314 Ga0075428_101893650 3300006844 Bacteria 620
315 Ga0075428_102000529 3300006844 Unclassified 601
316 Ga0075428_102569642 3300006844 Bacteria 521
317 Ga0075430_100926942 3300006846 Bacteria 718
318 Ga0075430_101358469 3300006846 Bacteria 584
319 Ga0075431_100135338 3300006847 Bacteria 2540
320 Ga0075431_101323741 3300006847 Bacteria 681
321 Ga0075433_10260718 3300006852 Bacteria 1537
322 Ga0075433_10605860 3300006852 Bacteria 961
323 Ga0075433_10738156 3300006852 Unclassified 861
324 Ga0075433_10805488 3300006852 Bacteria 821
325 Ga0075433_11754380 3300006852 Unclassified 534
326 Ga0075434_100058544 3300006871 Bacteria 3829
327 Ga0075434_100350886 3300006871 Bacteria 1496
328 Ga0075434_100523649 3300006871 Unclassified 1206
329 Ga0075434_101218639 3300006871 Bacteria 764
330 Ga0075429_100155894 3300006880 Bacteria 2000
331 Ga0075429_100165267 3300006880 Bacteria 1939
332 Ga0075429_100618943 3300006880 Bacteria 949
333 Ga0075429_101624650 3300006880 Unclassified 562
334 Ga0068865_100157397 3300006881 Bacteria 1729
335 Ga0068865_100207925 3300006881 Bacteria 1523
336 Ga0075436_100154456 3300006914 Bacteria 1616
337 Ga0075436_100200505 3300006914 Bacteria 1413
338 Ga0075436_100814261 3300006914 Unclassified 696
339 Ga0075436_101422909 3300006914 Bacteria 526
340 Ga0097620_100002936 3300006931 Bacteria 17301
341 Ga0097620_100066879 3300006931 Bacteria 3629
342 Ga0097620_100272913 3300006931 Bacteria 1783
343 Ga0097620_100373544 3300006931 Bacteria 1521
344 Ga0097620_100441450 3300006931 Bacteria 1398
345 Ga0075435_100077927 3300007076 Bacteria 2717
346 Ga0075435_100153326 3300007076 Unclassified 1938
347 Ga0075435_100177617 3300007076 Unclassified 1798
348 Ga0075435_100543149 3300007076 Bacteria 1006
349 Ga0099794_10076537 3300007265 Bacteria 1645
350 Ga0099794_10078032 3300007265 Bacteria 1630
351 Ga0105250_10339764 3300009092 Bacteria 656
352 Ga0105240_10079802 3300009093 Bacteria 4026
353 Ga0105240_10186847 3300009093 Bacteria 2440
354 Ga0105240_11044335 3300009093 Bacteria 872
355 Ga0111539_10253073 3300009094 Bacteria 2051
356 Ga0111539_10265096 3300009094 Bacteria 2000
357 Ga0111539_10366226 3300009094 Bacteria 1678
358 Ga0111539_10580809 3300009094 Bacteria 1305
359 Ga0105245_10202829 3300009098 Bacteria 1905
360 Ga0105245_10745444 3300009098 Bacteria 1015
361 Ga0105245_12776175 3300009098 Bacteria 542
362 Ga0105247_10200910 3300009101 Bacteria 1339
363 Ga0105247_11011128 3300009101 Unclassified 650
364 Ga0105247_11457000 3300009101 Bacteria 556
365 Ga0114129_10000226 3300009147 Bacteria 62744
366 Ga0114129_10097617 3300009147 Bacteria 4067
367 Ga0114129_10456697 3300009147 Unclassified 1675
368 Ga0114129_10629583 3300009147 Bacteria 1387
369 Ga0114129_10662564 3300009147 Bacteria 1346
370 Ga0114129_10768836 3300009147 Unclassified 1232
371 Ga0114129_10972727 3300009147 Unclassified 1071
372 Ga0114129_13077559 3300009147 Bacteria 546
373 Ga0105243_10280467 3300009148 Bacteria 1501
374 Ga0105243_10841202 3300009148 Bacteria 908
375 Ga0105243_12135377 3300009148 Unclassified 596
376 Ga0105243_12737233 3300009148 Bacteria 534
377 Ga0105243_12929451 3300009148 Unclassified 517
378 Ga0105241_10082574 3300009174 Bacteria 2519
379 Ga0105241_10162432 3300009174 Bacteria 1837
380 Ga0105241_10300577 3300009174 Bacteria 1377
381 Ga0105242_10033462 3300009176 Bacteria 4115
382 Ga0105242_10360604 3300009176 Bacteria 1345
383 Ga0105242_12923864 3300009176 Bacteria 528
384 Ga0105248_10268787 3300009177 Bacteria 1920
385 Ga0105248_10428018 3300009177 Bacteria 1491
386 Ga0105248_10557772 3300009177 Bacteria 1292
387 Ga0105248_10562215 3300009177 Bacteria 1287
388 Ga0105248_11491923 3300009177 Unclassified 765
389 Ga0105248_11535387 3300009177 Bacteria 754
390 Ga0105248_11878738 3300009177 Bacteria 679
391 Ga0105248_12755862 3300009177 Bacteria 561
392 Ga0105237_10147755 3300009545 Bacteria 2346
393 Ga0105237_11415114 3300009545 Unclassified 702
394 Ga0105237_11858371 3300009545 Bacteria 610
395 Ga0105238_10974693 3300009551 Unclassified 868
396 Ga0105238_12099507 3300009551 Bacteria 599
397 Ga0105238_12255919 3300009551 Bacteria 579
398 Ga0105249_10280119 3300009553 Bacteria 1665
399 Ga0105249_10305628 3300009553 Bacteria 1597
400 Ga0105249_10369383 3300009553 Bacteria 1458
401 Ga0105249_10506367 3300009553 Bacteria 1253
402 Ga0105249_11134258 3300009553 Bacteria 852
403 Ga0105249_11688045 3300009553 Unclassified 706
404 Ga0105029_108183 3300009984 Unclassified 766
405 Ga0099796_10231261 3300010159 Unclassified 761
406 Ga0099796_10397950 3300010159 Unclassified 603
407 Ga0105239_10234769 3300010375 Bacteria 2058
408 Ga0105239_10331908 3300010375 Bacteria 1716
409 Ga0105239_11516504 3300010375 Bacteria 775
410 Ga0105239_12289831 3300010375 Bacteria 629
411 Ga0105239_13058685 3300010375 Bacteria 545
412 Ga0105246_10091933 3300011119 Bacteria 2188
413 Ga0105246_10198369 3300011119 Bacteria 1558
414 Ga0105246_10233619 3300011119 Bacteria 1449
415 Ga0105246_11175059 3300011119 Unclassified 705
416 Ga0105246_11182816 3300011119 Unclassified 703
417 Ga0157328_1024325 3300012478 Bacteria 534
418 Ga0157329_1035116 3300012491 Bacteria 539
419 Ga0157313_1029975 3300012503 Bacteria 611
420 Ga0157373_10234914 3300013100 Bacteria 1295
421 Ga0157373_10294125 3300013100 Bacteria 1152
422 Ga0157371_10165431 3300013102 Bacteria 1580
423 Ga0157371_10172587 3300013102 Bacteria 1546
424 Ga0157370_10037829 3300013104 Bacteria 4672
425 Ga0157370_10228200 3300013104 Bacteria 1724
426 Ga0157369_10066033 3300013105 Bacteria 3893
427 Ga0157369_10242643 3300013105 Bacteria 1882
428 Ga0157374_10955526 3300013296 Bacteria 875
429 Ga0157374_10971853 3300013296 Bacteria 868
430 Ga0157374_11930117 3300013296 Bacteria 616
431 Ga0157378_10305023 3300013297 Bacteria 1542
432 Ga0157378_11832771 3300013297 Unclassified 655
433 Ga0157378_11947519 3300013297 Bacteria 637
434 Ga0163162_10397089 3300013306 Bacteria 1512
435 Ga0163162_10696053 3300013306 Bacteria 1138
436 Ga0163162_12489716 3300013306 Archaea 595
437 Ga0163162_12977790 3300013306 Bacteria 544
438 Ga0157372_10005251 3300013307 Bacteria 13755
439 Ga0157372_10441950 3300013307 Bacteria 1516
440 Ga0157372_11213646 3300013307 Bacteria 871
441 Ga0157372_11768269 3300013307 Bacteria 711
442 Ga0157372_11960380 3300013307 Bacteria 673
443 Ga0157375_10298390 3300013308 Bacteria 1775
444 Ga0157375_10456617 3300013308 Bacteria 1443
445 Ga0157375_10525265 3300013308 Bacteria 1346
446 Ga0157375_10576036 3300013308 Bacteria 1286
447 Ga0157375_10748734 3300013308 Bacteria 1128
448 Ga0157375_13392015 3300013308 Bacteria 531
449 Ga0163163_10325233 3300014325 Bacteria 1591
450 Ga0163163_10402124 3300014325 Bacteria 1428
451 Ga0163163_10947489 3300014325 Bacteria 924
452 Ga0163163_11069368 3300014325 Bacteria 870
453 Ga0163163_11757223 3300014325 Bacteria 681
454 Ga0163163_12587584 3300014325 Bacteria 565
455 Ga0163163_13148202 3300014325 Bacteria 514
456 Ga0157380_10025157 3300014326 Bacteria 4512
457 Ga0157380_10351274 3300014326 Bacteria 1380
458 Ga0157380_10719039 3300014326 Bacteria 1006
459 Ga0157380_11410910 3300014326 Bacteria 747
460 Ga0157380_11670131 3300014326 Unclassified 694
461 Ga0157380_11847841 3300014326 Bacteria 664
462 Ga0182008_10052695 3300014497 Bacteria 2016
463 Ga0157377_10082241 3300014745 Bacteria 1885
464 Ga0157377_10133264 3300014745 Bacteria 1520
465 Ga0157377_10155478 3300014745 Bacteria 1418
466 Ga0157377_10359922 3300014745 Bacteria 979
467 Ga0157377_10887418 3300014745 Bacteria 665
468 Ga0157377_11482913 3300014745 Unclassified 538
469 Ga0157379_10074980 3300014968 Bacteria 3028
470 Ga0157379_10136425 3300014968 Bacteria 2211
471 Ga0157379_12439341 3300014968 Bacteria 522
472 Ga0157376_10176588 3300014969 Bacteria 1949
473 Ga0157376_10233212 3300014969 Bacteria 1711
474 Ga0157376_12478499 3300014969 Unclassified 558
475 Ga0157376_12571292 3300014969 Bacteria 549
476 Ga0182007_10028842 3300015262 Bacteria 1904
477 Ga0182007_10169180 3300015262 Bacteria 751
478 Ga0182005_1249738 3300015265 Unclassified 548
479 Ga0163161_10531221 3300017792 Bacteria 962
480 Ga0163161_10605107 3300017792 Unclassified 904
481 Ga0163161_10798064 3300017792 Bacteria 793
482 Ga0206353_11537424 3300020082 Bacteria 1199
483 Ga0213876_10299092 3300021384 Unclassified 855
484 Ga0207697_10266705 3300025315 Bacteria 758
485 Ga0207697_10269913 3300025315 Bacteria 753
486 Ga0207697_10425363 3300025315 Bacteria 589
487 Ga0207656_10576485 3300025321 Bacteria 574
488 Ga0207653_10003598 3300025885 Bacteria 4880
489 Ga0207653_10016743 3300025885 Bacteria 2303
490 Ga0207653_10030644 3300025885 Bacteria 1736
491 Ga0207682_10043659 3300025893 Bacteria 1835
492 Ga0207682_10095358 3300025893 Bacteria 1295
493 Ga0207682_10556974 3300025893 Bacteria 542
494 Ga0207642_10039734 3300025899 Bacteria 2047
495 Ga0207642_10326844 3300025899 Bacteria 897
496 Ga0207710_10598106 3300025900 Unclassified 576
497 Ga0207688_10044602 3300025901 Bacteria 2471
498 Ga0207688_10079299 3300025901 Bacteria 1873
499 Ga0207688_10241385 3300025901 Bacteria 1093
500 Ga0207688_10295142 3300025901 Bacteria 990
501 Ga0207680_10363798 3300025903 Bacteria 1017
502 Ga0207680_10570028 3300025903 Bacteria 809
503 Ga0207680_10575205 3300025903 Bacteria 805
504 Ga0207647_10116707 3300025904 Bacteria 1576
505 Ga0207647_10132928 3300025904 Bacteria 1461
506 Ga0207647_10337155 3300025904 Bacteria 855
507 Ga0207647_10556405 3300025904 Bacteria 636
508 Ga0207685_10614014 3300025905 Bacteria 585
509 Ga0207699_10254393 3300025906 Bacteria 1212
510 Ga0207645_10093028 3300025907 Bacteria 1940
511 Ga0207645_10094019 3300025907 Bacteria 1929
512 Ga0207645_10203178 3300025907 Bacteria 1304
513 Ga0207645_10568707 3300025907 Bacteria 769
514 Ga0207645_10979791 3300025907 Bacteria 573
515 Ga0207643_10025429 3300025908 Bacteria 3272
516 Ga0207643_10149944 3300025908 Bacteria 1397
517 Ga0207643_10157115 3300025908 Bacteria 1366
518 Ga0207643_10906875 3300025908 Bacteria 571
519 Ga0207705_10333195 3300025909 Bacteria 1167
520 Ga0207705_11527815 3300025909 Bacteria 505
521 Ga0207684_10072334 3300025910 Bacteria 2928
522 Ga0207684_10327693 3300025910 Bacteria 1319
523 Ga0207684_10717408 3300025910 Bacteria 849
524 Ga0207684_10727763 3300025910 Bacteria 842
525 Ga0207684_10819083 3300025910 Bacteria 786
526 Ga0207684_10957203 3300025910 Bacteria 718
527 Ga0207684_11042464 3300025910 Bacteria 683
528 Ga0207654_10014867 3300025911 Bacteria 4030
529 Ga0207654_10189273 3300025911 Bacteria 1348
530 Ga0207707_10134106 3300025912 Bacteria 2166
531 Ga0207707_10250932 3300025912 Bacteria 1537
532 Ga0207707_10354263 3300025912 Bacteria 1264
533 Ga0207707_10483906 3300025912 Unclassified 1057
534 Ga0207707_10561188 3300025912 Bacteria 969
535 Ga0207707_10608568 3300025912 Unclassified 924
536 Ga0207695_10060157 3300025913 Bacteria 3934
537 Ga0207695_10317441 3300025913 Bacteria 1448
538 Ga0207671_10222326 3300025914 Bacteria 1479
539 Ga0207663_11367695 3300025916 Bacteria 570
540 Ga0207660_10152572 3300025917 Bacteria 1776
541 Ga0207660_10246470 3300025917 Bacteria 1409
542 Ga0207660_10445923 3300025917 Bacteria 1046
543 Ga0207660_10789817 3300025917 Bacteria 775
544 Ga0207660_11262681 3300025917 Bacteria 600
545 Ga0207660_11399086 3300025917 Unclassified 567
546 Ga0207662_10043066 3300025918 Bacteria 2663
547 Ga0207662_10086345 3300025918 Bacteria 1923
548 Ga0207662_10119518 3300025918 Bacteria 1651
549 Ga0207662_11003173 3300025918 Unclassified 593
550 Ga0207662_11162987 3300025918 Unclassified 549
551 Ga0207657_10306635 3300025919 Bacteria 1257
552 Ga0207657_10419970 3300025919 Bacteria 1051
553 Ga0207649_10295995 3300025920 Bacteria 1182
554 Ga0207652_10200894 3300025921 Bacteria 1794
555 Ga0207652_10317248 3300025921 Bacteria 1407
556 Ga0207652_10356831 3300025921 Bacteria 1319
557 Ga0207652_10421225 3300025921 Bacteria 1204
558 Ga0207652_11700018 3300025921 Unclassified 536
559 Ga0207646_10018667 3300025922 Bacteria 6466
560 Ga0207646_10286618 3300025922 Bacteria 1488
561 Ga0207646_10287931 3300025922 Bacteria 1484
562 Ga0207646_10586392 3300025922 Bacteria 1001
563 Ga0207646_11303733 3300025922 Bacteria 634
564 Ga0207681_10095965 3300025923 Bacteria 2128
565 Ga0207681_10329302 3300025923 Bacteria 1217
566 Ga0207681_10329587 3300025923 Bacteria 1216
567 Ga0207681_11225888 3300025923 Unclassified 630
568 Ga0207681_11507878 3300025923 Bacteria 564
569 Ga0207681_11651303 3300025923 Bacteria 536
570 Ga0207650_10091400 3300025925 Bacteria 2326
571 Ga0207650_10116210 3300025925 Bacteria 2077
572 Ga0207650_10284430 3300025925 Bacteria 1347
573 Ga0207650_10529776 3300025925 Unclassified 986
574 Ga0207650_10597443 3300025925 Bacteria 928
575 Ga0207650_11181618 3300025925 Bacteria 651
576 Ga0207650_11637786 3300025925 Bacteria 546
577 Ga0207659_10042089 3300025926 Bacteria 3201
578 Ga0207659_10322288 3300025926 Bacteria 1275
579 Ga0207659_10481984 3300025926 Bacteria 1048
580 Ga0207659_10901390 3300025926 Bacteria 760
581 Ga0207687_10305625 3300025927 Bacteria 1282
582 Ga0207687_10314524 3300025927 Bacteria 1266
583 Ga0207700_10403149 3300025928 Bacteria 1199
584 Ga0207644_10330572 3300025931 Bacteria 1234
585 Ga0207644_10385155 3300025931 Bacteria 1144
586 Ga0207644_10628797 3300025931 Bacteria 892
587 Ga0207690_10082981 3300025932 Bacteria 2242
588 Ga0207706_10187782 3300025933 Bacteria 1814
589 Ga0207706_10309929 3300025933 Bacteria 1375
590 Ga0207706_10368250 3300025933 Bacteria 1248
591 Ga0207686_10070928 3300025934 Bacteria 2240
592 Ga0207686_10178373 3300025934 Bacteria 1504
593 Ga0207686_10969096 3300025934 Bacteria 689
594 Ga0207709_10261330 3300025935 Bacteria 1270
595 Ga0207709_10281720 3300025935 Bacteria 1228
596 Ga0207709_11458388 3300025935 Unclassified 567
597 Ga0207670_10281972 3300025936 Bacteria 1295
598 Ga0207670_10292289 3300025936 Bacteria 1273
599 Ga0207670_10300929 3300025936 Bacteria 1256
600 Ga0207670_10780031 3300025936 Bacteria 795
601 Ga0207670_10798247 3300025936 Bacteria 786
602 Ga0207670_10825557 3300025936 Bacteria 773
603 Ga0207670_11422714 3300025936 Unclassified 589
604 Ga0207669_10305259 3300025937 Bacteria 1211
605 Ga0207704_10278519 3300025938 Bacteria 1270
606 Ga0207704_10284908 3300025938 Bacteria 1258
607 Ga0207704_10444252 3300025938 Bacteria 1034
608 Ga0207665_10940521 3300025939 Bacteria 686
609 Ga0207691_10040573 3300025940 Bacteria 4300
610 Ga0207691_10072138 3300025940 Bacteria 3115
611 Ga0207691_10609841 3300025940 Bacteria 924
612 Ga0207691_10849547 3300025940 Bacteria 765
613 Ga0207691_11298724 3300025940 Bacteria 601
614 Ga0207711_10316504 3300025941 Bacteria 1441
615 Ga0207711_10389464 3300025941 Bacteria 1294
616 Ga0207711_10751941 3300025941 Bacteria 909
617 Ga0207711_10842115 3300025941 Bacteria 854
618 Ga0207711_11296181 3300025941 Bacteria 670
619 Ga0207711_11719557 3300025941 Bacteria 571
620 Ga0207689_10016052 3300025942 Bacteria 6339
621 Ga0207689_10130237 3300025942 Bacteria 2070
622 Ga0207689_10240469 3300025942 Bacteria 1496
623 Ga0207689_10702942 3300025942 Bacteria 852
624 Ga0207689_10731670 3300025942 Bacteria 835
625 Ga0207689_11308331 3300025942 Bacteria 609
626 Ga0207661_10020261 3300025944 Bacteria 4967
627 Ga0207661_10169028 3300025944 Bacteria 1902
628 Ga0207661_10332157 3300025944 Bacteria 1368
629 Ga0207679_10001512 3300025945 Bacteria 14545
630 Ga0207679_10138584 3300025945 Bacteria 1963
631 Ga0207679_10302837 3300025945 Bacteria 1378
632 Ga0207679_10451988 3300025945 Bacteria 1139
633 Ga0207679_10640176 3300025945 Bacteria 961
634 Ga0207667_10022871 3300025949 Bacteria 6893
635 Ga0207667_10073324 3300025949 Bacteria 3557
636 Ga0207667_10236387 3300025949 Bacteria 1870
637 Ga0207667_11295124 3300025949 Bacteria 705
638 Ga0207651_10281849 3300025960 Bacteria 1374
639 Ga0207651_10301689 3300025960 Bacteria 1332
640 Ga0207651_10345299 3300025960 Bacteria 1251
641 Ga0207651_10535681 3300025960 Bacteria 1016
642 Ga0207651_10540451 3300025960 Bacteria 1012
643 Ga0207712_10264903 3300025961 Unclassified 1395
644 Ga0207712_10285147 3300025961 Bacteria 1349
645 Ga0207712_10323813 3300025961 Bacteria 1273
646 Ga0207712_11419906 3300025961 Unclassified 621
647 Ga0207640_10260981 3300025981 Bacteria 1350
648 Ga0207640_10277901 3300025981 Bacteria 1314
649 Ga0207640_10654649 3300025981 Bacteria 895
650 Ga0207640_12115614 3300025981 Bacteria 510
651 Ga0207658_10179467 3300025986 Bacteria 1751
652 Ga0207658_11492528 3300025986 Bacteria 618
653 Ga0207677_10064486 3300026023 Bacteria 2551
654 Ga0207677_10174617 3300026023 Bacteria 1684
655 Ga0207677_10735350 3300026023 Bacteria 878
656 Ga0207703_10218424 3300026035 Bacteria 1703
657 Ga0207703_10296941 3300026035 Bacteria 1472
658 Ga0207703_10405165 3300026035 Bacteria 1266
659 Ga0207639_10372685 3300026041 Bacteria 1280
660 Ga0207639_10375171 3300026041 Bacteria 1276
661 Ga0207639_10564141 3300026041 Bacteria 1046
662 Ga0207678_10045831 3300026067 Bacteria 3781
663 Ga0207678_10319727 3300026067 Bacteria 1335
664 Ga0207678_10820477 3300026067 Unclassified 821
665 Ga0207678_11250897 3300026067 Bacteria 657
666 Ga0207678_11773224 3300026067 Bacteria 541
667 Ga0207678_11860356 3300026067 Bacteria 526
668 Ga0207708_10110677 3300026075 Bacteria 2131
669 Ga0207708_10150178 3300026075 Bacteria 1833
670 Ga0207708_10204796 3300026075 Bacteria 1575
671 Ga0207708_10287082 3300026075 Bacteria 1335
672 Ga0207708_10297634 3300026075 Bacteria 1311
673 Ga0207708_11972679 3300026075 Unclassified 511
674 Ga0207708_11987197 3300026075 Bacteria 509
675 Ga0207702_10005153 3300026078 Bacteria 11498
676 Ga0207702_10053310 3300026078 Bacteria 3423
677 Ga0207641_10350237 3300026088 Bacteria 1407
678 Ga0207641_10367139 3300026088 Bacteria 1375
679 Ga0207641_10523619 3300026088 Bacteria 1153
680 Ga0207648_10148224 3300026089 Bacteria 2070
681 Ga0207648_10229304 3300026089 Bacteria 1652
682 Ga0207648_12263696 3300026089 Bacteria 504
683 Ga0207676_10038781 3300026095 Bacteria 3639
684 Ga0207676_10202883 3300026095 Bacteria 1753
685 Ga0207676_10212401 3300026095 Bacteria 1717
686 Ga0207676_10688154 3300026095 Bacteria 990
687 Ga0207674_10105939 3300026116 Bacteria 2789
688 Ga0207674_10321684 3300026116 Bacteria 1496
689 Ga0207674_10379580 3300026116 Bacteria 1366
690 Ga0207674_10425309 3300026116 Bacteria 1283
691 Ga0207674_10474028 3300026116 Bacteria 1210
692 Ga0207674_10844793 3300026116 Bacteria 883
693 Ga0207674_10982295 3300026116 Bacteria 813
694 Ga0207675_100069106 3300026118 Bacteria 3301
695 Ga0207675_100094831 3300026118 Bacteria 2807
696 Ga0207675_100202628 3300026118 Bacteria 1906
697 Ga0207675_100397928 3300026118 Archaea 1357
698 Ga0207683_10301242 3300026121 Bacteria 1467
699 Ga0207683_10372193 3300026121 Bacteria 1312
700 Ga0207683_11773336 3300026121 Bacteria 566
701 Ga0207698_11945726 3300026142 Bacteria 602
702 Ga0207698_12495421 3300026142 Bacteria 527
703 Ga0207698_12680362 3300026142 Bacteria 507
704 Ga0207698_12738248 3300026142 Bacteria 501
705 Ga0209967_1062337 3300027364 Bacteria 579
706 Ga0209995_1065051 3300027471 Bacteria 622
707 Ga0209588_1143266 3300027671 Bacteria 759
708 Ga0209588_1172766 3300027671 Bacteria 680
709 Ga0209966_1145496 3300027695 Unclassified 551
710 Ga0209974_10054843 3300027876 Bacteria 1344
711 Ga0207428_10258999 3300027907 Bacteria 1296
712 Ga0207428_10311329 3300027907 Bacteria 1164
713 Ga0207428_10498020 3300027907 Bacteria 885
714 Ga0268266_12275740 3300028379 Bacteria 513
715 Ga0268265_10064987 3300028380 Bacteria 2813
716 Ga0268265_10403930 3300028380 Bacteria 1263
717 Ga0268265_10695806 3300028380 Bacteria 981
718 Ga0268265_11491806 3300028380 Unclassified 680
719 Ga0268264_10262203 3300028381 Bacteria 1610
720 Ga0268264_10290548 3300028381 Bacteria 1535
721 Ga0268264_10429739 3300028381 Bacteria 1275
722 Ga0265323_10039285 3300028653 Bacteria 1726
723 Ga0316181_1006170 3300030744 Bacteria 631
724 Ga0316182_1062342 3300030745 Bacteria 1617
725 Ga0265316_11265602 3300031344 Unclassified 510
726 Ga0307408_100050434 3300031548 Bacteria 2993
727 Ga0316576_10401443 3300031727 Bacteria 1016
728 Ga0316576_11074895 3300031727 Bacteria 571
729 Ga0307405_10038719 3300031731 Bacteria 2876
730 Ga0307405_11162457 3300031731 Unclassified 666
731 Ga0316577_10576899 3300031733 Unclassified 640
732 Ga0307413_10062848 3300031824 Bacteria 2299
733 Ga0307410_10077117 3300031852 Bacteria 2328
734 Ga0307406_10084056 3300031901 Bacteria 2124
735 Ga0307407_10060318 3300031903 Bacteria 2213
736 Ga0307412_10175941 3300031911 Bacteria 1604
737 Ga0307412_10283358 3300031911 Bacteria 1302
738 Ga0307412_10737106 3300031911 Bacteria 849
739 Ga0307409_100009445 3300031995 Bacteria 5992
740 Ga0307409_102341207 3300031995 Bacteria 563
741 Ga0307409_102472141 3300031995 Unclassified 548
742 Ga0307416_100010633 3300032002 Bacteria 6092
743 Ga0307416_100222436 3300032002 Bacteria 1812
744 Ga0307416_101111731 3300032002 Archaea 895
745 Ga0307416_101575746 3300032002 Bacteria 762
746 Ga0307416_102212276 3300032002 Unclassified 651
747 Ga0307414_10373633 3300032004 Bacteria 1230
748 Ga0307411_10116528 3300032005 Bacteria 1923
749 Ga0307415_100139086 3300032126 Bacteria 1851
750 Ga0307415_100806525 3300032126 Unclassified 857
751 Ga0373948_0023129 3300034817 Bacteria 1203
752 Ga0373926_0069712 3300035083 Bacteria 1290
753 Ga0373926_0119713 3300035083 Bacteria 992
754 Ga0373926_0331724 3300035083 Bacteria 596
755 Ga0373928_0028779 3300035084 Bacteria 1218
756 Ga0373929_0216218 3300035085 Bacteria 543
757 Ga0373934_0376158 3300035086 Unclassified 592
758 Ga0373934_0450656 3300035086 Bacteria 539
759 Ga0373944_0018570 3300035089 Bacteria 1987
760 Ga0373944_0026099 3300035089 Bacteria 1724
761 Ga0373923_0084317 3300035111 Bacteria 1382
762 Ga0373932_0003450 3300035112 Unclassified 3799
763 Ga0373941_0307691 3300035115 Bacteria 634
764 Ga0373945_0069875 3300035116 Bacteria 1327
765 Ga0373945_0120360 3300035116 Unclassified 1043
766 Ga0373954_0074116 3300035118 Bacteria 1620
767 Ga0373956_0125004 3300035119 Bacteria 1202
768 Ga0373956_0309107 3300035119 Unclassified 753
769 Ga0373960_0211138 3300035121 Bacteria 690
770 Ga0373943_0040313 3300035170 Bacteria 2254
771 Ga0373943_0074079 3300035170 Bacteria 1730
772 Ga0373943_0111402 3300035170 Bacteria 1444
773 Ga0373946_0083337 3300035171 Bacteria 1404
774 Ga0373946_0087708 3300035171 Bacteria 1373
775 Ga0373946_0122039 3300035171 Bacteria 1190
776 Ga0373955_0062446 3300035172 Bacteria 2060
777 Ga0373955_0148766 3300035172 Bacteria 1377
778 Ga0373942_0124672 3300035207 Bacteria 808
779 Ga0373942_0318105 3300035207 Unclassified 544
780 Ga0373961_0037906 3300035241 Bacteria 1379
781 Ga0373961_0338420 3300035241 Unclassified 565
782 Ga0373962_0277498 3300035242 Bacteria 589
783 Ga0373962_0337154 3300035242 Bacteria 542
784 Ga0373924_0061564 3300035410 Bacteria 1571
785 Ga0373931_0055617 3300035691 Bacteria 2118
786 Ga0373935_0037727 3300035692 Bacteria 3024
787 Ga0373927_0206795 3300035695 Bacteria 1289
788 Ga0373927_0232698 3300035695 Bacteria 1211
789 Ga0373933_0151585 3300035724 Bacteria 1468
790 Ga0373947_0062952 3300035725 Bacteria 2259
791 Ga0373947_0132847 3300035725 Bacteria 1590
792 Ga0373947_0437982 3300035725 Bacteria 884
793 Ga0373947_0458554 3300035725 Bacteria 864
794 Ga0373937_0074523 3300036401 Bacteria 3132
795 Ga0373937_1195928 3300036401 Bacteria 709
796 Ga0316582_0360270 3300036647 Unclassified 1001
797 Ga0316584_1175843 3300036712 Bacteria 507
798 Ga0373925_0184528 3300037068 Bacteria 1653
799 Ga0373925_0277017 3300037068 Bacteria 1350
800 Ga0373925_0562261 3300037068 Bacteria 938
801 Ga0395905_0936703 3300037471 Unclassified 769
802 Ga0436365_0722888 3300039437 Bacteria 1032
803 Ga0436360_0782513 3300039438 Bacteria 801
804 Ga0436361_1207028 3300039447 Bacteria 516
805 Ga0436362_0662793 3300039453 Unclassified 555
806 Ga0439466_0223768 3300041411 Bacteria 571
807 Ga0451798_0206253 3300041458 Unclassified 550
808 Ga0439433_0129677 3300041999 Unclassified 640
809 Ga0439437_004648 3300042000 Bacteria 1501
810 Ga0439441_002412 3300042001 Bacteria 2632
811 Ga0439448_0005366 3300042005 Bacteria 3655
812 Ga0439450_027590 3300042008 Bacteria 1258
813 Ga0439455_0045522 3300042012 Bacteria 1134
814 Ga0439463_032040 3300042016 Bacteria 1328
815 Ga0450921_003447 3300042123 Bacteria 1113
816 Ga0450923_017250 3300042125 Bacteria 1369
817 Ga0450923_020544 3300042125 Bacteria 1280
818 Ga0450923_096548 3300042125 Bacteria 678
819 Ga0450892_002962 3300042130 Bacteria 1412
820 Ga0450905_018859 3300042142 Bacteria 1007
821 Ga0450889_005647 3300042144 Bacteria 1247
822 Ga0450910_098427 3300042147 Bacteria 524
823 Ga0439446_0271309 3300042156 Unclassified 590
824 Ga0439458_0025859 3300042157 Bacteria 1378
825 Ga0450908_015555 3300042184 Bacteria 1362
826 Ga0450908_022201 3300042184 Bacteria 1113
827 Ga0439434_0291328 3300042435 Bacteria 563
828 Ga0439464_0041541 3300042439 Bacteria 1311
829 Ga0439460_0012162 3300042461 Bacteria 2228
830 Ga0450918_075881 3300042531 Unclassified 636
831 Ga0450893_0011886 3300042532 Bacteria 1442
832 Ga0450893_0125466 3300042532 Unclassified 539
833 Ga0451577_0083638 3300042876 Bacteria 2847
834 Ga0451577_1625874 3300042876 Bacteria 569
835 Ga0439440_0107950 3300042993 Bacteria 763
836 Ga0466969_0091374 3300044656 Bacteria 1442
837 Ga0453683_0686333 3300044673 Bacteria 670
838 Ga0466966_0962068 3300044684 Unclassified 515
839 Ga0453684_0512421 3300044712 Bacteria 1326
840 Ga0466957_0741630 3300044842 Bacteria 695
841 Ga0466960_0734078 3300044901 Bacteria 594
842 Ga0466959_0468998 3300045049 Unclassified 853
843 Ga0466959_0485443 3300045049 Bacteria 836
844 Ga0466959_0950781 3300045049 Bacteria 573
845 Ga0451576_0967428 3300045051 Bacteria 892
846 Ga0451576_2356469 3300045051 Bacteria 545
847 Ga0466958_0547159 3300045836 Unclassified 752
848 Ga0466958_0980253 3300045836 Bacteria 552
849 Ga0466967_1684185 3300045976 Bacteria 632
850 Ga0495592_0150440 3300046454 Bacteria 1610
851 Ga0495629_0238159 3300046459 Bacteria 1253
852 Ga0495641_0193893 3300046461 Unclassified 910
853 Ga0495651_0367967 3300046462 Unclassified 946
854 Ga0495651_0556580 3300046462 Unclassified 728
855 Ga0495653_0137209 3300046463 Bacteria 1724
856 Ga0495580_0125892 3300046472 Unclassified 1778
857 Ga0495580_0475288 3300046472 Unclassified 836
858 Ga0495580_0482044 3300046472 Bacteria 829
859 Ga0495580_0711125 3300046472 Unclassified 657
860 Ga0495582_0097373 3300046473 Unclassified 1645
861 Ga0495582_0149772 3300046473 Bacteria 1324
862 Ga0495582_0198622 3300046473 Bacteria 1145
863 Ga0495639_0222009 3300046475 Unclassified 929
864 Ga0495639_0447185 3300046475 Unclassified 656
865 Ga0495662_0107190 3300046476 Bacteria 1368
866 Ga0495664_0183876 3300046477 Bacteria 1267
867 Ga0495664_0302794 3300046477 Bacteria 965
868 Ga0495584_0276243 3300046491 Bacteria 854
869 Ga0495608_0020219 3300046511 Bacteria 4576
870 Ga0495608_0198324 3300046511 Bacteria 1265
871 Ga0495618_0025481 3300046514 Bacteria 3671
872 Ga0495628_0270414 3300046516 Bacteria 1264
873 Ga0495628_0724911 3300046516 Unclassified 700
874 Ga0495630_0014021 3300046517 Bacteria 5833
875 Ga0495630_1361271 3300046517 Unclassified 534
876 Ga0495643_0014715 3300046522 Unclassified 4648
877 Ga0495652_0045503 3300046529 Bacteria 3772
878 Ga0495665_0571769 3300046531 Unclassified 566
879 Ga0495640_0195193 3300046533 Bacteria 1285
880 Ga0495586_0071576 3300046535 Bacteria 1895
881 Ga0495586_0476934 3300046535 Bacteria 719
882 Ga0495587_0206421 3300046536 Bacteria 1110
883 Ga0495587_0239852 3300046536 Unclassified 1020
884 Ga0495598_0179933 3300046537 Bacteria 754
885 Ga0495621_0092098 3300046539 Bacteria 1143
886 Ga0495621_0283583 3300046539 Bacteria 683
887 Ga0495645_0195033 3300046543 Bacteria 1377
888 Ga0495667_0071085 3300046559 Bacteria 2270
889 Ga0495667_0382110 3300046559 Unclassified 888
890 Ga0495634_0141101 3300046642 Bacteria 1529
891 Ga0495634_0828420 3300046642 Bacteria 526
892 Ga0495657_0066241 3300046675 Bacteria 2373
893 Ga0495599_0166517 3300046678 Bacteria 1361
894 Ga0495599_0413640 3300046678 Unclassified 802
895 Ga0495646_0148876 3300046680 Bacteria 1303
896 Ga0495647_0065239 3300046681 Bacteria 1445
897 Ga0495647_0090685 3300046681 Bacteria 1253
898 Ga0495658_0055089 3300046683 Bacteria 2264
899 Ga0495658_0121933 3300046683 Bacteria 1577
900 Ga0495658_0214668 3300046683 Bacteria 1203
901 Ga0495658_0431384 3300046683 Bacteria 841
902 Ga0495669_0283359 3300046684 Bacteria 798
903 Ga0495613_0026488 3300046689 Bacteria 4318
904 Ga0495613_0085628 3300046689 Bacteria 2286
905 Ga0495624_0730506 3300046690 Bacteria 587
906 Ga0495600_0060083 3300046809 Bacteria 2482
907 Ga0495600_0092765 3300046809 Bacteria 1969
908 Ga0495581_0779056 3300047315 Unclassified 549
909 Ga0495604_0166106 3300047317 Bacteria 1556
910 Ga0495604_0184800 3300047317 Bacteria 1456
911 Ga0495674_0050006 3300047319 Bacteria 3690
912 Ga0495676_0211452 3300047321 Bacteria 1342
913 Ga0495680_0070487 3300047322 Bacteria 2665
914 Ga0495675_0192257 3300047444 Bacteria 1245
915 Ga0495684_0002195 3300047471 Bacteria 15639
916 Ga0495602_0102326 3300048088 Bacteria 2347
917 Ga0495602_0766011 3300048088 Unclassified 650
918 Ga0495614_0051692 3300048089 Bacteria 1761
919 Ga0495614_0419234 3300048089 Unclassified 631
920 Ga0496102_0392995 3300048905 Bacteria 1304
921 Ga0496104_0291529 3300048907 Bacteria 1544
922 Ga0496106_0272589 3300048909 Bacteria 1355
923 Ga0496108_0284535 3300048911 Bacteria 1439
924 Ga0496109_0163005 3300048912 Bacteria 2089
925 Ga0496109_1315446 3300048912 Unclassified 659
926 Ga0496110_0349742 3300048913 Bacteria 1346
927 Ga0496111_0392304 3300048914 Bacteria 1026
928 Ga0496111_0491805 3300048914 Bacteria 903
929 Ga0496112_0238972 3300048915 Bacteria 1770
930 Ga0496112_0935517 3300048915 Unclassified 788
931 Ga0496112_1244724 3300048915 Bacteria 660
932 Ga0496113_0207998 3300048916 Bacteria 1557
933 Ga0496113_0327889 3300048916 Bacteria 1227
934 Ga0496113_0739128 3300048916 Bacteria 784
935 Ga0501031_0140264 3300049568 Bacteria 1580
936 Ga0501031_0373472 3300049568 Bacteria 923
937 Ga0501031_0981107 3300049568 Bacteria 540
938 Ga0501032_0218389 3300049569 Bacteria 1241
939 Ga0501032_0333473 3300049569 Unclassified 978
940 Ga0501032_0473406 3300049569 Bacteria 801
941 Ga0501034_0124335 3300049571 Bacteria 2565
942 Ga0501034_0291051 3300049571 Bacteria 1571
943 Ga0501036_0424025 3300049572 Bacteria 1109
944 Ga0501036_0828305 3300049572 Bacteria 761
945 Ga0501038_0204234 3300049574 Bacteria 1584
946 Ga0501038_0273036 3300049574 Bacteria 1333
947 Ga0501038_0614990 3300049574 Bacteria 821
948 Ga0501038_0707564 3300049574 Bacteria 754
949 Ga0501039_0286440 3300049575 Unclassified 1295
950 Ga0501039_1102586 3300049575 Unclassified 615
951 Ga0501040_0018468 3300049576 Bacteria 4630
952 Ga0501041_0365303 3300049577 Unclassified 913
953 Ga0501041_0691615 3300049577 Bacteria 652
954 Ga0501041_1038367 3300049577 Unclassified 528
955 Ga0501042_0275897 3300049578 Unclassified 1214
956 Ga0501042_0360850 3300049578 Bacteria 1051
957 Ga0501043_0247567 3300049579 Bacteria 1373
958 Ga0501043_1239272 3300049579 Bacteria 522
959 Ga0501046_0211564 3300049580 Unclassified 1439
960 Ga0501046_0592978 3300049580 Unclassified 787
961 Ga0501047_0060455 3300049581 Bacteria 3656
962 Ga0501047_0231223 3300049581 Unclassified 1702
963 Ga0501047_1062598 3300049581 Bacteria 623
964 Ga0501047_1333392 3300049581 Bacteria 532
965 Ga0501048_0172622 3300049582 Unclassified 1532
966 Ga0501048_1086651 3300049582 Viruses 575
967 Ga0501067_0263069 3300049583 Unclassified 960
968 Ga0501067_0418732 3300049583 Unclassified 747
969 Ga0501067_0493721 3300049583 Bacteria 685
970 Ga0501069_0415773 3300049585 Unclassified 797
971 Ga0501069_0767141 3300049585 Bacteria 584
972 Ga0501070_0050943 3300049586 Bacteria 3436
973 Ga0501071_0214119 3300049587 Bacteria 1449
974 Ga0501071_0249980 3300049587 Bacteria 1338
975 Ga0501071_0790499 3300049587 Bacteria 731
976 Ga0501072_0398984 3300049588 Bacteria 1091
977 Ga0501072_0646989 3300049588 Bacteria 832
978 Ga0501072_1453519 3300049588 Unclassified 530
979 Ga0501072_1515413 3300049588 Unclassified 517
980 Ga0501073_0185788 3300049589 Unclassified 1438
981 Ga0501074_0066148 3300049590 Bacteria 2600
982 Ga0501074_0109976 3300049590 Bacteria 1972
983 Ga0501075_0279341 3300049591 Unclassified 1272
984 Ga0501075_0303102 3300049591 Bacteria 1217
985 Ga0501075_0384110 3300049591 Unclassified 1070
986 Ga0501075_0495892 3300049591 Bacteria 932
987 Ga0501075_0555877 3300049591 Bacteria 876
988 Ga0501076_0106541 3300049592 Unclassified 2263
989 Ga0501077_0024076 3300049593 Bacteria 3863
990 Ga0501077_0093573 3300049593 Bacteria 1905
991 Ga0501077_0569826 3300049593 Bacteria 727
992 Ga0501198_002913 3300049649 Bacteria 2330
993 Ga0501199_007159 3300049650 Bacteria 1149
994 Ga0501079_0234581 3300049741 Unclassified 1433
995 Ga0501079_0338842 3300049741 Unclassified 1178
996 Ga0501079_0741776 3300049741 Bacteria 773
997 Ga0501079_1122625 3300049741 Unclassified 619
998 Ga0501080_0076444 3300049742 Bacteria 3114
999 Ga0501080_0668472 3300049742 Unclassified 918
1000 Ga0501081_0224517 3300049743 Bacteria 1366
1001 Ga0501081_0676557 3300049743 Bacteria 774
1002 Ga0501081_0999007 3300049743 Unclassified 632
1003 Ga0501263_002161 3300049760 Bacteria 1970
1004 Ga0501035_0184244 3300049822 Bacteria 1797
1005 Ga0501035_0308026 3300049822 Bacteria 1333
1006 Ga0501035_0332190 3300049822 Unclassified 1275
1007 Ga0501035_1456571 3300049822 Bacteria 523
1008 Ga0501044_0037919 3300049823 Bacteria 5036
1009 Ga0501044_0118855 3300049823 Bacteria 2645
1010 Ga0501044_0585222 3300049823 Bacteria 1010
1011 Ga0501045_0767613 3300049824 Unclassified 710
1012 nmdc:mga03683_187874_c1 3300050489 Unclassified 944
1013 nmdc:mga00v17_44931_c1 3300050491 Bacteria 2666
1014 nmdc:mga00v17_930352_c1 3300050491 Bacteria 549
1015 nmdc:mga05p37_128102_c1 3300050507 Bacteria 3116
1016 nmdc:mga05p37_285464_c1 3300050507 Bacteria 1967
1017 nmdc:mga05p37_478481_c1 3300050507 Bacteria 1435
1018 nmdc:mga05p37_566925_c1 3300050507 Unclassified 1289
1019 nmdc:mga05p37_720229_c1 3300050507 Unclassified 1105
1020 nmdc:mga05p37_966_c1 3300050507 Bacteria 32560
1021 nmdc:mga09592_143074_c1 3300050508 Bacteria 2062
1022 nmdc:mga09592_156862_c1 3300050508 Bacteria 1965
1023 nmdc:mga0qj67_1134751_c1 3300050509 Unclassified 610
1024 nmdc:mga0qj67_1223124_c1 3300050509 Bacteria 584
1025 nmdc:mga0qj67_1259258_c1 3300050509 Bacteria 574
1026 nmdc:mga06r32_279828_c1 3300050510 Bacteria 1655
1027 nmdc:mga06r32_949832_c1 3300050510 Bacteria 814
1028 nmdc:mga06r32_982752_c1 3300050510 Bacteria 797
1029 nmdc:mga08y16_203967_c1 3300050511 Bacteria 2049
1030 nmdc:mga08y16_443380_c1 3300050511 Bacteria 1325
1031 nmdc:mga08y16_506636_c1 3300050511 Bacteria 1226
1032 nmdc:mga08y16_554756_c1 3300050511 Bacteria 1162
1033 nmdc:mga0n895_1090208_c1 3300050512 Bacteria 776
1034 nmdc:mga0n895_1654066_c1 3300050512 Bacteria 604
1035 nmdc:mga0n895_381549_c1 3300050512 Unclassified 1426
1036 nmdc:mga0n895_518936_c1 3300050512 Bacteria 1199
1037 nmdc:mga0n895_556989_c1 3300050512 Bacteria 1152
1038 nmdc:mga0n895_574799_c1 3300050512 Unclassified 1131
1039 nmdc:mga0rr50_125243_c1 3300050513 Bacteria 1679
1040 nmdc:mga0rr50_260802_c1 3300050513 Unclassified 1442
1041 nmdc:mga0rr50_526193_c1 3300050513 Bacteria 1006
1042 nmdc:mga08x19_1031771_c1 3300050514 Bacteria 584
1043 nmdc:mga08x19_1320711_c1 3300050514 Bacteria 511
1044 nmdc:mga08x19_375483_c1 3300050514 Bacteria 995
1045 nmdc:mga08x19_980538_c1 3300050514 Bacteria 600
1046 nmdc:mga0a205_1029779_c1 3300050515 Unclassified 670
1047 nmdc:mga0a205_275497_c1 3300050515 Bacteria 1559
1048 Ga0495601_0024682 3300053077 Bacteria 3702
1049 Ga0495612_0037899 3300053078 Bacteria 1958
1050 Ga0495595_0019139 3300053084 Bacteria 2968
1051 Ga0495619_0026584 3300053085 Bacteria 3723
1052 Ga0495619_0034885 3300053085 Bacteria 3271
1053 Ga0495619_0419853 3300053085 Unclassified 923
1054 Ga0501084_0083321 3300054114 Unclassified 2684
1055 Ga0501084_0754912 3300054114 Unclassified 820
1056 Ga0501084_1479436 3300054114 Unclassified 568
1057 Ga0501082_0199562 3300060353 Bacteria 1740
1058 Ga0501082_0240840 3300060353 Bacteria 1574
1059 Ga0501082_0248415 3300060353 Unclassified 1548
1060 Ga0466962_0115578 3300061719 Bacteria 1293
1061 Ga0530510_0392740 3300061734 Bacteria 1045
1062 Ga0530510_0424735 3300061734 Bacteria 1003
1063 Ga0530510_1068530 3300061734 Archaea 618
1064 Ga0075433_10177524
1065 JGI24739J22299_10266415
1066 JGI24750J21931_1026287
1067 JGI24745J21846_1010174
1068 JGI24748J21848_1011908
1069 JGI24738J21930_10048949
1070 JGI24749J21850_1011346
1071 JGI24749J21850_1011472
1072 JGI24744J21845_10084781
1073 JGI24034J26672_10012518
1074 JGI24742J22300_10016512
1075 JGI24751J29686_10017613
1076 JGI24751J29686_10126619
1077 Ga0058860_12052141
1078 Ga0065704_10816231
1079 Ga0065715_10206191
1080 Ga0065715_10559367
1081 Ga0065715_10935716
1082 Ga0065715_11056628
1083 Ga0065707_10154356
1084 Ga0065707_10187395
1085 Ga0070676_10096332
1086 Ga0070676_10226698
1087 Ga0070676_10409838
1088 Ga0070676_10695783
1089 Ga0070683_100078772
1090 Ga0070683_100131022
1091 Ga0070683_100454541
1092 Ga0070690_100008090
1093 Ga0070690_100123800
1094 Ga0070690_101352275
1095 Ga0070670_100074697
1096 Ga0070670_100109278
1097 Ga0070670_100359551
1098 Ga0070670_100392682
1099 Ga0070670_102176457
1100 Ga0070677_10161620
1101 Ga0070677_10370079
1102 Ga0070677_10837580
1103 Ga0068869_100023556
1104 Ga0068869_100090649
1105 Ga0068869_100299510
1106 Ga0068869_101649559
1107 Ga0070666_10043570
1108 Ga0070666_10831291
1109 Ga0070666_10855169
1110 Ga0070666_11347649
1111 Ga0070680_100174485
1112 Ga0070680_100238513
1113 Ga0070680_100507951
1114 Ga0070680_100536981
1115 Ga0070682_100029078
1116 Ga0070682_100105836
1117 Ga0068868_100145778
1118 Ga0068868_100342719
1119 Ga0068868_100386728
1120 Ga0068868_102410635
1121 Ga0070660_100037223
1122 Ga0070660_100297337
1123 Ga0070660_100530425
1124 Ga0070689_100027928
1125 Ga0070689_100048972
1126 Ga0070689_100816454
1127 Ga0070691_10055975
1128 Ga0070691_10057126
1129 Ga0070691_10932242
1130 Ga0070687_100000955
1131 Ga0070687_100033857
1132 Ga0070687_100138072
1133 Ga0070687_101128869
1134 Ga0070687_101351380
1135 Ga0070661_100038173
1136 Ga0070661_100344775
1137 Ga0070661_101607048
1138 Ga0070692_10024218
1139 Ga0070692_10103362
1140 Ga0070668_100650894
1141 Ga0070668_101326534
1142 Ga0070668_101372365
1143 Ga0070669_100109319
1144 Ga0070669_100316562
1145 Ga0070669_100560082
1146 Ga0070669_101347021
1147 Ga0070675_100004802
1148 Ga0070675_100118376
1149 Ga0070675_100199593
1150 Ga0070675_100253845
1151 Ga0070675_100328381
1152 Ga0070675_101942405
1153 Ga0070671_100179691
1154 Ga0070671_100229799
1155 Ga0070671_100318365
1156 Ga0070671_101632433
1157 Ga0070674_100821028
1158 Ga0070674_101202495
1159 Ga0070673_100302069
1160 Ga0070673_100314216
1161 Ga0070673_100486947
1162 Ga0070673_100671242
1163 Ga0070673_100897343
1164 Ga0070688_100063700
1165 Ga0070688_100111240
1166 Ga0070688_100767591
1167 Ga0070688_100981632
1168 Ga0070659_100113765
1169 Ga0070659_100349647
1170 Ga0070659_100498986
1171 Ga0070667_100225281
1172 Ga0070667_101187046
1173 Ga0070703_10004974
1174 Ga0070703_10051971
1175 Ga0070703_10101491
1176 Ga0070709_11787129
1177 Ga0070701_10021491
1178 Ga0070701_10066735
1179 Ga0070701_10088687
1180 Ga0070701_10855687
1181 Ga0070711_101060362
1182 Ga0070705_100085440
1183 Ga0070705_100124783
1184 Ga0070705_100134876
1185 Ga0070705_100255333
1186 Ga0070705_101168018
1187 Ga0070700_100046222
1188 Ga0070700_100147780
1189 Ga0070700_100165838
1190 Ga0070700_100248851
1191 Ga0070700_100651422
1192 Ga0070694_100012293
1193 Ga0070694_100016000
1194 Ga0070694_100132377
1195 Ga0070694_100232751
1196 Ga0070694_100468554
1197 Ga0070708_100023219
1198 Ga0070708_100248277
1199 Ga0070708_100324249
1200 Ga0070708_100356529
1201 Ga0070708_100459374
1202 Ga0070708_100783155
1203 Ga0070663_100188150
1204 Ga0070663_100549883
1205 Ga0070663_101493581
1206 Ga0070663_101959686
1207 Ga0070678_100218030
1208 Ga0070678_100270009
1209 Ga0070678_100370921
1210 Ga0070662_100124487
1211 Ga0070662_100302340
1212 Ga0070662_100661499
1213 Ga0070662_101220080
1214 Ga0070681_10112839
1215 Ga0070681_10127523
1216 Ga0070681_10377448
1217 Ga0070681_10969717
1218 Ga0070681_11125419
1219 Ga0070681_11635651
1220 Ga0068867_100197845
1221 Ga0068867_100601866
1222 Ga0070685_10149309
1223 Ga0070685_10535694
1224 Ga0070685_10590172
1225 Ga0070706_100159971
1226 Ga0070706_100823841
1227 Ga0070706_100832824
1228 Ga0070706_101097586
1229 Ga0070706_101266614
1230 Ga0070706_101807235
1231 Ga0070707_100137998
1232 Ga0070707_100433758
1233 Ga0070707_101177628
1234 Ga0070707_101412710
1235 Ga0070698_100078722
1236 Ga0070698_100173826
1237 Ga0070698_101032220
1238 Ga0070698_101163061
1239 Ga0070698_101486611
1240 Ga0070698_102234686
1241 Ga0070699_100068492
1242 Ga0070699_100096495
1243 Ga0070699_100112158
1244 Ga0070699_100829009
1245 Ga0070699_101097765
1246 Ga0070699_101150886
1247 Ga0070699_101278522
1248 Ga0070699_101823677
1249 Ga0070679_100145258
1250 Ga0070679_100161780
1251 Ga0070679_100223270
1252 Ga0070679_100824852
1253 Ga0070684_100023645
1254 Ga0070684_100567563
1255 Ga0070684_100594538
1256 Ga0070684_100596362
1257 Ga0070697_100155274
1258 Ga0070697_100283026
1259 Ga0070697_100319945
1260 Ga0070697_100432638
1261 Ga0070697_100829856
1262 Ga0068853_100161593
1263 Ga0068853_100345238
1264 Ga0068853_100523405
1265 Ga0070672_100048567
1266 Ga0070672_100070253
1267 Ga0070672_100274141
1268 Ga0070672_101117543
1269 Ga0070672_101799012
1270 Ga0070686_100176863
1271 Ga0070686_100223487
1272 Ga0070686_100833542
1273 Ga0070686_100934119
1274 Ga0070686_101960053
1275 Ga0070695_100014665
1276 Ga0070695_100155250
1277 Ga0070695_100164193
1278 Ga0070695_101173092
1279 Ga0070695_101259682
1280 Ga0070696_100131157
1281 Ga0070696_100144497
1282 Ga0070696_100146423
1283 Ga0070696_100318739
1284 Ga0070693_100017173
1285 Ga0070693_100223989
1286 Ga0070665_100326456
1287 Ga0070704_100052210
1288 Ga0070704_100067160
1289 Ga0070704_100223487
1290 Ga0070704_100303084
1291 Ga0070704_100637418
1292 Ga0070704_100689679
1293 Ga0070704_100984953
1294 Ga0068855_100027115
1295 Ga0068855_100093765
1296 Ga0068855_100580796
1297 Ga0070664_100242413
1298 Ga0070664_100268426
1299 Ga0070664_100294591
1300 Ga0070664_101254267
1301 Ga0070664_101282653
1302 Ga0070664_101577715
1303 Ga0068857_100088462
1304 Ga0068857_100262774
1305 Ga0068857_100267502
1306 Ga0068857_100347665
1307 Ga0068857_100356397
1308 Ga0068857_100445219
1309 Ga0068857_101767641
1310 Ga0068854_100229498
1311 Ga0068854_100349622
1312 Ga0068854_100358931
1313 Ga0068854_100364328
1314 Ga0068856_100012950
1315 Ga0068856_100520683
1316 Ga0070702_100048137
1317 Ga0070702_100058390
1318 Ga0070702_100063399
1319 Ga0070702_100521135
1320 Ga0070702_101854355
1321 Ga0068852_100252970
1322 Ga0068852_102009356
1323 Ga0068852_102649599
1324 Ga0068859_100002936
1325 Ga0068859_100066879
1326 Ga0068859_100272917
1327 Ga0068859_100373551
1328 Ga0068859_100441466
1329 Ga0068864_100037195
1330 Ga0068864_100198208
1331 Ga0068864_100480456
1332 Ga0068864_101164304
1333 Ga0068866_10067847
1334 Ga0068861_100014326
1335 Ga0068861_100185263
1336 Ga0068861_100326738
1337 Ga0068870_10102358
1338 Ga0068870_10112461
1339 Ga0068870_10600535
1340 Ga0068870_11458532
1341 Ga0068863_100112267
1342 Ga0068863_100219157
1343 Ga0068863_100346152
1344 Ga0068858_100007318
1345 Ga0068858_100226453
1346 Ga0068858_100288932
1347 Ga0068860_100020802
1348 Ga0068860_100222305
1349 Ga0068860_100337336
1350 Ga0068862_100020058
1351 Ga0068862_100278032
1352 Ga0068862_100337760
1353 Ga0068862_100690907
1354 Ga0068862_101054340
1355 Ga0081455_10241461
1356 Ga0081539_10083330
1357 Ga0075364_10021432
1358 Ga0075364_10082899
1359 Ga0075364_10761395
1360 Ga0070715_10061784
1361 Ga0070715_10074494
1362 Ga0070715_10982328
1363 Ga0097621_100088856
1364 Ga0097621_100182468
1365 Ga0097621_100988600
1366 Ga0097621_101132018
1367 Ga0097621_101749948
1368 Ga0068871_100017662
1369 Ga0068871_100259132
1370 Ga0068871_100561513
1371 Ga0075428_100002738
1372 Ga0075428_100088281
1373 Ga0075428_100199871
1374 Ga0075428_100271945
1375 Ga0075428_101183825
1376 Ga0075428_101258300
1377 Ga0075428_101893650
1378 Ga0075428_102000529
1379 Ga0075428_102569642
1380 Ga0075430_100926942
1381 Ga0075430_101358469
1382 Ga0075431_100135338
1383 Ga0075431_101323741
1384 Ga0075433_10260718
1385 Ga0075433_10605860
1386 Ga0075433_10738156
1387 Ga0075433_10805488
1388 Ga0075433_11754380
1389 Ga0075434_100058544
1390 Ga0075434_100350886
1391 Ga0075434_100523649
1392 Ga0075434_101218639
1393 Ga0075429_100155894
1394 Ga0075429_100165267
1395 Ga0075429_100618943
1396 Ga0075429_101624650
1397 Ga0068865_100157397
1398 Ga0068865_100207925
1399 Ga0075436_100154456
1400 Ga0075436_100200505
1401 Ga0075436_100814261
1402 Ga0075436_101422909
1403 Ga0097620_100002936
1404 Ga0097620_100066879
1405 Ga0097620_100272913
1406 Ga0097620_100373544
1407 Ga0097620_100441450
1408 Ga0075435_100077927
1409 Ga0075435_100153326
1410 Ga0075435_100177617
1411 Ga0075435_100543149
1412 Ga0099794_10076537
1413 Ga0099794_10078032
1414 Ga0105250_10339764
1415 Ga0105240_10079802
1416 Ga0105240_10186847
1417 Ga0105240_11044335
1418 Ga0111539_10253073
1419 Ga0111539_10265096
1420 Ga0111539_10366226
1421 Ga0111539_10580809
1422 Ga0105245_10202829
1423 Ga0105245_10745444
1424 Ga0105245_12776175
1425 Ga0105247_10200910
1426 Ga0105247_11011128
1427 Ga0105247_11457000
1428 Ga0114129_10000226
1429 Ga0114129_10097617
1430 Ga0114129_10456697
1431 Ga0114129_10629583
1432 Ga0114129_10662564
1433 Ga0114129_10768836
1434 Ga0114129_10972727
1435 Ga0114129_13077559
1436 Ga0105243_10280467
1437 Ga0105243_10841202
1438 Ga0105243_12135377
1439 Ga0105243_12737233
1440 Ga0105243_12929451
1441 Ga0105241_10082574
1442 Ga0105241_10162432
1443 Ga0105241_10300577
1444 Ga0105242_10033462
1445 Ga0105242_10360604
1446 Ga0105242_12923864
1447 Ga0105248_10268787
1448 Ga0105248_10428018
1449 Ga0105248_10557772
1450 Ga0105248_10562215
1451 Ga0105248_11491923
1452 Ga0105248_11535387
1453 Ga0105248_11878738
1454 Ga0105248_12755862
1455 Ga0105237_10147755
1456 Ga0105237_11415114
1457 Ga0105237_11858371
1458 Ga0105238_10974693
1459 Ga0105238_12099507
1460 Ga0105238_12255919
1461 Ga0105249_10280119
1462 Ga0105249_10305628
1463 Ga0105249_10369383
1464 Ga0105249_10506367
1465 Ga0105249_11134258
1466 Ga0105249_11688045
1467 Ga0105029_108183
1468 Ga0099796_10231261
1469 Ga0099796_10397950
1470 Ga0105239_10234769
1471 Ga0105239_10331908
1472 Ga0105239_11516504
1473 Ga0105239_12289831
1474 Ga0105239_13058685
1475 Ga0105246_10091933
1476 Ga0105246_10198369
1477 Ga0105246_10233619
1478 Ga0105246_11175059
1479 Ga0105246_11182816
1480 Ga0157328_1024325
1481 Ga0157329_1035116
1482 Ga0157313_1029975
1483 Ga0157373_10234914
1484 Ga0157373_10294125
1485 Ga0157371_10165431
1486 Ga0157371_10172587
1487 Ga0157370_10037829
1488 Ga0157370_10228200
1489 Ga0157369_10066033
1490 Ga0157369_10242643
1491 Ga0157374_10955526
1492 Ga0157374_10971853
1493 Ga0157374_11930117
1494 Ga0157378_10305023
1495 Ga0157378_11832771
1496 Ga0157378_11947519
1497 Ga0163162_10397089
1498 Ga0163162_10696053
1499 Ga0163162_12489716
1500 Ga0163162_12977790
1501 Ga0157372_10005251
1502 Ga0157372_10441950
1503 Ga0157372_11213646
1504 Ga0157372_11768269
1505 Ga0157372_11960380
1506 Ga0157375_10298390
1507 Ga0157375_10456617
1508 Ga0157375_10525265
1509 Ga0157375_10576036
1510 Ga0157375_10748734
1511 Ga0157375_13392015
1512 Ga0163163_10325233
1513 Ga0163163_10402124
1514 Ga0163163_10947489
1515 Ga0163163_11069368
1516 Ga0163163_11757223
1517 Ga0163163_12587584
1518 Ga0163163_13148202
1519 Ga0157380_10025157
1520 Ga0157380_10351274
1521 Ga0157380_10719039
1522 Ga0157380_11410910
1523 Ga0157380_11670131
1524 Ga0157380_11847841
1525 Ga0182008_10052695
1526 Ga0157377_10082241
1527 Ga0157377_10133264
1528 Ga0157377_10155478
1529 Ga0157377_10359922
1530 Ga0157377_10887418
1531 Ga0157377_11482913
1532 Ga0157379_10074980
1533 Ga0157379_10136425
1534 Ga0157379_12439341
1535 Ga0157376_10176588
1536 Ga0157376_10233212
1537 Ga0157376_12478499
1538 Ga0157376_12571292
1539 Ga0182007_10028842
1540 Ga0182007_10169180
1541 Ga0182005_1249738
1542 Ga0163161_10531221
1543 Ga0163161_10605107
1544 Ga0163161_10798064
1545 Ga0206353_11537424
1546 Ga0213876_10299092
1547 Ga0207697_10266705
1548 Ga0207697_10269913
1549 Ga0207697_10425363
1550 Ga0207656_10576485
1551 Ga0207653_10003598
1552 Ga0207653_10016743
1553 Ga0207653_10030644
1554 Ga0207682_10043659
1555 Ga0207682_10095358
1556 Ga0207682_10556974
1557 Ga0207642_10039734
1558 Ga0207642_10326844
1559 Ga0207710_10598106
1560 Ga0207688_10044602
1561 Ga0207688_10079299
1562 Ga0207688_10241385
1563 Ga0207688_10295142
1564 Ga0207680_10363798
1565 Ga0207680_10570028
1566 Ga0207680_10575205
1567 Ga0207647_10116707
1568 Ga0207647_10132928
1569 Ga0207647_10337155
1570 Ga0207647_10556405
1571 Ga0207685_10614014
1572 Ga0207699_10254393
1573 Ga0207645_10093028
1574 Ga0207645_10094019
1575 Ga0207645_10203178
1576 Ga0207645_10568707
1577 Ga0207645_10979791
1578 Ga0207643_10025429
1579 Ga0207643_10149944
1580 Ga0207643_10157115
1581 Ga0207643_10906875
1582 Ga0207705_10333195
1583 Ga0207705_11527815
1584 Ga0207684_10072334
1585 Ga0207684_10327693
1586 Ga0207684_10717408
1587 Ga0207684_10727763
1588 Ga0207684_10819083
1589 Ga0207684_10957203
1590 Ga0207684_11042464
1591 Ga0207654_10014867
1592 Ga0207654_10189273
1593 Ga0207707_10134106
1594 Ga0207707_10250932
1595 Ga0207707_10354263
1596 Ga0207707_10483906
1597 Ga0207707_10561188
1598 Ga0207707_10608568
1599 Ga0207695_10060157
1600 Ga0207695_10317441
1601 Ga0207671_10222326
1602 Ga0207663_11367695
1603 Ga0207660_10152572
1604 Ga0207660_10246470
1605 Ga0207660_10445923
1606 Ga0207660_10789817
1607 Ga0207660_11262681
1608 Ga0207660_11399086
1609 Ga0207662_10043066
1610 Ga0207662_10086345
1611 Ga0207662_10119518
1612 Ga0207662_11003173
1613 Ga0207662_11162987
1614 Ga0207657_10306635
1615 Ga0207657_10419970
1616 Ga0207649_10295995
1617 Ga0207652_10200894
1618 Ga0207652_10317248
1619 Ga0207652_10356831
1620 Ga0207652_10421225
1621 Ga0207652_11700018
1622 Ga0207646_10018667
1623 Ga0207646_10286618
1624 Ga0207646_10287931
1625 Ga0207646_10586392
1626 Ga0207646_11303733
1627 Ga0207681_10095965
1628 Ga0207681_10329302
1629 Ga0207681_10329587
1630 Ga0207681_11225888
1631 Ga0207681_11507878
1632 Ga0207681_11651303
1633 Ga0207650_10091400
1634 Ga0207650_10116210
1635 Ga0207650_10284430
1636 Ga0207650_10529776
1637 Ga0207650_10597443
1638 Ga0207650_11181618
1639 Ga0207650_11637786
1640 Ga0207659_10042089
1641 Ga0207659_10322288
1642 Ga0207659_10481984
1643 Ga0207659_10901390
1644 Ga0207687_10305625
1645 Ga0207687_10314524
1646 Ga0207700_10403149
1647 Ga0207644_10330572
1648 Ga0207644_10385155
1649 Ga0207644_10628797
1650 Ga0207690_10082981
1651 Ga0207706_10187782
1652 Ga0207706_10309929
1653 Ga0207706_10368250
1654 Ga0207686_10070928
1655 Ga0207686_10178373
1656 Ga0207686_10969096
1657 Ga0207709_10261330
1658 Ga0207709_10281720
1659 Ga0207709_11458388
1660 Ga0207670_10281972
1661 Ga0207670_10292289
1662 Ga0207670_10300929
1663 Ga0207670_10780031
1664 Ga0207670_10798247
1665 Ga0207670_10825557
1666 Ga0207670_11422714
1667 Ga0207669_10305259
1668 Ga0207704_10278519
1669 Ga0207704_10284908
1670 Ga0207704_10444252
1671 Ga0207665_10940521
1672 Ga0207691_10040573
1673 Ga0207691_10072138
1674 Ga0207691_10609841
1675 Ga0207691_10849547
1676 Ga0207691_11298724
1677 Ga0207711_10316504
1678 Ga0207711_10389464
1679 Ga0207711_10751941
1680 Ga0207711_10842115
1681 Ga0207711_11296181
1682 Ga0207711_11719557
1683 Ga0207689_10016052
1684 Ga0207689_10130237
1685 Ga0207689_10240469
1686 Ga0207689_10702942
1687 Ga0207689_10731670
1688 Ga0207689_11308331
1689 Ga0207661_10020261
1690 Ga0207661_10169028
1691 Ga0207661_10332157
1692 Ga0207679_10001512
1693 Ga0207679_10138584
1694 Ga0207679_10302837
1695 Ga0207679_10451988
1696 Ga0207679_10640176
1697 Ga0207667_10022871
1698 Ga0207667_10073324
1699 Ga0207667_10236387
1700 Ga0207667_11295124
1701 Ga0207651_10281849
1702 Ga0207651_10301689
1703 Ga0207651_10345299
1704 Ga0207651_10535681
1705 Ga0207651_10540451
1706 Ga0207712_10264903
1707 Ga0207712_10285147
1708 Ga0207712_10323813
1709 Ga0207712_11419906
1710 Ga0207640_10260981
1711 Ga0207640_10277901
1712 Ga0207640_10654649
1713 Ga0207640_12115614
1714 Ga0207658_10179467
1715 Ga0207658_11492528
1716 Ga0207677_10064486
1717 Ga0207677_10174617
1718 Ga0207677_10735350
1719 Ga0207703_10218424
1720 Ga0207703_10296941
1721 Ga0207703_10405165
1722 Ga0207639_10372685
1723 Ga0207639_10375171
1724 Ga0207639_10564141
1725 Ga0207678_10045831
1726 Ga0207678_10319727
1727 Ga0207678_10820477
1728 Ga0207678_11250897
1729 Ga0207678_11773224
1730 Ga0207678_11860356
1731 Ga0207708_10110677
1732 Ga0207708_10150178
1733 Ga0207708_10204796
1734 Ga0207708_10287082
1735 Ga0207708_10297634
1736 Ga0207708_11972679
1737 Ga0207708_11987197
1738 Ga0207702_10005153
1739 Ga0207702_10053310
1740 Ga0207641_10350237
1741 Ga0207641_10367139
1742 Ga0207641_10523619
1743 Ga0207648_10148224
1744 Ga0207648_10229304
1745 Ga0207648_12263696
1746 Ga0207676_10038781
1747 Ga0207676_10202883
1748 Ga0207676_10212401
1749 Ga0207676_10688154
1750 Ga0207674_10105939
1751 Ga0207674_10321684
1752 Ga0207674_10379580
1753 Ga0207674_10425309
1754 Ga0207674_10474028
1755 Ga0207674_10844793
1756 Ga0207674_10982295
1757 Ga0207675_100069106
1758 Ga0207675_100094831
1759 Ga0207675_100202628
1760 Ga0207675_100397928
1761 Ga0207683_10301242
1762 Ga0207683_10372193
1763 Ga0207683_11773336
1764 Ga0207698_11945726
1765 Ga0207698_12495421
1766 Ga0207698_12680362
1767 Ga0207698_12738248
1768 Ga0209967_1062337
1769 Ga0209995_1065051
1770 Ga0209588_1143266
1771 Ga0209588_1172766
1772 Ga0209966_1145496
1773 Ga0209974_10054843
1774 Ga0207428_10258999
1775 Ga0207428_10311329
1776 Ga0207428_10498020
1777 Ga0268266_12275740
1778 Ga0268265_10064987
1779 Ga0268265_10403930
1780 Ga0268265_10695806
1781 Ga0268265_11491806
1782 Ga0268264_10262203
1783 Ga0268264_10290548
1784 Ga0268264_10429739
1785 Ga0265323_10039285
1786 Ga0316181_1006170
1787 Ga0316182_1062342
1788 Ga0265316_11265602
1789 Ga0307408_100050434
1790 Ga0316576_10401443
1791 Ga0316576_11074895
1792 Ga0307405_10038719
1793 Ga0307405_11162457
1794 Ga0316577_10576899
1795 Ga0307413_10062848
1796 Ga0307410_10077117
1797 Ga0307406_10084056
1798 Ga0307407_10060318
1799 Ga0307412_10175941
1800 Ga0307412_10283358
1801 Ga0307412_10737106
1802 Ga0307409_100009445
1803 Ga0307409_102341207
1804 Ga0307409_102472141
1805 Ga0307416_100010633
1806 Ga0307416_100222436
1807 Ga0307416_101111731
1808 Ga0307416_101575746
1809 Ga0307416_102212276
1810 Ga0307414_10373633
1811 Ga0307411_10116528
1812 Ga0307415_100139086
1813 Ga0307415_100806525
1814 Ga0373948_0023129
1815 Ga0373926_0069712
1816 Ga0373926_0119713
1817 Ga0373926_0331724
1818 Ga0373928_0028779
1819 Ga0373929_0216218
1820 Ga0373934_0376158
1821 Ga0373934_0450656
1822 Ga0373944_0018570
1823 Ga0373944_0026099
1824 Ga0373923_0084317
1825 Ga0373932_0003450
1826 Ga0373941_0307691
1827 Ga0373945_0069875
1828 Ga0373945_0120360
1829 Ga0373954_0074116
1830 Ga0373956_0125004
1831 Ga0373956_0309107
1832 Ga0373960_0211138
1833 Ga0373943_0040313
1834 Ga0373943_0074079
1835 Ga0373943_0111402
1836 Ga0373946_0083337
1837 Ga0373946_0087708
1838 Ga0373946_0122039
1839 Ga0373955_0062446
1840 Ga0373955_0148766
1841 Ga0373942_0124672
1842 Ga0373942_0318105
1843 Ga0373961_0037906
1844 Ga0373961_0338420
1845 Ga0373962_0277498
1846 Ga0373962_0337154
1847 Ga0373924_0061564
1848 Ga0373931_0055617
1849 Ga0373935_0037727
1850 Ga0373927_0206795
1851 Ga0373927_0232698
1852 Ga0373933_0151585
1853 Ga0373947_0062952
1854 Ga0373947_0132847
1855 Ga0373947_0437982
1856 Ga0373947_0458554
1857 Ga0373937_0074523
1858 Ga0373937_1195928
1859 Ga0316582_0360270
1860 Ga0316584_1175843
1861 Ga0373925_0184528
1862 Ga0373925_0277017
1863 Ga0373925_0562261
1864 Ga0395905_0936703
1865 Ga0436365_0722888
1866 Ga0436360_0782513
1867 Ga0436361_1207028
1868 Ga0436362_0662793
1869 Ga0439466_0223768
1870 Ga0451798_0206253
1871 Ga0439433_0129677
1872 Ga0439437_004648
1873 Ga0439441_002412
1874 Ga0439448_0005366
1875 Ga0439450_027590
1876 Ga0439455_0045522
1877 Ga0439463_032040
1878 Ga0450921_003447
1879 Ga0450923_017250
1880 Ga0450923_020544
1881 Ga0450923_096548
1882 Ga0450892_002962
1883 Ga0450905_018859
1884 Ga0450889_005647
1885 Ga0450910_098427
1886 Ga0439446_0271309
1887 Ga0439458_0025859
1888 Ga0450908_015555
1889 Ga0450908_022201
1890 Ga0439434_0291328
1891 Ga0439464_0041541
1892 Ga0439460_0012162
1893 Ga0450918_075881
1894 Ga0450893_0011886
1895 Ga0450893_0125466
1896 Ga0451577_0083638
1897 Ga0451577_1625874
1898 Ga0439440_0107950
1899 Ga0466969_0091374
1900 Ga0453683_0686333
1901 Ga0466966_0962068
1902 Ga0453684_0512421
1903 Ga0466957_0741630
1904 Ga0466960_0734078
1905 Ga0466959_0468998
1906 Ga0466959_0485443
1907 Ga0466959_0950781
1908 Ga0451576_0967428
1909 Ga0451576_2356469
1910 Ga0466958_0547159
1911 Ga0466958_0980253
1912 Ga0466967_1684185
1913 Ga0495592_0150440
1914 Ga0495629_0238159
1915 Ga0495641_0193893
1916 Ga0495651_0367967
1917 Ga0495651_0556580
1918 Ga0495653_0137209
1919 Ga0495580_0125892
1920 Ga0495580_0475288
1921 Ga0495580_0482044
1922 Ga0495580_0711125
1923 Ga0495582_0097373
1924 Ga0495582_0149772
1925 Ga0495582_0198622
1926 Ga0495639_0222009
1927 Ga0495639_0447185
1928 Ga0495662_0107190
1929 Ga0495664_0183876
1930 Ga0495664_0302794
1931 Ga0495584_0276243
1932 Ga0495608_0020219
1933 Ga0495608_0198324
1934 Ga0495618_0025481
1935 Ga0495628_0270414
1936 Ga0495628_0724911
1937 Ga0495630_0014021
1938 Ga0495630_1361271
1939 Ga0495643_0014715
1940 Ga0495652_0045503
1941 Ga0495665_0571769
1942 Ga0495640_0195193
1943 Ga0495586_0071576
1944 Ga0495586_0476934
1945 Ga0495587_0206421
1946 Ga0495587_0239852
1947 Ga0495598_0179933
1948 Ga0495621_0092098
1949 Ga0495621_0283583
1950 Ga0495645_0195033
1951 Ga0495667_0071085
1952 Ga0495667_0382110
1953 Ga0495634_0141101
1954 Ga0495634_0828420
1955 Ga0495657_0066241
1956 Ga0495599_0166517
1957 Ga0495599_0413640
1958 Ga0495646_0148876
1959 Ga0495647_0065239
1960 Ga0495647_0090685
1961 Ga0495658_0055089
1962 Ga0495658_0121933
1963 Ga0495658_0214668
1964 Ga0495658_0431384
1965 Ga0495669_0283359
1966 Ga0495613_0026488
1967 Ga0495613_0085628
1968 Ga0495624_0730506
1969 Ga0495600_0060083
1970 Ga0495600_0092765
1971 Ga0495581_0779056
1972 Ga0495604_0166106
1973 Ga0495604_0184800
1974 Ga0495674_0050006
1975 Ga0495676_0211452
1976 Ga0495680_0070487
1977 Ga0495675_0192257
1978 Ga0495684_0002195
1979 Ga0495602_0102326
1980 Ga0495602_0766011
1981 Ga0495614_0051692
1982 Ga0495614_0419234
1983 Ga0496102_0392995
1984 Ga0496104_0291529
1985 Ga0496106_0272589
1986 Ga0496108_0284535
1987 Ga0496109_0163005
1988 Ga0496109_1315446
1989 Ga0496110_0349742
1990 Ga0496111_0392304
1991 Ga0496111_0491805
1992 Ga0496112_0238972
1993 Ga0496112_0935517
1994 Ga0496112_1244724
1995 Ga0496113_0207998
1996 Ga0496113_0327889
1997 Ga0496113_0739128
1998 Ga0501031_0140264
1999 Ga0501031_0373472
2000 Ga0501031_0981107
2001 Ga0501032_0218389
2002 Ga0501032_0333473
2003 Ga0501032_0473406
2004 Ga0501034_0124335
2005 Ga0501034_0291051
2006 Ga0501036_0424025
2007 Ga0501036_0828305
2008 Ga0501038_0204234
2009 Ga0501038_0273036
2010 Ga0501038_0614990
2011 Ga0501038_0707564
2012 Ga0501039_0286440
2013 Ga0501039_1102586
2014 Ga0501040_0018468
2015 Ga0501041_0365303
2016 Ga0501041_0691615
2017 Ga0501041_1038367
2018 Ga0501042_0275897
2019 Ga0501042_0360850
2020 Ga0501043_0247567
2021 Ga0501043_1239272
2022 Ga0501046_0211564
2023 Ga0501046_0592978
2024 Ga0501047_0060455
2025 Ga0501047_0231223
2026 Ga0501047_1062598
2027 Ga0501047_1333392
2028 Ga0501048_0172622
2029 Ga0501048_1086651
2030 Ga0501067_0263069
2031 Ga0501067_0418732
2032 Ga0501067_0493721
2033 Ga0501069_0415773
2034 Ga0501069_0767141
2035 Ga0501070_0050943
2036 Ga0501071_0214119
2037 Ga0501071_0249980
2038 Ga0501071_0790499
2039 Ga0501072_0398984
2040 Ga0501072_0646989
2041 Ga0501072_1453519
2042 Ga0501072_1515413
2043 Ga0501073_0185788
2044 Ga0501074_0066148
2045 Ga0501074_0109976
2046 Ga0501075_0279341
2047 Ga0501075_0303102
2048 Ga0501075_0384110
2049 Ga0501075_0495892
2050 Ga0501075_0555877
2051 Ga0501076_0106541
2052 Ga0501077_0024076
2053 Ga0501077_0093573
2054 Ga0501077_0569826
2055 Ga0501198_002913
2056 Ga0501199_007159
2057 Ga0501079_0234581
2058 Ga0501079_0338842
2059 Ga0501079_0741776
2060 Ga0501079_1122625
2061 Ga0501080_0076444
2062 Ga0501080_0668472
2063 Ga0501081_0224517
2064 Ga0501081_0676557
2065 Ga0501081_0999007
2066 Ga0501263_002161
2067 Ga0501035_0184244
2068 Ga0501035_0308026
2069 Ga0501035_0332190
2070 Ga0501035_1456571
2071 Ga0501044_0037919
2072 Ga0501044_0118855
2073 Ga0501044_0585222
2074 Ga0501045_0767613
2075 nmdc:mga03683_187874_c1
2076 nmdc:mga00v17_44931_c1
2077 nmdc:mga00v17_930352_c1
2078 nmdc:mga05p37_128102_c1
2079 nmdc:mga05p37_285464_c1
2080 nmdc:mga05p37_478481_c1
2081 nmdc:mga05p37_566925_c1
2082 nmdc:mga05p37_720229_c1
2083 nmdc:mga05p37_966_c1
2084 nmdc:mga09592_143074_c1
2085 nmdc:mga09592_156862_c1
2086 nmdc:mga0qj67_1134751_c1
2087 nmdc:mga0qj67_1223124_c1
2088 nmdc:mga0qj67_1259258_c1
2089 nmdc:mga06r32_279828_c1
2090 nmdc:mga06r32_949832_c1
2091 nmdc:mga06r32_982752_c1
2092 nmdc:mga08y16_203967_c1
2093 nmdc:mga08y16_443380_c1
2094 nmdc:mga08y16_506636_c1
2095 nmdc:mga08y16_554756_c1
2096 nmdc:mga0n895_1090208_c1
2097 nmdc:mga0n895_1654066_c1
2098 nmdc:mga0n895_381549_c1
2099 nmdc:mga0n895_518936_c1
2100 nmdc:mga0n895_556989_c1
2101 nmdc:mga0n895_574799_c1
2102 nmdc:mga0rr50_125243_c1
2103 nmdc:mga0rr50_260802_c1
2104 nmdc:mga0rr50_526193_c1
2105 nmdc:mga08x19_1031771_c1
2106 nmdc:mga08x19_1320711_c1
2107 nmdc:mga08x19_375483_c1
2108 nmdc:mga08x19_980538_c1
2109 nmdc:mga0a205_1029779_c1
2110 nmdc:mga0a205_275497_c1
2111 Ga0495601_0024682
2112 Ga0495612_0037899
2113 Ga0495595_0019139
2114 Ga0495619_0026584
2115 Ga0495619_0034885
2116 Ga0495619_0419853
2117 Ga0501084_0083321
2118 Ga0501084_0754912
2119 Ga0501084_1479436
2120 Ga0501082_0199562
2121 Ga0501082_0240840
2122 Ga0501082_0248415
2123 Ga0466962_0115578
2124 Ga0530510_0392740
2125 Ga0530510_0424735
2126 Ga0530510_1068530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01527

HTH_Tnp_1

Transposase

1

71

0.95

PF13384

HTH_23

Homeodomain-like domain

5

51

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b4h-assembly1.cif.gz_D ista transposase cleaved donor complex 0.8876 4 40
8b4h-assembly1.cif.gz_B ista transposase cleaved donor complex 0.8227 4 40
1ijw-assembly1.cif.gz_C testing the water-mediated hin recombinase dna recognition by systematic mutations. 0.8214 1 40
8a5s-assembly1.cif.gz_AAA crystal structure of light-activated dna-binding protein el222 from erythrobacter litoralis crystallized in dark, measured illuminated. 0.7989 7 41
3clo-assembly2.cif.gz_C-2 crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution 0.792 6 44
ID Description Score Start End Superfamily
1jkpC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.819 1 40 1.10.10.60
2r0qF02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8187 7 42 1.10.10.60
1jj8C00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8094 1 40 1.10.10.60
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7947 6 44 1.10.10.10
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.792 6 44 1.10.10.10
ID Description Score Start End GO Terms
AF-F4TG19-F1-model_v4 deleted 0.9785 1 87
AF-F4TG19-F1-model_v4 deleted 0.9676 1 87
AF-A0A1X1PKA2-F1-model_v4 IS3 family transposase 0.9646 2 45 GO:0003677
GO:0004803
GO:0006313
AF-A0A1S2DI05-F1-model_v4 deleted 0.9646 2 42
AF-U3CIR2-F1-model_v4 Transposase 0.9635 2 45 GO:0003677
GO:0004803
GO:0006313

Map