F489305

General Info

Members Datasets Scaffolds Average Seq Length
1062 394 2120 204

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10054137|Ga0157372_100541372
Length 234
Sequence MAWGESKNWKKGTANQALYQALLDDASAAPARNSKRKKIVHPEDMPWELSRHGLLKHLMNEGMNTRMETVDAYMLIIPPGSRSGKHRQLAEECLYVLEGRGYDVHVDYDVEITDTYHWSPQKESKRFEWEAGDVIYIPPNTASQHFNADPERPVRLISAVNRIFKHAGLNDLEQLEDAPEYRPGVTVTPELVEQFLTGKIKQPAQGTVSGGVLKHRGHREHGGAQRYRIGIEWA

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
135 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
219 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
220 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
221 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
222 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
227 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
229 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
230 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
252 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
253 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
254 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
255 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
256 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
257 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
279 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
280 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
281 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
282 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
289 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
290 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
291 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
292 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
293 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
294 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
295 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
296 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
297 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
332 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
336 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
337 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
353 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
354 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
355 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
356 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
357 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
358 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
359 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
360 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
361 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
362 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
363 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
364 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
365 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
366 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
367 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
368 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
369 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
370 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
373 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
374 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
386 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
387 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
388 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
389 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
390 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
391 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
392 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
393 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
394 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.28
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 0.75
Rhizosphere 96.61
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10054137 3300013307 Bacteria 4475
2 SwRhRL2b_contig_3191446 2162886007 Bacteria 1459
3 ARcpr5oldR_c009958 3300000041 Bacteria 808
4 ARSoilOldRDRAFT_c005664 3300000044 Bacteria 1053
5 JGI24736J21556_1023795 3300001904 Bacteria 956
6 JGI24744J21845_10062573 3300002077 Bacteria 680
7 JGI24034J26672_10010129 3300002239 Bacteria 1398
8 Ga0058862_12576047 3300004803 Bacteria 948
9 Ga0065704_10012151 3300005289 Bacteria 1899
10 Ga0065704_10164581 3300005289 Bacteria 1331
11 Ga0065712_10138667 3300005290 Bacteria 1428
12 Ga0065712_10207366 3300005290 Bacteria 1085
13 Ga0065715_10277776 3300005293 Bacteria 1090
14 Ga0065707_10142056 3300005295 Bacteria 1744
15 Ga0065707_10391200 3300005295 Bacteria 864
16 Ga0065707_10397682 3300005295 Bacteria 857
17 Ga0070658_10295606 3300005327 Bacteria 1380
18 Ga0070676_10325754 3300005328 Bacteria 1049
19 Ga0070683_100007890 3300005329 Bacteria 9022
20 Ga0070690_100025367 3300005330 Bacteria 3651
21 Ga0070690_100159487 3300005330 Bacteria 1545
22 Ga0070690_100187637 3300005330 Bacteria 1432
23 Ga0070690_100744632 3300005330 Bacteria 756
24 Ga0068869_100022922 3300005334 Bacteria 4306
25 Ga0068869_100459548 3300005334 Bacteria 1056
26 Ga0070666_10079909 3300005335 Bacteria 2234
27 Ga0070666_10350231 3300005335 Bacteria 1057
28 Ga0070680_100031041 3300005336 Bacteria 4294
29 Ga0070680_100241394 3300005336 Bacteria 1527
30 Ga0070680_100536017 3300005336 Bacteria 1003
31 Ga0070680_100588664 3300005336 Bacteria 955
32 Ga0070682_100006531 3300005337 Bacteria 6545
33 Ga0068868_100048250 3300005338 Bacteria 3340
34 Ga0068868_101009160 3300005338 Bacteria 762
35 Ga0068868_101058630 3300005338 Bacteria 745
36 Ga0070689_100004358 3300005340 Bacteria 9550
37 Ga0070689_100041867 3300005340 Bacteria 3516
38 Ga0070689_100088109 3300005340 Bacteria 2443
39 Ga0070689_100131450 3300005340 Bacteria 2007
40 Ga0070689_100489887 3300005340 Bacteria 1051
41 Ga0070691_10002771 3300005341 Bacteria 7816
42 Ga0070691_10086361 3300005341 Bacteria 1542
43 Ga0070687_100086576 3300005343 Bacteria 1723
44 Ga0070687_100117773 3300005343 Bacteria 1514
45 Ga0070687_100183903 3300005343 Bacteria 1254
46 Ga0070687_100387443 3300005343 Bacteria 913
47 Ga0070687_100541285 3300005343 Bacteria 791
48 Ga0070661_100094216 3300005344 Bacteria 2219
49 Ga0070692_10002542 3300005345 Bacteria 7102
50 Ga0070692_10257748 3300005345 Bacteria 1047
51 Ga0070668_100170302 3300005347 Unclassified 1773
52 Ga0070669_100000739 3300005353 Bacteria 23805
53 Ga0070669_100303455 3300005353 Bacteria 1285
54 Ga0070669_100410544 3300005353 Bacteria 1110
55 Ga0070675_100016495 3300005354 Bacteria 5865
56 Ga0070675_100042883 3300005354 Bacteria 3697
57 Ga0070675_100110524 3300005354 Bacteria 2324
58 Ga0070675_100305914 3300005354 Bacteria 1401
59 Ga0070671_100162160 3300005355 Bacteria 1890
60 Ga0070671_100238411 3300005355 Bacteria 1544
61 Ga0070674_100324934 3300005356 Bacteria 1234
62 Ga0070673_100100450 3300005364 Bacteria 2382
63 Ga0070673_100105097 3300005364 Bacteria 2332
64 Ga0070673_100163817 3300005364 Bacteria 1893
65 Ga0070673_100668927 3300005364 Bacteria 951
66 Ga0070688_100018505 3300005365 Bacteria 4020
67 Ga0070688_100092881 3300005365 Bacteria 1975
68 Ga0070688_100135490 3300005365 Bacteria 1667
69 Ga0070667_100429728 3300005367 Bacteria 1205
70 Ga0070667_100451977 3300005367 Bacteria 1174
71 Ga0070703_10122957 3300005406 Bacteria 944
72 Ga0070714_100284299 3300005435 Bacteria 1538
73 Ga0070714_100303896 3300005435 Bacteria 1488
74 Ga0070713_100012279 3300005436 Bacteria 6276
75 Ga0070713_100102518 3300005436 Bacteria 2482
76 Ga0070713_100546226 3300005436 Bacteria 1097
77 Ga0070701_10008555 3300005438 Bacteria 4435
78 Ga0070701_10090978 3300005438 Bacteria 1672
79 Ga0070701_10571481 3300005438 Bacteria 745
80 Ga0070711_100557231 3300005439 Bacteria 951
81 Ga0070711_100801248 3300005439 Bacteria 799
82 Ga0070705_100000108 3300005440 Bacteria 47179
83 Ga0070705_100039722 3300005440 Bacteria 2671
84 Ga0070705_100143508 3300005440 Bacteria 1574
85 Ga0070705_100234190 3300005440 Bacteria 1279
86 Ga0070705_100238366 3300005440 Bacteria 1270
87 Ga0070705_100453139 3300005440 Bacteria 963
88 Ga0070700_100162458 3300005441 Bacteria 1539
89 Ga0070700_100188456 3300005441 Bacteria 1440
90 Ga0070694_100020418 3300005444 Bacteria 4223
91 Ga0070694_100022652 3300005444 Bacteria 4028
92 Ga0070694_100192098 3300005444 Bacteria 1517
93 Ga0070694_100376079 3300005444 Bacteria 1107
94 Ga0070694_100477142 3300005444 Bacteria 989
95 Ga0070708_100103908 3300005445 Bacteria 2605
96 Ga0070708_100114838 3300005445 Bacteria 2478
97 Ga0070708_100227567 3300005445 Bacteria 1750
98 Ga0070663_100069475 3300005455 Bacteria 2559
99 Ga0070678_100591700 3300005456 Bacteria 989
100 Ga0070662_100049570 3300005457 Bacteria 3028
101 Ga0070681_10018567 3300005458 Bacteria 6952
102 Ga0070681_10018962 3300005458 Bacteria 6886
103 Ga0070681_10020240 3300005458 Bacteria 6670
104 Ga0070681_10020583 3300005458 Bacteria 6611
105 Ga0070681_10036908 3300005458 Bacteria 4905
106 Ga0070681_10082153 3300005458 Bacteria 3177
107 Ga0068867_100004387 3300005459 Bacteria 9923
108 Ga0068867_100911501 3300005459 Bacteria 792
109 Ga0070685_10180442 3300005466 Bacteria 1359
110 Ga0070685_10270449 3300005466 Bacteria 1134
111 Ga0070685_10301070 3300005466 Bacteria 1080
112 Ga0070706_100030106 3300005467 Bacteria 5000
113 Ga0070706_100067859 3300005467 Bacteria 3298
114 Ga0070706_100587874 3300005467 Bacteria 1035
115 Ga0070706_100883854 3300005467 Bacteria 826
116 Ga0070707_100167909 3300005468 Bacteria 2139
117 Ga0070707_100174139 3300005468 Bacteria 2097
118 Ga0070707_100292504 3300005468 Bacteria 1583
119 Ga0070707_100522742 3300005468 Bacteria 1149
120 Ga0070707_100846142 3300005468 Bacteria 879
121 Ga0070698_100038208 3300005471 Bacteria 4947
122 Ga0070698_100047033 3300005471 Bacteria 4411
123 Ga0070698_100274403 3300005471 Bacteria 1618
124 Ga0070698_100299858 3300005471 Bacteria 1538
125 Ga0070698_100308320 3300005471 Bacteria 1514
126 Ga0070698_100718531 3300005471 Bacteria 942
127 Ga0070699_100003168 3300005518 Bacteria 14566
128 Ga0070699_100010154 3300005518 Bacteria 8149
129 Ga0070699_100028998 3300005518 Bacteria 4771
130 Ga0070699_100070494 3300005518 Bacteria 3039
131 Ga0070699_100093669 3300005518 Bacteria 2629
132 Ga0070699_100410665 3300005518 Bacteria 1225
133 Ga0070699_100481393 3300005518 Bacteria 1126
134 Ga0070679_100001812 3300005530 Bacteria 19273
135 Ga0070679_100007791 3300005530 Bacteria 10034
136 Ga0070679_100074072 3300005530 Bacteria 3396
137 Ga0070679_100092213 3300005530 Bacteria 3017
138 Ga0070679_100181703 3300005530 Bacteria 2075
139 Ga0070679_100502283 3300005530 Bacteria 1157
140 Ga0070679_100508467 3300005530 Bacteria 1148
141 Ga0070679_100580485 3300005530 Bacteria 1064
142 Ga0070684_100012143 3300005535 Bacteria 6888
143 Ga0070684_100137437 3300005535 Bacteria 2208
144 Ga0070684_100145024 3300005535 Bacteria 2149
145 Ga0070697_100012632 3300005536 Bacteria 6615
146 Ga0070697_100026075 3300005536 Bacteria 4664
147 Ga0070697_100033676 3300005536 Bacteria 4127
148 Ga0070697_100164643 3300005536 Bacteria 1875
149 Ga0070697_100276585 3300005536 Bacteria 1440
150 Ga0070697_100410592 3300005536 Bacteria 1176
151 Ga0070697_101166667 3300005536 Bacteria 686
152 Ga0068853_100169984 3300005539 Bacteria 1972
153 Ga0068853_100796368 3300005539 Bacteria 905
154 Ga0070672_100026908 3300005543 Bacteria 4286
155 Ga0070672_100113700 3300005543 Bacteria 2209
156 Ga0070672_100125184 3300005543 Bacteria 2107
157 Ga0070686_100091100 3300005544 Bacteria 2040
158 Ga0070686_100095324 3300005544 Bacteria 1999
159 Ga0070686_100234934 3300005544 Bacteria 1332
160 Ga0070686_100637111 3300005544 Bacteria 844
161 Ga0070695_100002095 3300005545 Bacteria 11424
162 Ga0070695_100146643 3300005545 Bacteria 1642
163 Ga0070695_100257462 3300005545 Bacteria 1273
164 Ga0070695_100498135 3300005545 Bacteria 942
165 Ga0070696_100000180 3300005546 Bacteria 36576
166 Ga0070696_100021785 3300005546 Bacteria 4347
167 Ga0070696_100057118 3300005546 Bacteria 2723
168 Ga0070696_100070794 3300005546 Bacteria 2454
169 Ga0070696_100079146 3300005546 Bacteria 2325
170 Ga0070696_100100300 3300005546 Bacteria 2074
171 Ga0070696_100102924 3300005546 Bacteria 2048
172 Ga0070696_100286810 3300005546 Bacteria 1256
173 Ga0070696_100452234 3300005546 Bacteria 1014
174 Ga0070693_100001151 3300005547 Bacteria 11865
175 Ga0070665_100363626 3300005548 Bacteria 1453
176 Ga0070704_100001866 3300005549 Bacteria 11619
177 Ga0070704_100009010 3300005549 Bacteria 6016
178 Ga0070704_100010578 3300005549 Bacteria 5617
179 Ga0070704_100044702 3300005549 Bacteria 3079
180 Ga0070704_100065410 3300005549 Bacteria 2617
181 Ga0070704_100095877 3300005549 Bacteria 2223
182 Ga0070704_100216431 3300005549 Bacteria 1555
183 Ga0070704_100253493 3300005549 Bacteria 1446
184 Ga0070704_100342956 3300005549 Bacteria 1259
185 Ga0070704_100877526 3300005549 Bacteria 806
186 Ga0070704_101023410 3300005549 Bacteria 748
187 Ga0068855_100001026 3300005563 Bacteria 34816
188 Ga0068855_100012705 3300005563 Bacteria 10161
189 Ga0068855_100049308 3300005563 Bacteria 4966
190 Ga0068855_100392686 3300005563 Bacteria 1521
191 Ga0070664_100017923 3300005564 Bacteria 5814
192 Ga0070664_100018613 3300005564 Bacteria 5710
193 Ga0070664_100073010 3300005564 Bacteria 2943
194 Ga0070664_100184978 3300005564 Bacteria 1854
195 Ga0070664_100645420 3300005564 Bacteria 984
196 Ga0070664_100754057 3300005564 Bacteria 909
197 Ga0070664_100945902 3300005564 Unclassified 809
198 Ga0068857_100083390 3300005577 Bacteria 2855
199 Ga0068857_100158661 3300005577 Bacteria 2052
200 Ga0068857_100181138 3300005577 Bacteria 1917
201 Ga0068857_100233760 3300005577 Bacteria 1681
202 Ga0068857_100529775 3300005577 Bacteria 1108
203 Ga0068857_100953674 3300005577 Bacteria 824
204 Ga0068854_100014330 3300005578 Bacteria 5224
205 Ga0068854_100317687 3300005578 Bacteria 1265
206 Ga0068854_100403478 3300005578 Bacteria 1132
207 Ga0068856_100060899 3300005614 Bacteria 3728
208 Ga0070702_100458271 3300005615 Bacteria 927
209 Ga0068852_100002946 3300005616 Bacteria 11831
210 Ga0068852_100008701 3300005616 Bacteria 7501
211 Ga0068852_100012355 3300005616 Bacteria 6479
212 Ga0068852_100066112 3300005616 Bacteria 3157
213 Ga0068852_100111657 3300005616 Bacteria 2486
214 Ga0068852_100504045 3300005616 Bacteria 1206
215 Ga0068852_101068054 3300005616 Bacteria 827
216 Ga0068859_100001226 3300005617 Bacteria 26171
217 Ga0068859_100032097 3300005617 Bacteria 5275
218 Ga0068859_100272209 3300005617 Bacteria 1786
219 Ga0068864_100151599 3300005618 Bacteria 2100
220 Ga0068864_101397013 3300005618 Bacteria 702
221 Ga0068861_100304979 3300005719 Bacteria 1381
222 Ga0068861_100559420 3300005719 Bacteria 1043
223 Ga0068861_100563874 3300005719 Bacteria 1040
224 Ga0068861_101569304 3300005719 Bacteria 648
225 Ga0068851_10001034 3300005834 Bacteria 12085
226 Ga0068870_10004542 3300005840 Bacteria 5978
227 Ga0068870_10036353 3300005840 Bacteria 2533
228 Ga0068870_10075527 3300005840 Bacteria 1848
229 Ga0068863_100120170 3300005841 Bacteria 2505
230 Ga0068863_100370523 3300005841 Bacteria 1397
231 Ga0068863_100410205 3300005841 Bacteria 1326
232 Ga0068863_100540002 3300005841 Bacteria 1150
233 Ga0068858_100011660 3300005842 Bacteria 8290
234 Ga0068858_100041666 3300005842 Bacteria 4257
235 Ga0068858_100075661 3300005842 Bacteria 3127
236 Ga0068858_100174104 3300005842 Bacteria 2030
237 Ga0068858_100671138 3300005842 Bacteria 1008
238 Ga0068860_100027637 3300005843 Bacteria 5462
239 Ga0068862_100000936 3300005844 Bacteria 28121
240 Ga0081455_10044130 3300005937 Bacteria 3893
241 Ga0081539_10000784 3300005985 Bacteria 61876
242 Ga0081539_10001417 3300005985 Bacteria 41272
243 Ga0081539_10018413 3300005985 Bacteria 4848
244 Ga0081539_10023062 3300005985 Bacteria 4090
245 Ga0070717_10323922 3300006028 Bacteria 1373
246 Ga0070717_10732603 3300006028 Bacteria 899
247 Ga0075364_10293237 3300006051 Bacteria 1107
248 Ga0070715_10085933 3300006163 Bacteria 1437
249 Ga0070715_10337313 3300006163 Bacteria 819
250 Ga0070716_100526442 3300006173 Bacteria 877
251 Ga0070712_100747546 3300006175 Bacteria 837
252 Ga0075367_10216606 3300006178 Bacteria 1198
253 Ga0075367_10401561 3300006178 Bacteria 867
254 Ga0075366_10006441 3300006195 Bacteria 6432
255 Ga0097621_100020817 3300006237 Bacteria 5061
256 Ga0097621_100072507 3300006237 Bacteria 2848
257 Ga0097621_100240151 3300006237 Bacteria 1583
258 Ga0097621_100564813 3300006237 Bacteria 1037
259 Ga0068871_100017452 3300006358 Bacteria 5433
260 Ga0068871_100038370 3300006358 Bacteria 3825
261 Ga0068871_100287246 3300006358 Bacteria 1440
262 Ga0068871_101196207 3300006358 Bacteria 713
263 Ga0068871_101220182 3300006358 Bacteria 706
264 Ga0075428_100001175 3300006844 Bacteria 28033
265 Ga0075428_100003327 3300006844 Bacteria 17580
266 Ga0075428_100004010 3300006844 Bacteria 16164
267 Ga0075428_100004550 3300006844 Bacteria 15333
268 Ga0075428_100042969 3300006844 Bacteria 4970
269 Ga0075428_100696108 3300006844 Bacteria 1083
270 Ga0075428_100858539 3300006844 Bacteria 964
271 Ga0075428_101056590 3300006844 Bacteria 858
272 Ga0075430_100000498 3300006846 Bacteria 29452
273 Ga0075430_100002934 3300006846 Bacteria 14264
274 Ga0075430_100069207 3300006846 Bacteria 2961
275 Ga0075430_100197768 3300006846 Bacteria 1670
276 Ga0075430_100522218 3300006846 Bacteria 980
277 Ga0075430_100666745 3300006846 Bacteria 858
278 Ga0075431_100046186 3300006847 Bacteria 4490
279 Ga0075431_100064349 3300006847 Bacteria 3787
280 Ga0075431_100068998 3300006847 Bacteria 3648
281 Ga0075431_100308504 3300006847 Bacteria 1598
282 Ga0075431_100346603 3300006847 Bacteria 1494
283 Ga0075433_10028232 3300006852 Bacteria 4769
284 Ga0075433_10121887 3300006852 Bacteria 2316
285 Ga0075433_10162581 3300006852 Bacteria 1987
286 Ga0075433_10242824 3300006852 Bacteria 1599
287 Ga0075433_10272932 3300006852 Bacteria 1499
288 Ga0075433_10467030 3300006852 Bacteria 1112
289 Ga0075433_10546284 3300006852 Bacteria 1019
290 Ga0075433_10644679 3300006852 Bacteria 929
291 Ga0075434_100001205 3300006871 Bacteria 21511
292 Ga0075434_100031867 3300006871 Bacteria 5198
293 Ga0075434_100085376 3300006871 Bacteria 3156
294 Ga0075434_100110147 3300006871 Bacteria 2764
295 Ga0075434_100149851 3300006871 Bacteria 2353
296 Ga0075434_100331759 3300006871 Bacteria 1542
297 Ga0075434_100447863 3300006871 Bacteria 1312
298 Ga0075434_100607600 3300006871 Bacteria 1113
299 Ga0075434_100850219 3300006871 Bacteria 928
300 Ga0075429_100001637 3300006880 Bacteria 18510
301 Ga0075429_100010090 3300006880 Bacteria 8184
302 Ga0075429_100010698 3300006880 Bacteria 7936
303 Ga0075429_100011040 3300006880 Bacteria 7817
304 Ga0075429_100017945 3300006880 Bacteria 6118
305 Ga0075436_100045265 3300006914 Bacteria 3035
306 Ga0075436_100057085 3300006914 Bacteria 2696
307 Ga0075436_100082492 3300006914 Bacteria 2230
308 Ga0075436_100108035 3300006914 Bacteria 1941
309 Ga0075436_100180569 3300006914 Bacteria 1491
310 Ga0075436_100236343 3300006914 Bacteria 1299
311 Ga0075436_100491400 3300006914 Bacteria 897
312 Ga0097620_100001226 3300006931 Bacteria 26171
313 Ga0097620_100032097 3300006931 Bacteria 5275
314 Ga0097620_100272189 3300006931 Bacteria 1786
315 Ga0075435_100082168 3300007076 Bacteria 2648
316 Ga0075435_100128335 3300007076 Bacteria 2120
317 Ga0075435_100184914 3300007076 Bacteria 1762
318 Ga0075435_100215458 3300007076 Bacteria 1630
319 Ga0075435_100311666 3300007076 Bacteria 1347
320 Ga0075435_100515020 3300007076 Bacteria 1035
321 Ga0099794_10220763 3300007265 Bacteria 974
322 Ga0099795_10105517 3300007788 Bacteria 1110
323 Ga0105250_10149064 3300009092 Bacteria 973
324 Ga0105240_10003193 3300009093 Bacteria 25753
325 Ga0105240_10017393 3300009093 Bacteria 9692
326 Ga0105240_10040202 3300009093 Bacteria 5985
327 Ga0105240_10065260 3300009093 Bacteria 4520
328 Ga0105240_10077370 3300009093 Bacteria 4098
329 Ga0105240_10339527 3300009093 Bacteria 1707
330 Ga0111539_10000829 3300009094 Bacteria 40191
331 Ga0111539_10001620 3300009094 Bacteria 30065
332 Ga0111539_10017285 3300009094 Bacteria 8926
333 Ga0111539_10060114 3300009094 Bacteria 4504
334 Ga0111539_10064868 3300009094 Bacteria 4318
335 Ga0111539_10252812 3300009094 Bacteria 2052
336 Ga0111539_10260136 3300009094 Bacteria 2020
337 Ga0111539_10264846 3300009094 Bacteria 2001
338 Ga0111539_10349958 3300009094 Bacteria 1719
339 Ga0111539_10623884 3300009094 Bacteria 1255
340 Ga0111539_10747725 3300009094 Bacteria 1138
341 Ga0105245_10086886 3300009098 Bacteria 2869
342 Ga0105247_10156699 3300009101 Bacteria 1505
343 Ga0105247_10698701 3300009101 Bacteria 763
344 Ga0114129_10009943 3300009147 Bacteria 13559
345 Ga0114129_10042478 3300009147 Bacteria 6402
346 Ga0114129_10090544 3300009147 Bacteria 4240
347 Ga0114129_10242973 3300009147 Bacteria 2420
348 Ga0114129_10358167 3300009147 Bacteria 1931
349 Ga0114129_10445809 3300009147 Bacteria 1698
350 Ga0114129_10564593 3300009147 Bacteria 1478
351 Ga0114129_10584212 3300009147 Bacteria 1449
352 Ga0114129_11024251 3300009147 Bacteria 1038
353 Ga0105243_10070885 3300009148 Bacteria 2816
354 Ga0105241_10074350 3300009174 Bacteria 2646
355 Ga0105242_10056398 3300009176 Bacteria 3215
356 Ga0105242_10073905 3300009176 Bacteria 2835
357 Ga0105242_10107916 3300009176 Bacteria 2369
358 Ga0105242_10356503 3300009176 Bacteria 1352
359 Ga0105242_10794903 3300009176 Bacteria 936
360 Ga0105242_10852726 3300009176 Bacteria 907
361 Ga0105248_10126896 3300009177 Bacteria 2878
362 Ga0105248_10202748 3300009177 Bacteria 2235
363 Ga0105248_10323721 3300009177 Bacteria 1736
364 Ga0105248_10412847 3300009177 Bacteria 1520
365 Ga0105248_10600328 3300009177 Bacteria 1242
366 Ga0105248_11285587 3300009177 Bacteria 827
367 Ga0105238_10103045 3300009551 Bacteria 2835
368 Ga0105238_10114073 3300009551 Bacteria 2681
369 Ga0105238_10217537 3300009551 Bacteria 1886
370 Ga0105238_10824962 3300009551 Unclassified 944
371 Ga0105249_10672699 3300009553 Bacteria 1094
372 Ga0105249_10986705 3300009553 Bacteria 911
373 Ga0099796_10069805 3300010159 Bacteria 1266
374 Ga0105239_10001816 3300010375 Bacteria 27990
375 Ga0105239_10177959 3300010375 Bacteria 2379
376 Ga0105246_10045566 3300011119 Bacteria 2987
377 Ga0105246_10116050 3300011119 Bacteria 1976
378 Ga0105246_10685142 3300011119 Bacteria 896
379 Ga0157345_1003674 3300012498 Bacteria 1127
380 Ga0157373_10356240 3300013100 Bacteria 1044
381 Ga0157371_10167367 3300013102 Bacteria 1570
382 Ga0157370_10005710 3300013104 Bacteria 13910
383 Ga0157370_10042884 3300013104 Bacteria 4357
384 Ga0157370_10370711 3300013104 Bacteria 1319
385 Ga0157370_10556619 3300013104 Bacteria 1051
386 Ga0157369_10043732 3300013105 Bacteria 4881
387 Ga0157369_10044856 3300013105 Bacteria 4810
388 Ga0157369_10198653 3300013105 Bacteria 2105
389 Ga0157374_10058657 3300013296 Bacteria 3597
390 Ga0163162_10326290 3300013306 Bacteria 1667
391 Ga0163162_10446001 3300013306 Bacteria 1426
392 Ga0163162_10477587 3300013306 Bacteria 1378
393 Ga0163162_11368340 3300013306 Unclassified 805
394 Ga0157372_10012175 3300013307 Bacteria 9164
395 Ga0157372_10482531 3300013307 Bacteria 1445
396 Ga0157372_10486194 3300013307 Bacteria 1439
397 Ga0157372_11114786 3300013307 Bacteria 913
398 Ga0157375_10087661 3300013308 Bacteria 3165
399 Ga0157375_10251269 3300013308 Bacteria 1929
400 Ga0157375_10295397 3300013308 Bacteria 1783
401 Ga0157375_10706320 3300013308 Bacteria 1162
402 Ga0157375_10991938 3300013308 Bacteria 980
403 Ga0163163_10274853 3300014325 Bacteria 1736
404 Ga0157380_10106642 3300014326 Bacteria 2345
405 Ga0157380_10715014 3300014326 Unclassified 1008
406 Ga0157377_10075513 3300014745 Bacteria 1957
407 Ga0157377_10167416 3300014745 Bacteria 1371
408 Ga0157379_10127673 3300014968 Bacteria 2288
409 Ga0157379_10189110 3300014968 Bacteria 1861
410 Ga0157379_10700527 3300014968 Bacteria 951
411 Ga0157379_10849578 3300014968 Unclassified 864
412 Ga0157376_10170070 3300014969 Bacteria 1984
413 Ga0163161_10406551 3300017792 Bacteria 1092
414 Ga0206350_11230895 3300020080 Bacteria 920
415 Ga0213875_10000825 3300021388 Bacteria 23073
416 Ga0213875_10066103 3300021388 Bacteria 1690
417 Ga0224572_1011562 3300024225 Bacteria 1670
418 Ga0228598_1006731 3300024227 Bacteria 2369
419 Ga0209233_1043555 3300025261 Bacteria 956
420 Ga0207656_10005524 3300025321 Bacteria 4475
421 Ga0207653_10077711 3300025885 Bacteria 1144
422 Ga0207692_10266016 3300025898 Bacteria 1032
423 Ga0207642_10000795 3300025899 Bacteria 9803
424 Ga0207688_10032513 3300025901 Bacteria 2884
425 Ga0207688_10054151 3300025901 Bacteria 2250
426 Ga0207688_10157069 3300025901 Bacteria 1346
427 Ga0207680_10073954 3300025903 Bacteria 2120
428 Ga0207680_10274317 3300025903 Bacteria 1170
429 Ga0207680_10349282 3300025903 Bacteria 1039
430 Ga0207680_10631961 3300025903 Bacteria 766
431 Ga0207680_10802778 3300025903 Bacteria 675
432 Ga0207699_10070849 3300025906 Bacteria 2130
433 Ga0207645_10331099 3300025907 Bacteria 1017
434 Ga0207643_10005979 3300025908 Bacteria 6505
435 Ga0207643_10082475 3300025908 Bacteria 1864
436 Ga0207705_10034767 3300025909 Bacteria 3604
437 Ga0207684_10049010 3300025910 Bacteria 3583
438 Ga0207684_10120761 3300025910 Bacteria 2247
439 Ga0207684_10238364 3300025910 Bacteria 1569
440 Ga0207684_10465228 3300025910 Bacteria 1085
441 Ga0207654_10002438 3300025911 Bacteria 9499
442 Ga0207654_10015834 3300025911 Bacteria 3919
443 Ga0207707_10003497 3300025912 Bacteria 13902
444 Ga0207707_10016850 3300025912 Bacteria 6366
445 Ga0207707_10029245 3300025912 Bacteria 4817
446 Ga0207707_10034663 3300025912 Bacteria 4416
447 Ga0207695_10009849 3300025913 Bacteria 11745
448 Ga0207695_10023472 3300025913 Bacteria 6967
449 Ga0207695_10066308 3300025913 Bacteria 3708
450 Ga0207695_10142311 3300025913 Bacteria 2346
451 Ga0207695_10276279 3300025913 Bacteria 1574
452 Ga0207695_10799832 3300025913 Bacteria 823
453 Ga0207671_10010577 3300025914 Bacteria 7595
454 Ga0207693_10453835 3300025915 Bacteria 1001
455 Ga0207693_10526241 3300025915 Bacteria 922
456 Ga0207663_10323963 3300025916 Bacteria 1159
457 Ga0207660_10000870 3300025917 Bacteria 19956
458 Ga0207660_10031088 3300025917 Bacteria 3674
459 Ga0207660_10390991 3300025917 Bacteria 1119
460 Ga0207660_10463861 3300025917 Bacteria 1025
461 Ga0207660_10618407 3300025917 Bacteria 883
462 Ga0207660_10622915 3300025917 Bacteria 879
463 Ga0207660_10900217 3300025917 Unclassified 722
464 Ga0207662_10005398 3300025918 Bacteria 6809
465 Ga0207662_10485524 3300025918 Bacteria 849
466 Ga0207657_10075804 3300025919 Bacteria 2838
467 Ga0207649_10037319 3300025920 Bacteria 2935
468 Ga0207649_10455895 3300025920 Bacteria 966
469 Ga0207652_10035689 3300025921 Bacteria 4199
470 Ga0207652_10056144 3300025921 Bacteria 3389
471 Ga0207652_10130747 3300025921 Bacteria 2239
472 Ga0207652_10156661 3300025921 Bacteria 2041
473 Ga0207652_10389944 3300025921 Bacteria 1257
474 Ga0207652_10540999 3300025921 Bacteria 1047
475 Ga0207646_10107224 3300025922 Bacteria 2506
476 Ga0207646_10252742 3300025922 Bacteria 1592
477 Ga0207646_10356553 3300025922 Bacteria 1321
478 Ga0207646_10379444 3300025922 Bacteria 1277
479 Ga0207646_10721780 3300025922 Bacteria 890
480 Ga0207646_11054382 3300025922 Bacteria 717
481 Ga0207681_10013395 3300025923 Bacteria 5075
482 Ga0207681_10183660 3300025923 Bacteria 1595
483 Ga0207681_10199406 3300025923 Bacteria 1536
484 Ga0207694_10011571 3300025924 Bacteria 6657
485 Ga0207694_10061409 3300025924 Bacteria 2925
486 Ga0207694_10083769 3300025924 Bacteria 2508
487 Ga0207694_10115840 3300025924 Bacteria 2135
488 Ga0207694_10162552 3300025924 Bacteria 1804
489 Ga0207694_10465046 3300025924 Bacteria 1057
490 Ga0207650_10057766 3300025925 Bacteria 2887
491 Ga0207659_10000497 3300025926 Bacteria 23633
492 Ga0207659_10034718 3300025926 Bacteria 3480
493 Ga0207659_10126562 3300025926 Bacteria 1966
494 Ga0207687_10000777 3300025927 Bacteria 21510
495 Ga0207687_10369365 3300025927 Bacteria 1173
496 Ga0207687_10712870 3300025927 Bacteria 852
497 Ga0207700_10016392 3300025928 Bacteria 4921
498 Ga0207700_10075771 3300025928 Bacteria 2608
499 Ga0207700_10429579 3300025928 Bacteria 1161
500 Ga0207664_10200486 3300025929 Bacteria 1722
501 Ga0207664_10393447 3300025929 Bacteria 1232
502 Ga0207644_10238897 3300025931 Bacteria 1446
503 Ga0207644_10242479 3300025931 Bacteria 1435
504 Ga0207644_10400244 3300025931 Bacteria 1122
505 Ga0207706_10020119 3300025933 Bacteria 5997
506 Ga0207706_10782110 3300025933 Bacteria 812
507 Ga0207706_10875667 3300025933 Bacteria 759
508 Ga0207686_10004090 3300025934 Bacteria 7824
509 Ga0207686_10005387 3300025934 Bacteria 6857
510 Ga0207686_10035151 3300025934 Bacteria 3005
511 Ga0207686_10179917 3300025934 Bacteria 1499
512 Ga0207686_10357970 3300025934 Bacteria 1101
513 Ga0207686_10585071 3300025934 Bacteria 877
514 Ga0207709_10002925 3300025935 Bacteria 10430
515 Ga0207709_10153793 3300025935 Bacteria 1596
516 Ga0207670_10011914 3300025936 Bacteria 5063
517 Ga0207670_10016160 3300025936 Bacteria 4478
518 Ga0207670_10066253 3300025936 Bacteria 2481
519 Ga0207670_10114076 3300025936 Bacteria 1952
520 Ga0207704_10001762 3300025938 Bacteria 9683
521 Ga0207704_10056227 3300025938 Bacteria 2409
522 Ga0207704_10255673 3300025938 Bacteria 1318
523 Ga0207665_10163607 3300025939 Bacteria 1602
524 Ga0207665_10480228 3300025939 Bacteria 957
525 Ga0207665_10559663 3300025939 Bacteria 889
526 Ga0207691_10017737 3300025940 Bacteria 6748
527 Ga0207691_10036125 3300025940 Bacteria 4579
528 Ga0207691_10058161 3300025940 Bacteria 3517
529 Ga0207691_10297890 3300025940 Bacteria 1386
530 Ga0207691_10425513 3300025940 Bacteria 1131
531 Ga0207711_10078696 3300025941 Bacteria 2876
532 Ga0207711_10129445 3300025941 Bacteria 2262
533 Ga0207711_10271924 3300025941 Bacteria 1559
534 Ga0207711_10643763 3300025941 Bacteria 989
535 Ga0207711_10785875 3300025941 Bacteria 887
536 Ga0207689_10193235 3300025942 Bacteria 1679
537 Ga0207689_10925381 3300025942 Bacteria 736
538 Ga0207661_10018037 3300025944 Bacteria 5239
539 Ga0207661_11045623 3300025944 Bacteria 752
540 Ga0207679_10049021 3300025945 Bacteria 3078
541 Ga0207679_10077749 3300025945 Bacteria 2526
542 Ga0207679_10109254 3300025945 Bacteria 2179
543 Ga0207679_10171460 3300025945 Bacteria 1787
544 Ga0207679_10373798 3300025945 Bacteria 1248
545 Ga0207679_10653994 3300025945 Bacteria 951
546 Ga0207667_10012992 3300025949 Bacteria 9558
547 Ga0207667_10021112 3300025949 Bacteria 7222
548 Ga0207667_10025639 3300025949 Bacteria 6451
549 Ga0207667_10046656 3300025949 Bacteria 4588
550 Ga0207667_10793221 3300025949 Unclassified 944
551 Ga0207651_10126165 3300025960 Bacteria 1950
552 Ga0207651_10223403 3300025960 Bacteria 1524
553 Ga0207651_10246370 3300025960 Bacteria 1459
554 Ga0207712_10065482 3300025961 Bacteria 2594
555 Ga0207712_10145845 3300025961 Bacteria 1822
556 Ga0207640_10016745 3300025981 Bacteria 4272
557 Ga0207640_10187453 3300025981 Bacteria 1556
558 Ga0207640_10345945 3300025981 Bacteria 1193
559 Ga0207640_10476957 3300025981 Bacteria 1034
560 Ga0207658_10503289 3300025986 Bacteria 1079
561 Ga0207677_10003975 3300026023 Bacteria 7883
562 Ga0207677_10153715 3300026023 Bacteria 1779
563 Ga0207677_10236452 3300026023 Bacteria 1475
564 Ga0207677_11317215 3300026023 Bacteria 664
565 Ga0207703_10007192 3300026035 Bacteria 8853
566 Ga0207703_10007199 3300026035 Bacteria 8848
567 Ga0207703_10049396 3300026035 Bacteria 3401
568 Ga0207703_10754127 3300026035 Bacteria 927
569 Ga0207639_10047688 3300026041 Bacteria 3239
570 Ga0207639_10089627 3300026041 Bacteria 2458
571 Ga0207639_10141060 3300026041 Bacteria 2008
572 Ga0207708_10008062 3300026075 Bacteria 7805
573 Ga0207708_10011323 3300026075 Bacteria 6641
574 Ga0207708_10043409 3300026075 Bacteria 3427
575 Ga0207708_10115137 3300026075 Bacteria 2091
576 Ga0207708_10820029 3300026075 Bacteria 802
577 Ga0207702_10110619 3300026078 Bacteria 2442
578 Ga0207702_10301901 3300026078 Bacteria 1520
579 Ga0207702_10425705 3300026078 Bacteria 1284
580 Ga0207641_10058519 3300026088 Bacteria 3280
581 Ga0207641_10094527 3300026088 Bacteria 2622
582 Ga0207641_10097219 3300026088 Bacteria 2588
583 Ga0207648_10004952 3300026089 Bacteria 13550
584 Ga0207676_10096410 3300026095 Bacteria 2441
585 Ga0207676_10398149 3300026095 Bacteria 1286
586 Ga0207676_10737063 3300026095 Bacteria 957
587 Ga0207674_10032849 3300026116 Bacteria 5440
588 Ga0207674_10041787 3300026116 Bacteria 4740
589 Ga0207674_10094210 3300026116 Bacteria 2981
590 Ga0207674_10945056 3300026116 Bacteria 830
591 Ga0207675_100011137 3300026118 Bacteria 8423
592 Ga0207675_100207131 3300026118 Bacteria 1885
593 Ga0207675_100218538 3300026118 Bacteria 1835
594 Ga0207675_100439040 3300026118 Bacteria 1292
595 Ga0207683_10208216 3300026121 Bacteria 1779
596 Ga0207683_10430023 3300026121 Bacteria 1216
597 Ga0207698_10000418 3300026142 Bacteria 24481
598 Ga0207698_10021364 3300026142 Bacteria 4475
599 Ga0207698_10097809 3300026142 Bacteria 2423
600 Ga0207698_10216375 3300026142 Bacteria 1728
601 Ga0207698_10337582 3300026142 Bacteria 1418
602 Ga0209969_1012774 3300027360 Bacteria 1212
603 Ga0209981_1024598 3300027378 Bacteria 869
604 Ga0209999_1029527 3300027543 Bacteria 1018
605 Ga0209588_1016536 3300027671 Bacteria 2278
606 Ga0209588_1039163 3300027671 Bacteria 1528
607 Ga0209998_10085360 3300027717 Bacteria 769
608 Ga0207428_10002123 3300027907 Bacteria 19965
609 Ga0207428_10005694 3300027907 Bacteria 11582
610 Ga0207428_10009987 3300027907 Bacteria 8496
611 Ga0207428_10097371 3300027907 Bacteria 2277
612 Ga0207428_10208048 3300027907 Bacteria 1471
613 Ga0207428_10321947 3300027907 Bacteria 1142
614 Ga0207428_10427244 3300027907 Bacteria 968
615 Ga0265357_1015454 3300028023 Bacteria 807
616 Ga0268266_10121600 3300028379 Bacteria 2324
617 Ga0268265_10000768 3300028380 Bacteria 31006
618 Ga0268264_10010052 3300028381 Bacteria 7833
619 Ga0268264_10032877 3300028381 Bacteria 4257
620 Ga0268264_10259452 3300028381 Bacteria 1618
621 Ga0265338_10027443 3300028800 Bacteria 5712
622 Ga0265773_1001335 3300031018 Bacteria 1299
623 Ga0265325_10048933 3300031241 Bacteria 2183
624 Ga0265339_10000323 3300031249 Bacteria 38406
625 Ga0307408_100125672 3300031548 Bacteria 1994
626 Ga0265313_10001589 3300031595 Bacteria 21087
627 Ga0307405_10905397 3300031731 Bacteria 746
628 Ga0307413_10292705 3300031824 Bacteria 1231
629 Ga0307409_100229965 3300031995 Bacteria 1680
630 Ga0307409_100623655 3300031995 Bacteria 1069
631 Ga0307416_100020661 3300032002 Bacteria 4705
632 Ga0307416_100021589 3300032002 Bacteria 4626
633 Ga0307416_100077582 3300032002 Bacteria 2791
634 Ga0307416_100819420 3300032002 Bacteria 1027
635 Ga0307416_100899632 3300032002 Bacteria 985
636 Ga0307414_10458339 3300032004 Bacteria 1120
637 Ga0307415_100168376 3300032126 Bacteria 1706
638 Ga0373948_0006145 3300034817 Bacteria 1975
639 Ga0373950_0005040 3300034818 Bacteria 1958
640 Ga0373938_0002374 3300034957 Bacteria 3035
641 Ga0373926_0007208 3300035083 Bacteria 3704
642 Ga0373926_0136483 3300035083 Bacteria 931
643 Ga0373929_0010367 3300035085 Bacteria 1742
644 Ga0373934_0000114 3300035086 Bacteria 28627
645 Ga0373934_0070257 3300035086 Bacteria 1400
646 Ga0373951_0007192 3300035091 Bacteria 2532
647 Ga0373951_0015649 3300035091 Bacteria 1710
648 Ga0373923_0019953 3300035111 Bacteria 2600
649 Ga0373923_0088705 3300035111 Bacteria 1350
650 Ga0373932_0025353 3300035112 Bacteria 1604
651 Ga0373936_0007051 3300035113 Bacteria 4228
652 Ga0373936_0014321 3300035113 Bacteria 3028
653 Ga0373939_0036313 3300035114 Bacteria 1457
654 Ga0373939_0051690 3300035114 Bacteria 1278
655 Ga0373941_0039352 3300035115 Bacteria 1452
656 Ga0373953_0051178 3300035117 Bacteria 1670
657 Ga0373953_0053703 3300035117 Bacteria 1634
658 Ga0373953_0148077 3300035117 Bacteria 1005
659 Ga0373954_0000191 3300035118 Bacteria 22126
660 Ga0373954_0000511 3300035118 Bacteria 14523
661 Ga0373954_0164892 3300035118 Bacteria 1084
662 Ga0373956_0000137 3300035119 Bacteria 26180
663 Ga0373956_0084704 3300035119 Bacteria 1457
664 Ga0373956_0115569 3300035119 Bacteria 1251
665 Ga0373957_0059787 3300035120 Bacteria 1474
666 Ga0373946_0012587 3300035171 Bacteria 3169
667 Ga0373946_0177899 3300035171 Bacteria 1008
668 Ga0373946_0418447 3300035171 Bacteria 679
669 Ga0373955_0003667 3300035172 Bacteria 6764
670 Ga0373955_0197262 3300035172 Bacteria 1198
671 Ga0373955_0204252 3300035172 Bacteria 1177
672 Ga0373955_0331269 3300035172 Bacteria 920
673 Ga0373961_0022217 3300035241 Bacteria 1696
674 Ga0373924_0005523 3300035410 Bacteria 4483
675 Ga0373924_0085207 3300035410 Bacteria 1347
676 Ga0373924_0184295 3300035410 Bacteria 919
677 Ga0373931_0001370 3300035691 Bacteria 10416
678 Ga0373931_0013447 3300035691 Bacteria 3985
679 Ga0373935_0013594 3300035692 Bacteria 4914
680 Ga0373935_0211732 3300035692 Bacteria 1343
681 Ga0373935_0562011 3300035692 Bacteria 832
682 Ga0373927_0004154 3300035695 Bacteria 10175
683 Ga0373927_0014329 3300035695 Bacteria 5250
684 Ga0373927_0074943 3300035695 Bacteria 2191
685 Ga0373933_0008591 3300035724 Bacteria 5570
686 Ga0373933_0009793 3300035724 Bacteria 5244
687 Ga0373933_0161322 3300035724 Bacteria 1423
688 Ga0373933_0363933 3300035724 Bacteria 941
689 Ga0373947_0005577 3300035725 Bacteria 7336
690 Ga0373947_0401070 3300035725 Bacteria 925
691 Ga0373947_0478285 3300035725 Bacteria 845
692 Ga0373937_0001819 3300036401 Bacteria 17904
693 Ga0373937_0002151 3300036401 Bacteria 16491
694 Ga0373937_0014778 3300036401 Bacteria 6893
695 Ga0373937_0088704 3300036401 Bacteria 2863
696 Ga0373937_0102121 3300036401 Bacteria 2662
697 Ga0373937_0139655 3300036401 Bacteria 2266
698 Ga0373937_0177460 3300036401 Bacteria 2000
699 Ga0373937_0194409 3300036401 Bacteria 1906
700 Ga0373937_1007521 3300036401 Bacteria 782
701 Ga0373925_0057775 3300037068 Bacteria 2907
702 Ga0373925_0132139 3300037068 Bacteria 1947
703 Ga0373925_0508940 3300037068 Bacteria 989
704 Ga0373925_0966927 3300037068 Bacteria 701
705 Ga0395900_0080357 3300037418 Bacteria 3350
706 Ga0395905_0092397 3300037471 Bacteria 2837
707 Ga0395905_0157392 3300037471 Bacteria 2136
708 Ga0436364_0204334 3300037853 Bacteria 1500
709 Ga0436364_0734767 3300037853 Bacteria 8451
710 Ga0436364_0919491 3300037853 Bacteria 1072
711 Ga0436364_0937935 3300037853 Bacteria 2357
712 Ga0436364_1433936 3300037853 Bacteria 1757
713 Ga0395901_0207803 3300038443 Bacteria 2050
714 Ga0436365_0560582 3300039437 Bacteria 7725
715 Ga0436365_1129272 3300039437 Bacteria 1028
716 Ga0436365_1389857 3300039437 Bacteria 2775
717 Ga0436365_1451327 3300039437 Bacteria 910
718 Ga0436365_1727819 3300039437 Bacteria 3270
719 Ga0436361_0191136 3300039447 Bacteria 1294
720 Ga0436361_0945327 3300039447 Bacteria 3240
721 Ga0436361_1181632 3300039447 Bacteria 673
722 Ga0436363_0424337 3300039450 Bacteria 2002
723 Ga0436363_0883771 3300039450 Bacteria 1867
724 Ga0436362_0082502 3300039453 Bacteria 1521
725 Ga0436362_0993435 3300039453 Bacteria 866
726 Ga0439441_000308 3300042001 Bacteria 4915
727 Ga0439451_035547 3300042009 Bacteria 1002
728 Ga0439435_0002925 3300042436 Bacteria 3472
729 Ga0439435_0057173 3300042436 Bacteria 1129
730 Ga0439435_0157386 3300042436 Bacteria 732
731 Ga0439444_0004416 3300042437 Bacteria 2043
732 Ga0439460_0000132 3300042461 Bacteria 13295
733 Ga0451577_0139976 3300042876 Bacteria 2174
734 Ga0451577_0204093 3300042876 Bacteria 1784
735 Ga0453683_0428571 3300044673 Bacteria 854
736 Ga0466966_0246346 3300044684 Bacteria 1077
737 Ga0466966_0252218 3300044684 Bacteria 1063
738 Ga0466964_0171150 3300044706 Bacteria 1023
739 Ga0453684_0521800 3300044712 Bacteria 1312
740 Ga0466957_0013848 3300044842 Bacteria 4688
741 Ga0466957_0313304 3300044842 Bacteria 1057
742 Ga0466959_0130223 3300045049 Bacteria 1783
743 Ga0451576_0125236 3300045051 Bacteria 2677
744 Ga0451576_0152672 3300045051 Bacteria 2408
745 Ga0451576_0260075 3300045051 Bacteria 1814
746 Ga0451576_0606265 3300045051 Bacteria 1151
747 Ga0451576_0816137 3300045051 Bacteria 979
748 Ga0451576_1101025 3300045051 Bacteria 831
749 Ga0451576_1538314 3300045051 Bacteria 691
750 Ga0466958_0036036 3300045836 Bacteria 2959
751 Ga0466958_0038400 3300045836 Bacteria 2873
752 Ga0466967_0595578 3300045976 Bacteria 1091
753 Ga0495592_0006417 3300046454 Bacteria 8754
754 Ga0495592_0022552 3300046454 Bacteria 4789
755 Ga0495592_0024414 3300046454 Bacteria 4596
756 Ga0495592_0051211 3300046454 Bacteria 3067
757 Ga0495592_0057057 3300046454 Bacteria 2883
758 Ga0495592_0096631 3300046454 Bacteria 2111
759 Ga0495603_0002879 3300046455 Bacteria 10178
760 Ga0495603_0079553 3300046455 Bacteria 1921
761 Ga0495590_0192973 3300046457 Bacteria 747
762 Ga0495629_0015797 3300046459 Bacteria 5421
763 Ga0495641_0013868 3300046461 Bacteria 4393
764 Ga0495641_0070180 3300046461 Bacteria 1574
765 Ga0495651_0000330 3300046462 Bacteria 36818
766 Ga0495651_0129986 3300046462 Bacteria 1839
767 Ga0495653_0031607 3300046463 Bacteria 4207
768 Ga0495653_0287831 3300046463 Bacteria 1076
769 Ga0495650_0025193 3300046471 Bacteria 2793
770 Ga0495580_0045495 3300046472 Bacteria 3117
771 Ga0495580_0104269 3300046472 Bacteria 1971
772 Ga0495582_0019856 3300046473 Bacteria 3675
773 Ga0495582_0065441 3300046473 Bacteria 2008
774 Ga0495582_0325954 3300046473 Bacteria 884
775 Ga0495605_0157714 3300046474 Bacteria 1009
776 Ga0495639_0016874 3300046475 Bacteria 3171
777 Ga0495639_0019052 3300046475 Bacteria 2993
778 Ga0495662_0012118 3300046476 Bacteria 4213
779 Ga0495662_0012796 3300046476 Bacteria 4091
780 Ga0495664_0039496 3300046477 Bacteria 2789
781 Ga0495584_0034293 3300046491 Bacteria 2568
782 Ga0495584_0139534 3300046491 Bacteria 1231
783 Ga0495584_0152108 3300046491 Bacteria 1175
784 Ga0495594_0035586 3300046499 Bacteria 2713
785 Ga0495594_0225007 3300046499 Bacteria 1070
786 Ga0495594_0256021 3300046499 Bacteria 997
787 Ga0495594_0471700 3300046499 Bacteria 713
788 Ga0495608_0058201 3300046511 Bacteria 2548
789 Ga0495608_0070270 3300046511 Bacteria 2285
790 Ga0495608_0171155 3300046511 Bacteria 1377
791 Ga0495618_0156188 3300046514 Bacteria 1456
792 Ga0495618_0206458 3300046514 Bacteria 1242
793 Ga0495628_0006673 3300046516 Bacteria 10065
794 Ga0495628_0067634 3300046516 Bacteria 2789
795 Ga0495628_0236492 3300046516 Bacteria 1368
796 Ga0495630_0023570 3300046517 Bacteria 4550
797 Ga0495630_0078289 3300046517 Bacteria 2492
798 Ga0495644_0197687 3300046523 Bacteria 775
799 Ga0495644_0228463 3300046523 Bacteria 720
800 Ga0495663_0070658 3300046525 Bacteria 1111
801 Ga0495663_0213958 3300046525 Bacteria 676
802 Ga0495666_0025550 3300046526 Bacteria 2916
803 Ga0495666_0030191 3300046526 Bacteria 2662
804 Ga0495652_0016527 3300046529 Bacteria 6600
805 Ga0495665_0032907 3300046531 Bacteria 2774
806 Ga0495665_0134763 3300046531 Bacteria 1292
807 Ga0495640_0043549 3300046533 Bacteria 3125
808 Ga0495640_0203586 3300046533 Bacteria 1253
809 Ga0495640_0270898 3300046533 Bacteria 1059
810 Ga0495640_0345207 3300046533 Bacteria 919
811 Ga0495586_0009349 3300046535 Bacteria 5214
812 Ga0495586_0015468 3300046535 Bacteria 4059
813 Ga0495586_0031541 3300046535 Bacteria 2839
814 Ga0495587_0008140 3300046536 Bacteria 6759
815 Ga0495587_0014866 3300046536 Bacteria 4870
816 Ga0495598_0088468 3300046537 Bacteria 1006
817 Ga0495621_0007990 3300046539 Bacteria 3152
818 Ga0495621_0133921 3300046539 Bacteria 966
819 Ga0495621_0230938 3300046539 Bacteria 751
820 Ga0495645_0003046 3300046543 Bacteria 11346
821 Ga0495645_0053623 3300046543 Bacteria 2930
822 Ga0495622_0188414 3300046557 Bacteria 923
823 Ga0495667_0025855 3300046559 Bacteria 3954
824 Ga0495667_0110333 3300046559 Bacteria 1777
825 Ga0495667_0181845 3300046559 Bacteria 1349
826 Ga0495634_0033792 3300046642 Bacteria 3512
827 Ga0495634_0126144 3300046642 Bacteria 1635
828 Ga0495635_0077719 3300046663 Bacteria 2273
829 Ga0495635_0089645 3300046663 Bacteria 2104
830 Ga0495659_0010183 3300046664 Bacteria 3013
831 Ga0495659_0011488 3300046664 Bacteria 2853
832 Ga0495659_0018068 3300046664 Bacteria 2345
833 Ga0495659_0033691 3300046664 Bacteria 1799
834 Ga0495588_0003424 3300046674 Bacteria 6894
835 Ga0495657_0015513 3300046675 Bacteria 5573
836 Ga0495657_0051824 3300046675 Bacteria 2755
837 Ga0495599_0009378 3300046678 Bacteria 5980
838 Ga0495599_0025668 3300046678 Bacteria 3690
839 Ga0495599_0038795 3300046678 Bacteria 2993
840 Ga0495599_0045984 3300046678 Bacteria 2737
841 Ga0495623_0187528 3300046679 Bacteria 1197
842 Ga0495647_0012487 3300046681 Bacteria 2926
843 Ga0495658_0048247 3300046683 Bacteria 2400
844 Ga0495658_0090028 3300046683 Bacteria 1815
845 Ga0495658_0094715 3300046683 Bacteria 1774
846 Ga0495658_0254019 3300046683 Bacteria 1106
847 Ga0495658_0264276 3300046683 Bacteria 1083
848 Ga0495658_0588668 3300046683 Bacteria 713
849 Ga0495669_0143477 3300046684 Bacteria 1128
850 Ga0495669_0145170 3300046684 Bacteria 1121
851 Ga0495613_0145642 3300046689 Bacteria 1690
852 Ga0495613_0204691 3300046689 Bacteria 1390
853 Ga0495613_0293298 3300046689 Bacteria 1127
854 Ga0495624_0053347 3300046690 Bacteria 2553
855 Ga0495624_0189577 3300046690 Bacteria 1251
856 Ga0495670_0229176 3300046691 Bacteria 988
857 Ga0495600_0005383 3300046809 Bacteria 7715
858 Ga0495581_0129820 3300047315 Bacteria 1468
859 Ga0495604_0066910 3300047317 Bacteria 2731
860 Ga0495636_0046260 3300047318 Bacteria 1814
861 Ga0495636_0112164 3300047318 Bacteria 1200
862 Ga0495636_0178911 3300047318 Bacteria 962
863 Ga0495674_0058934 3300047319 Bacteria 3355
864 Ga0495674_0136209 3300047319 Bacteria 2066
865 Ga0495674_0729270 3300047319 Bacteria 776
866 Ga0495672_0174178 3300047320 Bacteria 1095
867 Ga0495676_0022165 3300047321 Bacteria 5533
868 Ga0495680_0009272 3300047322 Bacteria 8865
869 Ga0495680_0476364 3300047322 Bacteria 850
870 Ga0495675_0092961 3300047444 Bacteria 1892
871 Ga0495675_0147024 3300047444 Bacteria 1458
872 Ga0495675_0283770 3300047444 Bacteria 987
873 Ga0495684_0174430 3300047471 Bacteria 1597
874 Ga0495602_0150513 3300048088 Bacteria 1830
875 Ga0495614_0139450 3300048089 Bacteria 1077
876 Ga0495614_0148665 3300048089 Bacteria 1044
877 Ga0496104_0026791 3300048907 Bacteria 5328
878 Ga0496105_0148478 3300048908 Bacteria 1928
879 Ga0496106_0000002 3300048909 Bacteria 377020
880 Ga0496106_0497198 3300048909 Bacteria 980
881 Ga0496109_0135678 3300048912 Bacteria 2299
882 Ga0496110_0305247 3300048913 Bacteria 1450
883 Ga0496114_0046832 3300048917 Bacteria 3594
884 Ga0496115_0402389 3300048918 Bacteria 1111
885 Ga0496121_0000188 3300048924 Bacteria 138221
886 Ga0496121_0004978 3300048924 Bacteria 17407
887 Ga0496126_0000783 3300048929 Bacteria 57293
888 Ga0501298_006885 3300049521 Bacteria 1872
889 Ga0501301_006743 3300049524 Bacteria 872
890 Ga0501031_0360544 3300049568 Bacteria 941
891 Ga0501032_0188007 3300049569 Bacteria 1350
892 Ga0501033_0003162 3300049570 Bacteria 13681
893 Ga0501033_0004124 3300049570 Bacteria 11709
894 Ga0501034_0590682 3300049571 Bacteria 1017
895 Ga0501036_0350782 3300049572 Bacteria 1232
896 Ga0501037_0041160 3300049573 Bacteria 3398
897 Ga0501038_0011635 3300049574 Bacteria 8026
898 Ga0501038_0051878 3300049574 Bacteria 3538
899 Ga0501038_0117039 3300049574 Bacteria 2202
900 Ga0501039_0003316 3300049575 Bacteria 12041
901 Ga0501039_0019554 3300049575 Bacteria 5192
902 Ga0501039_0118546 3300049575 Bacteria 2073
903 Ga0501039_0159525 3300049575 Bacteria 1773
904 Ga0501039_0786415 3300049575 Bacteria 743
905 Ga0501040_0002840 3300049576 Bacteria 11184
906 Ga0501040_0004847 3300049576 Bacteria 8709
907 Ga0501040_0018909 3300049576 Bacteria 4578
908 Ga0501041_0002963 3300049577 Bacteria 9732
909 Ga0501041_0071359 3300049577 Bacteria 2132
910 Ga0501041_0105954 3300049577 Bacteria 1742
911 Ga0501041_0243003 3300049577 Bacteria 1131
912 Ga0501042_0003637 3300049578 Bacteria 9722
913 Ga0501042_0063368 3300049578 Bacteria 2642
914 Ga0501042_0158059 3300049578 Bacteria 1635
915 Ga0501042_0271238 3300049578 Bacteria 1225
916 Ga0501042_0457986 3300049578 Bacteria 925
917 Ga0501043_0075803 3300049579 Bacteria 2642
918 Ga0501043_0179590 3300049579 Bacteria 1649
919 Ga0501046_0000583 3300049580 Bacteria 35953
920 Ga0501046_0010778 3300049580 Bacteria 7839
921 Ga0501046_0034333 3300049580 Bacteria 4094
922 Ga0501047_0148302 3300049581 Bacteria 2222
923 Ga0501048_0048965 3300049582 Bacteria 3013
924 Ga0501048_0083760 3300049582 Bacteria 2249
925 Ga0501068_0027506 3300049584 Bacteria 3358
926 Ga0501069_0000762 3300049585 Bacteria 15054
927 Ga0501069_0270581 3300049585 Bacteria 993
928 Ga0501070_0000520 3300049586 Bacteria 35280
929 Ga0501070_0185816 3300049586 Bacteria 1709
930 Ga0501071_0032083 3300049587 Bacteria 3728
931 Ga0501072_0004771 3300049588 Bacteria 10321
932 Ga0501072_0024394 3300049588 Bacteria 4704
933 Ga0501072_0698676 3300049588 Bacteria 797
934 Ga0501073_0001617 3300049589 Bacteria 16692
935 Ga0501073_0293261 3300049589 Bacteria 1122
936 Ga0501074_0000778 3300049590 Bacteria 20133
937 Ga0501074_0015775 3300049590 Bacteria 5492
938 Ga0501075_0001827 3300049591 Bacteria 14031
939 Ga0501075_0082024 3300049591 Bacteria 2442
940 Ga0501075_0149003 3300049591 Bacteria 1783
941 Ga0501076_0000718 3300049592 Bacteria 21378
942 Ga0501076_0004058 3300049592 Bacteria 10350
943 Ga0501076_0007717 3300049592 Bacteria 7839
944 Ga0501077_0005713 3300049593 Bacteria 7573
945 Ga0501077_0005714 3300049593 Bacteria 7572
946 Ga0501077_0014746 3300049593 Bacteria 4911
947 Ga0501235_059206 3300049669 Bacteria 896
948 Ga0501249_030480 3300049679 Bacteria 1201
949 Ga0501225_0056497 3300049705 Bacteria 1099
950 Ga0501079_0004816 3300049741 Bacteria 10001
951 Ga0501079_0008196 3300049741 Bacteria 7919
952 Ga0501079_0017044 3300049741 Bacteria 5547
953 Ga0501079_0049118 3300049741 Bacteria 3256
954 Ga0501080_0009662 3300049742 Bacteria 8809
955 Ga0501080_0034973 3300049742 Bacteria 4691
956 Ga0501080_0060217 3300049742 Bacteria 3533
957 Ga0501080_0097300 3300049742 Bacteria 2732
958 Ga0501081_0000426 3300049743 Bacteria 23313
959 Ga0501081_0001411 3300049743 Bacteria 14690
960 Ga0501081_0012608 3300049743 Bacteria 5558
961 Ga0501081_0123262 3300049743 Bacteria 1848
962 Ga0501081_0247769 3300049743 Bacteria 1300
963 Ga0501083_0002739 3300049744 Bacteria 12175
964 Ga0501083_0051572 3300049744 Bacteria 2766
965 Ga0501283_014211 3300049779 Bacteria 1214
966 Ga0501035_0029537 3300049822 Bacteria 5000
967 Ga0501035_0184204 3300049822 Bacteria 1797
968 Ga0501035_0232223 3300049822 Bacteria 1572
969 Ga0501044_0177430 3300049823 Bacteria 2099
970 Ga0501044_0350437 3300049823 Bacteria 1396
971 Ga0501045_0016498 3300049824 Bacteria 5248
972 Ga0501045_0016854 3300049824 Bacteria 5190
973 Ga0501045_0025487 3300049824 Bacteria 4252
974 Ga0501045_0086254 3300049824 Bacteria 2317
975 Ga0501045_0184855 3300049824 Bacteria 1553
976 nmdc:mga0k408_34802_c1 3300050493 Bacteria 2885
977 nmdc:mga0k408_558015_c1 3300050493 Bacteria 677
978 nmdc:mga06z11_144703_c1 3300050494 Bacteria 1346
979 nmdc:mga05p37_29455_c1 3300050507 Bacteria 6699
980 nmdc:mga05p37_31057_c1 3300050507 Bacteria 6523
981 nmdc:mga05p37_3200_c1 3300050507 Bacteria 19051
982 nmdc:mga05p37_331_c1 3300050507 Bacteria 50709
983 nmdc:mga05p37_551669_c1 3300050507 Bacteria 1312
984 nmdc:mga05p37_562883_c1 3300050507 Bacteria 1295
985 nmdc:mga05p37_6447_c1 3300050507 Bacteria 13837
986 nmdc:mga09592_118522_c1 3300050508 Bacteria 2272
987 nmdc:mga09592_308513_c1 3300050508 Bacteria 1371
988 nmdc:mga09592_3807_c1 3300050508 Bacteria 12145
989 nmdc:mga09592_4034_c1 3300050508 Bacteria 11848
990 nmdc:mga09592_53166_c1 3300050508 Bacteria 3419
991 nmdc:mga09592_65193_c1 3300050508 Bacteria 3085
992 nmdc:mga0qj67_208880_c1 3300050509 Bacteria 1586
993 nmdc:mga0qj67_214490_c1 3300050509 Bacteria 1563
994 nmdc:mga0qj67_483026_c1 3300050509 Bacteria 996
995 nmdc:mga0qj67_534742_c1 3300050509 Bacteria 941
996 nmdc:mga0qj67_53781_c1 3300050509 Bacteria 3188
997 nmdc:mga0qj67_7276_c1 3300050509 Bacteria 8178
998 nmdc:mga06r32_287818_c1 3300050510 Bacteria 1630
999 nmdc:mga06r32_312787_c1 3300050510 Bacteria 1556
1000 nmdc:mga08y16_105182_c1 3300050511 Bacteria 2939
1001 nmdc:mga08y16_223451_c1 3300050511 Bacteria 1949
1002 nmdc:mga08y16_26107_c1 3300050511 Bacteria 6161
1003 nmdc:mga08y16_35684_c1 3300050511 Bacteria 5222
1004 nmdc:mga08y16_357825_c1 3300050511 Bacteria 1499
1005 nmdc:mga08y16_376928_c1 3300050511 Bacteria 1455
1006 nmdc:mga08y16_4262_c1 3300050511 Bacteria 14934
1007 nmdc:mga08y16_50588_c1 3300050511 Bacteria 4348
1008 nmdc:mga08y16_807312_c1 3300050511 Bacteria 931
1009 nmdc:mga0n895_104407_c1 3300050512 Bacteria 2846
1010 nmdc:mga0n895_124172_c1 3300050512 Bacteria 2604
1011 nmdc:mga0n895_12827_c1 3300050512 Bacteria 7530
1012 nmdc:mga0n895_129987_c1 3300050512 Bacteria 2543
1013 nmdc:mga0n895_189577_c1 3300050512 Bacteria 2087
1014 nmdc:mga0n895_219233_c1 3300050512 Bacteria 1932
1015 nmdc:mga0n895_357119_c1 3300050512 Bacteria 1480
1016 nmdc:mga0n895_595208_c1 3300050512 Bacteria 1109
1017 nmdc:mga0n895_61111_c1 3300050512 Bacteria 3719
1018 nmdc:mga0n895_79858_c1 3300050512 Bacteria 3258
1019 nmdc:mga0n895_83290_c1 3300050512 Bacteria 3190
1020 nmdc:mga0n895_858088_c1 3300050512 Bacteria 895
1021 nmdc:mga0n895_94392_c1 3300050512 Bacteria 2995
1022 nmdc:mga0rr50_283881_c1 3300050513 Bacteria 1382
1023 nmdc:mga0rr50_288869_c1 3300050513 Bacteria 1370
1024 nmdc:mga0rr50_332597_c1 3300050513 Bacteria 1275
1025 nmdc:mga0rr50_40872_c1 3300050513 Bacteria 3374
1026 nmdc:mga0rr50_483546_c1 3300050513 Bacteria 1052
1027 nmdc:mga0rr50_553213_c1 3300050513 Bacteria 980
1028 nmdc:mga0rr50_593264_c1 3300050513 Bacteria 944
1029 nmdc:mga0rr50_733378_c1 3300050513 Bacteria 843
1030 nmdc:mga08x19_13853_c1 3300050514 Bacteria 4885
1031 nmdc:mga08x19_426260_c1 3300050514 Bacteria 932
1032 nmdc:mga08x19_52337_c1 3300050514 Bacteria 2626
1033 nmdc:mga08x19_65083_c1 3300050514 Bacteria 2367
1034 nmdc:mga0a205_176867_c1 3300050515 Bacteria 2029
1035 nmdc:mga0a205_36607_c1 3300050515 Bacteria 4716
1036 nmdc:mga0a205_39642_c1 3300050515 Bacteria 4533
1037 nmdc:mga0a205_430641_c1 3300050515 Bacteria 1180
1038 nmdc:mga0a205_48316_c1 3300050515 Bacteria 4107
1039 nmdc:mga0a205_565726_c1 3300050515 Bacteria 991
1040 nmdc:mga0a205_5777_c2 3300050515 Bacteria 10585
1041 nmdc:mga0a205_69813_c1 3300050515 Bacteria 3392
1042 nmdc:mga0a205_96870_c1 3300050515 Bacteria 2849
1043 Ga0495601_0012593 3300053077 Bacteria 5072
1044 Ga0495601_0066789 3300053077 Bacteria 2290
1045 Ga0495601_0294133 3300053077 Bacteria 1058
1046 Ga0495595_0037586 3300053084 Bacteria 2202
1047 Ga0495595_0046869 3300053084 Bacteria 1992
1048 Ga0495619_0155748 3300053085 Bacteria 1576
1049 Ga0500590_001674 3300053148 Bacteria 9274
1050 Ga0500619_000126 3300053154 Bacteria 20001
1051 Ga0501084_0035956 3300054114 Bacteria 4139
1052 Ga0501084_0051739 3300054114 Bacteria 3438
1053 Ga0590071_009014 3300059421 Bacteria 2346
1054 Ga0466962_0184301 3300061719 Bacteria 1018
1055 Ga0530510_0001351 3300061734 Bacteria 16409
1056 Ga0530510_0003565 3300061734 Bacteria 10727
1057 Ga0530510_0004356 3300061734 Bacteria 9801
1058 Ga0530510_0244492 3300061734 Bacteria 1336
1059 2885277873 2885270888 Bacteria 9831543
1060 3005413543 3005409236 Bacteria 7188837
1061 Ga0157372_10054137
1062 SwRhRL2b_contig_3191446
1063 ARcpr5oldR_c009958
1064 ARSoilOldRDRAFT_c005664
1065 JGI24736J21556_1023795
1066 JGI24744J21845_10062573
1067 JGI24034J26672_10010129
1068 Ga0058862_12576047
1069 Ga0065704_10012151
1070 Ga0065704_10164581
1071 Ga0065712_10138667
1072 Ga0065712_10207366
1073 Ga0065715_10277776
1074 Ga0065707_10142056
1075 Ga0065707_10391200
1076 Ga0065707_10397682
1077 Ga0070658_10295606
1078 Ga0070676_10325754
1079 Ga0070683_100007890
1080 Ga0070690_100025367
1081 Ga0070690_100159487
1082 Ga0070690_100187637
1083 Ga0070690_100744632
1084 Ga0068869_100022922
1085 Ga0068869_100459548
1086 Ga0070666_10079909
1087 Ga0070666_10350231
1088 Ga0070680_100031041
1089 Ga0070680_100241394
1090 Ga0070680_100536017
1091 Ga0070680_100588664
1092 Ga0070682_100006531
1093 Ga0068868_100048250
1094 Ga0068868_101009160
1095 Ga0068868_101058630
1096 Ga0070689_100004358
1097 Ga0070689_100041867
1098 Ga0070689_100088109
1099 Ga0070689_100131450
1100 Ga0070689_100489887
1101 Ga0070691_10002771
1102 Ga0070691_10086361
1103 Ga0070687_100086576
1104 Ga0070687_100117773
1105 Ga0070687_100183903
1106 Ga0070687_100387443
1107 Ga0070687_100541285
1108 Ga0070661_100094216
1109 Ga0070692_10002542
1110 Ga0070692_10257748
1111 Ga0070668_100170302
1112 Ga0070669_100000739
1113 Ga0070669_100303455
1114 Ga0070669_100410544
1115 Ga0070675_100016495
1116 Ga0070675_100042883
1117 Ga0070675_100110524
1118 Ga0070675_100305914
1119 Ga0070671_100162160
1120 Ga0070671_100238411
1121 Ga0070674_100324934
1122 Ga0070673_100100450
1123 Ga0070673_100105097
1124 Ga0070673_100163817
1125 Ga0070673_100668927
1126 Ga0070688_100018505
1127 Ga0070688_100092881
1128 Ga0070688_100135490
1129 Ga0070667_100429728
1130 Ga0070667_100451977
1131 Ga0070703_10122957
1132 Ga0070714_100284299
1133 Ga0070714_100303896
1134 Ga0070713_100012279
1135 Ga0070713_100102518
1136 Ga0070713_100546226
1137 Ga0070701_10008555
1138 Ga0070701_10090978
1139 Ga0070701_10571481
1140 Ga0070711_100557231
1141 Ga0070711_100801248
1142 Ga0070705_100000108
1143 Ga0070705_100039722
1144 Ga0070705_100143508
1145 Ga0070705_100234190
1146 Ga0070705_100238366
1147 Ga0070705_100453139
1148 Ga0070700_100162458
1149 Ga0070700_100188456
1150 Ga0070694_100020418
1151 Ga0070694_100022652
1152 Ga0070694_100192098
1153 Ga0070694_100376079
1154 Ga0070694_100477142
1155 Ga0070708_100103908
1156 Ga0070708_100114838
1157 Ga0070708_100227567
1158 Ga0070663_100069475
1159 Ga0070678_100591700
1160 Ga0070662_100049570
1161 Ga0070681_10018567
1162 Ga0070681_10018962
1163 Ga0070681_10020240
1164 Ga0070681_10020583
1165 Ga0070681_10036908
1166 Ga0070681_10082153
1167 Ga0068867_100004387
1168 Ga0068867_100911501
1169 Ga0070685_10180442
1170 Ga0070685_10270449
1171 Ga0070685_10301070
1172 Ga0070706_100030106
1173 Ga0070706_100067859
1174 Ga0070706_100587874
1175 Ga0070706_100883854
1176 Ga0070707_100167909
1177 Ga0070707_100174139
1178 Ga0070707_100292504
1179 Ga0070707_100522742
1180 Ga0070707_100846142
1181 Ga0070698_100038208
1182 Ga0070698_100047033
1183 Ga0070698_100274403
1184 Ga0070698_100299858
1185 Ga0070698_100308320
1186 Ga0070698_100718531
1187 Ga0070699_100003168
1188 Ga0070699_100010154
1189 Ga0070699_100028998
1190 Ga0070699_100070494
1191 Ga0070699_100093669
1192 Ga0070699_100410665
1193 Ga0070699_100481393
1194 Ga0070679_100001812
1195 Ga0070679_100007791
1196 Ga0070679_100074072
1197 Ga0070679_100092213
1198 Ga0070679_100181703
1199 Ga0070679_100502283
1200 Ga0070679_100508467
1201 Ga0070679_100580485
1202 Ga0070684_100012143
1203 Ga0070684_100137437
1204 Ga0070684_100145024
1205 Ga0070697_100012632
1206 Ga0070697_100026075
1207 Ga0070697_100033676
1208 Ga0070697_100164643
1209 Ga0070697_100276585
1210 Ga0070697_100410592
1211 Ga0070697_101166667
1212 Ga0068853_100169984
1213 Ga0068853_100796368
1214 Ga0070672_100026908
1215 Ga0070672_100113700
1216 Ga0070672_100125184
1217 Ga0070686_100091100
1218 Ga0070686_100095324
1219 Ga0070686_100234934
1220 Ga0070686_100637111
1221 Ga0070695_100002095
1222 Ga0070695_100146643
1223 Ga0070695_100257462
1224 Ga0070695_100498135
1225 Ga0070696_100000180
1226 Ga0070696_100021785
1227 Ga0070696_100057118
1228 Ga0070696_100070794
1229 Ga0070696_100079146
1230 Ga0070696_100100300
1231 Ga0070696_100102924
1232 Ga0070696_100286810
1233 Ga0070696_100452234
1234 Ga0070693_100001151
1235 Ga0070665_100363626
1236 Ga0070704_100001866
1237 Ga0070704_100009010
1238 Ga0070704_100010578
1239 Ga0070704_100044702
1240 Ga0070704_100065410
1241 Ga0070704_100095877
1242 Ga0070704_100216431
1243 Ga0070704_100253493
1244 Ga0070704_100342956
1245 Ga0070704_100877526
1246 Ga0070704_101023410
1247 Ga0068855_100001026
1248 Ga0068855_100012705
1249 Ga0068855_100049308
1250 Ga0068855_100392686
1251 Ga0070664_100017923
1252 Ga0070664_100018613
1253 Ga0070664_100073010
1254 Ga0070664_100184978
1255 Ga0070664_100645420
1256 Ga0070664_100754057
1257 Ga0070664_100945902
1258 Ga0068857_100083390
1259 Ga0068857_100158661
1260 Ga0068857_100181138
1261 Ga0068857_100233760
1262 Ga0068857_100529775
1263 Ga0068857_100953674
1264 Ga0068854_100014330
1265 Ga0068854_100317687
1266 Ga0068854_100403478
1267 Ga0068856_100060899
1268 Ga0070702_100458271
1269 Ga0068852_100002946
1270 Ga0068852_100008701
1271 Ga0068852_100012355
1272 Ga0068852_100066112
1273 Ga0068852_100111657
1274 Ga0068852_100504045
1275 Ga0068852_101068054
1276 Ga0068859_100001226
1277 Ga0068859_100032097
1278 Ga0068859_100272209
1279 Ga0068864_100151599
1280 Ga0068864_101397013
1281 Ga0068861_100304979
1282 Ga0068861_100559420
1283 Ga0068861_100563874
1284 Ga0068861_101569304
1285 Ga0068851_10001034
1286 Ga0068870_10004542
1287 Ga0068870_10036353
1288 Ga0068870_10075527
1289 Ga0068863_100120170
1290 Ga0068863_100370523
1291 Ga0068863_100410205
1292 Ga0068863_100540002
1293 Ga0068858_100011660
1294 Ga0068858_100041666
1295 Ga0068858_100075661
1296 Ga0068858_100174104
1297 Ga0068858_100671138
1298 Ga0068860_100027637
1299 Ga0068862_100000936
1300 Ga0081455_10044130
1301 Ga0081539_10000784
1302 Ga0081539_10001417
1303 Ga0081539_10018413
1304 Ga0081539_10023062
1305 Ga0070717_10323922
1306 Ga0070717_10732603
1307 Ga0075364_10293237
1308 Ga0070715_10085933
1309 Ga0070715_10337313
1310 Ga0070716_100526442
1311 Ga0070712_100747546
1312 Ga0075367_10216606
1313 Ga0075367_10401561
1314 Ga0075366_10006441
1315 Ga0097621_100020817
1316 Ga0097621_100072507
1317 Ga0097621_100240151
1318 Ga0097621_100564813
1319 Ga0068871_100017452
1320 Ga0068871_100038370
1321 Ga0068871_100287246
1322 Ga0068871_101196207
1323 Ga0068871_101220182
1324 Ga0075428_100001175
1325 Ga0075428_100003327
1326 Ga0075428_100004010
1327 Ga0075428_100004550
1328 Ga0075428_100042969
1329 Ga0075428_100696108
1330 Ga0075428_100858539
1331 Ga0075428_101056590
1332 Ga0075430_100000498
1333 Ga0075430_100002934
1334 Ga0075430_100069207
1335 Ga0075430_100197768
1336 Ga0075430_100522218
1337 Ga0075430_100666745
1338 Ga0075431_100046186
1339 Ga0075431_100064349
1340 Ga0075431_100068998
1341 Ga0075431_100308504
1342 Ga0075431_100346603
1343 Ga0075433_10028232
1344 Ga0075433_10121887
1345 Ga0075433_10162581
1346 Ga0075433_10242824
1347 Ga0075433_10272932
1348 Ga0075433_10467030
1349 Ga0075433_10546284
1350 Ga0075433_10644679
1351 Ga0075434_100001205
1352 Ga0075434_100031867
1353 Ga0075434_100085376
1354 Ga0075434_100110147
1355 Ga0075434_100149851
1356 Ga0075434_100331759
1357 Ga0075434_100447863
1358 Ga0075434_100607600
1359 Ga0075434_100850219
1360 Ga0075429_100001637
1361 Ga0075429_100010090
1362 Ga0075429_100010698
1363 Ga0075429_100011040
1364 Ga0075429_100017945
1365 Ga0075436_100045265
1366 Ga0075436_100057085
1367 Ga0075436_100082492
1368 Ga0075436_100108035
1369 Ga0075436_100180569
1370 Ga0075436_100236343
1371 Ga0075436_100491400
1372 Ga0097620_100001226
1373 Ga0097620_100032097
1374 Ga0097620_100272189
1375 Ga0075435_100082168
1376 Ga0075435_100128335
1377 Ga0075435_100184914
1378 Ga0075435_100215458
1379 Ga0075435_100311666
1380 Ga0075435_100515020
1381 Ga0099794_10220763
1382 Ga0099795_10105517
1383 Ga0105250_10149064
1384 Ga0105240_10003193
1385 Ga0105240_10017393
1386 Ga0105240_10040202
1387 Ga0105240_10065260
1388 Ga0105240_10077370
1389 Ga0105240_10339527
1390 Ga0111539_10000829
1391 Ga0111539_10001620
1392 Ga0111539_10017285
1393 Ga0111539_10060114
1394 Ga0111539_10064868
1395 Ga0111539_10252812
1396 Ga0111539_10260136
1397 Ga0111539_10264846
1398 Ga0111539_10349958
1399 Ga0111539_10623884
1400 Ga0111539_10747725
1401 Ga0105245_10086886
1402 Ga0105247_10156699
1403 Ga0105247_10698701
1404 Ga0114129_10009943
1405 Ga0114129_10042478
1406 Ga0114129_10090544
1407 Ga0114129_10242973
1408 Ga0114129_10358167
1409 Ga0114129_10445809
1410 Ga0114129_10564593
1411 Ga0114129_10584212
1412 Ga0114129_11024251
1413 Ga0105243_10070885
1414 Ga0105241_10074350
1415 Ga0105242_10056398
1416 Ga0105242_10073905
1417 Ga0105242_10107916
1418 Ga0105242_10356503
1419 Ga0105242_10794903
1420 Ga0105242_10852726
1421 Ga0105248_10126896
1422 Ga0105248_10202748
1423 Ga0105248_10323721
1424 Ga0105248_10412847
1425 Ga0105248_10600328
1426 Ga0105248_11285587
1427 Ga0105238_10103045
1428 Ga0105238_10114073
1429 Ga0105238_10217537
1430 Ga0105238_10824962
1431 Ga0105249_10672699
1432 Ga0105249_10986705
1433 Ga0099796_10069805
1434 Ga0105239_10001816
1435 Ga0105239_10177959
1436 Ga0105246_10045566
1437 Ga0105246_10116050
1438 Ga0105246_10685142
1439 Ga0157345_1003674
1440 Ga0157373_10356240
1441 Ga0157371_10167367
1442 Ga0157370_10005710
1443 Ga0157370_10042884
1444 Ga0157370_10370711
1445 Ga0157370_10556619
1446 Ga0157369_10043732
1447 Ga0157369_10044856
1448 Ga0157369_10198653
1449 Ga0157374_10058657
1450 Ga0163162_10326290
1451 Ga0163162_10446001
1452 Ga0163162_10477587
1453 Ga0163162_11368340
1454 Ga0157372_10012175
1455 Ga0157372_10482531
1456 Ga0157372_10486194
1457 Ga0157372_11114786
1458 Ga0157375_10087661
1459 Ga0157375_10251269
1460 Ga0157375_10295397
1461 Ga0157375_10706320
1462 Ga0157375_10991938
1463 Ga0163163_10274853
1464 Ga0157380_10106642
1465 Ga0157380_10715014
1466 Ga0157377_10075513
1467 Ga0157377_10167416
1468 Ga0157379_10127673
1469 Ga0157379_10189110
1470 Ga0157379_10700527
1471 Ga0157379_10849578
1472 Ga0157376_10170070
1473 Ga0163161_10406551
1474 Ga0206350_11230895
1475 Ga0213875_10000825
1476 Ga0213875_10066103
1477 Ga0224572_1011562
1478 Ga0228598_1006731
1479 Ga0209233_1043555
1480 Ga0207656_10005524
1481 Ga0207653_10077711
1482 Ga0207692_10266016
1483 Ga0207642_10000795
1484 Ga0207688_10032513
1485 Ga0207688_10054151
1486 Ga0207688_10157069
1487 Ga0207680_10073954
1488 Ga0207680_10274317
1489 Ga0207680_10349282
1490 Ga0207680_10631961
1491 Ga0207680_10802778
1492 Ga0207699_10070849
1493 Ga0207645_10331099
1494 Ga0207643_10005979
1495 Ga0207643_10082475
1496 Ga0207705_10034767
1497 Ga0207684_10049010
1498 Ga0207684_10120761
1499 Ga0207684_10238364
1500 Ga0207684_10465228
1501 Ga0207654_10002438
1502 Ga0207654_10015834
1503 Ga0207707_10003497
1504 Ga0207707_10016850
1505 Ga0207707_10029245
1506 Ga0207707_10034663
1507 Ga0207695_10009849
1508 Ga0207695_10023472
1509 Ga0207695_10066308
1510 Ga0207695_10142311
1511 Ga0207695_10276279
1512 Ga0207695_10799832
1513 Ga0207671_10010577
1514 Ga0207693_10453835
1515 Ga0207693_10526241
1516 Ga0207663_10323963
1517 Ga0207660_10000870
1518 Ga0207660_10031088
1519 Ga0207660_10390991
1520 Ga0207660_10463861
1521 Ga0207660_10618407
1522 Ga0207660_10622915
1523 Ga0207660_10900217
1524 Ga0207662_10005398
1525 Ga0207662_10485524
1526 Ga0207657_10075804
1527 Ga0207649_10037319
1528 Ga0207649_10455895
1529 Ga0207652_10035689
1530 Ga0207652_10056144
1531 Ga0207652_10130747
1532 Ga0207652_10156661
1533 Ga0207652_10389944
1534 Ga0207652_10540999
1535 Ga0207646_10107224
1536 Ga0207646_10252742
1537 Ga0207646_10356553
1538 Ga0207646_10379444
1539 Ga0207646_10721780
1540 Ga0207646_11054382
1541 Ga0207681_10013395
1542 Ga0207681_10183660
1543 Ga0207681_10199406
1544 Ga0207694_10011571
1545 Ga0207694_10061409
1546 Ga0207694_10083769
1547 Ga0207694_10115840
1548 Ga0207694_10162552
1549 Ga0207694_10465046
1550 Ga0207650_10057766
1551 Ga0207659_10000497
1552 Ga0207659_10034718
1553 Ga0207659_10126562
1554 Ga0207687_10000777
1555 Ga0207687_10369365
1556 Ga0207687_10712870
1557 Ga0207700_10016392
1558 Ga0207700_10075771
1559 Ga0207700_10429579
1560 Ga0207664_10200486
1561 Ga0207664_10393447
1562 Ga0207644_10238897
1563 Ga0207644_10242479
1564 Ga0207644_10400244
1565 Ga0207706_10020119
1566 Ga0207706_10782110
1567 Ga0207706_10875667
1568 Ga0207686_10004090
1569 Ga0207686_10005387
1570 Ga0207686_10035151
1571 Ga0207686_10179917
1572 Ga0207686_10357970
1573 Ga0207686_10585071
1574 Ga0207709_10002925
1575 Ga0207709_10153793
1576 Ga0207670_10011914
1577 Ga0207670_10016160
1578 Ga0207670_10066253
1579 Ga0207670_10114076
1580 Ga0207704_10001762
1581 Ga0207704_10056227
1582 Ga0207704_10255673
1583 Ga0207665_10163607
1584 Ga0207665_10480228
1585 Ga0207665_10559663
1586 Ga0207691_10017737
1587 Ga0207691_10036125
1588 Ga0207691_10058161
1589 Ga0207691_10297890
1590 Ga0207691_10425513
1591 Ga0207711_10078696
1592 Ga0207711_10129445
1593 Ga0207711_10271924
1594 Ga0207711_10643763
1595 Ga0207711_10785875
1596 Ga0207689_10193235
1597 Ga0207689_10925381
1598 Ga0207661_10018037
1599 Ga0207661_11045623
1600 Ga0207679_10049021
1601 Ga0207679_10077749
1602 Ga0207679_10109254
1603 Ga0207679_10171460
1604 Ga0207679_10373798
1605 Ga0207679_10653994
1606 Ga0207667_10012992
1607 Ga0207667_10021112
1608 Ga0207667_10025639
1609 Ga0207667_10046656
1610 Ga0207667_10793221
1611 Ga0207651_10126165
1612 Ga0207651_10223403
1613 Ga0207651_10246370
1614 Ga0207712_10065482
1615 Ga0207712_10145845
1616 Ga0207640_10016745
1617 Ga0207640_10187453
1618 Ga0207640_10345945
1619 Ga0207640_10476957
1620 Ga0207658_10503289
1621 Ga0207677_10003975
1622 Ga0207677_10153715
1623 Ga0207677_10236452
1624 Ga0207677_11317215
1625 Ga0207703_10007192
1626 Ga0207703_10007199
1627 Ga0207703_10049396
1628 Ga0207703_10754127
1629 Ga0207639_10047688
1630 Ga0207639_10089627
1631 Ga0207639_10141060
1632 Ga0207708_10008062
1633 Ga0207708_10011323
1634 Ga0207708_10043409
1635 Ga0207708_10115137
1636 Ga0207708_10820029
1637 Ga0207702_10110619
1638 Ga0207702_10301901
1639 Ga0207702_10425705
1640 Ga0207641_10058519
1641 Ga0207641_10094527
1642 Ga0207641_10097219
1643 Ga0207648_10004952
1644 Ga0207676_10096410
1645 Ga0207676_10398149
1646 Ga0207676_10737063
1647 Ga0207674_10032849
1648 Ga0207674_10041787
1649 Ga0207674_10094210
1650 Ga0207674_10945056
1651 Ga0207675_100011137
1652 Ga0207675_100207131
1653 Ga0207675_100218538
1654 Ga0207675_100439040
1655 Ga0207683_10208216
1656 Ga0207683_10430023
1657 Ga0207698_10000418
1658 Ga0207698_10021364
1659 Ga0207698_10097809
1660 Ga0207698_10216375
1661 Ga0207698_10337582
1662 Ga0209969_1012774
1663 Ga0209981_1024598
1664 Ga0209999_1029527
1665 Ga0209588_1016536
1666 Ga0209588_1039163
1667 Ga0209998_10085360
1668 Ga0207428_10002123
1669 Ga0207428_10005694
1670 Ga0207428_10009987
1671 Ga0207428_10097371
1672 Ga0207428_10208048
1673 Ga0207428_10321947
1674 Ga0207428_10427244
1675 Ga0265357_1015454
1676 Ga0268266_10121600
1677 Ga0268265_10000768
1678 Ga0268264_10010052
1679 Ga0268264_10032877
1680 Ga0268264_10259452
1681 Ga0265338_10027443
1682 Ga0265773_1001335
1683 Ga0265325_10048933
1684 Ga0265339_10000323
1685 Ga0307408_100125672
1686 Ga0265313_10001589
1687 Ga0307405_10905397
1688 Ga0307413_10292705
1689 Ga0307409_100229965
1690 Ga0307409_100623655
1691 Ga0307416_100020661
1692 Ga0307416_100021589
1693 Ga0307416_100077582
1694 Ga0307416_100819420
1695 Ga0307416_100899632
1696 Ga0307414_10458339
1697 Ga0307415_100168376
1698 Ga0373948_0006145
1699 Ga0373950_0005040
1700 Ga0373938_0002374
1701 Ga0373926_0007208
1702 Ga0373926_0136483
1703 Ga0373929_0010367
1704 Ga0373934_0000114
1705 Ga0373934_0070257
1706 Ga0373951_0007192
1707 Ga0373951_0015649
1708 Ga0373923_0019953
1709 Ga0373923_0088705
1710 Ga0373932_0025353
1711 Ga0373936_0007051
1712 Ga0373936_0014321
1713 Ga0373939_0036313
1714 Ga0373939_0051690
1715 Ga0373941_0039352
1716 Ga0373953_0051178
1717 Ga0373953_0053703
1718 Ga0373953_0148077
1719 Ga0373954_0000191
1720 Ga0373954_0000511
1721 Ga0373954_0164892
1722 Ga0373956_0000137
1723 Ga0373956_0084704
1724 Ga0373956_0115569
1725 Ga0373957_0059787
1726 Ga0373946_0012587
1727 Ga0373946_0177899
1728 Ga0373946_0418447
1729 Ga0373955_0003667
1730 Ga0373955_0197262
1731 Ga0373955_0204252
1732 Ga0373955_0331269
1733 Ga0373961_0022217
1734 Ga0373924_0005523
1735 Ga0373924_0085207
1736 Ga0373924_0184295
1737 Ga0373931_0001370
1738 Ga0373931_0013447
1739 Ga0373935_0013594
1740 Ga0373935_0211732
1741 Ga0373935_0562011
1742 Ga0373927_0004154
1743 Ga0373927_0014329
1744 Ga0373927_0074943
1745 Ga0373933_0008591
1746 Ga0373933_0009793
1747 Ga0373933_0161322
1748 Ga0373933_0363933
1749 Ga0373947_0005577
1750 Ga0373947_0401070
1751 Ga0373947_0478285
1752 Ga0373937_0001819
1753 Ga0373937_0002151
1754 Ga0373937_0014778
1755 Ga0373937_0088704
1756 Ga0373937_0102121
1757 Ga0373937_0139655
1758 Ga0373937_0177460
1759 Ga0373937_0194409
1760 Ga0373937_1007521
1761 Ga0373925_0057775
1762 Ga0373925_0132139
1763 Ga0373925_0508940
1764 Ga0373925_0966927
1765 Ga0395900_0080357
1766 Ga0395905_0092397
1767 Ga0395905_0157392
1768 Ga0436364_0204334
1769 Ga0436364_0734767
1770 Ga0436364_0919491
1771 Ga0436364_0937935
1772 Ga0436364_1433936
1773 Ga0395901_0207803
1774 Ga0436365_0560582
1775 Ga0436365_1129272
1776 Ga0436365_1389857
1777 Ga0436365_1451327
1778 Ga0436365_1727819
1779 Ga0436361_0191136
1780 Ga0436361_0945327
1781 Ga0436361_1181632
1782 Ga0436363_0424337
1783 Ga0436363_0883771
1784 Ga0436362_0082502
1785 Ga0436362_0993435
1786 Ga0439441_000308
1787 Ga0439451_035547
1788 Ga0439435_0002925
1789 Ga0439435_0057173
1790 Ga0439435_0157386
1791 Ga0439444_0004416
1792 Ga0439460_0000132
1793 Ga0451577_0139976
1794 Ga0451577_0204093
1795 Ga0453683_0428571
1796 Ga0466966_0246346
1797 Ga0466966_0252218
1798 Ga0466964_0171150
1799 Ga0453684_0521800
1800 Ga0466957_0013848
1801 Ga0466957_0313304
1802 Ga0466959_0130223
1803 Ga0451576_0125236
1804 Ga0451576_0152672
1805 Ga0451576_0260075
1806 Ga0451576_0606265
1807 Ga0451576_0816137
1808 Ga0451576_1101025
1809 Ga0451576_1538314
1810 Ga0466958_0036036
1811 Ga0466958_0038400
1812 Ga0466967_0595578
1813 Ga0495592_0006417
1814 Ga0495592_0022552
1815 Ga0495592_0024414
1816 Ga0495592_0051211
1817 Ga0495592_0057057
1818 Ga0495592_0096631
1819 Ga0495603_0002879
1820 Ga0495603_0079553
1821 Ga0495590_0192973
1822 Ga0495629_0015797
1823 Ga0495641_0013868
1824 Ga0495641_0070180
1825 Ga0495651_0000330
1826 Ga0495651_0129986
1827 Ga0495653_0031607
1828 Ga0495653_0287831
1829 Ga0495650_0025193
1830 Ga0495580_0045495
1831 Ga0495580_0104269
1832 Ga0495582_0019856
1833 Ga0495582_0065441
1834 Ga0495582_0325954
1835 Ga0495605_0157714
1836 Ga0495639_0016874
1837 Ga0495639_0019052
1838 Ga0495662_0012118
1839 Ga0495662_0012796
1840 Ga0495664_0039496
1841 Ga0495584_0034293
1842 Ga0495584_0139534
1843 Ga0495584_0152108
1844 Ga0495594_0035586
1845 Ga0495594_0225007
1846 Ga0495594_0256021
1847 Ga0495594_0471700
1848 Ga0495608_0058201
1849 Ga0495608_0070270
1850 Ga0495608_0171155
1851 Ga0495618_0156188
1852 Ga0495618_0206458
1853 Ga0495628_0006673
1854 Ga0495628_0067634
1855 Ga0495628_0236492
1856 Ga0495630_0023570
1857 Ga0495630_0078289
1858 Ga0495644_0197687
1859 Ga0495644_0228463
1860 Ga0495663_0070658
1861 Ga0495663_0213958
1862 Ga0495666_0025550
1863 Ga0495666_0030191
1864 Ga0495652_0016527
1865 Ga0495665_0032907
1866 Ga0495665_0134763
1867 Ga0495640_0043549
1868 Ga0495640_0203586
1869 Ga0495640_0270898
1870 Ga0495640_0345207
1871 Ga0495586_0009349
1872 Ga0495586_0015468
1873 Ga0495586_0031541
1874 Ga0495587_0008140
1875 Ga0495587_0014866
1876 Ga0495598_0088468
1877 Ga0495621_0007990
1878 Ga0495621_0133921
1879 Ga0495621_0230938
1880 Ga0495645_0003046
1881 Ga0495645_0053623
1882 Ga0495622_0188414
1883 Ga0495667_0025855
1884 Ga0495667_0110333
1885 Ga0495667_0181845
1886 Ga0495634_0033792
1887 Ga0495634_0126144
1888 Ga0495635_0077719
1889 Ga0495635_0089645
1890 Ga0495659_0010183
1891 Ga0495659_0011488
1892 Ga0495659_0018068
1893 Ga0495659_0033691
1894 Ga0495588_0003424
1895 Ga0495657_0015513
1896 Ga0495657_0051824
1897 Ga0495599_0009378
1898 Ga0495599_0025668
1899 Ga0495599_0038795
1900 Ga0495599_0045984
1901 Ga0495623_0187528
1902 Ga0495647_0012487
1903 Ga0495658_0048247
1904 Ga0495658_0090028
1905 Ga0495658_0094715
1906 Ga0495658_0254019
1907 Ga0495658_0264276
1908 Ga0495658_0588668
1909 Ga0495669_0143477
1910 Ga0495669_0145170
1911 Ga0495613_0145642
1912 Ga0495613_0204691
1913 Ga0495613_0293298
1914 Ga0495624_0053347
1915 Ga0495624_0189577
1916 Ga0495670_0229176
1917 Ga0495600_0005383
1918 Ga0495581_0129820
1919 Ga0495604_0066910
1920 Ga0495636_0046260
1921 Ga0495636_0112164
1922 Ga0495636_0178911
1923 Ga0495674_0058934
1924 Ga0495674_0136209
1925 Ga0495674_0729270
1926 Ga0495672_0174178
1927 Ga0495676_0022165
1928 Ga0495680_0009272
1929 Ga0495680_0476364
1930 Ga0495675_0092961
1931 Ga0495675_0147024
1932 Ga0495675_0283770
1933 Ga0495684_0174430
1934 Ga0495602_0150513
1935 Ga0495614_0139450
1936 Ga0495614_0148665
1937 Ga0496104_0026791
1938 Ga0496105_0148478
1939 Ga0496106_0000002
1940 Ga0496106_0497198
1941 Ga0496109_0135678
1942 Ga0496110_0305247
1943 Ga0496114_0046832
1944 Ga0496115_0402389
1945 Ga0496121_0000188
1946 Ga0496121_0004978
1947 Ga0496126_0000783
1948 Ga0501298_006885
1949 Ga0501301_006743
1950 Ga0501031_0360544
1951 Ga0501032_0188007
1952 Ga0501033_0003162
1953 Ga0501033_0004124
1954 Ga0501034_0590682
1955 Ga0501036_0350782
1956 Ga0501037_0041160
1957 Ga0501038_0011635
1958 Ga0501038_0051878
1959 Ga0501038_0117039
1960 Ga0501039_0003316
1961 Ga0501039_0019554
1962 Ga0501039_0118546
1963 Ga0501039_0159525
1964 Ga0501039_0786415
1965 Ga0501040_0002840
1966 Ga0501040_0004847
1967 Ga0501040_0018909
1968 Ga0501041_0002963
1969 Ga0501041_0071359
1970 Ga0501041_0105954
1971 Ga0501041_0243003
1972 Ga0501042_0003637
1973 Ga0501042_0063368
1974 Ga0501042_0158059
1975 Ga0501042_0271238
1976 Ga0501042_0457986
1977 Ga0501043_0075803
1978 Ga0501043_0179590
1979 Ga0501046_0000583
1980 Ga0501046_0010778
1981 Ga0501046_0034333
1982 Ga0501047_0148302
1983 Ga0501048_0048965
1984 Ga0501048_0083760
1985 Ga0501068_0027506
1986 Ga0501069_0000762
1987 Ga0501069_0270581
1988 Ga0501070_0000520
1989 Ga0501070_0185816
1990 Ga0501071_0032083
1991 Ga0501072_0004771
1992 Ga0501072_0024394
1993 Ga0501072_0698676
1994 Ga0501073_0001617
1995 Ga0501073_0293261
1996 Ga0501074_0000778
1997 Ga0501074_0015775
1998 Ga0501075_0001827
1999 Ga0501075_0082024
2000 Ga0501075_0149003
2001 Ga0501076_0000718
2002 Ga0501076_0004058
2003 Ga0501076_0007717
2004 Ga0501077_0005713
2005 Ga0501077_0005714
2006 Ga0501077_0014746
2007 Ga0501235_059206
2008 Ga0501249_030480
2009 Ga0501225_0056497
2010 Ga0501079_0004816
2011 Ga0501079_0008196
2012 Ga0501079_0017044
2013 Ga0501079_0049118
2014 Ga0501080_0009662
2015 Ga0501080_0034973
2016 Ga0501080_0060217
2017 Ga0501080_0097300
2018 Ga0501081_0000426
2019 Ga0501081_0001411
2020 Ga0501081_0012608
2021 Ga0501081_0123262
2022 Ga0501081_0247769
2023 Ga0501083_0002739
2024 Ga0501083_0051572
2025 Ga0501283_014211
2026 Ga0501035_0029537
2027 Ga0501035_0184204
2028 Ga0501035_0232223
2029 Ga0501044_0177430
2030 Ga0501044_0350437
2031 Ga0501045_0016498
2032 Ga0501045_0016854
2033 Ga0501045_0025487
2034 Ga0501045_0086254
2035 Ga0501045_0184855
2036 nmdc:mga0k408_34802_c1
2037 nmdc:mga0k408_558015_c1
2038 nmdc:mga06z11_144703_c1
2039 nmdc:mga05p37_29455_c1
2040 nmdc:mga05p37_31057_c1
2041 nmdc:mga05p37_3200_c1
2042 nmdc:mga05p37_331_c1
2043 nmdc:mga05p37_551669_c1
2044 nmdc:mga05p37_562883_c1
2045 nmdc:mga05p37_6447_c1
2046 nmdc:mga09592_118522_c1
2047 nmdc:mga09592_308513_c1
2048 nmdc:mga09592_3807_c1
2049 nmdc:mga09592_4034_c1
2050 nmdc:mga09592_53166_c1
2051 nmdc:mga09592_65193_c1
2052 nmdc:mga0qj67_208880_c1
2053 nmdc:mga0qj67_214490_c1
2054 nmdc:mga0qj67_483026_c1
2055 nmdc:mga0qj67_534742_c1
2056 nmdc:mga0qj67_53781_c1
2057 nmdc:mga0qj67_7276_c1
2058 nmdc:mga06r32_287818_c1
2059 nmdc:mga06r32_312787_c1
2060 nmdc:mga08y16_105182_c1
2061 nmdc:mga08y16_223451_c1
2062 nmdc:mga08y16_26107_c1
2063 nmdc:mga08y16_35684_c1
2064 nmdc:mga08y16_357825_c1
2065 nmdc:mga08y16_376928_c1
2066 nmdc:mga08y16_4262_c1
2067 nmdc:mga08y16_50588_c1
2068 nmdc:mga08y16_807312_c1
2069 nmdc:mga0n895_104407_c1
2070 nmdc:mga0n895_124172_c1
2071 nmdc:mga0n895_12827_c1
2072 nmdc:mga0n895_129987_c1
2073 nmdc:mga0n895_189577_c1
2074 nmdc:mga0n895_219233_c1
2075 nmdc:mga0n895_357119_c1
2076 nmdc:mga0n895_595208_c1
2077 nmdc:mga0n895_61111_c1
2078 nmdc:mga0n895_79858_c1
2079 nmdc:mga0n895_83290_c1
2080 nmdc:mga0n895_858088_c1
2081 nmdc:mga0n895_94392_c1
2082 nmdc:mga0rr50_283881_c1
2083 nmdc:mga0rr50_288869_c1
2084 nmdc:mga0rr50_332597_c1
2085 nmdc:mga0rr50_40872_c1
2086 nmdc:mga0rr50_483546_c1
2087 nmdc:mga0rr50_553213_c1
2088 nmdc:mga0rr50_593264_c1
2089 nmdc:mga0rr50_733378_c1
2090 nmdc:mga08x19_13853_c1
2091 nmdc:mga08x19_426260_c1
2092 nmdc:mga08x19_52337_c1
2093 nmdc:mga08x19_65083_c1
2094 nmdc:mga0a205_176867_c1
2095 nmdc:mga0a205_36607_c1
2096 nmdc:mga0a205_39642_c1
2097 nmdc:mga0a205_430641_c1
2098 nmdc:mga0a205_48316_c1
2099 nmdc:mga0a205_565726_c1
2100 nmdc:mga0a205_5777_c2
2101 nmdc:mga0a205_69813_c1
2102 nmdc:mga0a205_96870_c1
2103 Ga0495601_0012593
2104 Ga0495601_0066789
2105 Ga0495601_0294133
2106 Ga0495595_0037586
2107 Ga0495595_0046869
2108 Ga0495619_0155748
2109 Ga0500590_001674
2110 Ga0500619_000126
2111 Ga0501084_0035956
2112 Ga0501084_0051739
2113 Ga0590071_009014
2114 Ga0466962_0184301
2115 Ga0530510_0001351
2116 Ga0530510_0003565
2117 Ga0530510_0004356
2118 Ga0530510_0244492
2119 2885277873
2120 3005413543

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

73

160

0.92

PF02041

Auxin_BP

Auxin binding protein

28

169

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.8575 55 161
7x85-assembly2.cif.gz_C crystal structure of chicken cenp-c cupin domain 0.8478 47 162
3ibm-assembly1.cif.gz_B crystal structure of cupin 2 domain-containing protein hhal_0468 from halorhodospira halophila 0.8432 55 162
1sfn-assembly1.cif.gz_A crystal structure of protein dr1152 from deinococcus radiodurans r1, pfam duf861 0.8409 54 161
3es1-assembly1.cif.gz_A-2 crystal structure of protein with a cupin-like fold and unknown function (yp_001165807.1) from novosphingobium aromaticivorans dsm 12444 at 1.91 a resolution 0.8385 70 161
ID Description Score Start End Superfamily
af_F1LVA4_327_469_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8672 70 176 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8583 70 160 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8553 54 162 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8498 55 175 2.60.120.10
af_A0A0R0L0M3_22_151_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8412 69 175 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7C3JJ58-F1-model_v4 Cupin domain-containing protein 0.922 32 181
AF-A0A7X1PBS6-F1-model_v4 Cupin domain-containing protein 0.9207 33 181
AF-A0A3D9ZUW7-F1-model_v4 Cupin domain 0.9198 33 181
AF-A0A534UJM7-F1-model_v4 Cupin domain-containing protein 0.9185 32 181
AF-A0A536SRL1-F1-model_v4 Cupin domain-containing protein 0.9182 69 177

Map