F489303
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1062 | 443 | 2124 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10026825|Ga0105240_100268257 |
| Length | 255 |
| Sequence | MSEAEAVWLSSILPLAQFRNRSADRYTIGFPPEGIRMSRRTLDLNDKLYDYLLANSLREHPAQAALREATKDHPWAGMQISPEQGQLMALLVKLIGAKNAIEIGVFTGYSALTVALALPADGHLLACDISDEYTRIGRTFWKEAGVDGKIELRLAPAIKTLDARLADGAQGQYDFAFIDADKTGYDDYYERCLLLLRAGGLIAIDNVLWSGAVAKKAKTDDTRALQALNTKLHRDERVDISLLPIGDGLTLARKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 140 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 223 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 224 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 228 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 233 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 234 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 235 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 237 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 238 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 243 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 244 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 245 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 252 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 255 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 256 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 258 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 259 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 267 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 268 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 269 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 270 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 271 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 272 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 273 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 274 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 275 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 276 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 277 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 278 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 281 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 282 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 283 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 284 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 285 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 286 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 287 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 288 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 289 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 290 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 291 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 292 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 293 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 294 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 295 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 296 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 297 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 298 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 299 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 300 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 301 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 302 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 303 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 304 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 305 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 306 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 307 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 308 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 309 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 356 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 359 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 360 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 361 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 362 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 363 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 364 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 365 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 366 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 367 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 368 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 369 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 370 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 395 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 396 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 401 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 402 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 406 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 407 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 417 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 418 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 420 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 421 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 423 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 424 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 425 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 427 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 429 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 430 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 431 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 432 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 433 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 434 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 435 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 436 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 437 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 438 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 439 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 440 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 441 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 442 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 443 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.46 |
| Metatranscriptomes | 1.13 |
| Isolates | 1.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.52 |
| Nodule | 0 |
| Rhizoplane | 2.07 |
| Rhizosphere | 88.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_10026825 | 3300009093 | Bacteria | 7555 |
| 2 | JGI24747J21853_1019598 | 3300001978 | Bacteria | 730 |
| 3 | JGI24740J21852_10002282 | 3300001979 | Bacteria | 8718 |
| 4 | JGI24742J22300_10028610 | 3300002244 | Bacteria | 967 |
| 5 | JGI25162J39368_1000552 | 3300002737 | Bacteria | 27631 |
| 6 | JGI25154J39366_1001031 | 3300002738 | Bacteria | 11162 |
| 7 | JGI25165J46597_1000670 | 3300003214 | Bacteria | 27631 |
| 8 | JGI25153J46596_10000562 | 3300003215 | Bacteria | 22974 |
| 9 | JGI25404J52841_10003336 | 3300003659 | Bacteria | 3162 |
| 10 | Ga0055538_1000265 | 3300003751 | Bacteria | 27631 |
| 11 | Ga0055539_1000292 | 3300003752 | Bacteria | 27631 |
| 12 | Ga0055533_1000279 | 3300003756 | Bacteria | 27631 |
| 13 | Ga0055525_1000397 | 3300003759 | Bacteria | 27631 |
| 14 | Ga0055526_1000061 | 3300003771 | Bacteria | 106054 |
| 15 | Ga0055530_10028570 | 3300003791 | Bacteria | 1503 |
| 16 | Ga0055541_1000189 | 3300003841 | Bacteria | 27631 |
| 17 | Ga0065165_1030381 | 3300005262 | Bacteria | 1719 |
| 18 | Ga0065704_10171642 | 3300005289 | Unclassified | 1288 |
| 19 | Ga0065712_10086280 | 3300005290 | Bacteria | 2645 |
| 20 | Ga0065715_10096999 | 3300005293 | Bacteria | 3779 |
| 21 | Ga0065715_10119564 | 3300005293 | Bacteria | 2283 |
| 22 | Ga0065707_10081836 | 3300005295 | Bacteria | 34923 |
| 23 | Ga0070658_10000878 | 3300005327 | Bacteria | 25744 |
| 24 | Ga0070658_10017642 | 3300005327 | Bacteria | 5710 |
| 25 | Ga0070658_10037172 | 3300005327 | Bacteria | 3924 |
| 26 | Ga0070658_10159632 | 3300005327 | Bacteria | 1891 |
| 27 | Ga0070658_10334838 | 3300005327 | Bacteria | 1294 |
| 28 | Ga0070676_10025143 | 3300005328 | Bacteria | 3363 |
| 29 | Ga0070683_100030700 | 3300005329 | Bacteria | 4882 |
| 30 | Ga0070683_100145479 | 3300005329 | Bacteria | 2245 |
| 31 | Ga0070683_100185727 | 3300005329 | Bacteria | 1974 |
| 32 | Ga0070683_100305200 | 3300005329 | Bacteria | 1514 |
| 33 | Ga0070690_100009681 | 3300005330 | Bacteria | 5588 |
| 34 | Ga0070690_100034809 | 3300005330 | Bacteria | 3157 |
| 35 | Ga0070670_100022930 | 3300005331 | Bacteria | 5371 |
| 36 | Ga0070670_100026997 | 3300005331 | Bacteria | 4939 |
| 37 | Ga0070670_100029312 | 3300005331 | Bacteria | 4737 |
| 38 | Ga0070670_100082061 | 3300005331 | Bacteria | 2770 |
| 39 | Ga0070670_100147265 | 3300005331 | Bacteria | 2037 |
| 40 | Ga0070677_10002000 | 3300005333 | Bacteria | 6481 |
| 41 | Ga0070677_10014812 | 3300005333 | Unclassified | 2752 |
| 42 | Ga0068869_100003892 | 3300005334 | Bacteria | 9211 |
| 43 | Ga0068869_100171618 | 3300005334 | Bacteria | 1694 |
| 44 | Ga0070666_10030574 | 3300005335 | Bacteria | 3549 |
| 45 | Ga0070680_100005064 | 3300005336 | Bacteria | 9943 |
| 46 | Ga0070680_100105028 | 3300005336 | Bacteria | 2348 |
| 47 | Ga0070680_100116697 | 3300005336 | Bacteria | 2225 |
| 48 | Ga0070680_100265041 | 3300005336 | Bacteria | 1454 |
| 49 | Ga0070680_100416371 | 3300005336 | Bacteria | 1146 |
| 50 | Ga0070680_100680382 | 3300005336 | Bacteria | 885 |
| 51 | Ga0070682_100074888 | 3300005337 | Bacteria | 2175 |
| 52 | Ga0070682_100341721 | 3300005337 | Bacteria | 1113 |
| 53 | Ga0068868_100055701 | 3300005338 | Bacteria | 3121 |
| 54 | Ga0068868_100098667 | 3300005338 | Bacteria | 2362 |
| 55 | Ga0070660_100020762 | 3300005339 | Bacteria | 4834 |
| 56 | Ga0070660_100072589 | 3300005339 | Bacteria | 2690 |
| 57 | Ga0070660_100267728 | 3300005339 | Bacteria | 1396 |
| 58 | Ga0070660_100310441 | 3300005339 | Unclassified | 1294 |
| 59 | Ga0070689_100004722 | 3300005340 | Bacteria | 9247 |
| 60 | Ga0070691_10001239 | 3300005341 | Bacteria | 10753 |
| 61 | Ga0070661_100028799 | 3300005344 | Bacteria | 4007 |
| 62 | Ga0070661_100035354 | 3300005344 | Bacteria | 3628 |
| 63 | Ga0070661_100036184 | 3300005344 | Bacteria | 3589 |
| 64 | Ga0070661_100047822 | 3300005344 | Bacteria | 3131 |
| 65 | Ga0070661_100098215 | 3300005344 | Bacteria | 2175 |
| 66 | Ga0070661_100101094 | 3300005344 | Bacteria | 2144 |
| 67 | Ga0070661_100134125 | 3300005344 | Bacteria | 1862 |
| 68 | Ga0070692_10000156 | 3300005345 | Bacteria | 17039 |
| 69 | Ga0070692_10096910 | 3300005345 | Bacteria | 1612 |
| 70 | Ga0070692_10126787 | 3300005345 | Bacteria | 1430 |
| 71 | Ga0070692_10339690 | 3300005345 | Bacteria | 929 |
| 72 | Ga0070668_100002860 | 3300005347 | Bacteria | 12731 |
| 73 | Ga0070668_100025695 | 3300005347 | Bacteria | 4467 |
| 74 | Ga0070669_100006764 | 3300005353 | Bacteria | 8253 |
| 75 | Ga0070669_100015779 | 3300005353 | Bacteria | 5387 |
| 76 | Ga0070669_100554372 | 3300005353 | Bacteria | 958 |
| 77 | Ga0070675_100000158 | 3300005354 | Bacteria | 41146 |
| 78 | Ga0070675_100029770 | 3300005354 | Bacteria | 4405 |
| 79 | Ga0070675_100069599 | 3300005354 | Bacteria | 2916 |
| 80 | Ga0070671_100008095 | 3300005355 | Bacteria | 8417 |
| 81 | Ga0070671_100011485 | 3300005355 | Bacteria | 7121 |
| 82 | Ga0070671_100309862 | 3300005355 | Bacteria | 1344 |
| 83 | Ga0070671_100410291 | 3300005355 | Bacteria | 1159 |
| 84 | Ga0070674_100004688 | 3300005356 | Bacteria | 7814 |
| 85 | Ga0070674_100027541 | 3300005356 | Bacteria | 3725 |
| 86 | Ga0070673_100002034 | 3300005364 | Bacteria | 12204 |
| 87 | Ga0070673_100088781 | 3300005364 | Bacteria | 2522 |
| 88 | Ga0070673_100407084 | 3300005364 | Bacteria | 1217 |
| 89 | Ga0070673_100546618 | 3300005364 | Bacteria | 1052 |
| 90 | Ga0070688_100009085 | 3300005365 | Bacteria | 5421 |
| 91 | Ga0070688_100067667 | 3300005365 | Bacteria | 2276 |
| 92 | Ga0070659_100010910 | 3300005366 | Bacteria | 6704 |
| 93 | Ga0070659_100078604 | 3300005366 | Bacteria | 2632 |
| 94 | Ga0070659_100094191 | 3300005366 | Bacteria | 2405 |
| 95 | Ga0070667_100001488 | 3300005367 | Bacteria | 20998 |
| 96 | Ga0070667_100170680 | 3300005367 | Bacteria | 1920 |
| 97 | Ga0070667_100172723 | 3300005367 | Bacteria | 1909 |
| 98 | Ga0070667_100263048 | 3300005367 | Unclassified | 1545 |
| 99 | Ga0070667_100782299 | 3300005367 | Bacteria | 885 |
| 100 | Ga0070709_10000198 | 3300005434 | Bacteria | 38521 |
| 101 | Ga0070709_10078576 | 3300005434 | Bacteria | 2147 |
| 102 | Ga0070709_10091766 | 3300005434 | Bacteria | 2005 |
| 103 | Ga0070714_100003534 | 3300005435 | Bacteria | 11678 |
| 104 | Ga0070714_100020776 | 3300005435 | Bacteria | 5367 |
| 105 | Ga0070714_100131528 | 3300005435 | Bacteria | 2237 |
| 106 | Ga0070713_100000458 | 3300005436 | Bacteria | 26096 |
| 107 | Ga0070713_100064132 | 3300005436 | Bacteria | 3082 |
| 108 | Ga0070713_100313585 | 3300005436 | Bacteria | 1447 |
| 109 | Ga0070710_10000432 | 3300005437 | Bacteria | 19660 |
| 110 | Ga0070710_10430540 | 3300005437 | Bacteria | 890 |
| 111 | Ga0070701_10086602 | 3300005438 | Bacteria | 1708 |
| 112 | Ga0070711_100001067 | 3300005439 | Bacteria | 14618 |
| 113 | Ga0070711_100086220 | 3300005439 | Unclassified | 2251 |
| 114 | Ga0070711_100218400 | 3300005439 | Bacteria | 1480 |
| 115 | Ga0070700_100084560 | 3300005441 | Unclassified | 2056 |
| 116 | Ga0070708_100001307 | 3300005445 | Bacteria | 19092 |
| 117 | Ga0070663_100002315 | 3300005455 | Bacteria | 10698 |
| 118 | Ga0070663_100003421 | 3300005455 | Bacteria | 9159 |
| 119 | Ga0070663_100010281 | 3300005455 | Bacteria | 5829 |
| 120 | Ga0070663_100183568 | 3300005455 | Bacteria | 1624 |
| 121 | Ga0070663_100243623 | 3300005455 | Unclassified | 1420 |
| 122 | Ga0070663_100331062 | 3300005455 | Bacteria | 1227 |
| 123 | Ga0070663_100351529 | 3300005455 | Bacteria | 1193 |
| 124 | Ga0070663_100384768 | 3300005455 | Bacteria | 1143 |
| 125 | Ga0070678_100001095 | 3300005456 | Bacteria | 14186 |
| 126 | Ga0070678_100114257 | 3300005456 | Bacteria | 2118 |
| 127 | Ga0070678_100152603 | 3300005456 | Bacteria | 1862 |
| 128 | Ga0070678_100175332 | 3300005456 | Bacteria | 1750 |
| 129 | Ga0070678_100479264 | 3300005456 | Bacteria | 1094 |
| 130 | Ga0070678_100748341 | 3300005456 | Bacteria | 884 |
| 131 | Ga0070662_100005381 | 3300005457 | Bacteria | 8173 |
| 132 | Ga0070662_100421230 | 3300005457 | Bacteria | 1104 |
| 133 | Ga0070662_100600444 | 3300005457 | Bacteria | 926 |
| 134 | Ga0070662_100674548 | 3300005457 | Bacteria | 873 |
| 135 | Ga0070681_10000783 | 3300005458 | Bacteria | 26471 |
| 136 | Ga0070681_10007295 | 3300005458 | Bacteria | 10789 |
| 137 | Ga0070681_10300181 | 3300005458 | Bacteria | 1516 |
| 138 | Ga0068867_100008531 | 3300005459 | Bacteria | 7232 |
| 139 | Ga0068867_100076766 | 3300005459 | Bacteria | 2509 |
| 140 | Ga0068867_100245571 | 3300005459 | Bacteria | 1453 |
| 141 | Ga0068867_100536534 | 3300005459 | Bacteria | 1011 |
| 142 | Ga0070706_100320451 | 3300005467 | Bacteria | 1446 |
| 143 | Ga0070706_100751673 | 3300005467 | Unclassified | 903 |
| 144 | Ga0070707_100019024 | 3300005468 | Bacteria | 6468 |
| 145 | Ga0070707_100164845 | 3300005468 | Bacteria | 2159 |
| 146 | Ga0070698_100139870 | 3300005471 | Bacteria | 2373 |
| 147 | Ga0070679_100018839 | 3300005530 | Bacteria | 6702 |
| 148 | Ga0070679_100025928 | 3300005530 | Bacteria | 5752 |
| 149 | Ga0070679_100032605 | 3300005530 | Bacteria | 5154 |
| 150 | Ga0070679_100092041 | 3300005530 | Bacteria | 3020 |
| 151 | Ga0070679_100325800 | 3300005530 | Bacteria | 1485 |
| 152 | Ga0070684_100114806 | 3300005535 | Bacteria | 2418 |
| 153 | Ga0070684_100369292 | 3300005535 | Bacteria | 1321 |
| 154 | Ga0070697_100770533 | 3300005536 | Bacteria | 850 |
| 155 | Ga0068853_100040680 | 3300005539 | Bacteria | 3967 |
| 156 | Ga0068853_100194116 | 3300005539 | Bacteria | 1846 |
| 157 | Ga0070672_100001541 | 3300005543 | Bacteria | 14277 |
| 158 | Ga0070672_100004184 | 3300005543 | Bacteria | 9421 |
| 159 | Ga0070672_100145423 | 3300005543 | Bacteria | 1959 |
| 160 | Ga0070672_100147063 | 3300005543 | Bacteria | 1947 |
| 161 | Ga0070672_100169969 | 3300005543 | Bacteria | 1812 |
| 162 | Ga0070695_100284342 | 3300005545 | Bacteria | 1217 |
| 163 | Ga0070696_100041269 | 3300005546 | Bacteria | 3187 |
| 164 | Ga0070696_100042642 | 3300005546 | Bacteria | 3136 |
| 165 | Ga0070696_100262758 | 3300005546 | Bacteria | 1309 |
| 166 | Ga0070693_100028140 | 3300005547 | Bacteria | 3053 |
| 167 | Ga0070693_100034987 | 3300005547 | Bacteria | 2783 |
| 168 | Ga0070693_100041250 | 3300005547 | Bacteria | 2596 |
| 169 | Ga0070693_100103473 | 3300005547 | Bacteria | 1739 |
| 170 | Ga0070665_100281339 | 3300005548 | Bacteria | 1665 |
| 171 | Ga0070665_100329602 | 3300005548 | Bacteria | 1531 |
| 172 | Ga0070665_100485656 | 3300005548 | Bacteria | 1246 |
| 173 | Ga0068855_100001106 | 3300005563 | Bacteria | 33532 |
| 174 | Ga0068855_100001914 | 3300005563 | Bacteria | 25824 |
| 175 | Ga0068855_100009030 | 3300005563 | Bacteria | 12044 |
| 176 | Ga0068855_100023969 | 3300005563 | Bacteria | 7305 |
| 177 | Ga0068855_100037340 | 3300005563 | Bacteria | 5777 |
| 178 | Ga0068855_100077574 | 3300005563 | Bacteria | 3855 |
| 179 | Ga0068855_100102097 | 3300005563 | Bacteria | 3301 |
| 180 | Ga0068855_100115844 | 3300005563 | Bacteria | 3072 |
| 181 | Ga0070664_100087765 | 3300005564 | Bacteria | 2689 |
| 182 | Ga0070664_100088849 | 3300005564 | Bacteria | 2672 |
| 183 | Ga0070664_100133380 | 3300005564 | Bacteria | 2182 |
| 184 | Ga0070664_100367941 | 3300005564 | Bacteria | 1310 |
| 185 | Ga0070664_100641723 | 3300005564 | Bacteria | 986 |
| 186 | Ga0068857_100008167 | 3300005577 | Bacteria | 9040 |
| 187 | Ga0068857_100029781 | 3300005577 | Bacteria | 4817 |
| 188 | Ga0068854_100004663 | 3300005578 | Bacteria | 8646 |
| 189 | Ga0068854_100051349 | 3300005578 | Bacteria | 2954 |
| 190 | Ga0068854_100101441 | 3300005578 | Bacteria | 2158 |
| 191 | Ga0068854_100607773 | 3300005578 | Bacteria | 934 |
| 192 | Ga0068856_100000358 | 3300005614 | Bacteria | 49942 |
| 193 | Ga0068856_100035813 | 3300005614 | Bacteria | 4865 |
| 194 | Ga0068856_100535450 | 3300005614 | Bacteria | 1192 |
| 195 | Ga0070702_100012406 | 3300005615 | Bacteria | 4269 |
| 196 | Ga0068852_100006670 | 3300005616 | Bacteria | 8368 |
| 197 | Ga0068852_100028467 | 3300005616 | Bacteria | 4574 |
| 198 | Ga0068852_100049573 | 3300005616 | Bacteria | 3593 |
| 199 | Ga0068852_100112038 | 3300005616 | Bacteria | 2482 |
| 200 | Ga0068852_100177640 | 3300005616 | Bacteria | 2000 |
| 201 | Ga0068852_100237302 | 3300005616 | Bacteria | 1741 |
| 202 | Ga0068852_100416453 | 3300005616 | Bacteria | 1324 |
| 203 | Ga0068852_101410120 | 3300005616 | Bacteria | 719 |
| 204 | Ga0068859_100062866 | 3300005617 | Bacteria | 3743 |
| 205 | Ga0068859_100113458 | 3300005617 | Bacteria | 2774 |
| 206 | Ga0068859_100251402 | 3300005617 | Bacteria | 1858 |
| 207 | Ga0068864_100097369 | 3300005618 | Bacteria | 2604 |
| 208 | Ga0068864_100105084 | 3300005618 | Bacteria | 2509 |
| 209 | Ga0068864_100289176 | 3300005618 | Bacteria | 1532 |
| 210 | Ga0068866_10002436 | 3300005718 | Bacteria | 7679 |
| 211 | Ga0068861_100000937 | 3300005719 | Bacteria | 17730 |
| 212 | Ga0068861_100003539 | 3300005719 | Bacteria | 10384 |
| 213 | Ga0068861_100278432 | 3300005719 | Bacteria | 1439 |
| 214 | Ga0068851_10000378 | 3300005834 | Bacteria | 20201 |
| 215 | Ga0068851_10052932 | 3300005834 | Bacteria | 2065 |
| 216 | Ga0068851_10156608 | 3300005834 | Bacteria | 1248 |
| 217 | Ga0068851_10227545 | 3300005834 | Bacteria | 1050 |
| 218 | Ga0068851_10481597 | 3300005834 | Bacteria | 742 |
| 219 | Ga0068870_10056253 | 3300005840 | Bacteria | 2099 |
| 220 | Ga0068870_10309805 | 3300005840 | Bacteria | 999 |
| 221 | Ga0068863_100045929 | 3300005841 | Unclassified | 4145 |
| 222 | Ga0068863_100046448 | 3300005841 | Bacteria | 4121 |
| 223 | Ga0068863_100143804 | 3300005841 | Bacteria | 2281 |
| 224 | Ga0068863_100207676 | 3300005841 | Unclassified | 1885 |
| 225 | Ga0068858_100017319 | 3300005842 | Bacteria | 6758 |
| 226 | Ga0068858_100122777 | 3300005842 | Bacteria | 2430 |
| 227 | Ga0068858_100382450 | 3300005842 | Bacteria | 1351 |
| 228 | Ga0068858_100801935 | 3300005842 | Bacteria | 919 |
| 229 | Ga0068858_100842821 | 3300005842 | Bacteria | 895 |
| 230 | Ga0068858_101038082 | 3300005842 | Bacteria | 804 |
| 231 | Ga0068860_100535877 | 3300005843 | Bacteria | 1172 |
| 232 | Ga0068862_100001747 | 3300005844 | Bacteria | 19665 |
| 233 | Ga0068862_100192383 | 3300005844 | Unclassified | 1836 |
| 234 | Ga0070717_10002565 | 3300006028 | Bacteria | 12812 |
| 235 | Ga0070717_10091962 | 3300006028 | Bacteria | 2562 |
| 236 | Ga0070717_10443923 | 3300006028 | Bacteria | 1169 |
| 237 | Ga0075363_100166517 | 3300006048 | Bacteria | 1250 |
| 238 | Ga0070715_10029588 | 3300006163 | Bacteria | 2207 |
| 239 | Ga0070715_10040953 | 3300006163 | Bacteria | 1939 |
| 240 | Ga0070716_100021576 | 3300006173 | Bacteria | 3396 |
| 241 | Ga0070712_100009447 | 3300006175 | Bacteria | 6146 |
| 242 | Ga0070712_100047193 | 3300006175 | Bacteria | 2980 |
| 243 | Ga0070712_101085029 | 3300006175 | Bacteria | 694 |
| 244 | Ga0075362_10150391 | 3300006177 | Bacteria | 1117 |
| 245 | Ga0075367_10170634 | 3300006178 | Bacteria | 1355 |
| 246 | Ga0075366_10002934 | 3300006195 | Bacteria | 8870 |
| 247 | Ga0075366_10003063 | 3300006195 | Bacteria | 8731 |
| 248 | Ga0075366_10023761 | 3300006195 | Bacteria | 3572 |
| 249 | Ga0097621_100055101 | 3300006237 | Bacteria | 3246 |
| 250 | Ga0097621_100114363 | 3300006237 | Bacteria | 2283 |
| 251 | Ga0075370_10023079 | 3300006353 | Bacteria | 3423 |
| 252 | Ga0075370_10169313 | 3300006353 | Bacteria | 1284 |
| 253 | Ga0075428_100046712 | 3300006844 | Bacteria | 4755 |
| 254 | Ga0075428_100058034 | 3300006844 | Bacteria | 4237 |
| 255 | Ga0075428_100149122 | 3300006844 | Bacteria | 2541 |
| 256 | Ga0075428_100470193 | 3300006844 | Bacteria | 1346 |
| 257 | Ga0075428_100616016 | 3300006844 | Bacteria | 1159 |
| 258 | Ga0075430_100017771 | 3300006846 | Bacteria | 6054 |
| 259 | Ga0075430_100071516 | 3300006846 | Bacteria | 2910 |
| 260 | Ga0075430_100246898 | 3300006846 | Bacteria | 1479 |
| 261 | Ga0075431_100015827 | 3300006847 | Bacteria | 7648 |
| 262 | Ga0075431_100124133 | 3300006847 | Bacteria | 2664 |
| 263 | Ga0075431_100287326 | 3300006847 | Bacteria | 1664 |
| 264 | Ga0075433_10000660 | 3300006852 | Bacteria | 23286 |
| 265 | Ga0075433_10477234 | 3300006852 | Unclassified | 1099 |
| 266 | Ga0075434_100035955 | 3300006871 | Bacteria | 4898 |
| 267 | Ga0075434_100168427 | 3300006871 | Bacteria | 2211 |
| 268 | Ga0075434_100330834 | 3300006871 | Bacteria | 1544 |
| 269 | Ga0075434_102049439 | 3300006871 | Bacteria | 577 |
| 270 | Ga0075429_100113558 | 3300006880 | Bacteria | 2367 |
| 271 | Ga0075429_100462451 | 3300006880 | Bacteria | 1112 |
| 272 | Ga0075429_100489975 | 3300006880 | Bacteria | 1077 |
| 273 | Ga0097620_100062866 | 3300006931 | Bacteria | 3743 |
| 274 | Ga0097620_100113459 | 3300006931 | Bacteria | 2774 |
| 275 | Ga0097620_100251397 | 3300006931 | Bacteria | 1858 |
| 276 | Ga0097620_100359737 | 3300006931 | Bacteria | 1550 |
| 277 | Ga0105240_10006075 | 3300009093 | Bacteria | 17835 |
| 278 | Ga0105240_10073212 | 3300009093 | Bacteria | 4231 |
| 279 | Ga0105240_10075503 | 3300009093 | Bacteria | 4157 |
| 280 | Ga0105240_10146627 | 3300009093 | Bacteria | 2816 |
| 281 | Ga0105240_10417478 | 3300009093 | Bacteria | 1508 |
| 282 | Ga0105240_10472508 | 3300009093 | Bacteria | 1399 |
| 283 | Ga0105240_10617013 | 3300009093 | Bacteria | 1192 |
| 284 | Ga0105240_10630782 | 3300009093 | Bacteria | 1177 |
| 285 | Ga0105240_10672106 | 3300009093 | Bacteria | 1133 |
| 286 | Ga0111539_10003586 | 3300009094 | Bacteria | 20464 |
| 287 | Ga0111539_10034865 | 3300009094 | Bacteria | 6097 |
| 288 | Ga0111539_10077063 | 3300009094 | Bacteria | 3925 |
| 289 | Ga0111539_10146337 | 3300009094 | Bacteria | 2766 |
| 290 | Ga0111539_10186417 | 3300009094 | Bacteria | 2423 |
| 291 | Ga0111539_10417031 | 3300009094 | Bacteria | 1564 |
| 292 | Ga0111539_10988936 | 3300009094 | Bacteria | 978 |
| 293 | Ga0114129_10112203 | 3300009147 | Bacteria | 3760 |
| 294 | Ga0114129_10331757 | 3300009147 | Bacteria | 2019 |
| 295 | Ga0114129_10752106 | 3300009147 | Bacteria | 1248 |
| 296 | Ga0105243_10105736 | 3300009148 | Bacteria | 2345 |
| 297 | Ga0105243_10161153 | 3300009148 | Bacteria | 1934 |
| 298 | Ga0105241_10001282 | 3300009174 | Bacteria | 19192 |
| 299 | Ga0105241_10001952 | 3300009174 | Bacteria | 15614 |
| 300 | Ga0105241_10369814 | 3300009174 | Bacteria | 1250 |
| 301 | Ga0105248_10033122 | 3300009177 | Bacteria | 5772 |
| 302 | Ga0105248_10147575 | 3300009177 | Bacteria | 2654 |
| 303 | Ga0105248_10181771 | 3300009177 | Bacteria | 2369 |
| 304 | Ga0105237_10000617 | 3300009545 | Bacteria | 49620 |
| 305 | Ga0105237_10148527 | 3300009545 | Bacteria | 2339 |
| 306 | Ga0105237_10364903 | 3300009545 | Bacteria | 1449 |
| 307 | Ga0105238_10074533 | 3300009551 | Bacteria | 3386 |
| 308 | Ga0105238_10157618 | 3300009551 | Bacteria | 2245 |
| 309 | Ga0105238_10229458 | 3300009551 | Bacteria | 1833 |
| 310 | Ga0105238_10284681 | 3300009551 | Bacteria | 1635 |
| 311 | Ga0105238_10902387 | 3300009551 | Bacteria | 902 |
| 312 | Ga0105249_10021772 | 3300009553 | Bacteria | 5740 |
| 313 | Ga0105249_10028460 | 3300009553 | Bacteria | 5043 |
| 314 | Ga0105249_10093625 | 3300009553 | Bacteria | 2815 |
| 315 | Ga0105249_10566454 | 3300009553 | Bacteria | 1188 |
| 316 | Ga0105239_10083569 | 3300010375 | Bacteria | 3516 |
| 317 | Ga0105239_10139483 | 3300010375 | Bacteria | 2701 |
| 318 | Ga0105239_10142388 | 3300010375 | Bacteria | 2673 |
| 319 | Ga0105239_10622601 | 3300010375 | Bacteria | 1232 |
| 320 | Ga0105239_10891089 | 3300010375 | Bacteria | 1021 |
| 321 | Ga0105246_10276588 | 3300011119 | Bacteria | 1345 |
| 322 | Ga0157373_10007032 | 3300013100 | Bacteria | 8385 |
| 323 | Ga0157373_10053787 | 3300013100 | Bacteria | 2862 |
| 324 | Ga0157373_10126475 | 3300013100 | Bacteria | 1797 |
| 325 | Ga0157371_10017865 | 3300013102 | Bacteria | 5258 |
| 326 | Ga0157371_10058914 | 3300013102 | Bacteria | 2724 |
| 327 | Ga0157371_10103641 | 3300013102 | Bacteria | 2019 |
| 328 | Ga0157371_10164798 | 3300013102 | Bacteria | 1583 |
| 329 | Ga0157371_10348986 | 3300013102 | Bacteria | 1077 |
| 330 | Ga0157371_10395725 | 3300013102 | Bacteria | 1010 |
| 331 | Ga0157371_10468350 | 3300013102 | Bacteria | 928 |
| 332 | Ga0157370_10010304 | 3300013104 | Bacteria | 9858 |
| 333 | Ga0157370_10013448 | 3300013104 | Bacteria | 8430 |
| 334 | Ga0157370_10013656 | 3300013104 | Bacteria | 8353 |
| 335 | Ga0157370_10064853 | 3300013104 | Bacteria | 3457 |
| 336 | Ga0157370_10259272 | 3300013104 | Bacteria | 1607 |
| 337 | Ga0157370_10319853 | 3300013104 | Bacteria | 1431 |
| 338 | Ga0157370_10810470 | 3300013104 | Bacteria | 852 |
| 339 | Ga0157369_10002364 | 3300013105 | Bacteria | 22678 |
| 340 | Ga0157369_10050020 | 3300013105 | Bacteria | 4529 |
| 341 | Ga0157369_10054611 | 3300013105 | Bacteria | 4314 |
| 342 | Ga0157369_10064245 | 3300013105 | Bacteria | 3953 |
| 343 | Ga0157369_10212055 | 3300013105 | Bacteria | 2029 |
| 344 | Ga0157374_10373237 | 3300013296 | Bacteria | 1420 |
| 345 | Ga0157378_10175359 | 3300013297 | Unclassified | 2013 |
| 346 | Ga0157378_10336517 | 3300013297 | Bacteria | 1471 |
| 347 | Ga0163162_10065105 | 3300013306 | Bacteria | 3691 |
| 348 | Ga0163162_10065334 | 3300013306 | Bacteria | 3685 |
| 349 | Ga0163162_10229049 | 3300013306 | Bacteria | 1988 |
| 350 | Ga0163162_10480627 | 3300013306 | Bacteria | 1374 |
| 351 | Ga0163162_10828082 | 3300013306 | Bacteria | 1042 |
| 352 | Ga0157372_10001158 | 3300013307 | Bacteria | 28514 |
| 353 | Ga0157372_10005566 | 3300013307 | Bacteria | 13391 |
| 354 | Ga0157372_10068555 | 3300013307 | Bacteria | 3988 |
| 355 | Ga0157372_10128029 | 3300013307 | Bacteria | 2920 |
| 356 | Ga0157372_10458710 | 3300013307 | Bacteria | 1485 |
| 357 | Ga0157372_10461610 | 3300013307 | Bacteria | 1480 |
| 358 | Ga0157372_10504211 | 3300013307 | Bacteria | 1411 |
| 359 | Ga0157372_10604494 | 3300013307 | Bacteria | 1278 |
| 360 | Ga0157375_10101538 | 3300013308 | Bacteria | 2960 |
| 361 | Ga0157375_10255206 | 3300013308 | Bacteria | 1915 |
| 362 | Ga0157375_10477199 | 3300013308 | Bacteria | 1412 |
| 363 | Ga0157375_10497656 | 3300013308 | Bacteria | 1383 |
| 364 | Ga0157375_10864749 | 3300013308 | Bacteria | 1050 |
| 365 | Ga0163163_10037499 | 3300014325 | Bacteria | 4716 |
| 366 | Ga0163163_10066333 | 3300014325 | Unclassified | 3585 |
| 367 | Ga0163163_10613449 | 3300014325 | Bacteria | 1151 |
| 368 | Ga0163163_10887877 | 3300014325 | Bacteria | 955 |
| 369 | Ga0157380_10020312 | 3300014326 | Unclassified | 4963 |
| 370 | Ga0157380_10039857 | 3300014326 | Bacteria | 3655 |
| 371 | Ga0157380_10055104 | 3300014326 | Bacteria | 3156 |
| 372 | Ga0157380_10156645 | 3300014326 | Bacteria | 1975 |
| 373 | Ga0157380_10365549 | 3300014326 | Bacteria | 1356 |
| 374 | Ga0157377_10007070 | 3300014745 | Bacteria | 5393 |
| 375 | Ga0157379_10050580 | 3300014968 | Bacteria | 3711 |
| 376 | Ga0157379_10066341 | 3300014968 | Bacteria | 3226 |
| 377 | Ga0157379_10274099 | 3300014968 | Bacteria | 1534 |
| 378 | Ga0157379_10324235 | 3300014968 | Bacteria | 1407 |
| 379 | Ga0157376_10282791 | 3300014969 | Bacteria | 1563 |
| 380 | Ga0157376_10696891 | 3300014969 | Bacteria | 1020 |
| 381 | Ga0182007_10006749 | 3300015262 | Bacteria | 4897 |
| 382 | Ga0163161_10007946 | 3300017792 | Bacteria | 7344 |
| 383 | Ga0163161_10066438 | 3300017792 | Unclassified | 2633 |
| 384 | Ga0163161_10429285 | 3300017792 | Bacteria | 1065 |
| 385 | Ga0197907_11182327 | 3300020069 | Bacteria | 2105 |
| 386 | Ga0206356_10348143 | 3300020070 | Bacteria | 1776 |
| 387 | Ga0206356_11465550 | 3300020070 | Bacteria | 3128 |
| 388 | Ga0206356_11906906 | 3300020070 | Bacteria | 3680 |
| 389 | Ga0206351_10854524 | 3300020077 | Bacteria | 1045 |
| 390 | Ga0206353_11042515 | 3300020082 | Bacteria | 2013 |
| 391 | Ga0206353_11365073 | 3300020082 | Bacteria | 1382 |
| 392 | Ga0213872_10000001 | 3300021361 | Bacteria | 662532 |
| 393 | Ga0213872_10000777 | 3300021361 | Bacteria | 23405 |
| 394 | Ga0213872_10006712 | 3300021361 | Bacteria | 5736 |
| 395 | Ga0213876_10004985 | 3300021384 | Bacteria | 7336 |
| 396 | Ga0224712_10121277 | 3300022467 | Bacteria | 1132 |
| 397 | Ga0224712_10228544 | 3300022467 | Bacteria | 854 |
| 398 | Ga0224712_10327486 | 3300022467 | Bacteria | 721 |
| 399 | Ga0224572_1003827 | 3300024225 | Bacteria | 2569 |
| 400 | Ga0209784_100062 | 3300025224 | Bacteria | 162240 |
| 401 | Ga0209566_100023 | 3300025225 | Bacteria | 396571 |
| 402 | Ga0209674_100040 | 3300025226 | Bacteria | 396571 |
| 403 | Ga0209563_100096 | 3300025230 | Bacteria | 162240 |
| 404 | Ga0207427_101222 | 3300025231 | Bacteria | 9942 |
| 405 | Ga0209437_100146 | 3300025233 | Bacteria | 162240 |
| 406 | Ga0209437_112590 | 3300025233 | Bacteria | 1230 |
| 407 | Ga0209646_1000051 | 3300025246 | Bacteria | 296525 |
| 408 | Ga0209646_1001818 | 3300025246 | Bacteria | 5291 |
| 409 | Ga0209026_1001309 | 3300025250 | Bacteria | 11243 |
| 410 | Ga0209677_100058 | 3300025253 | Bacteria | 162240 |
| 411 | Ga0209759_1004825 | 3300025256 | Bacteria | 4906 |
| 412 | Ga0209233_1000159 | 3300025261 | Bacteria | 162240 |
| 413 | Ga0209455_1000343 | 3300025272 | Bacteria | 44216 |
| 414 | Ga0209564_1000089 | 3300025295 | Bacteria | 249694 |
| 415 | Ga0209758_1000500 | 3300025297 | Bacteria | 63618 |
| 416 | Ga0209050_1000223 | 3300025298 | Bacteria | 125465 |
| 417 | Ga0209051_1010940 | 3300025303 | Bacteria | 4528 |
| 418 | Ga0207697_10002525 | 3300025315 | Bacteria | 9433 |
| 419 | Ga0207697_10137508 | 3300025315 | Bacteria | 1058 |
| 420 | Ga0207656_10005197 | 3300025321 | Bacteria | 4578 |
| 421 | Ga0207656_10077458 | 3300025321 | Bacteria | 1488 |
| 422 | Ga0207656_10160601 | 3300025321 | Bacteria | 1069 |
| 423 | Ga0207682_10002139 | 3300025893 | Bacteria | 8951 |
| 424 | Ga0207682_10005898 | 3300025893 | Bacteria | 4962 |
| 425 | Ga0207692_10002596 | 3300025898 | Bacteria | 6946 |
| 426 | Ga0207692_10197284 | 3300025898 | Bacteria | 1181 |
| 427 | Ga0207688_10045489 | 3300025901 | Bacteria | 2449 |
| 428 | Ga0207680_10040469 | 3300025903 | Bacteria | 2712 |
| 429 | Ga0207680_10419551 | 3300025903 | Bacteria | 947 |
| 430 | Ga0207647_10002926 | 3300025904 | Bacteria | 12858 |
| 431 | Ga0207647_10119943 | 3300025904 | Bacteria | 1551 |
| 432 | Ga0207699_10059345 | 3300025906 | Bacteria | 2292 |
| 433 | Ga0207699_10082389 | 3300025906 | Bacteria | 1998 |
| 434 | Ga0207699_10116351 | 3300025906 | Bacteria | 1722 |
| 435 | Ga0207645_10002061 | 3300025907 | Bacteria | 16095 |
| 436 | Ga0207645_10004476 | 3300025907 | Bacteria | 10339 |
| 437 | Ga0207645_10028372 | 3300025907 | Bacteria | 3613 |
| 438 | Ga0207645_10095629 | 3300025907 | Bacteria | 1913 |
| 439 | Ga0207645_10138855 | 3300025907 | Bacteria | 1583 |
| 440 | Ga0207643_10002190 | 3300025908 | Bacteria | 10658 |
| 441 | Ga0207705_10000165 | 3300025909 | Bacteria | 71603 |
| 442 | Ga0207705_10000938 | 3300025909 | Bacteria | 23813 |
| 443 | Ga0207705_10011933 | 3300025909 | Bacteria | 6277 |
| 444 | Ga0207705_10022299 | 3300025909 | Bacteria | 4516 |
| 445 | Ga0207705_10055187 | 3300025909 | Bacteria | 2864 |
| 446 | Ga0207705_10110152 | 3300025909 | Bacteria | 2034 |
| 447 | Ga0207705_10246901 | 3300025909 | Bacteria | 1361 |
| 448 | Ga0207705_10490150 | 3300025909 | Bacteria | 954 |
| 449 | Ga0207684_10145736 | 3300025910 | Bacteria | 2036 |
| 450 | Ga0207707_10000630 | 3300025912 | Bacteria | 34922 |
| 451 | Ga0207707_10000859 | 3300025912 | Bacteria | 29680 |
| 452 | Ga0207707_10001033 | 3300025912 | Bacteria | 26719 |
| 453 | Ga0207707_10007482 | 3300025912 | Bacteria | 9516 |
| 454 | Ga0207707_10179180 | 3300025912 | Bacteria | 1850 |
| 455 | Ga0207707_10202004 | 3300025912 | Bacteria | 1733 |
| 456 | Ga0207695_10000975 | 3300025913 | Bacteria | 50860 |
| 457 | Ga0207695_10004622 | 3300025913 | Bacteria | 18671 |
| 458 | Ga0207695_10007233 | 3300025913 | Bacteria | 14181 |
| 459 | Ga0207695_10013008 | 3300025913 | Bacteria | 9942 |
| 460 | Ga0207695_10038122 | 3300025913 | Bacteria | 5179 |
| 461 | Ga0207695_10050428 | 3300025913 | Bacteria | 4379 |
| 462 | Ga0207695_10083362 | 3300025913 | Bacteria | 3230 |
| 463 | Ga0207695_10129478 | 3300025913 | Bacteria | 2482 |
| 464 | Ga0207695_10161595 | 3300025913 | Bacteria | 2171 |
| 465 | Ga0207695_10766159 | 3300025913 | Bacteria | 845 |
| 466 | Ga0207671_10000462 | 3300025914 | Bacteria | 55713 |
| 467 | Ga0207671_10158428 | 3300025914 | Bacteria | 1752 |
| 468 | Ga0207693_10006002 | 3300025915 | Bacteria | 10069 |
| 469 | Ga0207693_10058723 | 3300025915 | Bacteria | 3013 |
| 470 | Ga0207693_10141885 | 3300025915 | Bacteria | 1889 |
| 471 | Ga0207663_10119036 | 3300025916 | Unclassified | 1805 |
| 472 | Ga0207663_10165329 | 3300025916 | Bacteria | 1566 |
| 473 | Ga0207660_10088060 | 3300025917 | Bacteria | 2295 |
| 474 | Ga0207660_10099067 | 3300025917 | Bacteria | 2174 |
| 475 | Ga0207662_10005665 | 3300025918 | Bacteria | 6679 |
| 476 | Ga0207657_10000888 | 3300025919 | Bacteria | 31632 |
| 477 | Ga0207657_10007345 | 3300025919 | Bacteria | 11302 |
| 478 | Ga0207657_10078188 | 3300025919 | Unclassified | 2786 |
| 479 | Ga0207657_10286519 | 3300025919 | Unclassified | 1307 |
| 480 | Ga0207649_10017932 | 3300025920 | Bacteria | 4015 |
| 481 | Ga0207649_10041213 | 3300025920 | Bacteria | 2810 |
| 482 | Ga0207649_10173196 | 3300025920 | Bacteria | 1505 |
| 483 | Ga0207649_10176530 | 3300025920 | Bacteria | 1492 |
| 484 | Ga0207649_10181294 | 3300025920 | Bacteria | 1474 |
| 485 | Ga0207652_10000940 | 3300025921 | Bacteria | 27407 |
| 486 | Ga0207652_10001326 | 3300025921 | Bacteria | 21962 |
| 487 | Ga0207652_10036631 | 3300025921 | Bacteria | 4147 |
| 488 | Ga0207652_10050560 | 3300025921 | Bacteria | 3562 |
| 489 | Ga0207652_10116236 | 3300025921 | Bacteria | 2376 |
| 490 | Ga0207652_10199587 | 3300025921 | Bacteria | 1800 |
| 491 | Ga0207652_10253528 | 3300025921 | Bacteria | 1587 |
| 492 | Ga0207646_10045109 | 3300025922 | Bacteria | 3957 |
| 493 | Ga0207646_10082023 | 3300025922 | Bacteria | 2883 |
| 494 | Ga0207681_10004746 | 3300025923 | Bacteria | 8364 |
| 495 | Ga0207681_10139017 | 3300025923 | Bacteria | 1806 |
| 496 | Ga0207681_10940607 | 3300025923 | Bacteria | 724 |
| 497 | Ga0207694_10020636 | 3300025924 | Bacteria | 4987 |
| 498 | Ga0207650_10000254 | 3300025925 | Bacteria | 58014 |
| 499 | Ga0207650_10000662 | 3300025925 | Bacteria | 27141 |
| 500 | Ga0207650_10003114 | 3300025925 | Bacteria | 11426 |
| 501 | Ga0207650_10004774 | 3300025925 | Bacteria | 9259 |
| 502 | Ga0207650_10069235 | 3300025925 | Bacteria | 2651 |
| 503 | Ga0207650_10170634 | 3300025925 | Bacteria | 1729 |
| 504 | Ga0207659_10009497 | 3300025926 | Bacteria | 6082 |
| 505 | Ga0207659_10024144 | 3300025926 | Bacteria | 4069 |
| 506 | Ga0207659_10043661 | 3300025926 | Bacteria | 3150 |
| 507 | Ga0207700_10019285 | 3300025928 | Bacteria | 4604 |
| 508 | Ga0207700_10019723 | 3300025928 | Bacteria | 4560 |
| 509 | Ga0207700_10081952 | 3300025928 | Bacteria | 2521 |
| 510 | Ga0207700_10368123 | 3300025928 | Bacteria | 1254 |
| 511 | Ga0207664_10001253 | 3300025929 | Bacteria | 16753 |
| 512 | Ga0207664_10001691 | 3300025929 | Bacteria | 14529 |
| 513 | Ga0207664_10018049 | 3300025929 | Bacteria | 5184 |
| 514 | Ga0207664_10036084 | 3300025929 | Bacteria | 3819 |
| 515 | Ga0207664_10067184 | 3300025929 | Bacteria | 2876 |
| 516 | Ga0207664_10877244 | 3300025929 | Bacteria | 806 |
| 517 | Ga0207644_10019320 | 3300025931 | Bacteria | 4621 |
| 518 | Ga0207644_10033475 | 3300025931 | Bacteria | 3591 |
| 519 | Ga0207644_10155402 | 3300025931 | Bacteria | 1773 |
| 520 | Ga0207644_10466333 | 3300025931 | Bacteria | 1039 |
| 521 | Ga0207644_10535945 | 3300025931 | Bacteria | 968 |
| 522 | Ga0207644_10741143 | 3300025931 | Bacteria | 820 |
| 523 | Ga0207690_10155462 | 3300025932 | Bacteria | 1699 |
| 524 | Ga0207690_10178641 | 3300025932 | Bacteria | 1596 |
| 525 | Ga0207690_10498716 | 3300025932 | Bacteria | 984 |
| 526 | Ga0207690_10546427 | 3300025932 | Bacteria | 941 |
| 527 | Ga0207706_10004399 | 3300025933 | Bacteria | 13237 |
| 528 | Ga0207706_10008972 | 3300025933 | Bacteria | 9203 |
| 529 | Ga0207706_10074604 | 3300025933 | Bacteria | 2982 |
| 530 | Ga0207706_10353383 | 3300025933 | Bacteria | 1278 |
| 531 | Ga0207706_10679297 | 3300025933 | Bacteria | 881 |
| 532 | Ga0207686_10348218 | 3300025934 | Bacteria | 1115 |
| 533 | Ga0207669_10072369 | 3300025937 | Bacteria | 2170 |
| 534 | Ga0207669_10103904 | 3300025937 | Bacteria | 1885 |
| 535 | Ga0207704_10006922 | 3300025938 | Bacteria | 5320 |
| 536 | Ga0207665_10000042 | 3300025939 | Bacteria | 82783 |
| 537 | Ga0207691_10003393 | 3300025940 | Bacteria | 15491 |
| 538 | Ga0207691_10026592 | 3300025940 | Bacteria | 5429 |
| 539 | Ga0207691_10133230 | 3300025940 | Unclassified | 2194 |
| 540 | Ga0207691_10159073 | 3300025940 | Bacteria | 1983 |
| 541 | Ga0207711_10093544 | 3300025941 | Bacteria | 2648 |
| 542 | Ga0207711_10119835 | 3300025941 | Bacteria | 2348 |
| 543 | Ga0207711_10427272 | 3300025941 | Bacteria | 1232 |
| 544 | Ga0207689_10006317 | 3300025942 | Bacteria | 10497 |
| 545 | Ga0207689_10008002 | 3300025942 | Bacteria | 9230 |
| 546 | Ga0207661_10135971 | 3300025944 | Bacteria | 2111 |
| 547 | Ga0207661_10179836 | 3300025944 | Bacteria | 1847 |
| 548 | Ga0207679_10027846 | 3300025945 | Bacteria | 3914 |
| 549 | Ga0207679_10193649 | 3300025945 | Bacteria | 1692 |
| 550 | Ga0207667_10000345 | 3300025949 | Bacteria | 63385 |
| 551 | Ga0207667_10001085 | 3300025949 | Bacteria | 34518 |
| 552 | Ga0207667_10001211 | 3300025949 | Bacteria | 32264 |
| 553 | Ga0207667_10026140 | 3300025949 | Bacteria | 6382 |
| 554 | Ga0207667_10039969 | 3300025949 | Bacteria | 4994 |
| 555 | Ga0207667_10040481 | 3300025949 | Bacteria | 4962 |
| 556 | Ga0207667_10116328 | 3300025949 | Bacteria | 2755 |
| 557 | Ga0207667_10176813 | 3300025949 | Bacteria | 2192 |
| 558 | Ga0207667_10236858 | 3300025949 | Bacteria | 1868 |
| 559 | Ga0207667_10372985 | 3300025949 | Bacteria | 1454 |
| 560 | Ga0207667_10595232 | 3300025949 | Bacteria | 1115 |
| 561 | Ga0207651_10004824 | 3300025960 | Bacteria | 6866 |
| 562 | Ga0207651_10150150 | 3300025960 | Bacteria | 1812 |
| 563 | Ga0207651_10266063 | 3300025960 | Bacteria | 1410 |
| 564 | Ga0207712_10032292 | 3300025961 | Bacteria | 3533 |
| 565 | Ga0207712_10033427 | 3300025961 | Bacteria | 3477 |
| 566 | Ga0207712_10062190 | 3300025961 | Unclassified | 2652 |
| 567 | Ga0207668_10010113 | 3300025972 | Bacteria | 5686 |
| 568 | Ga0207668_10460130 | 3300025972 | Bacteria | 1087 |
| 569 | Ga0207640_10006790 | 3300025981 | Bacteria | 6295 |
| 570 | Ga0207640_10010335 | 3300025981 | Bacteria | 5255 |
| 571 | Ga0207640_10067856 | 3300025981 | Bacteria | 2388 |
| 572 | Ga0207640_10083057 | 3300025981 | Bacteria | 2195 |
| 573 | Ga0207640_10394199 | 3300025981 | Bacteria | 1125 |
| 574 | Ga0207640_11067373 | 3300025981 | Bacteria | 713 |
| 575 | Ga0207658_10008384 | 3300025986 | Bacteria | 7035 |
| 576 | Ga0207658_10068140 | 3300025986 | Unclassified | 2684 |
| 577 | Ga0207658_10154746 | 3300025986 | Bacteria | 1872 |
| 578 | Ga0207658_10561662 | 3300025986 | Bacteria | 1022 |
| 579 | Ga0207677_10148177 | 3300026023 | Bacteria | 1806 |
| 580 | Ga0207703_10182255 | 3300026035 | Bacteria | 1854 |
| 581 | Ga0207639_10000966 | 3300026041 | Bacteria | 19515 |
| 582 | Ga0207639_10326840 | 3300026041 | Bacteria | 1363 |
| 583 | Ga0207639_10415514 | 3300026041 | Bacteria | 1215 |
| 584 | Ga0207639_10463645 | 3300026041 | Bacteria | 1152 |
| 585 | Ga0207678_10000433 | 3300026067 | Bacteria | 37961 |
| 586 | Ga0207678_10002093 | 3300026067 | Bacteria | 18073 |
| 587 | Ga0207678_10003959 | 3300026067 | Bacteria | 13325 |
| 588 | Ga0207678_10006255 | 3300026067 | Bacteria | 10576 |
| 589 | Ga0207678_10272292 | 3300026067 | Bacteria | 1452 |
| 590 | Ga0207702_10001044 | 3300026078 | Bacteria | 28368 |
| 591 | Ga0207702_10001779 | 3300026078 | Bacteria | 21216 |
| 592 | Ga0207702_10046358 | 3300026078 | Bacteria | 3659 |
| 593 | Ga0207702_10225834 | 3300026078 | Bacteria | 1747 |
| 594 | Ga0207641_10052499 | 3300026088 | Bacteria | 3453 |
| 595 | Ga0207641_10103588 | 3300026088 | Bacteria | 2511 |
| 596 | Ga0207641_10143226 | 3300026088 | Bacteria | 2159 |
| 597 | Ga0207641_10147600 | 3300026088 | Bacteria | 2128 |
| 598 | Ga0207641_11006092 | 3300026088 | Bacteria | 830 |
| 599 | Ga0207648_10004786 | 3300026089 | Bacteria | 13819 |
| 600 | Ga0207648_10007984 | 3300026089 | Bacteria | 10323 |
| 601 | Ga0207648_10008110 | 3300026089 | Bacteria | 10225 |
| 602 | Ga0207648_10010341 | 3300026089 | Bacteria | 8849 |
| 603 | Ga0207648_10302952 | 3300026089 | Bacteria | 1433 |
| 604 | Ga0207648_10890250 | 3300026089 | Bacteria | 831 |
| 605 | Ga0207676_10010629 | 3300026095 | Bacteria | 6562 |
| 606 | Ga0207676_10064557 | 3300026095 | Bacteria | 2912 |
| 607 | Ga0207674_10000273 | 3300026116 | Bacteria | 65119 |
| 608 | Ga0207674_10004485 | 3300026116 | Bacteria | 16783 |
| 609 | Ga0207674_10008990 | 3300026116 | Bacteria | 11479 |
| 610 | Ga0207674_10020139 | 3300026116 | Bacteria | 7215 |
| 611 | Ga0207674_10036289 | 3300026116 | Bacteria | 5138 |
| 612 | Ga0207674_10047647 | 3300026116 | Bacteria | 4392 |
| 613 | Ga0207674_10468862 | 3300026116 | Bacteria | 1217 |
| 614 | Ga0207674_10599366 | 3300026116 | Bacteria | 1064 |
| 615 | Ga0207675_100001089 | 3300026118 | Bacteria | 26890 |
| 616 | Ga0207675_100004426 | 3300026118 | Bacteria | 13578 |
| 617 | Ga0207675_100005279 | 3300026118 | Bacteria | 12426 |
| 618 | Ga0207675_100006779 | 3300026118 | Bacteria | 10834 |
| 619 | Ga0207675_100181510 | 3300026118 | Bacteria | 2015 |
| 620 | Ga0207683_10004164 | 3300026121 | Bacteria | 12522 |
| 621 | Ga0207683_10023322 | 3300026121 | Bacteria | 5322 |
| 622 | Ga0207683_10093231 | 3300026121 | Bacteria | 2683 |
| 623 | Ga0207683_10163637 | 3300026121 | Bacteria | 2013 |
| 624 | Ga0207683_10182007 | 3300026121 | Bacteria | 1906 |
| 625 | Ga0207683_10336236 | 3300026121 | Bacteria | 1384 |
| 626 | Ga0207683_10518320 | 3300026121 | Bacteria | 1102 |
| 627 | Ga0207683_10792173 | 3300026121 | Bacteria | 880 |
| 628 | Ga0207698_10007069 | 3300026142 | Bacteria | 7029 |
| 629 | Ga0207698_10008997 | 3300026142 | Bacteria | 6340 |
| 630 | Ga0207698_10010525 | 3300026142 | Bacteria | 5952 |
| 631 | Ga0207698_10042887 | 3300026142 | Bacteria | 3385 |
| 632 | Ga0207698_10049534 | 3300026142 | Bacteria | 3198 |
| 633 | Ga0207698_10115869 | 3300026142 | Bacteria | 2257 |
| 634 | Ga0207698_10198933 | 3300026142 | Bacteria | 1793 |
| 635 | Ga0207698_10307357 | 3300026142 | Bacteria | 1479 |
| 636 | Ga0209983_1056901 | 3300027665 | Bacteria | 860 |
| 637 | Ga0207428_10013564 | 3300027907 | Bacteria | 7112 |
| 638 | Ga0207428_10068093 | 3300027907 | Bacteria | 2801 |
| 639 | Ga0207428_10070074 | 3300027907 | Bacteria | 2757 |
| 640 | Ga0268266_10030768 | 3300028379 | Bacteria | 4559 |
| 641 | Ga0268266_10266789 | 3300028379 | Unclassified | 1588 |
| 642 | Ga0268266_10362180 | 3300028379 | Bacteria | 1365 |
| 643 | Ga0268265_10000805 | 3300028380 | Bacteria | 29824 |
| 644 | Ga0268265_10005872 | 3300028380 | Bacteria | 8368 |
| 645 | Ga0268265_10462446 | 3300028380 | Bacteria | 1187 |
| 646 | Ga0268264_10005552 | 3300028381 | Bacteria | 10689 |
| 647 | Ga0268264_10247534 | 3300028381 | Bacteria | 1654 |
| 648 | Ga0268264_10278562 | 3300028381 | Bacteria | 1565 |
| 649 | Ga0268264_10417134 | 3300028381 | Bacteria | 1294 |
| 650 | Ga0265334_10019089 | 3300028573 | Bacteria | 2823 |
| 651 | Ga0265318_10121158 | 3300028577 | Bacteria | 962 |
| 652 | Ga0307517_10146576 | 3300028786 | Bacteria | 1636 |
| 653 | Ga0307515_10002080 | 3300028794 | Bacteria | 44046 |
| 654 | Ga0307515_10008408 | 3300028794 | Bacteria | 20124 |
| 655 | Ga0265324_10007296 | 3300029957 | Bacteria | 4502 |
| 656 | Ga0265760_10041754 | 3300031090 | Bacteria | 1368 |
| 657 | Ga0265339_10036673 | 3300031249 | Bacteria | 2743 |
| 658 | Ga0265327_10137220 | 3300031251 | Bacteria | 1146 |
| 659 | Ga0265316_10109747 | 3300031344 | Bacteria | 2090 |
| 660 | Ga0265316_10171292 | 3300031344 | Bacteria | 1619 |
| 661 | Ga0307513_10001806 | 3300031456 | Bacteria | 30395 |
| 662 | Ga0307513_10031824 | 3300031456 | Bacteria | 5964 |
| 663 | Ga0307408_100014143 | 3300031548 | Bacteria | 5302 |
| 664 | Ga0307408_100130969 | 3300031548 | Bacteria | 1956 |
| 665 | Ga0307408_100271297 | 3300031548 | Bacteria | 1409 |
| 666 | Ga0307408_100299796 | 3300031548 | Bacteria | 1346 |
| 667 | Ga0307408_100350618 | 3300031548 | Bacteria | 1252 |
| 668 | Ga0265313_10021899 | 3300031595 | Bacteria | 3483 |
| 669 | Ga0316576_10002152 | 3300031727 | Bacteria | 11102 |
| 670 | Ga0316578_10164209 | 3300031728 | Bacteria | 1338 |
| 671 | Ga0307516_10000797 | 3300031730 | Bacteria | 43106 |
| 672 | Ga0307516_10001904 | 3300031730 | Bacteria | 28571 |
| 673 | Ga0307516_10049734 | 3300031730 | Bacteria | 4117 |
| 674 | Ga0307516_10187809 | 3300031730 | Bacteria | 1795 |
| 675 | Ga0307516_10214012 | 3300031730 | Bacteria | 1640 |
| 676 | Ga0307405_10122852 | 3300031731 | Bacteria | 1779 |
| 677 | Ga0307405_10329872 | 3300031731 | Bacteria | 1169 |
| 678 | Ga0307405_10332458 | 3300031731 | Bacteria | 1165 |
| 679 | Ga0307413_10118860 | 3300031824 | Bacteria | 1785 |
| 680 | Ga0307413_10333669 | 3300031824 | Bacteria | 1163 |
| 681 | Ga0307413_10871774 | 3300031824 | Bacteria | 762 |
| 682 | Ga0307410_10143841 | 3300031852 | Bacteria | 1767 |
| 683 | Ga0307406_10119220 | 3300031901 | Bacteria | 1831 |
| 684 | Ga0307406_10245082 | 3300031901 | Bacteria | 1347 |
| 685 | Ga0307406_10332930 | 3300031901 | Bacteria | 1179 |
| 686 | Ga0307406_10338607 | 3300031901 | Bacteria | 1171 |
| 687 | Ga0307412_10133198 | 3300031911 | Bacteria | 1809 |
| 688 | Ga0307412_10231002 | 3300031911 | Bacteria | 1424 |
| 689 | Ga0307412_10693182 | 3300031911 | Bacteria | 873 |
| 690 | Ga0307409_100081424 | 3300031995 | Bacteria | 2617 |
| 691 | Ga0307409_100241466 | 3300031995 | Bacteria | 1645 |
| 692 | Ga0307409_100852293 | 3300031995 | Bacteria | 922 |
| 693 | Ga0307409_100867189 | 3300031995 | Bacteria | 914 |
| 694 | Ga0307416_100019971 | 3300032002 | Bacteria | 4766 |
| 695 | Ga0307416_100059552 | 3300032002 | Bacteria | 3104 |
| 696 | Ga0307416_100398454 | 3300032002 | Bacteria | 1413 |
| 697 | Ga0307416_100491110 | 3300032002 | Bacteria | 1290 |
| 698 | Ga0307416_100678130 | 3300032002 | Bacteria | 1118 |
| 699 | Ga0307416_100679045 | 3300032002 | Bacteria | 1117 |
| 700 | Ga0307416_100816053 | 3300032002 | Bacteria | 1029 |
| 701 | Ga0307416_101167886 | 3300032002 | Bacteria | 875 |
| 702 | Ga0307414_10480838 | 3300032004 | Bacteria | 1095 |
| 703 | Ga0307411_10043040 | 3300032005 | Bacteria | 2886 |
| 704 | Ga0307411_10117914 | 3300032005 | Bacteria | 1914 |
| 705 | Ga0307411_10137033 | 3300032005 | Bacteria | 1799 |
| 706 | Ga0307411_10139804 | 3300032005 | Bacteria | 1784 |
| 707 | Ga0307411_10328699 | 3300032005 | Bacteria | 1238 |
| 708 | Ga0307411_10344638 | 3300032005 | Bacteria | 1212 |
| 709 | Ga0307411_10549234 | 3300032005 | Bacteria | 985 |
| 710 | Ga0307411_10838209 | 3300032005 | Bacteria | 812 |
| 711 | Ga0307415_100006199 | 3300032126 | Bacteria | 6424 |
| 712 | Ga0307415_100171287 | 3300032126 | Bacteria | 1693 |
| 713 | Ga0373959_0009269 | 3300034820 | Bacteria | 1694 |
| 714 | Ga0373928_0009176 | 3300035084 | Bacteria | 1930 |
| 715 | Ga0373934_0012855 | 3300035086 | Bacteria | 3163 |
| 716 | Ga0373949_0009262 | 3300035090 | Bacteria | 2158 |
| 717 | Ga0373954_0025981 | 3300035118 | Bacteria | 2681 |
| 718 | Ga0373955_0017445 | 3300035172 | Bacteria | 3554 |
| 719 | Ga0373955_0036342 | 3300035172 | Bacteria | 2613 |
| 720 | Ga0373955_0453097 | 3300035172 | Unclassified | 782 |
| 721 | Ga0316574_0246926 | 3300035398 | Bacteria | 1141 |
| 722 | Ga0316574_0256571 | 3300035398 | Bacteria | 1117 |
| 723 | Ga0373931_0001412 | 3300035691 | Bacteria | 10287 |
| 724 | Ga0373931_0086753 | 3300035691 | Bacteria | 1737 |
| 725 | Ga0373935_0182821 | 3300035692 | Bacteria | 1440 |
| 726 | Ga0373927_0059099 | 3300035695 | Bacteria | 2480 |
| 727 | Ga0373947_0536650 | 3300035725 | Bacteria | 796 |
| 728 | Ga0373937_0050565 | 3300036401 | Bacteria | 3807 |
| 729 | Ga0373937_0143427 | 3300036401 | Bacteria | 2235 |
| 730 | Ga0372808_006155 | 3300036459 | Bacteria | 1609 |
| 731 | Ga0316582_0065628 | 3300036647 | Bacteria | 2337 |
| 732 | Ga0316584_0119065 | 3300036712 | Bacteria | 1974 |
| 733 | Ga0316584_0322216 | 3300036712 | Bacteria | 1115 |
| 734 | Ga0373925_0535672 | 3300037068 | Bacteria | 962 |
| 735 | Ga0373925_0554038 | 3300037068 | Bacteria | 946 |
| 736 | Ga0395900_0034230 | 3300037418 | Bacteria | 5230 |
| 737 | Ga0395898_0508422 | 3300037466 | Bacteria | 1146 |
| 738 | Ga0395905_0013842 | 3300037471 | Bacteria | 7717 |
| 739 | Ga0395905_0254786 | 3300037471 | Bacteria | 1639 |
| 740 | Ga0395905_0547817 | 3300037471 | Bacteria | 1058 |
| 741 | Ga0436364_1162620 | 3300037853 | Bacteria | 950 |
| 742 | Ga0395901_0162594 | 3300038443 | Bacteria | 2344 |
| 743 | Ga0400490_01085 | 3300038726 | Bacteria | 8367 |
| 744 | Ga0400485_08748 | 3300038735 | Bacteria | 1068 |
| 745 | Ga0400488_37204 | 3300038741 | Bacteria | 9069 |
| 746 | Ga0400486_10215 | 3300038742 | Bacteria | 1642 |
| 747 | Ga0400486_17669 | 3300038742 | Bacteria | 2618 |
| 748 | Ga0400483_123864 | 3300039062 | Bacteria | 2285 |
| 749 | Ga0400483_139687 | 3300039062 | Bacteria | 4849 |
| 750 | Ga0400483_163400 | 3300039062 | Bacteria | 5787 |
| 751 | Ga0400483_215046 | 3300039062 | Bacteria | 1508 |
| 752 | Ga0400489_63320 | 3300039093 | Bacteria | 11737 |
| 753 | Ga0400487_27921 | 3300039110 | Bacteria | 1829 |
| 754 | Ga0436365_0254146 | 3300039437 | Bacteria | 17395 |
| 755 | Ga0436360_1100593 | 3300039438 | Bacteria | 2140 |
| 756 | Ga0436361_0060173 | 3300039447 | Bacteria | 21826 |
| 757 | Ga0436361_0471013 | 3300039447 | Bacteria | 1357 |
| 758 | Ga0436361_0530365 | 3300039447 | Bacteria | 62073 |
| 759 | Ga0436361_0565711 | 3300039447 | Bacteria | 18708 |
| 760 | Ga0436361_0965385 | 3300039447 | Bacteria | 947 |
| 761 | Ga0436361_1185928 | 3300039447 | Bacteria | 172199 |
| 762 | Ga0439436_0130741 | 3300041404 | Bacteria | 704 |
| 763 | Ga0439461_0005492 | 3300041410 | Bacteria | 2164 |
| 764 | Ga0439461_0014830 | 3300041410 | Bacteria | 1487 |
| 765 | Ga0451797_0567997 | 3300041453 | Bacteria | 991 |
| 766 | Ga0451802_1012494 | 3300041460 | Bacteria | 1832 |
| 767 | Ga0451853_1252851 | 3300041512 | Bacteria | 2321 |
| 768 | Ga0439431_0016232 | 3300041997 | Bacteria | 1741 |
| 769 | Ga0439441_003495 | 3300042001 | Bacteria | 2321 |
| 770 | Ga0439441_007738 | 3300042001 | Bacteria | 1741 |
| 771 | Ga0439441_015568 | 3300042001 | Bacteria | 1347 |
| 772 | Ga0439448_0096392 | 3300042005 | Bacteria | 1002 |
| 773 | Ga0439432_029230 | 3300042006 | Bacteria | 1793 |
| 774 | Ga0450913_004596 | 3300042117 | Bacteria | 954 |
| 775 | Ga0450921_000102 | 3300042123 | Bacteria | 2714 |
| 776 | Ga0450923_006970 | 3300042125 | Bacteria | 1893 |
| 777 | Ga0450895_004740 | 3300042132 | Bacteria | 1079 |
| 778 | Ga0450896_000112 | 3300042133 | Bacteria | 5887 |
| 779 | Ga0450898_000545 | 3300042134 | Bacteria | 4433 |
| 780 | Ga0450899_004524 | 3300042135 | Bacteria | 1490 |
| 781 | Ga0450906_008259 | 3300042145 | Bacteria | 2021 |
| 782 | Ga0450910_001893 | 3300042147 | Bacteria | 2705 |
| 783 | Ga0439446_0000024 | 3300042156 | Bacteria | 26106 |
| 784 | Ga0450908_000686 | 3300042184 | Bacteria | 6496 |
| 785 | Ga0439434_0000267 | 3300042435 | Bacteria | 14791 |
| 786 | Ga0439435_0001268 | 3300042436 | Bacteria | 4585 |
| 787 | Ga0439459_0057446 | 3300042438 | Bacteria | 871 |
| 788 | Ga0451577_0001918 | 3300042876 | Bacteria | 26353 |
| 789 | Ga0451577_0002661 | 3300042876 | Bacteria | 20878 |
| 790 | Ga0451577_0004478 | 3300042876 | Bacteria | 14738 |
| 791 | Ga0451577_0191942 | 3300042876 | Bacteria | 1843 |
| 792 | Ga0466969_0022687 | 3300044656 | Bacteria | 3239 |
| 793 | Ga0466966_0415936 | 3300044684 | Bacteria | 808 |
| 794 | Ga0466961_0035962 | 3300044693 | Bacteria | 3179 |
| 795 | Ga0466963_0051835 | 3300044694 | Bacteria | 2721 |
| 796 | Ga0453684_0017824 | 3300044712 | Bacteria | 10957 |
| 797 | Ga0453684_0026121 | 3300044712 | Bacteria | 8451 |
| 798 | Ga0453684_0215251 | 3300044712 | Bacteria | 2230 |
| 799 | Ga0466971_0014993 | 3300044719 | Bacteria | 3410 |
| 800 | Ga0466959_0226169 | 3300045049 | Bacteria | 1296 |
| 801 | Ga0451576_0002092 | 3300045051 | Bacteria | 31120 |
| 802 | Ga0466967_0008702 | 3300045976 | Bacteria | 7471 |
| 803 | Ga0466967_0485303 | 3300045976 | Bacteria | 1211 |
| 804 | Ga0495617_000003 | 3300046452 | Bacteria | 541914 |
| 805 | Ga0495592_0001784 | 3300046454 | Bacteria | 15153 |
| 806 | Ga0495603_0178836 | 3300046455 | Bacteria | 1228 |
| 807 | Ga0495590_0158661 | 3300046457 | Bacteria | 822 |
| 808 | Ga0495638_0000752 | 3300046460 | Bacteria | 34566 |
| 809 | Ga0495638_0129308 | 3300046460 | Bacteria | 1485 |
| 810 | Ga0495653_0000024 | 3300046463 | Bacteria | 160810 |
| 811 | Ga0495653_0007107 | 3300046463 | Bacteria | 9177 |
| 812 | Ga0495650_0000390 | 3300046471 | Bacteria | 75055 |
| 813 | Ga0495650_0010380 | 3300046471 | Bacteria | 5201 |
| 814 | Ga0495650_0031404 | 3300046471 | Bacteria | 2391 |
| 815 | Ga0495580_0235388 | 3300046472 | Bacteria | 1256 |
| 816 | Ga0495639_0238362 | 3300046475 | Bacteria | 897 |
| 817 | Ga0495585_0002560 | 3300046492 | Bacteria | 12885 |
| 818 | Ga0495606_0000095 | 3300046507 | Bacteria | 151634 |
| 819 | Ga0495606_0000943 | 3300046507 | Bacteria | 42806 |
| 820 | Ga0495608_0007220 | 3300046511 | Bacteria | 7857 |
| 821 | Ga0495608_0108954 | 3300046511 | Bacteria | 1781 |
| 822 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 823 | Ga0495610_0131070 | 3300046512 | Bacteria | 1088 |
| 824 | Ga0495620_0044494 | 3300046515 | Bacteria | 1928 |
| 825 | Ga0495620_0095830 | 3300046515 | Bacteria | 1187 |
| 826 | Ga0495628_0031874 | 3300046516 | Bacteria | 4260 |
| 827 | Ga0495632_0054710 | 3300046519 | Bacteria | 1955 |
| 828 | Ga0495637_0000629 | 3300046520 | Bacteria | 24861 |
| 829 | Ga0495643_0108191 | 3300046522 | Bacteria | 1416 |
| 830 | Ga0495648_0005405 | 3300046524 | Bacteria | 10621 |
| 831 | Ga0495648_0012398 | 3300046524 | Bacteria | 6365 |
| 832 | Ga0495648_0110281 | 3300046524 | Bacteria | 1498 |
| 833 | Ga0495654_0000176 | 3300046530 | Bacteria | 62766 |
| 834 | Ga0495654_0010995 | 3300046530 | Bacteria | 4916 |
| 835 | Ga0495598_0031383 | 3300046537 | Bacteria | 1495 |
| 836 | Ga0495645_0092227 | 3300046543 | Bacteria | 2163 |
| 837 | Ga0495668_0000214 | 3300046616 | Bacteria | 84120 |
| 838 | Ga0495668_0259721 | 3300046616 | Bacteria | 951 |
| 839 | Ga0495634_0254221 | 3300046642 | Bacteria | 1074 |
| 840 | Ga0495625_0004050 | 3300046660 | Bacteria | 14007 |
| 841 | Ga0495625_0018166 | 3300046660 | Bacteria | 5496 |
| 842 | Ga0495625_0043874 | 3300046660 | Bacteria | 3240 |
| 843 | Ga0495635_0142577 | 3300046663 | Bacteria | 1631 |
| 844 | Ga0495659_0094099 | 3300046664 | Bacteria | 1154 |
| 845 | Ga0495661_0401437 | 3300046665 | Bacteria | 666 |
| 846 | Ga0495657_0096564 | 3300046675 | Bacteria | 1888 |
| 847 | Ga0495599_0003264 | 3300046678 | Bacteria | 9446 |
| 848 | Ga0495599_0157910 | 3300046678 | Bacteria | 1402 |
| 849 | Ga0495623_0016399 | 3300046679 | Bacteria | 4786 |
| 850 | Ga0495671_0000010 | 3300046692 | Bacteria | 368641 |
| 851 | Ga0495671_0017033 | 3300046692 | Bacteria | 3871 |
| 852 | Ga0495600_0003322 | 3300046809 | Bacteria | 9445 |
| 853 | Ga0495660_0011334 | 3300046810 | Bacteria | 5176 |
| 854 | Ga0495604_0011292 | 3300047317 | Bacteria | 7091 |
| 855 | Ga0495676_0153508 | 3300047321 | Bacteria | 1636 |
| 856 | Ga0495680_0025428 | 3300047322 | Bacteria | 4900 |
| 857 | Ga0495683_0001772 | 3300047323 | Bacteria | 13606 |
| 858 | Ga0495679_024300 | 3300047446 | Bacteria | 2042 |
| 859 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 860 | Ga0495673_0000016 | 3300047469 | Bacteria | 580643 |
| 861 | Ga0495686_0055983 | 3300047472 | Bacteria | 2465 |
| 862 | Ga0496100_0168469 | 3300048903 | Bacteria | 1575 |
| 863 | Ga0496101_0030610 | 3300048904 | Bacteria | 3776 |
| 864 | Ga0496102_0013838 | 3300048905 | Bacteria | 7002 |
| 865 | Ga0496102_0092148 | 3300048905 | Bacteria | 2806 |
| 866 | Ga0496104_0007302 | 3300048907 | Bacteria | 9751 |
| 867 | Ga0496104_0156374 | 3300048907 | Bacteria | 2188 |
| 868 | Ga0496104_0284728 | 3300048907 | Bacteria | 1566 |
| 869 | Ga0496105_0008827 | 3300048908 | Bacteria | 7853 |
| 870 | Ga0496107_0195345 | 3300048910 | Bacteria | 1504 |
| 871 | Ga0496108_0003054 | 3300048911 | Bacteria | 13457 |
| 872 | Ga0496108_0341859 | 3300048911 | Bacteria | 1306 |
| 873 | Ga0496109_0002176 | 3300048912 | Bacteria | 16283 |
| 874 | Ga0496109_0244036 | 3300048912 | Unclassified | 1691 |
| 875 | Ga0496110_0010236 | 3300048913 | Bacteria | 7619 |
| 876 | Ga0496112_0094714 | 3300048915 | Bacteria | 2957 |
| 877 | Ga0496113_0064178 | 3300048916 | Bacteria | 2776 |
| 878 | Ga0496113_0160210 | 3300048916 | Bacteria | 1779 |
| 879 | Ga0496114_0008854 | 3300048917 | Bacteria | 7978 |
| 880 | Ga0496114_0429080 | 3300048917 | Bacteria | 1171 |
| 881 | Ga0496115_0016687 | 3300048918 | Bacteria | 5597 |
| 882 | Ga0496120_0076768 | 3300048923 | Bacteria | 1819 |
| 883 | Ga0496121_0019583 | 3300048924 | Bacteria | 6758 |
| 884 | Ga0496121_0100095 | 3300048924 | Bacteria | 2238 |
| 885 | Ga0496121_0268238 | 3300048924 | Bacteria | 1175 |
| 886 | Ga0496122_0031334 | 3300048925 | Bacteria | 4428 |
| 887 | Ga0496122_0140118 | 3300048925 | Bacteria | 1514 |
| 888 | Ga0496123_0002828 | 3300048926 | Bacteria | 20535 |
| 889 | Ga0496126_0026686 | 3300048929 | Bacteria | 5531 |
| 890 | Ga0501292_000657 | 3300049515 | Bacteria | 4224 |
| 891 | Ga0501298_004393 | 3300049521 | Bacteria | 2221 |
| 892 | Ga0501031_0046495 | 3300049568 | Bacteria | 2830 |
| 893 | Ga0501032_0020823 | 3300049569 | Bacteria | 4565 |
| 894 | Ga0501032_0233521 | 3300049569 | Bacteria | 1196 |
| 895 | Ga0501033_0153859 | 3300049570 | Bacteria | 1658 |
| 896 | Ga0501033_0167882 | 3300049570 | Bacteria | 1577 |
| 897 | Ga0501033_0620417 | 3300049570 | Bacteria | 740 |
| 898 | Ga0501034_1350719 | 3300049571 | Bacteria | 588 |
| 899 | Ga0501036_0035446 | 3300049572 | Bacteria | 4223 |
| 900 | Ga0501036_0049741 | 3300049572 | Bacteria | 3550 |
| 901 | Ga0501036_0079251 | 3300049572 | Bacteria | 2778 |
| 902 | Ga0501036_0157205 | 3300049572 | Bacteria | 1917 |
| 903 | Ga0501036_0171190 | 3300049572 | Bacteria | 1830 |
| 904 | Ga0501038_0126200 | 3300049574 | Bacteria | 2106 |
| 905 | Ga0501038_0379146 | 3300049574 | Bacteria | 1097 |
| 906 | Ga0501038_0393978 | 3300049574 | Bacteria | 1072 |
| 907 | Ga0501038_0540625 | 3300049574 | Bacteria | 887 |
| 908 | Ga0501039_0039218 | 3300049575 | Bacteria | 3658 |
| 909 | Ga0501039_0457512 | 3300049575 | Unclassified | 1002 |
| 910 | Ga0501039_0458331 | 3300049575 | Bacteria | 1001 |
| 911 | Ga0501040_0061443 | 3300049576 | Bacteria | 2584 |
| 912 | Ga0501040_0198749 | 3300049576 | Bacteria | 1423 |
| 913 | Ga0501040_0264136 | 3300049576 | Bacteria | 1228 |
| 914 | Ga0501041_0022378 | 3300049577 | Bacteria | 3784 |
| 915 | Ga0501041_0083373 | 3300049577 | Bacteria | 1970 |
| 916 | Ga0501041_0102175 | 3300049577 | Bacteria | 1775 |
| 917 | Ga0501041_0285351 | 3300049577 | Bacteria | 1039 |
| 918 | Ga0501042_0081267 | 3300049578 | Bacteria | 2322 |
| 919 | Ga0501043_0255248 | 3300049579 | Bacteria | 1350 |
| 920 | Ga0501046_0119948 | 3300049580 | Bacteria | 2002 |
| 921 | Ga0501046_0314185 | 3300049580 | Bacteria | 1142 |
| 922 | Ga0501047_0005265 | 3300049581 | Bacteria | 12154 |
| 923 | Ga0501047_0021596 | 3300049581 | Bacteria | 6182 |
| 924 | Ga0501047_0071329 | 3300049581 | Bacteria | 3344 |
| 925 | Ga0501047_0088358 | 3300049581 | Bacteria | 2976 |
| 926 | Ga0501047_0171272 | 3300049581 | Bacteria | 2040 |
| 927 | Ga0501048_0032943 | 3300049582 | Bacteria | 3744 |
| 928 | Ga0501068_0009016 | 3300049584 | Bacteria | 5568 |
| 929 | Ga0501068_0062373 | 3300049584 | Bacteria | 2267 |
| 930 | Ga0501069_0001761 | 3300049585 | Bacteria | 10809 |
| 931 | Ga0501069_0017402 | 3300049585 | Bacteria | 3867 |
| 932 | Ga0501069_0075416 | 3300049585 | Bacteria | 1894 |
| 933 | Ga0501069_0099890 | 3300049585 | Bacteria | 1647 |
| 934 | Ga0501070_0004313 | 3300049586 | Bacteria | 12219 |
| 935 | Ga0501070_0009412 | 3300049586 | Bacteria | 8258 |
| 936 | Ga0501070_0014787 | 3300049586 | Bacteria | 6567 |
| 937 | Ga0501070_0021328 | 3300049586 | Bacteria | 5435 |
| 938 | Ga0501070_0093292 | 3300049586 | Bacteria | 2490 |
| 939 | Ga0501070_0335463 | 3300049586 | Bacteria | 1228 |
| 940 | Ga0501070_0446162 | 3300049586 | Bacteria | 1043 |
| 941 | Ga0501070_0676267 | 3300049586 | Bacteria | 818 |
| 942 | Ga0501071_0021301 | 3300049587 | Bacteria | 4512 |
| 943 | Ga0501071_0095978 | 3300049587 | Bacteria | 2182 |
| 944 | Ga0501071_0215193 | 3300049587 | Bacteria | 1445 |
| 945 | Ga0501071_0460649 | 3300049587 | Bacteria | 973 |
| 946 | Ga0501072_0035428 | 3300049588 | Bacteria | 3909 |
| 947 | Ga0501072_0072438 | 3300049588 | Bacteria | 2723 |
| 948 | Ga0501072_0209740 | 3300049588 | Bacteria | 1552 |
| 949 | Ga0501073_0006354 | 3300049589 | Bacteria | 8794 |
| 950 | Ga0501073_0024901 | 3300049589 | Bacteria | 4295 |
| 951 | Ga0501073_0027836 | 3300049589 | Bacteria | 4039 |
| 952 | Ga0501073_0241663 | 3300049589 | Bacteria | 1247 |
| 953 | Ga0501074_0011463 | 3300049590 | Bacteria | 6448 |
| 954 | Ga0501074_0022795 | 3300049590 | Bacteria | 4552 |
| 955 | Ga0501074_0134070 | 3300049590 | Bacteria | 1771 |
| 956 | Ga0501074_0145435 | 3300049590 | Bacteria | 1695 |
| 957 | Ga0501075_0032546 | 3300049591 | Bacteria | 3875 |
| 958 | Ga0501075_0152383 | 3300049591 | Bacteria | 1762 |
| 959 | Ga0501075_0158966 | 3300049591 | Bacteria | 1724 |
| 960 | Ga0501076_0008726 | 3300049592 | Bacteria | 7446 |
| 961 | Ga0501076_0046180 | 3300049592 | Bacteria | 3441 |
| 962 | Ga0501076_0077583 | 3300049592 | Bacteria | 2665 |
| 963 | Ga0501076_0152961 | 3300049592 | Bacteria | 1877 |
| 964 | Ga0501076_0183453 | 3300049592 | Bacteria | 1706 |
| 965 | Ga0501076_0539806 | 3300049592 | Bacteria | 961 |
| 966 | Ga0501077_0126411 | 3300049593 | Bacteria | 1621 |
| 967 | Ga0501077_0174103 | 3300049593 | Bacteria | 1367 |
| 968 | Ga0501077_0224367 | 3300049593 | Bacteria | 1194 |
| 969 | Ga0501233_034387 | 3300049668 | Bacteria | 1162 |
| 970 | Ga0501249_012407 | 3300049679 | Bacteria | 1800 |
| 971 | Ga0501079_0084937 | 3300049741 | Bacteria | 2449 |
| 972 | Ga0501079_0129407 | 3300049741 | Bacteria | 1964 |
| 973 | Ga0501079_0212214 | 3300049741 | Bacteria | 1512 |
| 974 | Ga0501079_0467973 | 3300049741 | Bacteria | 990 |
| 975 | Ga0501080_0018849 | 3300049742 | Bacteria | 6389 |
| 976 | Ga0501080_0025134 | 3300049742 | Bacteria | 5528 |
| 977 | Ga0501080_0046250 | 3300049742 | Bacteria | 4053 |
| 978 | Ga0501080_0058090 | 3300049742 | Bacteria | 3601 |
| 979 | Ga0501080_0071775 | 3300049742 | Bacteria | 3220 |
| 980 | Ga0501080_0101741 | 3300049742 | Bacteria | 2666 |
| 981 | Ga0501080_0296701 | 3300049742 | Bacteria | 1467 |
| 982 | Ga0501080_0656866 | 3300049742 | Bacteria | 927 |
| 983 | Ga0501081_0007215 | 3300049743 | Bacteria | 7226 |
| 984 | Ga0501081_0221058 | 3300049743 | Bacteria | 1377 |
| 985 | Ga0501081_0232043 | 3300049743 | Bacteria | 1344 |
| 986 | Ga0501081_0298154 | 3300049743 | Bacteria | 1182 |
| 987 | Ga0501083_0003965 | 3300049744 | Bacteria | 10396 |
| 988 | Ga0501083_0013521 | 3300049744 | Bacteria | 5706 |
| 989 | Ga0501083_0467349 | 3300049744 | Bacteria | 821 |
| 990 | Ga0501265_001666 | 3300049762 | Bacteria | 2514 |
| 991 | Ga0501268_009701 | 3300049765 | Bacteria | 1484 |
| 992 | Ga0501035_0096487 | 3300049822 | Bacteria | 2598 |
| 993 | Ga0501035_0140248 | 3300049822 | Bacteria | 2102 |
| 994 | Ga0501035_0268645 | 3300049822 | Bacteria | 1444 |
| 995 | Ga0501035_0275562 | 3300049822 | Bacteria | 1423 |
| 996 | Ga0501035_0463960 | 3300049822 | Bacteria | 1046 |
| 997 | Ga0501035_0468218 | 3300049822 | Bacteria | 1041 |
| 998 | Ga0501044_0009149 | 3300049823 | Bacteria | 10817 |
| 999 | Ga0501044_0014207 | 3300049823 | Bacteria | 8600 |
| 1000 | Ga0501044_0067653 | 3300049823 | Bacteria | 3639 |
| 1001 | Ga0501044_0230367 | 3300049823 | Bacteria | 1800 |
| 1002 | Ga0501044_0235341 | 3300049823 | Bacteria | 1777 |
| 1003 | Ga0501045_0061156 | 3300049824 | Bacteria | 2763 |
| 1004 | Ga0501045_0477364 | 3300049824 | Bacteria | 926 |
| 1005 | nmdc:mga0k408_100917_c1 | 3300050493 | Bacteria | 1701 |
| 1006 | nmdc:mga0k408_280480_c1 | 3300050493 | Bacteria | 995 |
| 1007 | nmdc:mga0k408_29621_c1 | 3300050493 | Bacteria | 3118 |
| 1008 | nmdc:mga06z11_179751_c1 | 3300050494 | Bacteria | 1219 |
| 1009 | nmdc:mga07m45_110075_c1 | 3300050496 | Bacteria | 1586 |
| 1010 | nmdc:mga07m45_51881_c1 | 3300050496 | Bacteria | 1853 |
| 1011 | nmdc:mga05p37_321469_c1 | 3300050507 | Bacteria | 1831 |
| 1012 | nmdc:mga05p37_757745_c1 | 3300050507 | Bacteria | 1069 |
| 1013 | nmdc:mga09592_295067_c1 | 3300050508 | Bacteria | 1405 |
| 1014 | nmdc:mga09592_94004_c1 | 3300050508 | Bacteria | 2564 |
| 1015 | nmdc:mga0qj67_13140_c1 | 3300050509 | Bacteria | 6252 |
| 1016 | nmdc:mga0qj67_659753_c1 | 3300050509 | Bacteria | 834 |
| 1017 | nmdc:mga0qj67_685365_c1 | 3300050509 | Bacteria | 816 |
| 1018 | nmdc:mga06r32_162765_c1 | 3300050510 | Bacteria | 2213 |
| 1019 | nmdc:mga06r32_294_c1 | 3300050510 | Bacteria | 41509 |
| 1020 | nmdc:mga06r32_299864_c1 | 3300050510 | Bacteria | 1593 |
| 1021 | nmdc:mga08y16_116514_c1 | 3300050511 | Bacteria | 2781 |
| 1022 | nmdc:mga08y16_368907_c1 | 3300050511 | Bacteria | 1473 |
| 1023 | nmdc:mga08y16_4964_c1 | 3300050511 | Bacteria | 13905 |
| 1024 | nmdc:mga0n895_123601_c1 | 3300050512 | Bacteria | 2610 |
| 1025 | nmdc:mga0n895_1253215_c1 | 3300050512 | Bacteria | 714 |
| 1026 | nmdc:mga0n895_1426_c1 | 3300050512 | Bacteria | 17877 |
| 1027 | nmdc:mga0n895_748600_c1 | 3300050512 | Bacteria | 970 |
| 1028 | nmdc:mga08x19_298145_c1 | 3300050514 | Bacteria | 1119 |
| 1029 | nmdc:mga08x19_481153_c1 | 3300050514 | Bacteria | 875 |
| 1030 | nmdc:mga0a205_101383_c1 | 3300050515 | Bacteria | 2778 |
| 1031 | Ga0500578_0000549 | 3300053086 | Bacteria | 45594 |
| 1032 | Ga0500647_0133959 | 3300053091 | Bacteria | 1167 |
| 1033 | Ga0500555_035799 | 3300053103 | Bacteria | 1393 |
| 1034 | Ga0500618_000236 | 3300053125 | Bacteria | 43585 |
| 1035 | Ga0500652_001792 | 3300053131 | Bacteria | 6514 |
| 1036 | Ga0500658_0030291 | 3300053134 | Bacteria | 2109 |
| 1037 | Ga0500574_000670 | 3300053141 | Bacteria | 4491 |
| 1038 | Ga0500619_000446 | 3300053154 | Bacteria | 7411 |
| 1039 | Ga0500587_001275 | 3300053739 | Bacteria | 3526 |
| 1040 | Ga0501084_1069356 | 3300054114 | Bacteria | 678 |
| 1041 | Ga0590071_000328 | 3300059421 | Bacteria | 13941 |
| 1042 | Ga0590071_004548 | 3300059421 | Bacteria | 3364 |
| 1043 | Ga0501082_0368361 | 3300060353 | Bacteria | 1253 |
| 1044 | Ga0501082_0550091 | 3300060353 | Bacteria | 1009 |
| 1045 | Ga0530510_0132082 | 3300061734 | Bacteria | 1837 |
| 1046 | Ga0530510_0179691 | 3300061734 | Bacteria | 1569 |
| 1047 | Ga0530510_0284289 | 3300061734 | Bacteria | 1236 |
| 1048 | 2587725876 | 2585428057 | Bacteria | 6737412 |
| 1049 | 2587736167 | 2585428058 | Bacteria | 6853932 |
| 1050 | 2588292910 | 2588253510 | Bacteria | 6901809 |
| 1051 | 2643968019 | 2643221592 | Bacteria | 6608788 |
| 1052 | 2644143057 | 2643221625 | Bacteria | 6512927 |
| 1053 | 2644271855 | 2643221648 | Bacteria | 6521465 |
| 1054 | 2738829996 | 2738541297 | Bacteria | 6549566 |
| 1055 | 2739153792 | 2738541357 | Bacteria | 6549408 |
| 1056 | 2739195712 | 2738543003 | Bacteria | 6549560 |
| 1057 | 2739322188 | 2738543026 | Bacteria | 6549408 |
| 1058 | 2739340429 | 2738543029 | Bacteria | 6549249 |
| 1059 | 2819541588 | 2818991436 | Bacteria | 5376622 |
| 1060 | 2821131939 | 2821131069 | Bacteria | 6108407 |
| 1061 | 2849666822 | 2849660919 | Bacteria | 8251853 |
| 1062 | 2857568604 | 2857564685 | Bacteria | 6290584 |
| 1063 | Ga0105240_10026825 | |||
| 1064 | JGI24747J21853_1019598 | |||
| 1065 | JGI24740J21852_10002282 | |||
| 1066 | JGI24742J22300_10028610 | |||
| 1067 | JGI25162J39368_1000552 | |||
| 1068 | JGI25154J39366_1001031 | |||
| 1069 | JGI25165J46597_1000670 | |||
| 1070 | JGI25153J46596_10000562 | |||
| 1071 | JGI25404J52841_10003336 | |||
| 1072 | Ga0055538_1000265 | |||
| 1073 | Ga0055539_1000292 | |||
| 1074 | Ga0055533_1000279 | |||
| 1075 | Ga0055525_1000397 | |||
| 1076 | Ga0055526_1000061 | |||
| 1077 | Ga0055530_10028570 | |||
| 1078 | Ga0055541_1000189 | |||
| 1079 | Ga0065165_1030381 | |||
| 1080 | Ga0065704_10171642 | |||
| 1081 | Ga0065712_10086280 | |||
| 1082 | Ga0065715_10096999 | |||
| 1083 | Ga0065715_10119564 | |||
| 1084 | Ga0065707_10081836 | |||
| 1085 | Ga0070658_10000878 | |||
| 1086 | Ga0070658_10017642 | |||
| 1087 | Ga0070658_10037172 | |||
| 1088 | Ga0070658_10159632 | |||
| 1089 | Ga0070658_10334838 | |||
| 1090 | Ga0070676_10025143 | |||
| 1091 | Ga0070683_100030700 | |||
| 1092 | Ga0070683_100145479 | |||
| 1093 | Ga0070683_100185727 | |||
| 1094 | Ga0070683_100305200 | |||
| 1095 | Ga0070690_100009681 | |||
| 1096 | Ga0070690_100034809 | |||
| 1097 | Ga0070670_100022930 | |||
| 1098 | Ga0070670_100026997 | |||
| 1099 | Ga0070670_100029312 | |||
| 1100 | Ga0070670_100082061 | |||
| 1101 | Ga0070670_100147265 | |||
| 1102 | Ga0070677_10002000 | |||
| 1103 | Ga0070677_10014812 | |||
| 1104 | Ga0068869_100003892 | |||
| 1105 | Ga0068869_100171618 | |||
| 1106 | Ga0070666_10030574 | |||
| 1107 | Ga0070680_100005064 | |||
| 1108 | Ga0070680_100105028 | |||
| 1109 | Ga0070680_100116697 | |||
| 1110 | Ga0070680_100265041 | |||
| 1111 | Ga0070680_100416371 | |||
| 1112 | Ga0070680_100680382 | |||
| 1113 | Ga0070682_100074888 | |||
| 1114 | Ga0070682_100341721 | |||
| 1115 | Ga0068868_100055701 | |||
| 1116 | Ga0068868_100098667 | |||
| 1117 | Ga0070660_100020762 | |||
| 1118 | Ga0070660_100072589 | |||
| 1119 | Ga0070660_100267728 | |||
| 1120 | Ga0070660_100310441 | |||
| 1121 | Ga0070689_100004722 | |||
| 1122 | Ga0070691_10001239 | |||
| 1123 | Ga0070661_100028799 | |||
| 1124 | Ga0070661_100035354 | |||
| 1125 | Ga0070661_100036184 | |||
| 1126 | Ga0070661_100047822 | |||
| 1127 | Ga0070661_100098215 | |||
| 1128 | Ga0070661_100101094 | |||
| 1129 | Ga0070661_100134125 | |||
| 1130 | Ga0070692_10000156 | |||
| 1131 | Ga0070692_10096910 | |||
| 1132 | Ga0070692_10126787 | |||
| 1133 | Ga0070692_10339690 | |||
| 1134 | Ga0070668_100002860 | |||
| 1135 | Ga0070668_100025695 | |||
| 1136 | Ga0070669_100006764 | |||
| 1137 | Ga0070669_100015779 | |||
| 1138 | Ga0070669_100554372 | |||
| 1139 | Ga0070675_100000158 | |||
| 1140 | Ga0070675_100029770 | |||
| 1141 | Ga0070675_100069599 | |||
| 1142 | Ga0070671_100008095 | |||
| 1143 | Ga0070671_100011485 | |||
| 1144 | Ga0070671_100309862 | |||
| 1145 | Ga0070671_100410291 | |||
| 1146 | Ga0070674_100004688 | |||
| 1147 | Ga0070674_100027541 | |||
| 1148 | Ga0070673_100002034 | |||
| 1149 | Ga0070673_100088781 | |||
| 1150 | Ga0070673_100407084 | |||
| 1151 | Ga0070673_100546618 | |||
| 1152 | Ga0070688_100009085 | |||
| 1153 | Ga0070688_100067667 | |||
| 1154 | Ga0070659_100010910 | |||
| 1155 | Ga0070659_100078604 | |||
| 1156 | Ga0070659_100094191 | |||
| 1157 | Ga0070667_100001488 | |||
| 1158 | Ga0070667_100170680 | |||
| 1159 | Ga0070667_100172723 | |||
| 1160 | Ga0070667_100263048 | |||
| 1161 | Ga0070667_100782299 | |||
| 1162 | Ga0070709_10000198 | |||
| 1163 | Ga0070709_10078576 | |||
| 1164 | Ga0070709_10091766 | |||
| 1165 | Ga0070714_100003534 | |||
| 1166 | Ga0070714_100020776 | |||
| 1167 | Ga0070714_100131528 | |||
| 1168 | Ga0070713_100000458 | |||
| 1169 | Ga0070713_100064132 | |||
| 1170 | Ga0070713_100313585 | |||
| 1171 | Ga0070710_10000432 | |||
| 1172 | Ga0070710_10430540 | |||
| 1173 | Ga0070701_10086602 | |||
| 1174 | Ga0070711_100001067 | |||
| 1175 | Ga0070711_100086220 | |||
| 1176 | Ga0070711_100218400 | |||
| 1177 | Ga0070700_100084560 | |||
| 1178 | Ga0070708_100001307 | |||
| 1179 | Ga0070663_100002315 | |||
| 1180 | Ga0070663_100003421 | |||
| 1181 | Ga0070663_100010281 | |||
| 1182 | Ga0070663_100183568 | |||
| 1183 | Ga0070663_100243623 | |||
| 1184 | Ga0070663_100331062 | |||
| 1185 | Ga0070663_100351529 | |||
| 1186 | Ga0070663_100384768 | |||
| 1187 | Ga0070678_100001095 | |||
| 1188 | Ga0070678_100114257 | |||
| 1189 | Ga0070678_100152603 | |||
| 1190 | Ga0070678_100175332 | |||
| 1191 | Ga0070678_100479264 | |||
| 1192 | Ga0070678_100748341 | |||
| 1193 | Ga0070662_100005381 | |||
| 1194 | Ga0070662_100421230 | |||
| 1195 | Ga0070662_100600444 | |||
| 1196 | Ga0070662_100674548 | |||
| 1197 | Ga0070681_10000783 | |||
| 1198 | Ga0070681_10007295 | |||
| 1199 | Ga0070681_10300181 | |||
| 1200 | Ga0068867_100008531 | |||
| 1201 | Ga0068867_100076766 | |||
| 1202 | Ga0068867_100245571 | |||
| 1203 | Ga0068867_100536534 | |||
| 1204 | Ga0070706_100320451 | |||
| 1205 | Ga0070706_100751673 | |||
| 1206 | Ga0070707_100019024 | |||
| 1207 | Ga0070707_100164845 | |||
| 1208 | Ga0070698_100139870 | |||
| 1209 | Ga0070679_100018839 | |||
| 1210 | Ga0070679_100025928 | |||
| 1211 | Ga0070679_100032605 | |||
| 1212 | Ga0070679_100092041 | |||
| 1213 | Ga0070679_100325800 | |||
| 1214 | Ga0070684_100114806 | |||
| 1215 | Ga0070684_100369292 | |||
| 1216 | Ga0070697_100770533 | |||
| 1217 | Ga0068853_100040680 | |||
| 1218 | Ga0068853_100194116 | |||
| 1219 | Ga0070672_100001541 | |||
| 1220 | Ga0070672_100004184 | |||
| 1221 | Ga0070672_100145423 | |||
| 1222 | Ga0070672_100147063 | |||
| 1223 | Ga0070672_100169969 | |||
| 1224 | Ga0070695_100284342 | |||
| 1225 | Ga0070696_100041269 | |||
| 1226 | Ga0070696_100042642 | |||
| 1227 | Ga0070696_100262758 | |||
| 1228 | Ga0070693_100028140 | |||
| 1229 | Ga0070693_100034987 | |||
| 1230 | Ga0070693_100041250 | |||
| 1231 | Ga0070693_100103473 | |||
| 1232 | Ga0070665_100281339 | |||
| 1233 | Ga0070665_100329602 | |||
| 1234 | Ga0070665_100485656 | |||
| 1235 | Ga0068855_100001106 | |||
| 1236 | Ga0068855_100001914 | |||
| 1237 | Ga0068855_100009030 | |||
| 1238 | Ga0068855_100023969 | |||
| 1239 | Ga0068855_100037340 | |||
| 1240 | Ga0068855_100077574 | |||
| 1241 | Ga0068855_100102097 | |||
| 1242 | Ga0068855_100115844 | |||
| 1243 | Ga0070664_100087765 | |||
| 1244 | Ga0070664_100088849 | |||
| 1245 | Ga0070664_100133380 | |||
| 1246 | Ga0070664_100367941 | |||
| 1247 | Ga0070664_100641723 | |||
| 1248 | Ga0068857_100008167 | |||
| 1249 | Ga0068857_100029781 | |||
| 1250 | Ga0068854_100004663 | |||
| 1251 | Ga0068854_100051349 | |||
| 1252 | Ga0068854_100101441 | |||
| 1253 | Ga0068854_100607773 | |||
| 1254 | Ga0068856_100000358 | |||
| 1255 | Ga0068856_100035813 | |||
| 1256 | Ga0068856_100535450 | |||
| 1257 | Ga0070702_100012406 | |||
| 1258 | Ga0068852_100006670 | |||
| 1259 | Ga0068852_100028467 | |||
| 1260 | Ga0068852_100049573 | |||
| 1261 | Ga0068852_100112038 | |||
| 1262 | Ga0068852_100177640 | |||
| 1263 | Ga0068852_100237302 | |||
| 1264 | Ga0068852_100416453 | |||
| 1265 | Ga0068852_101410120 | |||
| 1266 | Ga0068859_100062866 | |||
| 1267 | Ga0068859_100113458 | |||
| 1268 | Ga0068859_100251402 | |||
| 1269 | Ga0068864_100097369 | |||
| 1270 | Ga0068864_100105084 | |||
| 1271 | Ga0068864_100289176 | |||
| 1272 | Ga0068866_10002436 | |||
| 1273 | Ga0068861_100000937 | |||
| 1274 | Ga0068861_100003539 | |||
| 1275 | Ga0068861_100278432 | |||
| 1276 | Ga0068851_10000378 | |||
| 1277 | Ga0068851_10052932 | |||
| 1278 | Ga0068851_10156608 | |||
| 1279 | Ga0068851_10227545 | |||
| 1280 | Ga0068851_10481597 | |||
| 1281 | Ga0068870_10056253 | |||
| 1282 | Ga0068870_10309805 | |||
| 1283 | Ga0068863_100045929 | |||
| 1284 | Ga0068863_100046448 | |||
| 1285 | Ga0068863_100143804 | |||
| 1286 | Ga0068863_100207676 | |||
| 1287 | Ga0068858_100017319 | |||
| 1288 | Ga0068858_100122777 | |||
| 1289 | Ga0068858_100382450 | |||
| 1290 | Ga0068858_100801935 | |||
| 1291 | Ga0068858_100842821 | |||
| 1292 | Ga0068858_101038082 | |||
| 1293 | Ga0068860_100535877 | |||
| 1294 | Ga0068862_100001747 | |||
| 1295 | Ga0068862_100192383 | |||
| 1296 | Ga0070717_10002565 | |||
| 1297 | Ga0070717_10091962 | |||
| 1298 | Ga0070717_10443923 | |||
| 1299 | Ga0075363_100166517 | |||
| 1300 | Ga0070715_10029588 | |||
| 1301 | Ga0070715_10040953 | |||
| 1302 | Ga0070716_100021576 | |||
| 1303 | Ga0070712_100009447 | |||
| 1304 | Ga0070712_100047193 | |||
| 1305 | Ga0070712_101085029 | |||
| 1306 | Ga0075362_10150391 | |||
| 1307 | Ga0075367_10170634 | |||
| 1308 | Ga0075366_10002934 | |||
| 1309 | Ga0075366_10003063 | |||
| 1310 | Ga0075366_10023761 | |||
| 1311 | Ga0097621_100055101 | |||
| 1312 | Ga0097621_100114363 | |||
| 1313 | Ga0075370_10023079 | |||
| 1314 | Ga0075370_10169313 | |||
| 1315 | Ga0075428_100046712 | |||
| 1316 | Ga0075428_100058034 | |||
| 1317 | Ga0075428_100149122 | |||
| 1318 | Ga0075428_100470193 | |||
| 1319 | Ga0075428_100616016 | |||
| 1320 | Ga0075430_100017771 | |||
| 1321 | Ga0075430_100071516 | |||
| 1322 | Ga0075430_100246898 | |||
| 1323 | Ga0075431_100015827 | |||
| 1324 | Ga0075431_100124133 | |||
| 1325 | Ga0075431_100287326 | |||
| 1326 | Ga0075433_10000660 | |||
| 1327 | Ga0075433_10477234 | |||
| 1328 | Ga0075434_100035955 | |||
| 1329 | Ga0075434_100168427 | |||
| 1330 | Ga0075434_100330834 | |||
| 1331 | Ga0075434_102049439 | |||
| 1332 | Ga0075429_100113558 | |||
| 1333 | Ga0075429_100462451 | |||
| 1334 | Ga0075429_100489975 | |||
| 1335 | Ga0097620_100062866 | |||
| 1336 | Ga0097620_100113459 | |||
| 1337 | Ga0097620_100251397 | |||
| 1338 | Ga0097620_100359737 | |||
| 1339 | Ga0105240_10006075 | |||
| 1340 | Ga0105240_10073212 | |||
| 1341 | Ga0105240_10075503 | |||
| 1342 | Ga0105240_10146627 | |||
| 1343 | Ga0105240_10417478 | |||
| 1344 | Ga0105240_10472508 | |||
| 1345 | Ga0105240_10617013 | |||
| 1346 | Ga0105240_10630782 | |||
| 1347 | Ga0105240_10672106 | |||
| 1348 | Ga0111539_10003586 | |||
| 1349 | Ga0111539_10034865 | |||
| 1350 | Ga0111539_10077063 | |||
| 1351 | Ga0111539_10146337 | |||
| 1352 | Ga0111539_10186417 | |||
| 1353 | Ga0111539_10417031 | |||
| 1354 | Ga0111539_10988936 | |||
| 1355 | Ga0114129_10112203 | |||
| 1356 | Ga0114129_10331757 | |||
| 1357 | Ga0114129_10752106 | |||
| 1358 | Ga0105243_10105736 | |||
| 1359 | Ga0105243_10161153 | |||
| 1360 | Ga0105241_10001282 | |||
| 1361 | Ga0105241_10001952 | |||
| 1362 | Ga0105241_10369814 | |||
| 1363 | Ga0105248_10033122 | |||
| 1364 | Ga0105248_10147575 | |||
| 1365 | Ga0105248_10181771 | |||
| 1366 | Ga0105237_10000617 | |||
| 1367 | Ga0105237_10148527 | |||
| 1368 | Ga0105237_10364903 | |||
| 1369 | Ga0105238_10074533 | |||
| 1370 | Ga0105238_10157618 | |||
| 1371 | Ga0105238_10229458 | |||
| 1372 | Ga0105238_10284681 | |||
| 1373 | Ga0105238_10902387 | |||
| 1374 | Ga0105249_10021772 | |||
| 1375 | Ga0105249_10028460 | |||
| 1376 | Ga0105249_10093625 | |||
| 1377 | Ga0105249_10566454 | |||
| 1378 | Ga0105239_10083569 | |||
| 1379 | Ga0105239_10139483 | |||
| 1380 | Ga0105239_10142388 | |||
| 1381 | Ga0105239_10622601 | |||
| 1382 | Ga0105239_10891089 | |||
| 1383 | Ga0105246_10276588 | |||
| 1384 | Ga0157373_10007032 | |||
| 1385 | Ga0157373_10053787 | |||
| 1386 | Ga0157373_10126475 | |||
| 1387 | Ga0157371_10017865 | |||
| 1388 | Ga0157371_10058914 | |||
| 1389 | Ga0157371_10103641 | |||
| 1390 | Ga0157371_10164798 | |||
| 1391 | Ga0157371_10348986 | |||
| 1392 | Ga0157371_10395725 | |||
| 1393 | Ga0157371_10468350 | |||
| 1394 | Ga0157370_10010304 | |||
| 1395 | Ga0157370_10013448 | |||
| 1396 | Ga0157370_10013656 | |||
| 1397 | Ga0157370_10064853 | |||
| 1398 | Ga0157370_10259272 | |||
| 1399 | Ga0157370_10319853 | |||
| 1400 | Ga0157370_10810470 | |||
| 1401 | Ga0157369_10002364 | |||
| 1402 | Ga0157369_10050020 | |||
| 1403 | Ga0157369_10054611 | |||
| 1404 | Ga0157369_10064245 | |||
| 1405 | Ga0157369_10212055 | |||
| 1406 | Ga0157374_10373237 | |||
| 1407 | Ga0157378_10175359 | |||
| 1408 | Ga0157378_10336517 | |||
| 1409 | Ga0163162_10065105 | |||
| 1410 | Ga0163162_10065334 | |||
| 1411 | Ga0163162_10229049 | |||
| 1412 | Ga0163162_10480627 | |||
| 1413 | Ga0163162_10828082 | |||
| 1414 | Ga0157372_10001158 | |||
| 1415 | Ga0157372_10005566 | |||
| 1416 | Ga0157372_10068555 | |||
| 1417 | Ga0157372_10128029 | |||
| 1418 | Ga0157372_10458710 | |||
| 1419 | Ga0157372_10461610 | |||
| 1420 | Ga0157372_10504211 | |||
| 1421 | Ga0157372_10604494 | |||
| 1422 | Ga0157375_10101538 | |||
| 1423 | Ga0157375_10255206 | |||
| 1424 | Ga0157375_10477199 | |||
| 1425 | Ga0157375_10497656 | |||
| 1426 | Ga0157375_10864749 | |||
| 1427 | Ga0163163_10037499 | |||
| 1428 | Ga0163163_10066333 | |||
| 1429 | Ga0163163_10613449 | |||
| 1430 | Ga0163163_10887877 | |||
| 1431 | Ga0157380_10020312 | |||
| 1432 | Ga0157380_10039857 | |||
| 1433 | Ga0157380_10055104 | |||
| 1434 | Ga0157380_10156645 | |||
| 1435 | Ga0157380_10365549 | |||
| 1436 | Ga0157377_10007070 | |||
| 1437 | Ga0157379_10050580 | |||
| 1438 | Ga0157379_10066341 | |||
| 1439 | Ga0157379_10274099 | |||
| 1440 | Ga0157379_10324235 | |||
| 1441 | Ga0157376_10282791 | |||
| 1442 | Ga0157376_10696891 | |||
| 1443 | Ga0182007_10006749 | |||
| 1444 | Ga0163161_10007946 | |||
| 1445 | Ga0163161_10066438 | |||
| 1446 | Ga0163161_10429285 | |||
| 1447 | Ga0197907_11182327 | |||
| 1448 | Ga0206356_10348143 | |||
| 1449 | Ga0206356_11465550 | |||
| 1450 | Ga0206356_11906906 | |||
| 1451 | Ga0206351_10854524 | |||
| 1452 | Ga0206353_11042515 | |||
| 1453 | Ga0206353_11365073 | |||
| 1454 | Ga0213872_10000001 | |||
| 1455 | Ga0213872_10000777 | |||
| 1456 | Ga0213872_10006712 | |||
| 1457 | Ga0213876_10004985 | |||
| 1458 | Ga0224712_10121277 | |||
| 1459 | Ga0224712_10228544 | |||
| 1460 | Ga0224712_10327486 | |||
| 1461 | Ga0224572_1003827 | |||
| 1462 | Ga0209784_100062 | |||
| 1463 | Ga0209566_100023 | |||
| 1464 | Ga0209674_100040 | |||
| 1465 | Ga0209563_100096 | |||
| 1466 | Ga0207427_101222 | |||
| 1467 | Ga0209437_100146 | |||
| 1468 | Ga0209437_112590 | |||
| 1469 | Ga0209646_1000051 | |||
| 1470 | Ga0209646_1001818 | |||
| 1471 | Ga0209026_1001309 | |||
| 1472 | Ga0209677_100058 | |||
| 1473 | Ga0209759_1004825 | |||
| 1474 | Ga0209233_1000159 | |||
| 1475 | Ga0209455_1000343 | |||
| 1476 | Ga0209564_1000089 | |||
| 1477 | Ga0209758_1000500 | |||
| 1478 | Ga0209050_1000223 | |||
| 1479 | Ga0209051_1010940 | |||
| 1480 | Ga0207697_10002525 | |||
| 1481 | Ga0207697_10137508 | |||
| 1482 | Ga0207656_10005197 | |||
| 1483 | Ga0207656_10077458 | |||
| 1484 | Ga0207656_10160601 | |||
| 1485 | Ga0207682_10002139 | |||
| 1486 | Ga0207682_10005898 | |||
| 1487 | Ga0207692_10002596 | |||
| 1488 | Ga0207692_10197284 | |||
| 1489 | Ga0207688_10045489 | |||
| 1490 | Ga0207680_10040469 | |||
| 1491 | Ga0207680_10419551 | |||
| 1492 | Ga0207647_10002926 | |||
| 1493 | Ga0207647_10119943 | |||
| 1494 | Ga0207699_10059345 | |||
| 1495 | Ga0207699_10082389 | |||
| 1496 | Ga0207699_10116351 | |||
| 1497 | Ga0207645_10002061 | |||
| 1498 | Ga0207645_10004476 | |||
| 1499 | Ga0207645_10028372 | |||
| 1500 | Ga0207645_10095629 | |||
| 1501 | Ga0207645_10138855 | |||
| 1502 | Ga0207643_10002190 | |||
| 1503 | Ga0207705_10000165 | |||
| 1504 | Ga0207705_10000938 | |||
| 1505 | Ga0207705_10011933 | |||
| 1506 | Ga0207705_10022299 | |||
| 1507 | Ga0207705_10055187 | |||
| 1508 | Ga0207705_10110152 | |||
| 1509 | Ga0207705_10246901 | |||
| 1510 | Ga0207705_10490150 | |||
| 1511 | Ga0207684_10145736 | |||
| 1512 | Ga0207707_10000630 | |||
| 1513 | Ga0207707_10000859 | |||
| 1514 | Ga0207707_10001033 | |||
| 1515 | Ga0207707_10007482 | |||
| 1516 | Ga0207707_10179180 | |||
| 1517 | Ga0207707_10202004 | |||
| 1518 | Ga0207695_10000975 | |||
| 1519 | Ga0207695_10004622 | |||
| 1520 | Ga0207695_10007233 | |||
| 1521 | Ga0207695_10013008 | |||
| 1522 | Ga0207695_10038122 | |||
| 1523 | Ga0207695_10050428 | |||
| 1524 | Ga0207695_10083362 | |||
| 1525 | Ga0207695_10129478 | |||
| 1526 | Ga0207695_10161595 | |||
| 1527 | Ga0207695_10766159 | |||
| 1528 | Ga0207671_10000462 | |||
| 1529 | Ga0207671_10158428 | |||
| 1530 | Ga0207693_10006002 | |||
| 1531 | Ga0207693_10058723 | |||
| 1532 | Ga0207693_10141885 | |||
| 1533 | Ga0207663_10119036 | |||
| 1534 | Ga0207663_10165329 | |||
| 1535 | Ga0207660_10088060 | |||
| 1536 | Ga0207660_10099067 | |||
| 1537 | Ga0207662_10005665 | |||
| 1538 | Ga0207657_10000888 | |||
| 1539 | Ga0207657_10007345 | |||
| 1540 | Ga0207657_10078188 | |||
| 1541 | Ga0207657_10286519 | |||
| 1542 | Ga0207649_10017932 | |||
| 1543 | Ga0207649_10041213 | |||
| 1544 | Ga0207649_10173196 | |||
| 1545 | Ga0207649_10176530 | |||
| 1546 | Ga0207649_10181294 | |||
| 1547 | Ga0207652_10000940 | |||
| 1548 | Ga0207652_10001326 | |||
| 1549 | Ga0207652_10036631 | |||
| 1550 | Ga0207652_10050560 | |||
| 1551 | Ga0207652_10116236 | |||
| 1552 | Ga0207652_10199587 | |||
| 1553 | Ga0207652_10253528 | |||
| 1554 | Ga0207646_10045109 | |||
| 1555 | Ga0207646_10082023 | |||
| 1556 | Ga0207681_10004746 | |||
| 1557 | Ga0207681_10139017 | |||
| 1558 | Ga0207681_10940607 | |||
| 1559 | Ga0207694_10020636 | |||
| 1560 | Ga0207650_10000254 | |||
| 1561 | Ga0207650_10000662 | |||
| 1562 | Ga0207650_10003114 | |||
| 1563 | Ga0207650_10004774 | |||
| 1564 | Ga0207650_10069235 | |||
| 1565 | Ga0207650_10170634 | |||
| 1566 | Ga0207659_10009497 | |||
| 1567 | Ga0207659_10024144 | |||
| 1568 | Ga0207659_10043661 | |||
| 1569 | Ga0207700_10019285 | |||
| 1570 | Ga0207700_10019723 | |||
| 1571 | Ga0207700_10081952 | |||
| 1572 | Ga0207700_10368123 | |||
| 1573 | Ga0207664_10001253 | |||
| 1574 | Ga0207664_10001691 | |||
| 1575 | Ga0207664_10018049 | |||
| 1576 | Ga0207664_10036084 | |||
| 1577 | Ga0207664_10067184 | |||
| 1578 | Ga0207664_10877244 | |||
| 1579 | Ga0207644_10019320 | |||
| 1580 | Ga0207644_10033475 | |||
| 1581 | Ga0207644_10155402 | |||
| 1582 | Ga0207644_10466333 | |||
| 1583 | Ga0207644_10535945 | |||
| 1584 | Ga0207644_10741143 | |||
| 1585 | Ga0207690_10155462 | |||
| 1586 | Ga0207690_10178641 | |||
| 1587 | Ga0207690_10498716 | |||
| 1588 | Ga0207690_10546427 | |||
| 1589 | Ga0207706_10004399 | |||
| 1590 | Ga0207706_10008972 | |||
| 1591 | Ga0207706_10074604 | |||
| 1592 | Ga0207706_10353383 | |||
| 1593 | Ga0207706_10679297 | |||
| 1594 | Ga0207686_10348218 | |||
| 1595 | Ga0207669_10072369 | |||
| 1596 | Ga0207669_10103904 | |||
| 1597 | Ga0207704_10006922 | |||
| 1598 | Ga0207665_10000042 | |||
| 1599 | Ga0207691_10003393 | |||
| 1600 | Ga0207691_10026592 | |||
| 1601 | Ga0207691_10133230 | |||
| 1602 | Ga0207691_10159073 | |||
| 1603 | Ga0207711_10093544 | |||
| 1604 | Ga0207711_10119835 | |||
| 1605 | Ga0207711_10427272 | |||
| 1606 | Ga0207689_10006317 | |||
| 1607 | Ga0207689_10008002 | |||
| 1608 | Ga0207661_10135971 | |||
| 1609 | Ga0207661_10179836 | |||
| 1610 | Ga0207679_10027846 | |||
| 1611 | Ga0207679_10193649 | |||
| 1612 | Ga0207667_10000345 | |||
| 1613 | Ga0207667_10001085 | |||
| 1614 | Ga0207667_10001211 | |||
| 1615 | Ga0207667_10026140 | |||
| 1616 | Ga0207667_10039969 | |||
| 1617 | Ga0207667_10040481 | |||
| 1618 | Ga0207667_10116328 | |||
| 1619 | Ga0207667_10176813 | |||
| 1620 | Ga0207667_10236858 | |||
| 1621 | Ga0207667_10372985 | |||
| 1622 | Ga0207667_10595232 | |||
| 1623 | Ga0207651_10004824 | |||
| 1624 | Ga0207651_10150150 | |||
| 1625 | Ga0207651_10266063 | |||
| 1626 | Ga0207712_10032292 | |||
| 1627 | Ga0207712_10033427 | |||
| 1628 | Ga0207712_10062190 | |||
| 1629 | Ga0207668_10010113 | |||
| 1630 | Ga0207668_10460130 | |||
| 1631 | Ga0207640_10006790 | |||
| 1632 | Ga0207640_10010335 | |||
| 1633 | Ga0207640_10067856 | |||
| 1634 | Ga0207640_10083057 | |||
| 1635 | Ga0207640_10394199 | |||
| 1636 | Ga0207640_11067373 | |||
| 1637 | Ga0207658_10008384 | |||
| 1638 | Ga0207658_10068140 | |||
| 1639 | Ga0207658_10154746 | |||
| 1640 | Ga0207658_10561662 | |||
| 1641 | Ga0207677_10148177 | |||
| 1642 | Ga0207703_10182255 | |||
| 1643 | Ga0207639_10000966 | |||
| 1644 | Ga0207639_10326840 | |||
| 1645 | Ga0207639_10415514 | |||
| 1646 | Ga0207639_10463645 | |||
| 1647 | Ga0207678_10000433 | |||
| 1648 | Ga0207678_10002093 | |||
| 1649 | Ga0207678_10003959 | |||
| 1650 | Ga0207678_10006255 | |||
| 1651 | Ga0207678_10272292 | |||
| 1652 | Ga0207702_10001044 | |||
| 1653 | Ga0207702_10001779 | |||
| 1654 | Ga0207702_10046358 | |||
| 1655 | Ga0207702_10225834 | |||
| 1656 | Ga0207641_10052499 | |||
| 1657 | Ga0207641_10103588 | |||
| 1658 | Ga0207641_10143226 | |||
| 1659 | Ga0207641_10147600 | |||
| 1660 | Ga0207641_11006092 | |||
| 1661 | Ga0207648_10004786 | |||
| 1662 | Ga0207648_10007984 | |||
| 1663 | Ga0207648_10008110 | |||
| 1664 | Ga0207648_10010341 | |||
| 1665 | Ga0207648_10302952 | |||
| 1666 | Ga0207648_10890250 | |||
| 1667 | Ga0207676_10010629 | |||
| 1668 | Ga0207676_10064557 | |||
| 1669 | Ga0207674_10000273 | |||
| 1670 | Ga0207674_10004485 | |||
| 1671 | Ga0207674_10008990 | |||
| 1672 | Ga0207674_10020139 | |||
| 1673 | Ga0207674_10036289 | |||
| 1674 | Ga0207674_10047647 | |||
| 1675 | Ga0207674_10468862 | |||
| 1676 | Ga0207674_10599366 | |||
| 1677 | Ga0207675_100001089 | |||
| 1678 | Ga0207675_100004426 | |||
| 1679 | Ga0207675_100005279 | |||
| 1680 | Ga0207675_100006779 | |||
| 1681 | Ga0207675_100181510 | |||
| 1682 | Ga0207683_10004164 | |||
| 1683 | Ga0207683_10023322 | |||
| 1684 | Ga0207683_10093231 | |||
| 1685 | Ga0207683_10163637 | |||
| 1686 | Ga0207683_10182007 | |||
| 1687 | Ga0207683_10336236 | |||
| 1688 | Ga0207683_10518320 | |||
| 1689 | Ga0207683_10792173 | |||
| 1690 | Ga0207698_10007069 | |||
| 1691 | Ga0207698_10008997 | |||
| 1692 | Ga0207698_10010525 | |||
| 1693 | Ga0207698_10042887 | |||
| 1694 | Ga0207698_10049534 | |||
| 1695 | Ga0207698_10115869 | |||
| 1696 | Ga0207698_10198933 | |||
| 1697 | Ga0207698_10307357 | |||
| 1698 | Ga0209983_1056901 | |||
| 1699 | Ga0207428_10013564 | |||
| 1700 | Ga0207428_10068093 | |||
| 1701 | Ga0207428_10070074 | |||
| 1702 | Ga0268266_10030768 | |||
| 1703 | Ga0268266_10266789 | |||
| 1704 | Ga0268266_10362180 | |||
| 1705 | Ga0268265_10000805 | |||
| 1706 | Ga0268265_10005872 | |||
| 1707 | Ga0268265_10462446 | |||
| 1708 | Ga0268264_10005552 | |||
| 1709 | Ga0268264_10247534 | |||
| 1710 | Ga0268264_10278562 | |||
| 1711 | Ga0268264_10417134 | |||
| 1712 | Ga0265334_10019089 | |||
| 1713 | Ga0265318_10121158 | |||
| 1714 | Ga0307517_10146576 | |||
| 1715 | Ga0307515_10002080 | |||
| 1716 | Ga0307515_10008408 | |||
| 1717 | Ga0265324_10007296 | |||
| 1718 | Ga0265760_10041754 | |||
| 1719 | Ga0265339_10036673 | |||
| 1720 | Ga0265327_10137220 | |||
| 1721 | Ga0265316_10109747 | |||
| 1722 | Ga0265316_10171292 | |||
| 1723 | Ga0307513_10001806 | |||
| 1724 | Ga0307513_10031824 | |||
| 1725 | Ga0307408_100014143 | |||
| 1726 | Ga0307408_100130969 | |||
| 1727 | Ga0307408_100271297 | |||
| 1728 | Ga0307408_100299796 | |||
| 1729 | Ga0307408_100350618 | |||
| 1730 | Ga0265313_10021899 | |||
| 1731 | Ga0316576_10002152 | |||
| 1732 | Ga0316578_10164209 | |||
| 1733 | Ga0307516_10000797 | |||
| 1734 | Ga0307516_10001904 | |||
| 1735 | Ga0307516_10049734 | |||
| 1736 | Ga0307516_10187809 | |||
| 1737 | Ga0307516_10214012 | |||
| 1738 | Ga0307405_10122852 | |||
| 1739 | Ga0307405_10329872 | |||
| 1740 | Ga0307405_10332458 | |||
| 1741 | Ga0307413_10118860 | |||
| 1742 | Ga0307413_10333669 | |||
| 1743 | Ga0307413_10871774 | |||
| 1744 | Ga0307410_10143841 | |||
| 1745 | Ga0307406_10119220 | |||
| 1746 | Ga0307406_10245082 | |||
| 1747 | Ga0307406_10332930 | |||
| 1748 | Ga0307406_10338607 | |||
| 1749 | Ga0307412_10133198 | |||
| 1750 | Ga0307412_10231002 | |||
| 1751 | Ga0307412_10693182 | |||
| 1752 | Ga0307409_100081424 | |||
| 1753 | Ga0307409_100241466 | |||
| 1754 | Ga0307409_100852293 | |||
| 1755 | Ga0307409_100867189 | |||
| 1756 | Ga0307416_100019971 | |||
| 1757 | Ga0307416_100059552 | |||
| 1758 | Ga0307416_100398454 | |||
| 1759 | Ga0307416_100491110 | |||
| 1760 | Ga0307416_100678130 | |||
| 1761 | Ga0307416_100679045 | |||
| 1762 | Ga0307416_100816053 | |||
| 1763 | Ga0307416_101167886 | |||
| 1764 | Ga0307414_10480838 | |||
| 1765 | Ga0307411_10043040 | |||
| 1766 | Ga0307411_10117914 | |||
| 1767 | Ga0307411_10137033 | |||
| 1768 | Ga0307411_10139804 | |||
| 1769 | Ga0307411_10328699 | |||
| 1770 | Ga0307411_10344638 | |||
| 1771 | Ga0307411_10549234 | |||
| 1772 | Ga0307411_10838209 | |||
| 1773 | Ga0307415_100006199 | |||
| 1774 | Ga0307415_100171287 | |||
| 1775 | Ga0373959_0009269 | |||
| 1776 | Ga0373928_0009176 | |||
| 1777 | Ga0373934_0012855 | |||
| 1778 | Ga0373949_0009262 | |||
| 1779 | Ga0373954_0025981 | |||
| 1780 | Ga0373955_0017445 | |||
| 1781 | Ga0373955_0036342 | |||
| 1782 | Ga0373955_0453097 | |||
| 1783 | Ga0316574_0246926 | |||
| 1784 | Ga0316574_0256571 | |||
| 1785 | Ga0373931_0001412 | |||
| 1786 | Ga0373931_0086753 | |||
| 1787 | Ga0373935_0182821 | |||
| 1788 | Ga0373927_0059099 | |||
| 1789 | Ga0373947_0536650 | |||
| 1790 | Ga0373937_0050565 | |||
| 1791 | Ga0373937_0143427 | |||
| 1792 | Ga0372808_006155 | |||
| 1793 | Ga0316582_0065628 | |||
| 1794 | Ga0316584_0119065 | |||
| 1795 | Ga0316584_0322216 | |||
| 1796 | Ga0373925_0535672 | |||
| 1797 | Ga0373925_0554038 | |||
| 1798 | Ga0395900_0034230 | |||
| 1799 | Ga0395898_0508422 | |||
| 1800 | Ga0395905_0013842 | |||
| 1801 | Ga0395905_0254786 | |||
| 1802 | Ga0395905_0547817 | |||
| 1803 | Ga0436364_1162620 | |||
| 1804 | Ga0395901_0162594 | |||
| 1805 | Ga0400490_01085 | |||
| 1806 | Ga0400485_08748 | |||
| 1807 | Ga0400488_37204 | |||
| 1808 | Ga0400486_10215 | |||
| 1809 | Ga0400486_17669 | |||
| 1810 | Ga0400483_123864 | |||
| 1811 | Ga0400483_139687 | |||
| 1812 | Ga0400483_163400 | |||
| 1813 | Ga0400483_215046 | |||
| 1814 | Ga0400489_63320 | |||
| 1815 | Ga0400487_27921 | |||
| 1816 | Ga0436365_0254146 | |||
| 1817 | Ga0436360_1100593 | |||
| 1818 | Ga0436361_0060173 | |||
| 1819 | Ga0436361_0471013 | |||
| 1820 | Ga0436361_0530365 | |||
| 1821 | Ga0436361_0565711 | |||
| 1822 | Ga0436361_0965385 | |||
| 1823 | Ga0436361_1185928 | |||
| 1824 | Ga0439436_0130741 | |||
| 1825 | Ga0439461_0005492 | |||
| 1826 | Ga0439461_0014830 | |||
| 1827 | Ga0451797_0567997 | |||
| 1828 | Ga0451802_1012494 | |||
| 1829 | Ga0451853_1252851 | |||
| 1830 | Ga0439431_0016232 | |||
| 1831 | Ga0439441_003495 | |||
| 1832 | Ga0439441_007738 | |||
| 1833 | Ga0439441_015568 | |||
| 1834 | Ga0439448_0096392 | |||
| 1835 | Ga0439432_029230 | |||
| 1836 | Ga0450913_004596 | |||
| 1837 | Ga0450921_000102 | |||
| 1838 | Ga0450923_006970 | |||
| 1839 | Ga0450895_004740 | |||
| 1840 | Ga0450896_000112 | |||
| 1841 | Ga0450898_000545 | |||
| 1842 | Ga0450899_004524 | |||
| 1843 | Ga0450906_008259 | |||
| 1844 | Ga0450910_001893 | |||
| 1845 | Ga0439446_0000024 | |||
| 1846 | Ga0450908_000686 | |||
| 1847 | Ga0439434_0000267 | |||
| 1848 | Ga0439435_0001268 | |||
| 1849 | Ga0439459_0057446 | |||
| 1850 | Ga0451577_0001918 | |||
| 1851 | Ga0451577_0002661 | |||
| 1852 | Ga0451577_0004478 | |||
| 1853 | Ga0451577_0191942 | |||
| 1854 | Ga0466969_0022687 | |||
| 1855 | Ga0466966_0415936 | |||
| 1856 | Ga0466961_0035962 | |||
| 1857 | Ga0466963_0051835 | |||
| 1858 | Ga0453684_0017824 | |||
| 1859 | Ga0453684_0026121 | |||
| 1860 | Ga0453684_0215251 | |||
| 1861 | Ga0466971_0014993 | |||
| 1862 | Ga0466959_0226169 | |||
| 1863 | Ga0451576_0002092 | |||
| 1864 | Ga0466967_0008702 | |||
| 1865 | Ga0466967_0485303 | |||
| 1866 | Ga0495617_000003 | |||
| 1867 | Ga0495592_0001784 | |||
| 1868 | Ga0495603_0178836 | |||
| 1869 | Ga0495590_0158661 | |||
| 1870 | Ga0495638_0000752 | |||
| 1871 | Ga0495638_0129308 | |||
| 1872 | Ga0495653_0000024 | |||
| 1873 | Ga0495653_0007107 | |||
| 1874 | Ga0495650_0000390 | |||
| 1875 | Ga0495650_0010380 | |||
| 1876 | Ga0495650_0031404 | |||
| 1877 | Ga0495580_0235388 | |||
| 1878 | Ga0495639_0238362 | |||
| 1879 | Ga0495585_0002560 | |||
| 1880 | Ga0495606_0000095 | |||
| 1881 | Ga0495606_0000943 | |||
| 1882 | Ga0495608_0007220 | |||
| 1883 | Ga0495608_0108954 | |||
| 1884 | Ga0495610_0000003 | |||
| 1885 | Ga0495610_0131070 | |||
| 1886 | Ga0495620_0044494 | |||
| 1887 | Ga0495620_0095830 | |||
| 1888 | Ga0495628_0031874 | |||
| 1889 | Ga0495632_0054710 | |||
| 1890 | Ga0495637_0000629 | |||
| 1891 | Ga0495643_0108191 | |||
| 1892 | Ga0495648_0005405 | |||
| 1893 | Ga0495648_0012398 | |||
| 1894 | Ga0495648_0110281 | |||
| 1895 | Ga0495654_0000176 | |||
| 1896 | Ga0495654_0010995 | |||
| 1897 | Ga0495598_0031383 | |||
| 1898 | Ga0495645_0092227 | |||
| 1899 | Ga0495668_0000214 | |||
| 1900 | Ga0495668_0259721 | |||
| 1901 | Ga0495634_0254221 | |||
| 1902 | Ga0495625_0004050 | |||
| 1903 | Ga0495625_0018166 | |||
| 1904 | Ga0495625_0043874 | |||
| 1905 | Ga0495635_0142577 | |||
| 1906 | Ga0495659_0094099 | |||
| 1907 | Ga0495661_0401437 | |||
| 1908 | Ga0495657_0096564 | |||
| 1909 | Ga0495599_0003264 | |||
| 1910 | Ga0495599_0157910 | |||
| 1911 | Ga0495623_0016399 | |||
| 1912 | Ga0495671_0000010 | |||
| 1913 | Ga0495671_0017033 | |||
| 1914 | Ga0495600_0003322 | |||
| 1915 | Ga0495660_0011334 | |||
| 1916 | Ga0495604_0011292 | |||
| 1917 | Ga0495676_0153508 | |||
| 1918 | Ga0495680_0025428 | |||
| 1919 | Ga0495683_0001772 | |||
| 1920 | Ga0495679_024300 | |||
| 1921 | Ga0495673_0000003 | |||
| 1922 | Ga0495673_0000016 | |||
| 1923 | Ga0495686_0055983 | |||
| 1924 | Ga0496100_0168469 | |||
| 1925 | Ga0496101_0030610 | |||
| 1926 | Ga0496102_0013838 | |||
| 1927 | Ga0496102_0092148 | |||
| 1928 | Ga0496104_0007302 | |||
| 1929 | Ga0496104_0156374 | |||
| 1930 | Ga0496104_0284728 | |||
| 1931 | Ga0496105_0008827 | |||
| 1932 | Ga0496107_0195345 | |||
| 1933 | Ga0496108_0003054 | |||
| 1934 | Ga0496108_0341859 | |||
| 1935 | Ga0496109_0002176 | |||
| 1936 | Ga0496109_0244036 | |||
| 1937 | Ga0496110_0010236 | |||
| 1938 | Ga0496112_0094714 | |||
| 1939 | Ga0496113_0064178 | |||
| 1940 | Ga0496113_0160210 | |||
| 1941 | Ga0496114_0008854 | |||
| 1942 | Ga0496114_0429080 | |||
| 1943 | Ga0496115_0016687 | |||
| 1944 | Ga0496120_0076768 | |||
| 1945 | Ga0496121_0019583 | |||
| 1946 | Ga0496121_0100095 | |||
| 1947 | Ga0496121_0268238 | |||
| 1948 | Ga0496122_0031334 | |||
| 1949 | Ga0496122_0140118 | |||
| 1950 | Ga0496123_0002828 | |||
| 1951 | Ga0496126_0026686 | |||
| 1952 | Ga0501292_000657 | |||
| 1953 | Ga0501298_004393 | |||
| 1954 | Ga0501031_0046495 | |||
| 1955 | Ga0501032_0020823 | |||
| 1956 | Ga0501032_0233521 | |||
| 1957 | Ga0501033_0153859 | |||
| 1958 | Ga0501033_0167882 | |||
| 1959 | Ga0501033_0620417 | |||
| 1960 | Ga0501034_1350719 | |||
| 1961 | Ga0501036_0035446 | |||
| 1962 | Ga0501036_0049741 | |||
| 1963 | Ga0501036_0079251 | |||
| 1964 | Ga0501036_0157205 | |||
| 1965 | Ga0501036_0171190 | |||
| 1966 | Ga0501038_0126200 | |||
| 1967 | Ga0501038_0379146 | |||
| 1968 | Ga0501038_0393978 | |||
| 1969 | Ga0501038_0540625 | |||
| 1970 | Ga0501039_0039218 | |||
| 1971 | Ga0501039_0457512 | |||
| 1972 | Ga0501039_0458331 | |||
| 1973 | Ga0501040_0061443 | |||
| 1974 | Ga0501040_0198749 | |||
| 1975 | Ga0501040_0264136 | |||
| 1976 | Ga0501041_0022378 | |||
| 1977 | Ga0501041_0083373 | |||
| 1978 | Ga0501041_0102175 | |||
| 1979 | Ga0501041_0285351 | |||
| 1980 | Ga0501042_0081267 | |||
| 1981 | Ga0501043_0255248 | |||
| 1982 | Ga0501046_0119948 | |||
| 1983 | Ga0501046_0314185 | |||
| 1984 | Ga0501047_0005265 | |||
| 1985 | Ga0501047_0021596 | |||
| 1986 | Ga0501047_0071329 | |||
| 1987 | Ga0501047_0088358 | |||
| 1988 | Ga0501047_0171272 | |||
| 1989 | Ga0501048_0032943 | |||
| 1990 | Ga0501068_0009016 | |||
| 1991 | Ga0501068_0062373 | |||
| 1992 | Ga0501069_0001761 | |||
| 1993 | Ga0501069_0017402 | |||
| 1994 | Ga0501069_0075416 | |||
| 1995 | Ga0501069_0099890 | |||
| 1996 | Ga0501070_0004313 | |||
| 1997 | Ga0501070_0009412 | |||
| 1998 | Ga0501070_0014787 | |||
| 1999 | Ga0501070_0021328 | |||
| 2000 | Ga0501070_0093292 | |||
| 2001 | Ga0501070_0335463 | |||
| 2002 | Ga0501070_0446162 | |||
| 2003 | Ga0501070_0676267 | |||
| 2004 | Ga0501071_0021301 | |||
| 2005 | Ga0501071_0095978 | |||
| 2006 | Ga0501071_0215193 | |||
| 2007 | Ga0501071_0460649 | |||
| 2008 | Ga0501072_0035428 | |||
| 2009 | Ga0501072_0072438 | |||
| 2010 | Ga0501072_0209740 | |||
| 2011 | Ga0501073_0006354 | |||
| 2012 | Ga0501073_0024901 | |||
| 2013 | Ga0501073_0027836 | |||
| 2014 | Ga0501073_0241663 | |||
| 2015 | Ga0501074_0011463 | |||
| 2016 | Ga0501074_0022795 | |||
| 2017 | Ga0501074_0134070 | |||
| 2018 | Ga0501074_0145435 | |||
| 2019 | Ga0501075_0032546 | |||
| 2020 | Ga0501075_0152383 | |||
| 2021 | Ga0501075_0158966 | |||
| 2022 | Ga0501076_0008726 | |||
| 2023 | Ga0501076_0046180 | |||
| 2024 | Ga0501076_0077583 | |||
| 2025 | Ga0501076_0152961 | |||
| 2026 | Ga0501076_0183453 | |||
| 2027 | Ga0501076_0539806 | |||
| 2028 | Ga0501077_0126411 | |||
| 2029 | Ga0501077_0174103 | |||
| 2030 | Ga0501077_0224367 | |||
| 2031 | Ga0501233_034387 | |||
| 2032 | Ga0501249_012407 | |||
| 2033 | Ga0501079_0084937 | |||
| 2034 | Ga0501079_0129407 | |||
| 2035 | Ga0501079_0212214 | |||
| 2036 | Ga0501079_0467973 | |||
| 2037 | Ga0501080_0018849 | |||
| 2038 | Ga0501080_0025134 | |||
| 2039 | Ga0501080_0046250 | |||
| 2040 | Ga0501080_0058090 | |||
| 2041 | Ga0501080_0071775 | |||
| 2042 | Ga0501080_0101741 | |||
| 2043 | Ga0501080_0296701 | |||
| 2044 | Ga0501080_0656866 | |||
| 2045 | Ga0501081_0007215 | |||
| 2046 | Ga0501081_0221058 | |||
| 2047 | Ga0501081_0232043 | |||
| 2048 | Ga0501081_0298154 | |||
| 2049 | Ga0501083_0003965 | |||
| 2050 | Ga0501083_0013521 | |||
| 2051 | Ga0501083_0467349 | |||
| 2052 | Ga0501265_001666 | |||
| 2053 | Ga0501268_009701 | |||
| 2054 | Ga0501035_0096487 | |||
| 2055 | Ga0501035_0140248 | |||
| 2056 | Ga0501035_0268645 | |||
| 2057 | Ga0501035_0275562 | |||
| 2058 | Ga0501035_0463960 | |||
| 2059 | Ga0501035_0468218 | |||
| 2060 | Ga0501044_0009149 | |||
| 2061 | Ga0501044_0014207 | |||
| 2062 | Ga0501044_0067653 | |||
| 2063 | Ga0501044_0230367 | |||
| 2064 | Ga0501044_0235341 | |||
| 2065 | Ga0501045_0061156 | |||
| 2066 | Ga0501045_0477364 | |||
| 2067 | nmdc:mga0k408_100917_c1 | |||
| 2068 | nmdc:mga0k408_280480_c1 | |||
| 2069 | nmdc:mga0k408_29621_c1 | |||
| 2070 | nmdc:mga06z11_179751_c1 | |||
| 2071 | nmdc:mga07m45_110075_c1 | |||
| 2072 | nmdc:mga07m45_51881_c1 | |||
| 2073 | nmdc:mga05p37_321469_c1 | |||
| 2074 | nmdc:mga05p37_757745_c1 | |||
| 2075 | nmdc:mga09592_295067_c1 | |||
| 2076 | nmdc:mga09592_94004_c1 | |||
| 2077 | nmdc:mga0qj67_13140_c1 | |||
| 2078 | nmdc:mga0qj67_659753_c1 | |||
| 2079 | nmdc:mga0qj67_685365_c1 | |||
| 2080 | nmdc:mga06r32_162765_c1 | |||
| 2081 | nmdc:mga06r32_294_c1 | |||
| 2082 | nmdc:mga06r32_299864_c1 | |||
| 2083 | nmdc:mga08y16_116514_c1 | |||
| 2084 | nmdc:mga08y16_368907_c1 | |||
| 2085 | nmdc:mga08y16_4964_c1 | |||
| 2086 | nmdc:mga0n895_123601_c1 | |||
| 2087 | nmdc:mga0n895_1253215_c1 | |||
| 2088 | nmdc:mga0n895_1426_c1 | |||
| 2089 | nmdc:mga0n895_748600_c1 | |||
| 2090 | nmdc:mga08x19_298145_c1 | |||
| 2091 | nmdc:mga08x19_481153_c1 | |||
| 2092 | nmdc:mga0a205_101383_c1 | |||
| 2093 | Ga0500578_0000549 | |||
| 2094 | Ga0500647_0133959 | |||
| 2095 | Ga0500555_035799 | |||
| 2096 | Ga0500618_000236 | |||
| 2097 | Ga0500652_001792 | |||
| 2098 | Ga0500658_0030291 | |||
| 2099 | Ga0500574_000670 | |||
| 2100 | Ga0500619_000446 | |||
| 2101 | Ga0500587_001275 | |||
| 2102 | Ga0501084_1069356 | |||
| 2103 | Ga0590071_000328 | |||
| 2104 | Ga0590071_004548 | |||
| 2105 | Ga0501082_0368361 | |||
| 2106 | Ga0501082_0550091 | |||
| 2107 | Ga0530510_0132082 | |||
| 2108 | Ga0530510_0179691 | |||
| 2109 | Ga0530510_0284289 | |||
| 2110 | 2587725876 | |||
| 2111 | 2587736167 | |||
| 2112 | 2588292910 | |||
| 2113 | 2643968019 | |||
| 2114 | 2644143057 | |||
| 2115 | 2644271855 | |||
| 2116 | 2738829996 | |||
| 2117 | 2739153792 | |||
| 2118 | 2739195712 | |||
| 2119 | 2739322188 | |||
| 2120 | 2739340429 | |||
| 2121 | 2819541588 | |||
| 2122 | 2821131939 | |||
| 2123 | 2849666822 | |||
| 2124 | 2857568604 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5log-assembly1.cif.gz_A | crystal structure of safc from myxococcus xanthus bound to sam | 0.9617 | 7 | 220 |
| 3tr6-assembly1.cif.gz_A-2 | structure of a o-methyltransferase from coxiella burnetii | 0.9608 | 8 | 220 |
| 2hnk-assembly1.cif.gz_C | crystal structure of sam-dependent o-methyltransferase from pathogenic bacterium leptospira interrogans | 0.9567 | 7 | 219 |
| 3cbg-assembly1.cif.gz_A-2 | functional and structural characterization of a cationdependent o-methyltransferase from the cyanobacterium synechocystis sp. strain pcc 6803 | 0.9509 | 7 | 219 |
| 5log-assembly1.cif.gz_B | crystal structure of safc from myxococcus xanthus bound to sam | 0.9467 | 7 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3cbgA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9509 | 7 | 219 | 3.40.50.150 |
| af_Q9M266_77_290_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9485 | 7 | 219 | 3.40.50.150 |
| 2hnkB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9467 | 7 | 219 | 3.40.50.150 |
| af_Q86IC9_10_229_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9466 | 7 | 218 | 3.40.50.150 |
| 3tr6A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9454 | 8 | 220 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A524NPL2-F1-model_v4 | SAM-dependent methyltransferase | 0.9872 | 53 | 219 |
GO:0008171
GO:0008757 GO:0032259 |
| AF-A0A7V8X194-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9857 | 7 | 219 |
GO:0008171
GO:0008757 GO:0032259 |
| AF-A0A2V9S2S9-F1-model_v4 | O-methyltransferase | 0.9833 | 119 | 219 |
GO:0008171
GO:0008757 GO:0032259 |
| AF-A0A0M9XNL3-F1-model_v4 | SAM-dependent methyltransferase | 0.9809 | 14 | 219 |
GO:0008171
GO:0008757 GO:0032259 |
| AF-A0A2I7SX51-F1-model_v4 | deleted | 0.9785 | 44 | 220 |
|