F489256

General Info

Members Datasets Scaffolds Average Seq Length
1059 506 2118 175

Family's Representative Sequence

Representative Sequence 3300047444|Ga0495675_0231113|Ga0495675_0231113_38_661
Length 207
Sequence MVNVNQRFVVNATLTSADGALTPANQQLKSPVMAIREIIILPDKKLRLVSKPVEKVTTEVRKLADDMLETMYDAPGIGLAAIQVAQPLRLITMDLAKRDEDGESKPRPRVFINPEILSSSEELSVYEEGCLSIPEYYEEVERPAQVRVRFTDLDGKVHEEDADGLFATCIQHEIDHLNGVLFVDYLSKLKRDRVLKKFAKAAKRGAE

Samples

Sample ID Description Type Environment
1 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
146 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
147 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
148 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
149 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
150 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
151 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
152 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
154 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
222 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
227 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
234 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
235 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
236 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
237 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
238 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
239 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
240 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
241 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
246 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
247 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
248 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
249 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
250 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
252 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
253 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
257 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
261 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
265 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
266 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
267 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
272 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
273 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
274 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
275 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
276 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
277 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
278 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
279 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
280 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
281 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
282 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
283 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
284 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
285 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
286 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
287 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
288 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
289 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
290 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
291 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
294 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
295 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
296 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
297 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
298 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
299 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
300 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
303 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
304 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
305 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
306 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
307 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
308 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
309 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
310 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
311 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
312 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
313 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
316 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
317 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
318 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
319 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
320 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
321 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
322 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
323 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
324 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
325 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
326 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
327 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
328 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
329 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
330 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
333 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
334 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
335 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
336 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
337 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
338 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
339 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
340 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
341 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
342 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
343 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
346 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
347 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
348 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
349 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
350 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
351 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
352 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
353 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
354 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
355 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
356 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
357 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
358 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
359 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
360 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
361 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
362 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
363 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
364 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
365 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
366 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
367 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
368 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
369 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
370 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
371 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
372 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
373 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
374 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
375 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
376 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
377 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
378 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
379 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
380 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
381 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
392 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
393 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
394 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
395 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
396 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
397 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
398 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
399 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
400 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
401 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
403 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
404 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
405 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
406 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
407 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
408 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
409 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
410 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
411 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
412 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
413 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
414 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
415 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
416 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
417 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
418 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
419 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
420 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
421 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
422 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
423 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
424 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
425 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
426 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
427 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
428 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
429 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
430 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
431 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
432 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
433 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
434 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
435 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
436 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
437 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
438 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
439 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
440 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
441 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
442 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
443 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
444 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
445 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
446 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
447 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
448 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
449 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
450 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
451 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
452 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
453 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
454 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
455 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
456 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
457 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
458 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
459 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
460 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
461 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
462 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
463 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
464 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
465 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
466 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
467 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
468 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
469 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
470 2791355199
471 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
472 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
473 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
474 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
475 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
476 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
477 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
478 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
479 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
480 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
481 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
482 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
483 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
484 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
485 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
486 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
487 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
488 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
489 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
490 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
491 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
492 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
493 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
494 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
495 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
496 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
497 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
498 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
499 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
500 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
501 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
502 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
503 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
504 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
505 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
506 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.22
Metatranscriptomes 0
Isolates 3.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.13
Nodule 2.17
Rhizoplane 6.7
Rhizosphere 72.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495675_0231113 3300047444 Bacteria 1116
2 LJQas_1019141 3300000549 Bacteria 796
3 JGI24752J21851_1005869 3300001976 Bacteria 1604
4 JGI24746J21847_1011045 3300001977 Bacteria 1330
5 JGI24737J22298_10008476 3300001990 Bacteria 3437
6 JGI24750J21931_1000922 3300002070 Bacteria 3942
7 JGI24738J21930_10008035 3300002075 Bacteria 2411
8 JGI24749J21850_1024206 3300002076 Bacteria 864
9 JGI24744J21845_10043646 3300002077 Bacteria 835
10 JGI24033J26618_1001210 3300002155 Bacteria 2525
11 JGI25153J46596_10000737 3300003215 Bacteria 20058
12 JGI25153J46596_10003367 3300003215 Bacteria 8974
13 JGI25153J46596_10007257 3300003215 Bacteria 5482
14 JGI25404J52841_10039382 3300003659 Bacteria 1001
15 JGI25404J52841_10064614 3300003659 Bacteria 766
16 Ga0055525_1013893 3300003759 Bacteria 682
17 Ga0055531_10001561 3300003794 Bacteria 16764
18 Ga0065165_1004470 3300005262 Bacteria 8633
19 Ga0065715_10519441 3300005293 Bacteria 765
20 Ga0065707_10311342 3300005295 Bacteria 984
21 Ga0070658_10040408 3300005327 Bacteria 3763
22 Ga0070658_10103592 3300005327 Bacteria 2354
23 Ga0070658_10126013 3300005327 Bacteria 2132
24 Ga0070676_10600534 3300005328 Bacteria 794
25 Ga0070676_10634820 3300005328 Bacteria 774
26 Ga0070683_100085584 3300005329 Bacteria 2955
27 Ga0070683_100152966 3300005329 Bacteria 2187
28 Ga0070683_100557080 3300005329 Bacteria 1096
29 Ga0070683_100801715 3300005329 Bacteria 903
30 Ga0070690_100201009 3300005330 Bacteria 1386
31 Ga0070670_100447081 3300005331 Bacteria 1145
32 Ga0068869_100071073 3300005334 Bacteria 2576
33 Ga0070666_10484592 3300005335 Bacteria 895
34 Ga0070666_11065192 3300005335 Bacteria 600
35 Ga0070680_100014124 3300005336 Bacteria 6237
36 Ga0070682_100101551 3300005337 Bacteria 1899
37 Ga0070682_100663854 3300005337 Bacteria 831
38 Ga0068868_100050413 3300005338 Bacteria 3269
39 Ga0068868_100112357 3300005338 Bacteria 2215
40 Ga0068868_100116439 3300005338 Bacteria 2176
41 Ga0070660_100008154 3300005339 Bacteria 7321
42 Ga0070660_100019496 3300005339 Bacteria 4972
43 Ga0070689_100002942 3300005340 Bacteria 11202
44 Ga0070689_100182200 3300005340 Bacteria 1706
45 Ga0070687_100002703 3300005343 Bacteria 6710
46 Ga0070687_100179264 3300005343 Bacteria 1268
47 Ga0070687_100216054 3300005343 Bacteria 1171
48 Ga0070661_100151852 3300005344 Bacteria 1751
49 Ga0070661_100186925 3300005344 Bacteria 1579
50 Ga0070661_100229711 3300005344 Bacteria 1426
51 Ga0070668_100068023 3300005347 Bacteria 2768
52 Ga0070668_100434053 3300005347 Bacteria 1126
53 Ga0070668_100462583 3300005347 Bacteria 1092
54 Ga0070669_100090274 3300005353 Bacteria 2296
55 Ga0070669_100117869 3300005353 Bacteria 2022
56 Ga0070669_100287673 3300005353 Bacteria 1318
57 Ga0070669_100370352 3300005353 Bacteria 1167
58 Ga0070669_100881864 3300005353 Bacteria 763
59 Ga0070675_100024783 3300005354 Bacteria 4805
60 Ga0070675_100125767 3300005354 Bacteria 2181
61 Ga0070675_100382114 3300005354 Bacteria 1254
62 Ga0070675_101265060 3300005354 Bacteria 680
63 Ga0070671_100024229 3300005355 Bacteria 4967
64 Ga0070671_100035120 3300005355 Bacteria 4153
65 Ga0070671_100134347 3300005355 Bacteria 2085
66 Ga0070671_100354839 3300005355 Bacteria 1252
67 Ga0070674_100006229 3300005356 Bacteria 6943
68 Ga0070674_100090970 3300005356 Bacteria 2202
69 Ga0070674_100235596 3300005356 Bacteria 1431
70 Ga0070673_100349037 3300005364 Bacteria 1313
71 Ga0070688_100001124 3300005365 Bacteria 13400
72 Ga0070688_100422871 3300005365 Bacteria 991
73 Ga0070659_100128256 3300005366 Bacteria 2058
74 Ga0070659_100190255 3300005366 Bacteria 1686
75 Ga0070659_100371883 3300005366 Bacteria 1202
76 Ga0070667_100016348 3300005367 Bacteria 6139
77 Ga0070709_10005348 3300005434 Bacteria 6954
78 Ga0070714_100017351 3300005435 Bacteria 5830
79 Ga0070714_100062176 3300005435 Bacteria 3208
80 Ga0070713_100015040 3300005436 Bacteria 5765
81 Ga0070713_100136923 3300005436 Bacteria 2165
82 Ga0070713_100822854 3300005436 Bacteria 891
83 Ga0070711_100011236 3300005439 Bacteria 5553
84 Ga0070711_100023790 3300005439 Bacteria 3990
85 Ga0070705_101089872 3300005440 Bacteria 653
86 Ga0070700_100008667 3300005441 Bacteria 5546
87 Ga0070700_100290350 3300005441 Bacteria 1189
88 Ga0070700_100295802 3300005441 Bacteria 1180
89 Ga0070694_100262922 3300005444 Bacteria 1309
90 Ga0070708_100114274 3300005445 Bacteria 2484
91 Ga0070708_100367486 3300005445 Bacteria 1356
92 Ga0070708_100383409 3300005445 Bacteria 1325
93 Ga0070663_100020693 3300005455 Bacteria 4359
94 Ga0070663_100041353 3300005455 Bacteria 3232
95 Ga0070663_100164432 3300005455 Bacteria 1710
96 Ga0070663_100352724 3300005455 Bacteria 1191
97 Ga0070663_100865897 3300005455 Bacteria 778
98 Ga0070678_100080677 3300005456 Bacteria 2464
99 Ga0070678_100448487 3300005456 Bacteria 1130
100 Ga0070678_100864443 3300005456 Bacteria 825
101 Ga0070662_100009754 3300005457 Bacteria 6286
102 Ga0070662_100357014 3300005457 Bacteria 1198
103 Ga0070662_100491755 3300005457 Bacteria 1022
104 Ga0070662_100521835 3300005457 Bacteria 993
105 Ga0070681_10002469 3300005458 Bacteria 16935
106 Ga0068867_100003711 3300005459 Bacteria 10742
107 Ga0068867_100061978 3300005459 Bacteria 2778
108 Ga0068867_100288466 3300005459 Bacteria 1348
109 Ga0068867_100389346 3300005459 Bacteria 1173
110 Ga0070685_10061291 3300005466 Bacteria 2203
111 Ga0070706_100365343 3300005467 Bacteria 1345
112 Ga0070707_100273378 3300005468 Bacteria 1642
113 Ga0070707_100436227 3300005468 Bacteria 1270
114 Ga0070698_101167681 3300005471 Bacteria 719
115 Ga0070679_100051194 3300005530 Bacteria 4113
116 Ga0070679_100131720 3300005530 Bacteria 2481
117 Ga0070684_100262038 3300005535 Bacteria 1581
118 Ga0070684_100407077 3300005535 Bacteria 1255
119 Ga0070697_100592841 3300005536 Bacteria 974
120 Ga0068853_100018933 3300005539 Bacteria 5702
121 Ga0068853_100084410 3300005539 Bacteria 2782
122 Ga0068853_100107427 3300005539 Bacteria 2474
123 Ga0068853_100388308 3300005539 Bacteria 1305
124 Ga0070672_100406572 3300005543 Bacteria 1167
125 Ga0070672_100748254 3300005543 Bacteria 858
126 Ga0070686_100003108 3300005544 Bacteria 9102
127 Ga0070686_100162765 3300005544 Bacteria 1572
128 Ga0070696_100606975 3300005546 Bacteria 883
129 Ga0070693_100032489 3300005547 Bacteria 2871
130 Ga0070693_100521512 3300005547 Bacteria 846
131 Ga0070665_100221308 3300005548 Bacteria 1893
132 Ga0070665_100469705 3300005548 Bacteria 1268
133 Ga0070665_100999919 3300005548 Bacteria 849
134 Ga0070704_100848698 3300005549 Bacteria 819
135 Ga0068855_100051784 3300005563 Bacteria 4835
136 Ga0068855_100147390 3300005563 Bacteria 2678
137 Ga0068855_100352639 3300005563 Bacteria 1620
138 Ga0070664_100180215 3300005564 Bacteria 1877
139 Ga0070664_100237032 3300005564 Bacteria 1637
140 Ga0070664_100304013 3300005564 Bacteria 1442
141 Ga0070664_101111240 3300005564 Bacteria 745
142 Ga0068857_100027411 3300005577 Bacteria 5026
143 Ga0068854_100033796 3300005578 Bacteria 3566
144 Ga0068856_100142662 3300005614 Bacteria 2402
145 Ga0068856_100274979 3300005614 Bacteria 1700
146 Ga0068856_100633605 3300005614 Bacteria 1090
147 Ga0070702_100015597 3300005615 Bacteria 3882
148 Ga0068852_100010808 3300005616 Bacteria 6838
149 Ga0068852_100170876 3300005616 Bacteria 2037
150 Ga0068852_100233382 3300005616 Bacteria 1755
151 Ga0068852_100432081 3300005616 Bacteria 1300
152 Ga0068852_100635632 3300005616 Bacteria 1074
153 Ga0068859_100059034 3300005617 Bacteria 3865
154 Ga0068859_100565994 3300005617 Bacteria 1230
155 Ga0068859_100622028 3300005617 Bacteria 1172
156 Ga0068859_100772033 3300005617 Bacteria 1049
157 Ga0068864_100007700 3300005618 Bacteria 8870
158 Ga0068864_100087310 3300005618 Bacteria 2745
159 Ga0068864_100313834 3300005618 Bacteria 1470
160 Ga0068864_100973004 3300005618 Bacteria 841
161 Ga0068864_101205566 3300005618 Bacteria 755
162 Ga0068866_10026785 3300005718 Bacteria 2727
163 Ga0068866_10043317 3300005718 Bacteria 2245
164 Ga0068866_10281945 3300005718 Bacteria 1030
165 Ga0068861_100012230 3300005719 Bacteria 5983
166 Ga0068861_100094115 3300005719 Bacteria 2370
167 Ga0068861_100283598 3300005719 Bacteria 1427
168 Ga0068861_100414675 3300005719 Bacteria 1198
169 Ga0068861_100439200 3300005719 Bacteria 1167
170 Ga0068861_100577396 3300005719 Bacteria 1028
171 Ga0068851_10012901 3300005834 Bacteria 3948
172 Ga0068851_10174122 3300005834 Bacteria 1189
173 Ga0068851_10538718 3300005834 Bacteria 704
174 Ga0068870_10002489 3300005840 Bacteria 7684
175 Ga0068870_10079535 3300005840 Bacteria 1809
176 Ga0068863_100003083 3300005841 Bacteria 16468
177 Ga0068863_100335739 3300005841 Bacteria 1470
178 Ga0068863_100337783 3300005841 Bacteria 1465
179 Ga0068863_100725910 3300005841 Bacteria 988
180 Ga0068858_100010185 3300005842 Bacteria 8923
181 Ga0068858_100011517 3300005842 Bacteria 8345
182 Ga0068858_100192618 3300005842 Bacteria 1926
183 Ga0068858_100593988 3300005842 Bacteria 1074
184 Ga0068860_100022900 3300005843 Bacteria 6040
185 Ga0068860_100060834 3300005843 Bacteria 3588
186 Ga0068860_100137524 3300005843 Bacteria 2347
187 Ga0068860_100449991 3300005843 Bacteria 1280
188 Ga0068862_100172949 3300005844 Bacteria 1934
189 Ga0068862_100186660 3300005844 Bacteria 1863
190 Ga0068862_100327969 3300005844 Bacteria 1415
191 Ga0068862_100332346 3300005844 Bacteria 1405
192 Ga0068862_100691041 3300005844 Bacteria 988
193 Ga0081455_10005910 3300005937 Bacteria 13278
194 Ga0081538_10006470 3300005981 Bacteria 10310
195 Ga0081538_10035829 3300005981 Bacteria 3252
196 Ga0081540_1003256 3300005983 Bacteria 12900
197 Ga0081540_1004546 3300005983 Bacteria 10516
198 Ga0081540_1004899 3300005983 Bacteria 10082
199 Ga0081540_1004944 3300005983 Bacteria 10022
200 Ga0081540_1050482 3300005983 Bacteria 2065
201 Ga0081539_10017345 3300005985 Bacteria 5062
202 Ga0081539_10183910 3300005985 Bacteria 978
203 Ga0070717_10053842 3300006028 Bacteria 3317
204 Ga0070717_10085363 3300006028 Bacteria 2656
205 Ga0070717_10248513 3300006028 Bacteria 1570
206 Ga0075365_10005417 3300006038 Bacteria 6876
207 Ga0075365_10039804 3300006038 Bacteria 3063
208 Ga0075365_10096118 3300006038 Bacteria 2024
209 Ga0075365_10111844 3300006038 Bacteria 1877
210 Ga0075365_10131968 3300006038 Bacteria 1729
211 Ga0075365_10142558 3300006038 Bacteria 1664
212 Ga0075368_10003187 3300006042 Bacteria 5454
213 Ga0075368_10024060 3300006042 Bacteria 2330
214 Ga0075368_10058877 3300006042 Bacteria 1536
215 Ga0075368_10084416 3300006042 Bacteria 1294
216 Ga0075363_100001863 3300006048 Bacteria 8314
217 Ga0075363_100015726 3300006048 Bacteria 3725
218 Ga0075363_100023698 3300006048 Bacteria 3114
219 Ga0075364_10047455 3300006051 Bacteria 2797
220 Ga0075364_10113252 3300006051 Bacteria 1812
221 Ga0075364_10748760 3300006051 Bacteria 666
222 Ga0070715_10000196 3300006163 Bacteria 14161
223 Ga0070715_10020288 3300006163 Bacteria 2562
224 Ga0070716_100042171 3300006173 Bacteria 2546
225 Ga0070716_100098746 3300006173 Bacteria 1785
226 Ga0070712_100028551 3300006175 Bacteria 3733
227 Ga0070712_100654590 3300006175 Bacteria 893
228 Ga0075362_10029536 3300006177 Bacteria 2363
229 Ga0075362_10032797 3300006177 Bacteria 2256
230 Ga0075367_10006527 3300006178 Bacteria 5901
231 Ga0075367_10091932 3300006178 Bacteria 1846
232 Ga0075367_10134494 3300006178 Bacteria 1529
233 Ga0075367_10152079 3300006178 Bacteria 1436
234 Ga0075369_10216289 3300006186 Bacteria 886
235 Ga0075427_10033449 3300006194 Bacteria 850
236 Ga0075366_10018773 3300006195 Bacteria 3995
237 Ga0075366_10024591 3300006195 Bacteria 3513
238 Ga0075366_10059632 3300006195 Bacteria 2266
239 Ga0075366_10097012 3300006195 Bacteria 1768
240 Ga0075366_10116406 3300006195 Bacteria 1609
241 Ga0075366_10292781 3300006195 Bacteria 995
242 Ga0097621_100039899 3300006237 Bacteria 3772
243 Ga0097621_100168624 3300006237 Bacteria 1886
244 Ga0075370_10033038 3300006353 Bacteria 2895
245 Ga0075370_10078824 3300006353 Bacteria 1892
246 Ga0075370_10107167 3300006353 Bacteria 1620
247 Ga0075370_10193911 3300006353 Bacteria 1197
248 Ga0075370_10215347 3300006353 Bacteria 1134
249 Ga0068871_100004410 3300006358 Bacteria 9783
250 Ga0068871_100131718 3300006358 Bacteria 2121
251 Ga0068871_100291376 3300006358 Bacteria 1430
252 Ga0068871_100516188 3300006358 Bacteria 1078
253 Ga0075430_100379258 3300006846 Bacteria 1167
254 Ga0075430_100567676 3300006846 Bacteria 936
255 Ga0075431_100030106 3300006847 Bacteria 5589
256 Ga0075433_10756544 3300006852 Bacteria 850
257 Ga0075434_100102368 3300006871 Bacteria 2871
258 Ga0075434_100191044 3300006871 Bacteria 2068
259 Ga0075434_100216833 3300006871 Bacteria 1934
260 Ga0075434_100394474 3300006871 Bacteria 1405
261 Ga0075434_101014709 3300006871 Bacteria 844
262 Ga0068865_100191324 3300006881 Bacteria 1583
263 Ga0075436_100373887 3300006914 Bacteria 1030
264 Ga0075436_100672111 3300006914 Bacteria 766
265 Ga0097620_100059033 3300006931 Bacteria 3865
266 Ga0097620_100566030 3300006931 Bacteria 1230
267 Ga0097620_100622053 3300006931 Bacteria 1172
268 Ga0097620_100772021 3300006931 Bacteria 1049
269 Ga0075435_100610968 3300007076 Bacteria 946
270 Ga0099794_10093843 3300007265 Bacteria 1492
271 Ga0099794_10103944 3300007265 Bacteria 1419
272 Ga0105250_10016355 3300009092 Bacteria 3024
273 Ga0105250_10022806 3300009092 Bacteria 2523
274 Ga0105240_10042329 3300009093 Bacteria 5804
275 Ga0111539_10014441 3300009094 Bacteria 9855
276 Ga0111539_10372158 3300009094 Bacteria 1663
277 Ga0111539_10503200 3300009094 Bacteria 1411
278 Ga0105245_10031984 3300009098 Bacteria 4657
279 Ga0105245_10233758 3300009098 Bacteria 1779
280 Ga0105245_10280859 3300009098 Bacteria 1627
281 Ga0105245_10416111 3300009098 Bacteria 1346
282 Ga0105245_10440570 3300009098 Bacteria 1309
283 Ga0105247_10011457 3300009101 Bacteria 5345
284 Ga0105247_10351329 3300009101 Bacteria 1037
285 Ga0105247_10748934 3300009101 Bacteria 740
286 Ga0114129_10020394 3300009147 Bacteria 9429
287 Ga0114129_10108466 3300009147 Bacteria 3833
288 Ga0105243_10202574 3300009148 Bacteria 1741
289 Ga0105243_10323492 3300009148 Bacteria 1406
290 Ga0105241_10621766 3300009174 Bacteria 978
291 Ga0105242_10012498 3300009176 Bacteria 6536
292 Ga0105242_10031107 3300009176 Bacteria 4261
293 Ga0105242_11615687 3300009176 Bacteria 682
294 Ga0105248_10015423 3300009177 Bacteria 8423
295 Ga0105248_10315372 3300009177 Bacteria 1761
296 Ga0105248_10608009 3300009177 Bacteria 1233
297 Ga0105248_11235845 3300009177 Bacteria 845
298 Ga0105237_10023272 3300009545 Bacteria 6350
299 Ga0105237_10318264 3300009545 Bacteria 1559
300 Ga0105237_10482081 3300009545 Bacteria 1246
301 Ga0105238_10021495 3300009551 Bacteria 6572
302 Ga0105238_10051906 3300009551 Bacteria 4123
303 Ga0105238_10782148 3300009551 Bacteria 969
304 Ga0105249_10238364 3300009553 Bacteria 1797
305 Ga0105249_10878441 3300009553 Bacteria 963
306 Ga0099796_10062492 3300010159 Bacteria 1324
307 Ga0099796_10157405 3300010159 Bacteria 898
308 Ga0105239_10046833 3300010375 Bacteria 4738
309 Ga0105239_10269983 3300010375 Bacteria 1913
310 Ga0105239_10352127 3300010375 Bacteria 1663
311 Ga0105246_10114010 3300011119 Bacteria 1991
312 Ga0105246_10177478 3300011119 Bacteria 1637
313 Ga0105246_10299507 3300011119 Bacteria 1297
314 Ga0157329_1005633 3300012491 Bacteria 856
315 Ga0157371_10859408 3300013102 Bacteria 686
316 Ga0157369_10077855 3300013105 Bacteria 3554
317 Ga0157369_10868152 3300013105 Bacteria 926
318 Ga0157374_10013462 3300013296 Bacteria 7138
319 Ga0157374_10085907 3300013296 Bacteria 2993
320 Ga0157374_10259982 3300013296 Bacteria 1710
321 Ga0157374_10407854 3300013296 Bacteria 1356
322 Ga0157378_10280538 3300013297 Bacteria 1606
323 Ga0157378_10343811 3300013297 Bacteria 1455
324 Ga0157378_10675034 3300013297 Bacteria 1051
325 Ga0163162_10262957 3300013306 Bacteria 1857
326 Ga0163162_10279512 3300013306 Bacteria 1801
327 Ga0163162_10286805 3300013306 Bacteria 1778
328 Ga0163162_10438899 3300013306 Bacteria 1438
329 Ga0163162_10457842 3300013306 Bacteria 1407
330 Ga0163162_10678899 3300013306 Bacteria 1153
331 Ga0157372_10228028 3300013307 Bacteria 2159
332 Ga0157375_10186350 3300013308 Bacteria 2229
333 Ga0157375_10456447 3300013308 Bacteria 1443
334 Ga0163163_10041628 3300014325 Bacteria 4494
335 Ga0163163_10133509 3300014325 Bacteria 2523
336 Ga0157380_10007021 3300014326 Bacteria 7969
337 Ga0157380_10242152 3300014326 Bacteria 1627
338 Ga0157380_10341301 3300014326 Bacteria 1397
339 Ga0157377_10016568 3300014745 Bacteria 3793
340 Ga0157377_10051863 3300014745 Bacteria 2315
341 Ga0157377_10140760 3300014745 Bacteria 1482
342 Ga0157379_10004696 3300014968 Bacteria 11727
343 Ga0157379_10129008 3300014968 Bacteria 2275
344 Ga0157379_10237861 3300014968 Bacteria 1651
345 Ga0157379_10567334 3300014968 Bacteria 1057
346 Ga0157379_11497894 3300014968 Bacteria 656
347 Ga0157376_10121901 3300014969 Bacteria 2312
348 Ga0157376_10420854 3300014969 Bacteria 1296
349 Ga0157376_10594645 3300014969 Bacteria 1100
350 Ga0182006_1198536 3300015261 Bacteria 665
351 Ga0163161_10089265 3300017792 Bacteria 2280
352 Ga0163161_10147553 3300017792 Bacteria 1785
353 Ga0163161_10411532 3300017792 Bacteria 1086
354 Ga0163161_11096627 3300017792 Bacteria 684
355 Ga0214544_1039616 3300021320 Bacteria 1073
356 Ga0214542_1000007 3300021321 Bacteria 291816
357 Ga0214545_1000006 3300021324 Bacteria 291693
358 Ga0214543_1000009 3300021327 Bacteria 384302
359 Ga0213872_10016109 3300021361 Bacteria 3472
360 Ga0213874_10092689 3300021377 Bacteria 994
361 Ga0213871_10090806 3300021441 Bacteria 885
362 Ga0209563_107789 3300025230 Bacteria 1734
363 Ga0207425_1043328 3300025245 Bacteria 849
364 Ga0209026_1041610 3300025250 Bacteria 665
365 Ga0209758_1000015 3300025297 Bacteria 851943
366 Ga0209758_1000161 3300025297 Bacteria 154278
367 Ga0209758_1000798 3300025297 Bacteria 44669
368 Ga0209758_1005779 3300025297 Bacteria 9280
369 Ga0209758_1083386 3300025297 Bacteria 959
370 Ga0209256_1004114 3300025299 Bacteria 9418
371 Ga0209256_1017362 3300025299 Bacteria 2394
372 Ga0209256_1058012 3300025299 Bacteria 911
373 Ga0209257_1002985 3300025304 Bacteria 15399
374 Ga0209257_1023500 3300025304 Bacteria 2165
375 Ga0209257_1042064 3300025304 Bacteria 1351
376 Ga0207697_10123752 3300025315 Bacteria 1114
377 Ga0207656_10014586 3300025321 Bacteria 3031
378 Ga0207653_10066958 3300025885 Bacteria 1221
379 Ga0207682_10244041 3300025893 Bacteria 835
380 Ga0207642_10004596 3300025899 Bacteria 4459
381 Ga0207642_10336888 3300025899 Bacteria 886
382 Ga0207710_10004498 3300025900 Bacteria 6073
383 Ga0207688_10001290 3300025901 Bacteria 12987
384 Ga0207680_10260026 3300025903 Bacteria 1201
385 Ga0207647_10054075 3300025904 Bacteria 2471
386 Ga0207685_10107755 3300025905 Bacteria 1202
387 Ga0207645_10004676 3300025907 Bacteria 10075
388 Ga0207645_10102590 3300025907 Bacteria 1846
389 Ga0207645_10642676 3300025907 Bacteria 721
390 Ga0207643_10004180 3300025908 Bacteria 7781
391 Ga0207643_10049197 3300025908 Bacteria 2389
392 Ga0207643_10153459 3300025908 Bacteria 1382
393 Ga0207643_10323617 3300025908 Bacteria 963
394 Ga0207705_10027385 3300025909 Bacteria 4065
395 Ga0207705_10106100 3300025909 Bacteria 2071
396 Ga0207684_10034992 3300025910 Bacteria 4265
397 Ga0207654_10086174 3300025911 Bacteria 1903
398 Ga0207707_10033729 3300025912 Bacteria 4479
399 Ga0207707_10048847 3300025912 Bacteria 3686
400 Ga0207707_10200740 3300025912 Bacteria 1739
401 Ga0207695_10099522 3300025913 Bacteria 2905
402 Ga0207671_10120866 3300025914 Bacteria 2002
403 Ga0207671_10203634 3300025914 Bacteria 1546
404 Ga0207693_10031950 3300025915 Bacteria 4159
405 Ga0207693_10038564 3300025915 Bacteria 3761
406 Ga0207693_10052911 3300025915 Bacteria 3185
407 Ga0207663_10043583 3300025916 Bacteria 2748
408 Ga0207663_10418468 3300025916 Bacteria 1028
409 Ga0207660_10001899 3300025917 Bacteria 13916
410 Ga0207662_10003858 3300025918 Bacteria 7797
411 Ga0207662_10251888 3300025918 Bacteria 1159
412 Ga0207662_10286179 3300025918 Bacteria 1092
413 Ga0207657_10019726 3300025919 Bacteria 6393
414 Ga0207657_10092157 3300025919 Bacteria 2526
415 Ga0207657_10123396 3300025919 Bacteria 2129
416 Ga0207649_10723089 3300025920 Bacteria 773
417 Ga0207652_10029791 3300025921 Bacteria 4567
418 Ga0207652_10084520 3300025921 Bacteria 2780
419 Ga0207646_10059004 3300025922 Bacteria 3427
420 Ga0207646_10300157 3300025922 Bacteria 1451
421 Ga0207646_10613105 3300025922 Bacteria 976
422 Ga0207681_10013657 3300025923 Bacteria 5028
423 Ga0207681_10149121 3300025923 Bacteria 1750
424 Ga0207681_10254929 3300025923 Bacteria 1371
425 Ga0207694_10040064 3300025924 Bacteria 3606
426 Ga0207694_10334726 3300025924 Bacteria 1251
427 Ga0207659_10006187 3300025926 Bacteria 7324
428 Ga0207659_10104018 3300025926 Bacteria 2147
429 Ga0207687_10042558 3300025927 Bacteria 3126
430 Ga0207687_10059447 3300025927 Bacteria 2693
431 Ga0207687_10295179 3300025927 Bacteria 1304
432 Ga0207687_10626675 3300025927 Bacteria 908
433 Ga0207700_10006617 3300025928 Bacteria 7021
434 Ga0207664_10122439 3300025929 Bacteria 2179
435 Ga0207664_10510473 3300025929 Bacteria 1077
436 Ga0207644_10043816 3300025931 Bacteria 3176
437 Ga0207644_10087233 3300025931 Bacteria 2319
438 Ga0207644_10105501 3300025931 Bacteria 2123
439 Ga0207644_10415822 3300025931 Bacteria 1101
440 Ga0207644_10466767 3300025931 Bacteria 1038
441 Ga0207690_10380450 3300025932 Bacteria 1122
442 Ga0207690_10434300 3300025932 Bacteria 1053
443 Ga0207706_10004291 3300025933 Bacteria 13400
444 Ga0207706_10015413 3300025933 Bacteria 6906
445 Ga0207706_10163023 3300025933 Bacteria 1959
446 Ga0207706_10285173 3300025933 Bacteria 1440
447 Ga0207706_10733109 3300025933 Bacteria 843
448 Ga0207686_10462972 3300025934 Bacteria 977
449 Ga0207709_10012137 3300025935 Bacteria 4749
450 Ga0207709_10526073 3300025935 Bacteria 926
451 Ga0207670_10067039 3300025936 Bacteria 2468
452 Ga0207670_10439309 3300025936 Bacteria 1050
453 Ga0207669_10016383 3300025937 Bacteria 3764
454 Ga0207665_10002433 3300025939 Bacteria 12590
455 Ga0207665_10116998 3300025939 Bacteria 1879
456 Ga0207665_10119165 3300025939 Bacteria 1863
457 Ga0207691_10002355 3300025940 Bacteria 18498
458 Ga0207691_10086622 3300025940 Bacteria 2810
459 Ga0207691_10773337 3300025940 Bacteria 808
460 Ga0207711_10060689 3300025941 Bacteria 3259
461 Ga0207711_10405685 3300025941 Bacteria 1266
462 Ga0207711_10658608 3300025941 Bacteria 977
463 Ga0207689_10035753 3300025942 Bacteria 4125
464 Ga0207689_10080790 3300025942 Bacteria 2672
465 Ga0207679_10260799 3300025945 Bacteria 1478
466 Ga0207679_10407498 3300025945 Bacteria 1197
467 Ga0207667_10015657 3300025949 Bacteria 8603
468 Ga0207667_10086709 3300025949 Bacteria 3239
469 Ga0207667_11737978 3300025949 Bacteria 589
470 Ga0207651_10001708 3300025960 Bacteria 10136
471 Ga0207651_10598677 3300025960 Bacteria 963
472 Ga0207712_10043280 3300025961 Bacteria 3105
473 Ga0207712_10497846 3300025961 Bacteria 1041
474 Ga0207712_10670820 3300025961 Bacteria 903
475 Ga0207668_10029465 3300025972 Bacteria 3597
476 Ga0207668_10033903 3300025972 Bacteria 3385
477 Ga0207668_10062968 3300025972 Bacteria 2614
478 Ga0207668_10190371 3300025972 Bacteria 1625
479 Ga0207640_10040878 3300025981 Bacteria 2945
480 Ga0207658_10125538 3300025986 Bacteria 2053
481 Ga0207658_10202183 3300025986 Bacteria 1659
482 Ga0207677_10128344 3300026023 Bacteria 1920
483 Ga0207703_10005387 3300026035 Bacteria 10302
484 Ga0207703_10006710 3300026035 Bacteria 9185
485 Ga0207703_10629909 3300026035 Bacteria 1016
486 Ga0207639_10015166 3300026041 Bacteria 5430
487 Ga0207639_10016333 3300026041 Bacteria 5250
488 Ga0207639_10083547 3300026041 Bacteria 2535
489 Ga0207639_10191890 3300026041 Bacteria 1746
490 Ga0207639_10229022 3300026041 Bacteria 1610
491 Ga0207678_10008170 3300026067 Bacteria 9229
492 Ga0207678_10030441 3300026067 Bacteria 4712
493 Ga0207678_10120814 3300026067 Bacteria 2236
494 Ga0207678_10175240 3300026067 Bacteria 1831
495 Ga0207678_10198771 3300026067 Bacteria 1714
496 Ga0207708_10009289 3300026075 Bacteria 7281
497 Ga0207708_10104745 3300026075 Bacteria 2192
498 Ga0207708_10163799 3300026075 Bacteria 1757
499 Ga0207641_10200798 3300026088 Bacteria 1838
500 Ga0207641_10230533 3300026088 Bacteria 1721
501 Ga0207641_10493857 3300026088 Bacteria 1188
502 Ga0207641_10602402 3300026088 Bacteria 1076
503 Ga0207648_10002750 3300026089 Bacteria 18697
504 Ga0207648_10130053 3300026089 Bacteria 2216
505 Ga0207648_10209561 3300026089 Bacteria 1729
506 Ga0207676_10006730 3300026095 Bacteria 8133
507 Ga0207676_10048400 3300026095 Bacteria 3300
508 Ga0207674_10014216 3300026116 Bacteria 8795
509 Ga0207674_10547536 3300026116 Bacteria 1118
510 Ga0207674_10558565 3300026116 Bacteria 1106
511 Ga0207675_100005717 3300026118 Bacteria 11901
512 Ga0207675_100047285 3300026118 Bacteria 4017
513 Ga0207675_100170158 3300026118 Bacteria 2082
514 Ga0207675_100293425 3300026118 Bacteria 1582
515 Ga0207675_101057516 3300026118 Bacteria 831
516 Ga0207683_10016129 3300026121 Bacteria 6359
517 Ga0207683_10054935 3300026121 Bacteria 3492
518 Ga0207683_11292757 3300026121 Bacteria 675
519 Ga0207698_10013023 3300026142 Bacteria 5472
520 Ga0207698_10120848 3300026142 Bacteria 2217
521 Ga0207698_10458620 3300026142 Bacteria 1232
522 Ga0207698_10557609 3300026142 Bacteria 1124
523 Ga0209588_1002374 3300027671 Bacteria 5099
524 Ga0209588_1011067 3300027671 Bacteria 2720
525 Ga0209588_1083496 3300027671 Bacteria 1031
526 Ga0209813_10058073 3300027866 Bacteria 1229
527 Ga0209813_10115654 3300027866 Bacteria 929
528 Ga0207428_10296280 3300027907 Bacteria 1198
529 Ga0207428_10556454 3300027907 Bacteria 829
530 Ga0268266_10004998 3300028379 Bacteria 12533
531 Ga0268266_10011610 3300028379 Bacteria 7646
532 Ga0268266_10705532 3300028379 Bacteria 972
533 Ga0268265_10086876 3300028380 Bacteria 2486
534 Ga0268265_10095558 3300028380 Bacteria 2386
535 Ga0268265_10139559 3300028380 Bacteria 2027
536 Ga0268265_10522026 3300028380 Bacteria 1123
537 Ga0268265_11180385 3300028380 Bacteria 762
538 Ga0268265_11831961 3300028380 Bacteria 613
539 Ga0268264_10006546 3300028381 Bacteria 9807
540 Ga0268264_10050023 3300028381 Bacteria 3479
541 Ga0268264_10085860 3300028381 Bacteria 2702
542 Ga0268264_10274108 3300028381 Bacteria 1577
543 Ga0268264_10461321 3300028381 Bacteria 1233
544 Ga0268264_10547168 3300028381 Bacteria 1135
545 Ga0307517_10000066 3300028786 Bacteria 141370
546 Ga0265331_10155757 3300031250 Bacteria 1037
547 Ga0307513_10371147 3300031456 Bacteria 1173
548 Ga0307509_10045343 3300031507 Bacteria 4741
549 Ga0307408_100190448 3300031548 Bacteria 1652
550 Ga0307408_100244452 3300031548 Bacteria 1477
551 Ga0307508_10187670 3300031616 Bacteria 1669
552 Ga0265314_10035502 3300031711 Bacteria 3633
553 Ga0307516_10044256 3300031730 Bacteria 4406
554 Ga0307516_10083837 3300031730 Bacteria 3027
555 Ga0307405_10433681 3300031731 Bacteria 1037
556 Ga0307410_10206400 3300031852 Bacteria 1503
557 Ga0307410_10819756 3300031852 Bacteria 793
558 Ga0307406_10341191 3300031901 Bacteria 1167
559 Ga0307406_10950432 3300031901 Bacteria 734
560 Ga0307407_10192431 3300031903 Bacteria 1361
561 Ga0307412_10200769 3300031911 Bacteria 1514
562 Ga0307409_101664003 3300031995 Bacteria 667
563 Ga0307416_100790461 3300032002 Bacteria 1044
564 Ga0307416_101167714 3300032002 Bacteria 875
565 Ga0307414_10654057 3300032004 Bacteria 948
566 Ga0307411_10135066 3300032005 Bacteria 1809
567 Ga0307415_100158577 3300032126 Bacteria 1751
568 Ga0307415_100600674 3300032126 Bacteria 979
569 Ga0307510_10501130 3300033180 Bacteria 657
570 Ga0373958_0097810 3300034819 Bacteria 685
571 Ga0373938_0011879 3300034957 Bacteria 1627
572 Ga0373938_0085483 3300034957 Bacteria 773
573 Ga0373926_0284689 3300035083 Bacteria 644
574 Ga0373928_0149732 3300035084 Bacteria 645
575 Ga0373929_0058557 3300035085 Bacteria 897
576 Ga0373936_0037807 3300035113 Bacteria 1929
577 Ga0373936_0084783 3300035113 Bacteria 1323
578 Ga0373939_0144617 3300035114 Bacteria 860
579 Ga0373941_0280706 3300035115 Bacteria 659
580 Ga0373945_0021908 3300035116 Bacteria 2199
581 Ga0373945_0268186 3300035116 Bacteria 725
582 Ga0373943_0003370 3300035170 Bacteria 7264
583 Ga0373943_0022438 3300035170 Bacteria 2925
584 Ga0373943_0042686 3300035170 Bacteria 2199
585 Ga0373943_0739798 3300035170 Bacteria 584
586 Ga0373946_0184418 3300035171 Bacteria 992
587 Ga0373961_0015040 3300035241 Bacteria 1973
588 Ga0373924_0238677 3300035410 Bacteria 804
589 Ga0373931_0004850 3300035691 Bacteria 6179
590 Ga0373931_0007968 3300035691 Bacteria 5010
591 Ga0373931_0407382 3300035691 Bacteria 862
592 Ga0373935_0000128 3300035692 Bacteria 34347
593 Ga0373935_0074836 3300035692 Bacteria 2190
594 Ga0373927_0000496 3300035695 Bacteria 29963
595 Ga0373927_0005789 3300035695 Bacteria 8482
596 Ga0373927_0035473 3300035695 Bacteria 3243
597 Ga0373927_0562150 3300035695 Bacteria 754
598 Ga0373947_0001955 3300035725 Bacteria 12612
599 Ga0373947_0068804 3300035725 Bacteria 2166
600 Ga0373947_0136021 3300035725 Bacteria 1572
601 Ga0373937_0020378 3300036401 Bacteria 5946
602 Ga0373925_0006551 3300037068 Bacteria 8561
603 Ga0373925_0014210 3300037068 Bacteria 5762
604 Ga0373925_0025490 3300037068 Bacteria 4320
605 Ga0373925_0136494 3300037068 Bacteria 1917
606 Ga0373925_0967092 3300037068 Bacteria 701
607 Ga0395899_0165439 3300037312 Bacteria 1561
608 Ga0395900_0000962 3300037418 Bacteria 37526
609 Ga0395898_0002601 3300037466 Bacteria 21069
610 Ga0395898_0087051 3300037466 Bacteria 3010
611 Ga0395898_0107991 3300037466 Bacteria 2669
612 Ga0395898_0451487 3300037466 Bacteria 1224
613 Ga0395898_0708763 3300037466 Bacteria 948
614 Ga0395905_0132877 3300037471 Bacteria 2341
615 Ga0395905_0557420 3300037471 Bacteria 1047
616 Ga0395905_0761377 3300037471 Bacteria 871
617 Ga0395901_0002873 3300038443 Bacteria 17387
618 Ga0395901_0409245 3300038443 Bacteria 1393
619 Ga0395901_0737801 3300038443 Bacteria 979
620 Ga0395901_0968655 3300038443 Bacteria 828
621 Ga0395901_1082601 3300038443 Bacteria 773
622 Ga0436360_0571065 3300039438 Bacteria 932
623 Ga0436361_1112783 3300039447 Bacteria 5393
624 Ga0436363_0014749 3300039450 Bacteria 1256
625 Ga0436362_0050395 3300039453 Bacteria 804
626 Ga0439453_0001876 3300041408 Bacteria 2799
627 Ga0439466_0048414 3300041411 Bacteria 1398
628 Ga0451791_0233608 3300041451 Bacteria 706
629 Ga0451797_1044080 3300041453 Bacteria 923
630 Ga0451802_0997669 3300041460 Bacteria 1109
631 Ga0451807_0408876 3300041486 Bacteria 851
632 Ga0451833_0273741 3300041491 Bacteria 1006
633 Ga0451839_1410685 3300041496 Bacteria 677
634 Ga0451853_1315886 3300041512 Bacteria 694
635 Ga0439452_073497 3300042010 Bacteria 751
636 Ga0439435_0006016 3300042436 Bacteria 2705
637 Ga0439435_0093735 3300042436 Bacteria 915
638 Ga0439444_0057317 3300042437 Bacteria 805
639 Ga0439460_0094345 3300042461 Bacteria 954
640 Ga0439440_0047810 3300042993 Bacteria 1061
641 Ga0466972_0000048 3300044658 Bacteria 119165
642 Ga0466968_0015525 3300044735 Bacteria 3020
643 Ga0466968_0384425 3300044735 Bacteria 686
644 Ga0495617_014085 3300046452 Bacteria 2718
645 Ga0495603_0000104 3300046455 Bacteria 39821
646 Ga0495603_0026654 3300046455 Bacteria 3491
647 Ga0495590_0017439 3300046457 Bacteria 2584
648 Ga0495629_0006415 3300046459 Bacteria 8719
649 Ga0495629_0008475 3300046459 Bacteria 7569
650 Ga0495629_0115725 3300046459 Bacteria 1869
651 Ga0495641_0000402 3300046461 Bacteria 36037
652 Ga0495641_0020048 3300046461 Bacteria 3402
653 Ga0495653_0127629 3300046463 Bacteria 1804
654 Ga0495580_0003617 3300046472 Bacteria 13095
655 Ga0495580_0177577 3300046472 Bacteria 1471
656 Ga0495582_0000063 3300046473 Bacteria 54381
657 Ga0495582_0055645 3300046473 Bacteria 2181
658 Ga0495639_0000224 3300046475 Bacteria 28629
659 Ga0495639_0158100 3300046475 Bacteria 1096
660 Ga0495639_0293702 3300046475 Bacteria 809
661 Ga0495662_0000297 3300046476 Bacteria 21564
662 Ga0495664_0020799 3300046477 Bacteria 3788
663 Ga0495584_0069162 3300046491 Bacteria 1774
664 Ga0495584_0275321 3300046491 Bacteria 855
665 Ga0495594_0001344 3300046499 Bacteria 12765
666 Ga0495594_0047295 3300046499 Bacteria 2362
667 Ga0495594_0095419 3300046499 Bacteria 1670
668 Ga0495594_0259020 3300046499 Bacteria 991
669 Ga0495607_0061979 3300046501 Bacteria 2123
670 Ga0495607_0178303 3300046501 Bacteria 1067
671 Ga0495606_0115427 3300046507 Bacteria 1614
672 Ga0495606_0388531 3300046507 Bacteria 730
673 Ga0495616_0068580 3300046513 Bacteria 1721
674 Ga0495616_0299636 3300046513 Bacteria 679
675 Ga0495618_0658926 3300046514 Bacteria 618
676 Ga0495628_0019566 3300046516 Bacteria 5595
677 Ga0495628_0025324 3300046516 Bacteria 4847
678 Ga0495628_0265615 3300046516 Bacteria 1278
679 Ga0495630_0003717 3300046517 Bacteria 10637
680 Ga0495631_0073021 3300046518 Bacteria 1482
681 Ga0495632_0186660 3300046519 Bacteria 948
682 Ga0495632_0263640 3300046519 Bacteria 770
683 Ga0495637_0075326 3300046520 Bacteria 1354
684 Ga0495643_0021009 3300046522 Bacteria 3752
685 Ga0495648_0001804 3300046524 Bacteria 20615
686 Ga0495648_0147972 3300046524 Bacteria 1228
687 Ga0495648_0211009 3300046524 Bacteria 965
688 Ga0495663_0034790 3300046525 Bacteria 1511
689 Ga0495666_0003431 3300046526 Bacteria 7991
690 Ga0495666_0054890 3300046526 Bacteria 1910
691 Ga0495666_0160067 3300046526 Bacteria 1044
692 Ga0495652_0231371 3300046529 Bacteria 1382
693 Ga0495665_0000290 3300046531 Bacteria 25439
694 Ga0495640_0005621 3300046533 Bacteria 9972
695 Ga0495598_0015794 3300046537 Bacteria 1913
696 Ga0495598_0176445 3300046537 Bacteria 760
697 Ga0495609_0013656 3300046538 Bacteria 3832
698 Ga0495597_0167895 3300046542 Bacteria 892
699 Ga0495622_0004071 3300046557 Bacteria 6826
700 Ga0495622_0264803 3300046557 Bacteria 754
701 Ga0495633_0082897 3300046558 Bacteria 1492
702 Ga0495667_0139368 3300046559 Bacteria 1563
703 Ga0495656_0057331 3300046615 Bacteria 1686
704 Ga0495656_0219873 3300046615 Bacteria 949
705 Ga0495634_0000645 3300046642 Bacteria 33906
706 Ga0495634_0556047 3300046642 Bacteria 669
707 Ga0495625_0323552 3300046660 Bacteria 981
708 Ga0495635_0007816 3300046663 Bacteria 7465
709 Ga0495635_0531605 3300046663 Bacteria 772
710 Ga0495659_0058330 3300046664 Bacteria 1420
711 Ga0495659_0061441 3300046664 Bacteria 1388
712 Ga0495659_0261639 3300046664 Bacteria 723
713 Ga0495588_0032489 3300046674 Bacteria 2631
714 Ga0495588_0175070 3300046674 Bacteria 1134
715 Ga0495599_0542198 3300046678 Bacteria 682
716 Ga0495658_0000702 3300046683 Bacteria 18142
717 Ga0495669_0008345 3300046684 Bacteria 4354
718 Ga0495669_0038301 3300046684 Bacteria 2123
719 Ga0495669_0063672 3300046684 Bacteria 1673
720 Ga0495669_0256402 3300046684 Bacteria 840
721 Ga0495613_0000449 3300046689 Bacteria 35095
722 Ga0495624_0000224 3300046690 Bacteria 44228
723 Ga0495624_0074122 3300046690 Bacteria 2115
724 Ga0495670_0070593 3300046691 Bacteria 1767
725 Ga0495671_0015127 3300046692 Bacteria 4142
726 Ga0495589_0090806 3300046794 Bacteria 1483
727 Ga0495589_0100362 3300046794 Bacteria 1401
728 Ga0495660_0334527 3300046810 Bacteria 677
729 Ga0495581_0000168 3300047315 Bacteria 29532
730 Ga0495581_0132461 3300047315 Bacteria 1453
731 Ga0495604_0164902 3300047317 Bacteria 1563
732 Ga0495674_0005032 3300047319 Bacteria 12712
733 Ga0495674_0065139 3300047319 Bacteria 3166
734 Ga0495674_0311684 3300047319 Bacteria 1284
735 Ga0495672_0050066 3300047320 Bacteria 2469
736 Ga0495672_0198790 3300047320 Bacteria 1004
737 Ga0495672_0357789 3300047320 Bacteria 676
738 Ga0495676_0011951 3300047321 Bacteria 7832
739 Ga0495676_0031024 3300047321 Bacteria 4527
740 Ga0495676_0064997 3300047321 Bacteria 2833
741 Ga0495676_0442640 3300047321 Bacteria 858
742 Ga0495680_0200609 3300047322 Bacteria 1431
743 Ga0495683_0052730 3300047323 Bacteria 2030
744 Ga0495687_115411 3300047443 Bacteria 979
745 Ga0495687_154668 3300047443 Bacteria 779
746 Ga0495679_102667 3300047446 Bacteria 793
747 Ga0495685_011031 3300047447 Bacteria 3040
748 Ga0495685_064237 3300047447 Bacteria 1235
749 Ga0495673_0136439 3300047469 Bacteria 960
750 Ga0495684_0017497 3300047471 Bacteria 5519
751 Ga0495686_0267486 3300047472 Bacteria 955
752 Ga0495686_0532498 3300047472 Bacteria 615
753 Ga0495593_0000150 3300047673 Bacteria 34569
754 Ga0495602_0480368 3300048088 Bacteria 872
755 Ga0495614_0021011 3300048089 Bacteria 2822
756 Ga0495614_0196391 3300048089 Bacteria 912
757 Ga0495615_0094013 3300048090 Bacteria 839
758 Ga0495626_0131265 3300048091 Bacteria 1069
759 Ga0496100_0004254 3300048903 Bacteria 7567
760 Ga0496100_0078021 3300048903 Bacteria 2228
761 Ga0496100_0105783 3300048903 Bacteria 1947
762 Ga0496101_0031574 3300048904 Bacteria 3725
763 Ga0496101_0045043 3300048904 Bacteria 3158
764 Ga0496101_0079733 3300048904 Bacteria 2417
765 Ga0496101_0570676 3300048904 Bacteria 895
766 Ga0496101_0691726 3300048904 Bacteria 805
767 Ga0496102_0007637 3300048905 Bacteria 9242
768 Ga0496102_0039187 3300048905 Bacteria 4280
769 Ga0496102_0079462 3300048905 Bacteria 3021
770 Ga0496102_0480677 3300048905 Bacteria 1163
771 Ga0496102_0960843 3300048905 Bacteria 775
772 Ga0496103_0001066 3300048906 Bacteria 19147
773 Ga0496103_0362944 3300048906 Bacteria 931
774 Ga0496104_0005780 3300048907 Bacteria 10826
775 Ga0496104_0036010 3300048907 Bacteria 4623
776 Ga0496104_0050061 3300048907 Bacteria 3942
777 Ga0496104_0232760 3300048907 Bacteria 1754
778 Ga0496104_0365402 3300048907 Bacteria 1355
779 Ga0496105_0007945 3300048908 Bacteria 8245
780 Ga0496105_0098561 3300048908 Bacteria 2413
781 Ga0496106_0005311 3300048909 Bacteria 9538
782 Ga0496106_0039298 3300048909 Bacteria 3543
783 Ga0496106_0078332 3300048909 Bacteria 2536
784 Ga0496106_0525154 3300048909 Bacteria 950
785 Ga0496107_0002318 3300048910 Bacteria 12290
786 Ga0496107_0009193 3300048910 Bacteria 6850
787 Ga0496107_0115296 3300048910 Bacteria 1977
788 Ga0496108_0016355 3300048911 Bacteria 6049
789 Ga0496108_0093351 3300048911 Bacteria 2560
790 Ga0496108_0167765 3300048911 Bacteria 1898
791 Ga0496108_0329922 3300048911 Bacteria 1330
792 Ga0496109_0041331 3300048912 Bacteria 4176
793 Ga0496109_0086868 3300048912 Bacteria 2888
794 Ga0496109_0095694 3300048912 Bacteria 2750
795 Ga0496109_0292591 3300048912 Bacteria 1535
796 Ga0496109_0533594 3300048912 Bacteria 1107
797 Ga0496109_0568499 3300048912 Bacteria 1069
798 Ga0496109_0578251 3300048912 Bacteria 1059
799 Ga0496109_0612738 3300048912 Bacteria 1025
800 Ga0496110_0077437 3300048913 Bacteria 2958
801 Ga0496110_0124682 3300048913 Bacteria 2323
802 Ga0496110_0448083 3300048913 Bacteria 1176
803 Ga0496110_0939082 3300048913 Bacteria 771
804 Ga0496111_0027434 3300048914 Bacteria 4029
805 Ga0496111_0027782 3300048914 Bacteria 4006
806 Ga0496111_0343651 3300048914 Bacteria 1105
807 Ga0496111_0631796 3300048914 Bacteria 782
808 Ga0496112_0007218 3300048915 Bacteria 9850
809 Ga0496112_0174514 3300048915 Bacteria 2114
810 Ga0496112_0262483 3300048915 Bacteria 1676
811 Ga0496113_0000496 3300048916 Bacteria 19347
812 Ga0496113_0176032 3300048916 Bacteria 1695
813 Ga0496113_0292011 3300048916 Bacteria 1304
814 Ga0496113_0341690 3300048916 Bacteria 1200
815 Ga0496114_0012038 3300048917 Bacteria 6920
816 Ga0496114_0013035 3300048917 Bacteria 6661
817 Ga0496114_0017866 3300048917 Bacteria 5732
818 Ga0496115_0004434 3300048918 Bacteria 10175
819 Ga0496115_0008313 3300048918 Bacteria 7673
820 Ga0496115_0016948 3300048918 Bacteria 5558
821 Ga0496115_0095081 3300048918 Bacteria 2439
822 Ga0496115_0113133 3300048918 Bacteria 2230
823 Ga0496115_0145338 3300048918 Bacteria 1957
824 Ga0496115_0220163 3300048918 Bacteria 1566
825 Ga0496115_0273588 3300048918 Bacteria 1387
826 Ga0496117_0059519 3300048920 Bacteria 2638
827 Ga0496118_0027985 3300048921 Bacteria 4759
828 Ga0496118_0234457 3300048921 Bacteria 1056
829 Ga0496119_0109364 3300048922 Bacteria 1537
830 Ga0496119_0165871 3300048922 Bacteria 1170
831 Ga0496121_0004660 3300048924 Bacteria 18214
832 Ga0496121_0008147 3300048924 Bacteria 12447
833 Ga0496121_0135528 3300048924 Bacteria 1835
834 Ga0496121_0215611 3300048924 Bacteria 1356
835 Ga0496121_0217523 3300048924 Bacteria 1348
836 Ga0496121_0368273 3300048924 Bacteria 951
837 Ga0496121_0431675 3300048924 Bacteria 854
838 Ga0496124_0271024 3300048927 Bacteria 1243
839 Ga0496124_0284551 3300048927 Bacteria 1203
840 Ga0496125_0077413 3300048928 Bacteria 2564
841 Ga0496126_0079844 3300048929 Bacteria 2895
842 Ga0496126_0113508 3300048929 Bacteria 2358
843 Ga0496126_0198212 3300048929 Bacteria 1697
844 Ga0496126_0200586 3300048929 Bacteria 1685
845 Ga0496126_0423541 3300048929 Bacteria 1076
846 Ga0496126_0972875 3300048929 Bacteria 639
847 Ga0495682_0110488 3300049460 Bacteria 985
848 Ga0495682_0257162 3300049460 Bacteria 617
849 Ga0501032_0003836 3300049569 Bacteria 11418
850 Ga0501034_0586099 3300049571 Bacteria 1022
851 Ga0501036_0020722 3300049572 Bacteria 5522
852 Ga0501038_0046870 3300049574 Bacteria 3746
853 Ga0501039_0100043 3300049575 Bacteria 2263
854 Ga0501039_0110674 3300049575 Bacteria 2147
855 Ga0501039_0710315 3300049575 Bacteria 786
856 Ga0501040_0205164 3300049576 Bacteria 1400
857 Ga0501040_0322621 3300049576 Bacteria 1105
858 Ga0501041_0877641 3300049577 Bacteria 576
859 Ga0501042_0064693 3300049578 Bacteria 2614
860 Ga0501043_0006408 3300049579 Bacteria 9455
861 Ga0501043_0164435 3300049579 Bacteria 1733
862 Ga0501047_0061951 3300049581 Bacteria 3609
863 Ga0501069_0160057 3300049585 Bacteria 1296
864 Ga0501071_0017478 3300049587 Bacteria 4947
865 Ga0501072_0007865 3300049588 Bacteria 8099
866 Ga0501072_0101152 3300049588 Bacteria 2291
867 Ga0501072_0109837 3300049588 Bacteria 2195
868 Ga0501072_0578457 3300049588 Bacteria 886
869 Ga0501072_1096633 3300049588 Bacteria 619
870 Ga0501073_0389655 3300049589 Bacteria 963
871 Ga0501075_0019695 3300049591 Bacteria 4898
872 Ga0501075_0223053 3300049591 Bacteria 1438
873 Ga0501075_0519414 3300049591 Bacteria 909
874 Ga0501075_0937640 3300049591 Bacteria 658
875 Ga0501075_0962829 3300049591 Bacteria 648
876 Ga0501076_0047740 3300049592 Bacteria 3385
877 Ga0501076_0087775 3300049592 Bacteria 2500
878 Ga0501076_0215183 3300049592 Bacteria 1571
879 Ga0501076_0468036 3300049592 Bacteria 1038
880 Ga0501077_0045269 3300049593 Bacteria 2795
881 Ga0501079_0010693 3300049741 Bacteria 6988
882 Ga0501079_0367945 3300049741 Bacteria 1127
883 Ga0501079_0559658 3300049741 Bacteria 899
884 Ga0501080_0184430 3300049742 Bacteria 1919
885 Ga0501083_0009952 3300049744 Bacteria 6712
886 Ga0501083_0073057 3300049744 Bacteria 2279
887 Ga0501044_0018129 3300049823 Bacteria 7549
888 Ga0501045_0041315 3300049824 Bacteria 3356
889 Ga0501045_0455647 3300049824 Bacteria 951
890 Ga0501045_0627801 3300049824 Bacteria 795
891 nmdc:mga03683_182057_c1 3300050489 Bacteria 959
892 nmdc:mga03683_30172_c1 3300050489 Bacteria 2168
893 nmdc:mga03683_84916_c1 3300050489 Bacteria 1372
894 nmdc:mga03n38_1239_c1 3300050490 Bacteria 7175
895 nmdc:mga03n38_153340_c1 3300050490 Bacteria 1161
896 nmdc:mga03n38_172242_c1 3300050490 Bacteria 1103
897 nmdc:mga03n38_28159_c1 3300050490 Bacteria 2339
898 nmdc:mga00v17_463660_c1 3300050491 Bacteria 822
899 nmdc:mga0yw44_273642_c1 3300050492 Bacteria 1127
900 nmdc:mga0yw44_28870_c1 3300050492 Bacteria 3196
901 nmdc:mga0yw44_294353_c1 3300050492 Bacteria 1087
902 nmdc:mga0yw44_394_c1 3300050492 Bacteria 14330
903 nmdc:mga0yw44_41173_c1 3300050492 Bacteria 2749
904 nmdc:mga0yw44_55712_c1 3300050492 Bacteria 2407
905 nmdc:mga0yw44_623756_c1 3300050492 Bacteria 733
906 nmdc:mga0yw44_95498_c1 3300050492 Bacteria 1886
907 nmdc:mga0k408_121842_c1 3300050493 Bacteria 1545
908 nmdc:mga0k408_165252_c1 3300050493 Bacteria 1319
909 nmdc:mga0k408_46098_c1 3300050493 Bacteria 2517
910 nmdc:mga0k408_54794_c1 3300050493 Bacteria 2311
911 nmdc:mga0k408_58624_c1 3300050493 Bacteria 2236
912 nmdc:mga06z11_114328_c1 3300050494 Bacteria 1498
913 nmdc:mga06z11_1922_c1 3300050494 Bacteria 7836
914 nmdc:mga06z11_305965_c1 3300050494 Bacteria 946
915 nmdc:mga06z11_39510_c1 3300050494 Bacteria 2349
916 nmdc:mga06z11_523797_c1 3300050494 Bacteria 719
917 nmdc:mga06z11_61050_c1 3300050494 Bacteria 1965
918 nmdc:mga04h51_216872_c1 3300050495 Bacteria 757
919 nmdc:mga07m45_228324_c1 3300050496 Bacteria 1083
920 nmdc:mga07m45_25926_c1 3300050496 Bacteria 3219
921 nmdc:mga07m45_354960_c1 3300050496 Bacteria 852
922 nmdc:mga07m45_55327_c1 3300050496 Bacteria 2243
923 nmdc:mga07m45_55888_c1 3300050496 Bacteria 2231
924 nmdc:mga05p37_1167662_c1 3300050507 Bacteria 799
925 nmdc:mga05p37_191752_c1 3300050507 Bacteria 2481
926 nmdc:mga05p37_973969_c1 3300050507 Bacteria 905
927 nmdc:mga09592_339522_c1 3300050508 Bacteria 1300
928 nmdc:mga09592_475031_c1 3300050508 Bacteria 1077
929 nmdc:mga0qj67_117654_c1 3300050509 Bacteria 2148
930 nmdc:mga0qj67_352417_c1 3300050509 Bacteria 1190
931 nmdc:mga06r32_596912_c1 3300050510 Bacteria 1075
932 nmdc:mga08y16_312765_c1 3300050511 Bacteria 1618
933 nmdc:mga08y16_858895_c1 3300050511 Bacteria 896
934 nmdc:mga08y16_89632_c1 3300050511 Bacteria 3205
935 nmdc:mga0n895_429563_c1 3300050512 Bacteria 1335
936 nmdc:mga0n895_462834_c1 3300050512 Bacteria 1280
937 nmdc:mga0n895_606063_c1 3300050512 Bacteria 1097
938 nmdc:mga0n895_797909_c1 3300050512 Bacteria 935
939 nmdc:mga0rr50_219400_c1 3300050513 Bacteria 1570
940 nmdc:mga0a205_220424_c1 3300050515 Bacteria 1782
941 nmdc:mga0a205_767259_c1 3300050515 Bacteria 812
942 nmdc:mga0a205_94603_c1 3300050515 Bacteria 2886
943 nmdc:mga0sz30_21420_c1 3300050516 Bacteria 2616
944 nmdc:mga0sz30_39231_c1 3300050516 Bacteria 1987
945 Ga0495601_0077341 3300053077 Bacteria 2131
946 Ga0495601_0109745 3300053077 Bacteria 1786
947 Ga0495601_0174905 3300053077 Bacteria 1403
948 Ga0495601_0618217 3300053077 Bacteria 694
949 Ga0495612_0235846 3300053078 Bacteria 812
950 Ga0495612_0275843 3300053078 Bacteria 751
951 Ga0500635_0020830 3300053080 Bacteria 2013
952 Ga0495655_0006368 3300053083 Bacteria 2141
953 Ga0495655_0116089 3300053083 Bacteria 810
954 Ga0495655_0219671 3300053083 Bacteria 628
955 Ga0495595_0011279 3300053084 Bacteria 3732
956 Ga0495595_0026945 3300053084 Bacteria 2557
957 Ga0495619_0154365 3300053085 Bacteria 1584
958 Ga0495619_0174953 3300053085 Bacteria 1485
959 Ga0500643_028564 3300053087 Bacteria 1724
960 Ga0500583_0224640 3300053092 Bacteria 930
961 Ga0500651_0010878 3300053093 Bacteria 5470
962 Ga0500651_0505754 3300053093 Bacteria 665
963 Ga0500566_0007378 3300053094 Bacteria 6512
964 Ga0500566_0008620 3300053094 Bacteria 6027
965 Ga0500654_144857 3300053099 Bacteria 854
966 Ga0500554_008364 3300053102 Bacteria 2427
967 Ga0500554_010211 3300053102 Bacteria 2278
968 Ga0500555_023317 3300053103 Bacteria 1775
969 Ga0500593_205228 3300053117 Bacteria 707
970 Ga0500595_005128 3300053119 Bacteria 5748
971 Ga0500595_032129 3300053119 Bacteria 1755
972 Ga0500595_068216 3300053119 Bacteria 1059
973 Ga0500597_273417 3300053120 Bacteria 683
974 Ga0500608_130298 3300053122 Bacteria 1129
975 Ga0500618_105851 3300053125 Bacteria 635
976 Ga0500621_034574 3300053126 Bacteria 2023
977 Ga0500628_147191 3300053129 Bacteria 657
978 Ga0500642_0027046 3300053130 Bacteria 2350
979 Ga0500642_0287771 3300053130 Bacteria 745
980 Ga0500642_0326926 3300053130 Bacteria 686
981 Ga0500652_044110 3300053131 Bacteria 1805
982 Ga0500655_043240 3300053133 Bacteria 887
983 Ga0500559_0282552 3300053136 Bacteria 780
984 Ga0500568_0009009 3300053139 Bacteria 4762
985 Ga0500568_0083592 3300053139 Bacteria 1210
986 Ga0500568_0238613 3300053139 Bacteria 663
987 Ga0500577_0123315 3300053142 Bacteria 1080
988 Ga0500579_186773 3300053143 Bacteria 801
989 Ga0500588_0226501 3300053146 Bacteria 698
990 Ga0500603_000894 3300053150 Bacteria 7080
991 Ga0500604_0040349 3300053151 Bacteria 1407
992 Ga0500604_0121397 3300053151 Bacteria 874
993 Ga0500616_0013390 3300053153 Bacteria 4763
994 Ga0500616_0020223 3300053153 Bacteria 3742
995 Ga0500620_227568 3300053155 Bacteria 628
996 Ga0500633_0193109 3300053160 Bacteria 763
997 Ga0500634_0091390 3300053161 Bacteria 1543
998 Ga0500638_049422 3300053162 Bacteria 2034
999 Ga0500636_0012016 3300053177 Bacteria 5072
1000 Ga0500637_0000172 3300053178 Bacteria 24102
1001 Ga0500570_163665 3300053724 Bacteria 760
1002 Ga0500645_007164 3300053730 Bacteria 3913
1003 Ga0500609_011699 3300053731 Bacteria 1187
1004 Ga0500609_012446 3300053731 Bacteria 1151
1005 Ga0500587_038440 3300053739 Bacteria 679
1006 Ga0501084_0021975 3300054114 Bacteria 5322
1007 Ga0501084_0030992 3300054114 Bacteria 4472
1008 Ga0501084_0045308 3300054114 Bacteria 3683
1009 Ga0501084_0093765 3300054114 Bacteria 2521
1010 Ga0501084_0100816 3300054114 Bacteria 2424
1011 Ga0501084_0872106 3300054114 Bacteria 757
1012 Ga0500661_000719 3300055283 Bacteria 6184
1013 Ga0590071_046384 3300059421 Bacteria 1050
1014 Ga0501082_0177554 3300060353 Bacteria 1852
1015 Ga0501082_0194582 3300060353 Bacteria 1764
1016 Ga0501082_0414460 3300060353 Bacteria 1176
1017 Ga0501082_1561435 3300060353 Bacteria 576
1018 Ga0530510_0027025 3300061734 Bacteria 4111
1019 2513653116 2513237095 Bacteria 8976980
1020 2513694326 2513237101 Bacteria 7952346
1021 2513699143 2513237102 Bacteria 7703324
1022 2723849151 2721755755 Bacteria 8322773
1023 2793078492
1024 2818243388 2816332527 Bacteria 8933356
1025 2824622545 2824617872 Bacteria 8814715
1026 2824633906 2824626560 Bacteria 8813858
1027 2824642349 2824635225 Bacteria 8785348
1028 2824649889 2824644064 Bacteria 8743947
1029 2824684151 2824679649 Bacteria 8248951
1030 2824722367 2824714736 Bacteria 8717648
1031 2824730133 2824723954 Bacteria 8758240
1032 2824738869 2824732956 Bacteria 7810675
1033 2824752531 2824746037 Bacteria 7911610
1034 2842044073 2842038055 Bacteria 8002051
1035 2842051938 2842045827 Bacteria 8006841
1036 2857515809 2857509624 Bacteria 7472071
1037 2874606910 2874604998 Bacteria 7834745
1038 2874621429 2874620515 Bacteria 8290088
1039 2879112580 2879110137 Bacteria 8907982
1040 2885368176 2885366525 Bacteria 8326213
1041 2888378822 2888378607 Bacteria 9652610
1042 2888391200 2888388044 Bacteria 7304136
1043 2889036154 2889033259 Bacteria 9099371
1044 2904668098 2904666416 Bacteria 8226587
1045 2906635062 2906626472 Bacteria 8826946
1046 2908783012 2908775508 Bacteria 8092255
1047 2922364532 2922361189 Bacteria 7436256
1048 2922389216 2922386360 Bacteria 7017218
1049 2922400957 2922393267 Bacteria 8285685
1050 2935634722 2935630451 Bacteria 8169952
1051 2941511948 2941507105 Bacteria 8166816
1052 2941519650 2941515067 Bacteria 8166720
1053 2941527658 2941523033 Bacteria 8169134
1054 3005509715 3005506211 Bacteria 6943378
1055 8006928191 8006926726 Bacteria 6749210
1056 8006967692 8006964411 Bacteria 8966052
1057 8006992654 8006984368 Bacteria 9651211
1058 8006998359 8006994254 Bacteria 8309700
1059 8056678397 8056673599 Bacteria 7871253
1060 Ga0495675_0231113
1061 LJQas_1019141
1062 JGI24752J21851_1005869
1063 JGI24746J21847_1011045
1064 JGI24737J22298_10008476
1065 JGI24750J21931_1000922
1066 JGI24738J21930_10008035
1067 JGI24749J21850_1024206
1068 JGI24744J21845_10043646
1069 JGI24033J26618_1001210
1070 JGI25153J46596_10000737
1071 JGI25153J46596_10003367
1072 JGI25153J46596_10007257
1073 JGI25404J52841_10039382
1074 JGI25404J52841_10064614
1075 Ga0055525_1013893
1076 Ga0055531_10001561
1077 Ga0065165_1004470
1078 Ga0065715_10519441
1079 Ga0065707_10311342
1080 Ga0070658_10040408
1081 Ga0070658_10103592
1082 Ga0070658_10126013
1083 Ga0070676_10600534
1084 Ga0070676_10634820
1085 Ga0070683_100085584
1086 Ga0070683_100152966
1087 Ga0070683_100557080
1088 Ga0070683_100801715
1089 Ga0070690_100201009
1090 Ga0070670_100447081
1091 Ga0068869_100071073
1092 Ga0070666_10484592
1093 Ga0070666_11065192
1094 Ga0070680_100014124
1095 Ga0070682_100101551
1096 Ga0070682_100663854
1097 Ga0068868_100050413
1098 Ga0068868_100112357
1099 Ga0068868_100116439
1100 Ga0070660_100008154
1101 Ga0070660_100019496
1102 Ga0070689_100002942
1103 Ga0070689_100182200
1104 Ga0070687_100002703
1105 Ga0070687_100179264
1106 Ga0070687_100216054
1107 Ga0070661_100151852
1108 Ga0070661_100186925
1109 Ga0070661_100229711
1110 Ga0070668_100068023
1111 Ga0070668_100434053
1112 Ga0070668_100462583
1113 Ga0070669_100090274
1114 Ga0070669_100117869
1115 Ga0070669_100287673
1116 Ga0070669_100370352
1117 Ga0070669_100881864
1118 Ga0070675_100024783
1119 Ga0070675_100125767
1120 Ga0070675_100382114
1121 Ga0070675_101265060
1122 Ga0070671_100024229
1123 Ga0070671_100035120
1124 Ga0070671_100134347
1125 Ga0070671_100354839
1126 Ga0070674_100006229
1127 Ga0070674_100090970
1128 Ga0070674_100235596
1129 Ga0070673_100349037
1130 Ga0070688_100001124
1131 Ga0070688_100422871
1132 Ga0070659_100128256
1133 Ga0070659_100190255
1134 Ga0070659_100371883
1135 Ga0070667_100016348
1136 Ga0070709_10005348
1137 Ga0070714_100017351
1138 Ga0070714_100062176
1139 Ga0070713_100015040
1140 Ga0070713_100136923
1141 Ga0070713_100822854
1142 Ga0070711_100011236
1143 Ga0070711_100023790
1144 Ga0070705_101089872
1145 Ga0070700_100008667
1146 Ga0070700_100290350
1147 Ga0070700_100295802
1148 Ga0070694_100262922
1149 Ga0070708_100114274
1150 Ga0070708_100367486
1151 Ga0070708_100383409
1152 Ga0070663_100020693
1153 Ga0070663_100041353
1154 Ga0070663_100164432
1155 Ga0070663_100352724
1156 Ga0070663_100865897
1157 Ga0070678_100080677
1158 Ga0070678_100448487
1159 Ga0070678_100864443
1160 Ga0070662_100009754
1161 Ga0070662_100357014
1162 Ga0070662_100491755
1163 Ga0070662_100521835
1164 Ga0070681_10002469
1165 Ga0068867_100003711
1166 Ga0068867_100061978
1167 Ga0068867_100288466
1168 Ga0068867_100389346
1169 Ga0070685_10061291
1170 Ga0070706_100365343
1171 Ga0070707_100273378
1172 Ga0070707_100436227
1173 Ga0070698_101167681
1174 Ga0070679_100051194
1175 Ga0070679_100131720
1176 Ga0070684_100262038
1177 Ga0070684_100407077
1178 Ga0070697_100592841
1179 Ga0068853_100018933
1180 Ga0068853_100084410
1181 Ga0068853_100107427
1182 Ga0068853_100388308
1183 Ga0070672_100406572
1184 Ga0070672_100748254
1185 Ga0070686_100003108
1186 Ga0070686_100162765
1187 Ga0070696_100606975
1188 Ga0070693_100032489
1189 Ga0070693_100521512
1190 Ga0070665_100221308
1191 Ga0070665_100469705
1192 Ga0070665_100999919
1193 Ga0070704_100848698
1194 Ga0068855_100051784
1195 Ga0068855_100147390
1196 Ga0068855_100352639
1197 Ga0070664_100180215
1198 Ga0070664_100237032
1199 Ga0070664_100304013
1200 Ga0070664_101111240
1201 Ga0068857_100027411
1202 Ga0068854_100033796
1203 Ga0068856_100142662
1204 Ga0068856_100274979
1205 Ga0068856_100633605
1206 Ga0070702_100015597
1207 Ga0068852_100010808
1208 Ga0068852_100170876
1209 Ga0068852_100233382
1210 Ga0068852_100432081
1211 Ga0068852_100635632
1212 Ga0068859_100059034
1213 Ga0068859_100565994
1214 Ga0068859_100622028
1215 Ga0068859_100772033
1216 Ga0068864_100007700
1217 Ga0068864_100087310
1218 Ga0068864_100313834
1219 Ga0068864_100973004
1220 Ga0068864_101205566
1221 Ga0068866_10026785
1222 Ga0068866_10043317
1223 Ga0068866_10281945
1224 Ga0068861_100012230
1225 Ga0068861_100094115
1226 Ga0068861_100283598
1227 Ga0068861_100414675
1228 Ga0068861_100439200
1229 Ga0068861_100577396
1230 Ga0068851_10012901
1231 Ga0068851_10174122
1232 Ga0068851_10538718
1233 Ga0068870_10002489
1234 Ga0068870_10079535
1235 Ga0068863_100003083
1236 Ga0068863_100335739
1237 Ga0068863_100337783
1238 Ga0068863_100725910
1239 Ga0068858_100010185
1240 Ga0068858_100011517
1241 Ga0068858_100192618
1242 Ga0068858_100593988
1243 Ga0068860_100022900
1244 Ga0068860_100060834
1245 Ga0068860_100137524
1246 Ga0068860_100449991
1247 Ga0068862_100172949
1248 Ga0068862_100186660
1249 Ga0068862_100327969
1250 Ga0068862_100332346
1251 Ga0068862_100691041
1252 Ga0081455_10005910
1253 Ga0081538_10006470
1254 Ga0081538_10035829
1255 Ga0081540_1003256
1256 Ga0081540_1004546
1257 Ga0081540_1004899
1258 Ga0081540_1004944
1259 Ga0081540_1050482
1260 Ga0081539_10017345
1261 Ga0081539_10183910
1262 Ga0070717_10053842
1263 Ga0070717_10085363
1264 Ga0070717_10248513
1265 Ga0075365_10005417
1266 Ga0075365_10039804
1267 Ga0075365_10096118
1268 Ga0075365_10111844
1269 Ga0075365_10131968
1270 Ga0075365_10142558
1271 Ga0075368_10003187
1272 Ga0075368_10024060
1273 Ga0075368_10058877
1274 Ga0075368_10084416
1275 Ga0075363_100001863
1276 Ga0075363_100015726
1277 Ga0075363_100023698
1278 Ga0075364_10047455
1279 Ga0075364_10113252
1280 Ga0075364_10748760
1281 Ga0070715_10000196
1282 Ga0070715_10020288
1283 Ga0070716_100042171
1284 Ga0070716_100098746
1285 Ga0070712_100028551
1286 Ga0070712_100654590
1287 Ga0075362_10029536
1288 Ga0075362_10032797
1289 Ga0075367_10006527
1290 Ga0075367_10091932
1291 Ga0075367_10134494
1292 Ga0075367_10152079
1293 Ga0075369_10216289
1294 Ga0075427_10033449
1295 Ga0075366_10018773
1296 Ga0075366_10024591
1297 Ga0075366_10059632
1298 Ga0075366_10097012
1299 Ga0075366_10116406
1300 Ga0075366_10292781
1301 Ga0097621_100039899
1302 Ga0097621_100168624
1303 Ga0075370_10033038
1304 Ga0075370_10078824
1305 Ga0075370_10107167
1306 Ga0075370_10193911
1307 Ga0075370_10215347
1308 Ga0068871_100004410
1309 Ga0068871_100131718
1310 Ga0068871_100291376
1311 Ga0068871_100516188
1312 Ga0075430_100379258
1313 Ga0075430_100567676
1314 Ga0075431_100030106
1315 Ga0075433_10756544
1316 Ga0075434_100102368
1317 Ga0075434_100191044
1318 Ga0075434_100216833
1319 Ga0075434_100394474
1320 Ga0075434_101014709
1321 Ga0068865_100191324
1322 Ga0075436_100373887
1323 Ga0075436_100672111
1324 Ga0097620_100059033
1325 Ga0097620_100566030
1326 Ga0097620_100622053
1327 Ga0097620_100772021
1328 Ga0075435_100610968
1329 Ga0099794_10093843
1330 Ga0099794_10103944
1331 Ga0105250_10016355
1332 Ga0105250_10022806
1333 Ga0105240_10042329
1334 Ga0111539_10014441
1335 Ga0111539_10372158
1336 Ga0111539_10503200
1337 Ga0105245_10031984
1338 Ga0105245_10233758
1339 Ga0105245_10280859
1340 Ga0105245_10416111
1341 Ga0105245_10440570
1342 Ga0105247_10011457
1343 Ga0105247_10351329
1344 Ga0105247_10748934
1345 Ga0114129_10020394
1346 Ga0114129_10108466
1347 Ga0105243_10202574
1348 Ga0105243_10323492
1349 Ga0105241_10621766
1350 Ga0105242_10012498
1351 Ga0105242_10031107
1352 Ga0105242_11615687
1353 Ga0105248_10015423
1354 Ga0105248_10315372
1355 Ga0105248_10608009
1356 Ga0105248_11235845
1357 Ga0105237_10023272
1358 Ga0105237_10318264
1359 Ga0105237_10482081
1360 Ga0105238_10021495
1361 Ga0105238_10051906
1362 Ga0105238_10782148
1363 Ga0105249_10238364
1364 Ga0105249_10878441
1365 Ga0099796_10062492
1366 Ga0099796_10157405
1367 Ga0105239_10046833
1368 Ga0105239_10269983
1369 Ga0105239_10352127
1370 Ga0105246_10114010
1371 Ga0105246_10177478
1372 Ga0105246_10299507
1373 Ga0157329_1005633
1374 Ga0157371_10859408
1375 Ga0157369_10077855
1376 Ga0157369_10868152
1377 Ga0157374_10013462
1378 Ga0157374_10085907
1379 Ga0157374_10259982
1380 Ga0157374_10407854
1381 Ga0157378_10280538
1382 Ga0157378_10343811
1383 Ga0157378_10675034
1384 Ga0163162_10262957
1385 Ga0163162_10279512
1386 Ga0163162_10286805
1387 Ga0163162_10438899
1388 Ga0163162_10457842
1389 Ga0163162_10678899
1390 Ga0157372_10228028
1391 Ga0157375_10186350
1392 Ga0157375_10456447
1393 Ga0163163_10041628
1394 Ga0163163_10133509
1395 Ga0157380_10007021
1396 Ga0157380_10242152
1397 Ga0157380_10341301
1398 Ga0157377_10016568
1399 Ga0157377_10051863
1400 Ga0157377_10140760
1401 Ga0157379_10004696
1402 Ga0157379_10129008
1403 Ga0157379_10237861
1404 Ga0157379_10567334
1405 Ga0157379_11497894
1406 Ga0157376_10121901
1407 Ga0157376_10420854
1408 Ga0157376_10594645
1409 Ga0182006_1198536
1410 Ga0163161_10089265
1411 Ga0163161_10147553
1412 Ga0163161_10411532
1413 Ga0163161_11096627
1414 Ga0214544_1039616
1415 Ga0214542_1000007
1416 Ga0214545_1000006
1417 Ga0214543_1000009
1418 Ga0213872_10016109
1419 Ga0213874_10092689
1420 Ga0213871_10090806
1421 Ga0209563_107789
1422 Ga0207425_1043328
1423 Ga0209026_1041610
1424 Ga0209758_1000015
1425 Ga0209758_1000161
1426 Ga0209758_1000798
1427 Ga0209758_1005779
1428 Ga0209758_1083386
1429 Ga0209256_1004114
1430 Ga0209256_1017362
1431 Ga0209256_1058012
1432 Ga0209257_1002985
1433 Ga0209257_1023500
1434 Ga0209257_1042064
1435 Ga0207697_10123752
1436 Ga0207656_10014586
1437 Ga0207653_10066958
1438 Ga0207682_10244041
1439 Ga0207642_10004596
1440 Ga0207642_10336888
1441 Ga0207710_10004498
1442 Ga0207688_10001290
1443 Ga0207680_10260026
1444 Ga0207647_10054075
1445 Ga0207685_10107755
1446 Ga0207645_10004676
1447 Ga0207645_10102590
1448 Ga0207645_10642676
1449 Ga0207643_10004180
1450 Ga0207643_10049197
1451 Ga0207643_10153459
1452 Ga0207643_10323617
1453 Ga0207705_10027385
1454 Ga0207705_10106100
1455 Ga0207684_10034992
1456 Ga0207654_10086174
1457 Ga0207707_10033729
1458 Ga0207707_10048847
1459 Ga0207707_10200740
1460 Ga0207695_10099522
1461 Ga0207671_10120866
1462 Ga0207671_10203634
1463 Ga0207693_10031950
1464 Ga0207693_10038564
1465 Ga0207693_10052911
1466 Ga0207663_10043583
1467 Ga0207663_10418468
1468 Ga0207660_10001899
1469 Ga0207662_10003858
1470 Ga0207662_10251888
1471 Ga0207662_10286179
1472 Ga0207657_10019726
1473 Ga0207657_10092157
1474 Ga0207657_10123396
1475 Ga0207649_10723089
1476 Ga0207652_10029791
1477 Ga0207652_10084520
1478 Ga0207646_10059004
1479 Ga0207646_10300157
1480 Ga0207646_10613105
1481 Ga0207681_10013657
1482 Ga0207681_10149121
1483 Ga0207681_10254929
1484 Ga0207694_10040064
1485 Ga0207694_10334726
1486 Ga0207659_10006187
1487 Ga0207659_10104018
1488 Ga0207687_10042558
1489 Ga0207687_10059447
1490 Ga0207687_10295179
1491 Ga0207687_10626675
1492 Ga0207700_10006617
1493 Ga0207664_10122439
1494 Ga0207664_10510473
1495 Ga0207644_10043816
1496 Ga0207644_10087233
1497 Ga0207644_10105501
1498 Ga0207644_10415822
1499 Ga0207644_10466767
1500 Ga0207690_10380450
1501 Ga0207690_10434300
1502 Ga0207706_10004291
1503 Ga0207706_10015413
1504 Ga0207706_10163023
1505 Ga0207706_10285173
1506 Ga0207706_10733109
1507 Ga0207686_10462972
1508 Ga0207709_10012137
1509 Ga0207709_10526073
1510 Ga0207670_10067039
1511 Ga0207670_10439309
1512 Ga0207669_10016383
1513 Ga0207665_10002433
1514 Ga0207665_10116998
1515 Ga0207665_10119165
1516 Ga0207691_10002355
1517 Ga0207691_10086622
1518 Ga0207691_10773337
1519 Ga0207711_10060689
1520 Ga0207711_10405685
1521 Ga0207711_10658608
1522 Ga0207689_10035753
1523 Ga0207689_10080790
1524 Ga0207679_10260799
1525 Ga0207679_10407498
1526 Ga0207667_10015657
1527 Ga0207667_10086709
1528 Ga0207667_11737978
1529 Ga0207651_10001708
1530 Ga0207651_10598677
1531 Ga0207712_10043280
1532 Ga0207712_10497846
1533 Ga0207712_10670820
1534 Ga0207668_10029465
1535 Ga0207668_10033903
1536 Ga0207668_10062968
1537 Ga0207668_10190371
1538 Ga0207640_10040878
1539 Ga0207658_10125538
1540 Ga0207658_10202183
1541 Ga0207677_10128344
1542 Ga0207703_10005387
1543 Ga0207703_10006710
1544 Ga0207703_10629909
1545 Ga0207639_10015166
1546 Ga0207639_10016333
1547 Ga0207639_10083547
1548 Ga0207639_10191890
1549 Ga0207639_10229022
1550 Ga0207678_10008170
1551 Ga0207678_10030441
1552 Ga0207678_10120814
1553 Ga0207678_10175240
1554 Ga0207678_10198771
1555 Ga0207708_10009289
1556 Ga0207708_10104745
1557 Ga0207708_10163799
1558 Ga0207641_10200798
1559 Ga0207641_10230533
1560 Ga0207641_10493857
1561 Ga0207641_10602402
1562 Ga0207648_10002750
1563 Ga0207648_10130053
1564 Ga0207648_10209561
1565 Ga0207676_10006730
1566 Ga0207676_10048400
1567 Ga0207674_10014216
1568 Ga0207674_10547536
1569 Ga0207674_10558565
1570 Ga0207675_100005717
1571 Ga0207675_100047285
1572 Ga0207675_100170158
1573 Ga0207675_100293425
1574 Ga0207675_101057516
1575 Ga0207683_10016129
1576 Ga0207683_10054935
1577 Ga0207683_11292757
1578 Ga0207698_10013023
1579 Ga0207698_10120848
1580 Ga0207698_10458620
1581 Ga0207698_10557609
1582 Ga0209588_1002374
1583 Ga0209588_1011067
1584 Ga0209588_1083496
1585 Ga0209813_10058073
1586 Ga0209813_10115654
1587 Ga0207428_10296280
1588 Ga0207428_10556454
1589 Ga0268266_10004998
1590 Ga0268266_10011610
1591 Ga0268266_10705532
1592 Ga0268265_10086876
1593 Ga0268265_10095558
1594 Ga0268265_10139559
1595 Ga0268265_10522026
1596 Ga0268265_11180385
1597 Ga0268265_11831961
1598 Ga0268264_10006546
1599 Ga0268264_10050023
1600 Ga0268264_10085860
1601 Ga0268264_10274108
1602 Ga0268264_10461321
1603 Ga0268264_10547168
1604 Ga0307517_10000066
1605 Ga0265331_10155757
1606 Ga0307513_10371147
1607 Ga0307509_10045343
1608 Ga0307408_100190448
1609 Ga0307408_100244452
1610 Ga0307508_10187670
1611 Ga0265314_10035502
1612 Ga0307516_10044256
1613 Ga0307516_10083837
1614 Ga0307405_10433681
1615 Ga0307410_10206400
1616 Ga0307410_10819756
1617 Ga0307406_10341191
1618 Ga0307406_10950432
1619 Ga0307407_10192431
1620 Ga0307412_10200769
1621 Ga0307409_101664003
1622 Ga0307416_100790461
1623 Ga0307416_101167714
1624 Ga0307414_10654057
1625 Ga0307411_10135066
1626 Ga0307415_100158577
1627 Ga0307415_100600674
1628 Ga0307510_10501130
1629 Ga0373958_0097810
1630 Ga0373938_0011879
1631 Ga0373938_0085483
1632 Ga0373926_0284689
1633 Ga0373928_0149732
1634 Ga0373929_0058557
1635 Ga0373936_0037807
1636 Ga0373936_0084783
1637 Ga0373939_0144617
1638 Ga0373941_0280706
1639 Ga0373945_0021908
1640 Ga0373945_0268186
1641 Ga0373943_0003370
1642 Ga0373943_0022438
1643 Ga0373943_0042686
1644 Ga0373943_0739798
1645 Ga0373946_0184418
1646 Ga0373961_0015040
1647 Ga0373924_0238677
1648 Ga0373931_0004850
1649 Ga0373931_0007968
1650 Ga0373931_0407382
1651 Ga0373935_0000128
1652 Ga0373935_0074836
1653 Ga0373927_0000496
1654 Ga0373927_0005789
1655 Ga0373927_0035473
1656 Ga0373927_0562150
1657 Ga0373947_0001955
1658 Ga0373947_0068804
1659 Ga0373947_0136021
1660 Ga0373937_0020378
1661 Ga0373925_0006551
1662 Ga0373925_0014210
1663 Ga0373925_0025490
1664 Ga0373925_0136494
1665 Ga0373925_0967092
1666 Ga0395899_0165439
1667 Ga0395900_0000962
1668 Ga0395898_0002601
1669 Ga0395898_0087051
1670 Ga0395898_0107991
1671 Ga0395898_0451487
1672 Ga0395898_0708763
1673 Ga0395905_0132877
1674 Ga0395905_0557420
1675 Ga0395905_0761377
1676 Ga0395901_0002873
1677 Ga0395901_0409245
1678 Ga0395901_0737801
1679 Ga0395901_0968655
1680 Ga0395901_1082601
1681 Ga0436360_0571065
1682 Ga0436361_1112783
1683 Ga0436363_0014749
1684 Ga0436362_0050395
1685 Ga0439453_0001876
1686 Ga0439466_0048414
1687 Ga0451791_0233608
1688 Ga0451797_1044080
1689 Ga0451802_0997669
1690 Ga0451807_0408876
1691 Ga0451833_0273741
1692 Ga0451839_1410685
1693 Ga0451853_1315886
1694 Ga0439452_073497
1695 Ga0439435_0006016
1696 Ga0439435_0093735
1697 Ga0439444_0057317
1698 Ga0439460_0094345
1699 Ga0439440_0047810
1700 Ga0466972_0000048
1701 Ga0466968_0015525
1702 Ga0466968_0384425
1703 Ga0495617_014085
1704 Ga0495603_0000104
1705 Ga0495603_0026654
1706 Ga0495590_0017439
1707 Ga0495629_0006415
1708 Ga0495629_0008475
1709 Ga0495629_0115725
1710 Ga0495641_0000402
1711 Ga0495641_0020048
1712 Ga0495653_0127629
1713 Ga0495580_0003617
1714 Ga0495580_0177577
1715 Ga0495582_0000063
1716 Ga0495582_0055645
1717 Ga0495639_0000224
1718 Ga0495639_0158100
1719 Ga0495639_0293702
1720 Ga0495662_0000297
1721 Ga0495664_0020799
1722 Ga0495584_0069162
1723 Ga0495584_0275321
1724 Ga0495594_0001344
1725 Ga0495594_0047295
1726 Ga0495594_0095419
1727 Ga0495594_0259020
1728 Ga0495607_0061979
1729 Ga0495607_0178303
1730 Ga0495606_0115427
1731 Ga0495606_0388531
1732 Ga0495616_0068580
1733 Ga0495616_0299636
1734 Ga0495618_0658926
1735 Ga0495628_0019566
1736 Ga0495628_0025324
1737 Ga0495628_0265615
1738 Ga0495630_0003717
1739 Ga0495631_0073021
1740 Ga0495632_0186660
1741 Ga0495632_0263640
1742 Ga0495637_0075326
1743 Ga0495643_0021009
1744 Ga0495648_0001804
1745 Ga0495648_0147972
1746 Ga0495648_0211009
1747 Ga0495663_0034790
1748 Ga0495666_0003431
1749 Ga0495666_0054890
1750 Ga0495666_0160067
1751 Ga0495652_0231371
1752 Ga0495665_0000290
1753 Ga0495640_0005621
1754 Ga0495598_0015794
1755 Ga0495598_0176445
1756 Ga0495609_0013656
1757 Ga0495597_0167895
1758 Ga0495622_0004071
1759 Ga0495622_0264803
1760 Ga0495633_0082897
1761 Ga0495667_0139368
1762 Ga0495656_0057331
1763 Ga0495656_0219873
1764 Ga0495634_0000645
1765 Ga0495634_0556047
1766 Ga0495625_0323552
1767 Ga0495635_0007816
1768 Ga0495635_0531605
1769 Ga0495659_0058330
1770 Ga0495659_0061441
1771 Ga0495659_0261639
1772 Ga0495588_0032489
1773 Ga0495588_0175070
1774 Ga0495599_0542198
1775 Ga0495658_0000702
1776 Ga0495669_0008345
1777 Ga0495669_0038301
1778 Ga0495669_0063672
1779 Ga0495669_0256402
1780 Ga0495613_0000449
1781 Ga0495624_0000224
1782 Ga0495624_0074122
1783 Ga0495670_0070593
1784 Ga0495671_0015127
1785 Ga0495589_0090806
1786 Ga0495589_0100362
1787 Ga0495660_0334527
1788 Ga0495581_0000168
1789 Ga0495581_0132461
1790 Ga0495604_0164902
1791 Ga0495674_0005032
1792 Ga0495674_0065139
1793 Ga0495674_0311684
1794 Ga0495672_0050066
1795 Ga0495672_0198790
1796 Ga0495672_0357789
1797 Ga0495676_0011951
1798 Ga0495676_0031024
1799 Ga0495676_0064997
1800 Ga0495676_0442640
1801 Ga0495680_0200609
1802 Ga0495683_0052730
1803 Ga0495687_115411
1804 Ga0495687_154668
1805 Ga0495679_102667
1806 Ga0495685_011031
1807 Ga0495685_064237
1808 Ga0495673_0136439
1809 Ga0495684_0017497
1810 Ga0495686_0267486
1811 Ga0495686_0532498
1812 Ga0495593_0000150
1813 Ga0495602_0480368
1814 Ga0495614_0021011
1815 Ga0495614_0196391
1816 Ga0495615_0094013
1817 Ga0495626_0131265
1818 Ga0496100_0004254
1819 Ga0496100_0078021
1820 Ga0496100_0105783
1821 Ga0496101_0031574
1822 Ga0496101_0045043
1823 Ga0496101_0079733
1824 Ga0496101_0570676
1825 Ga0496101_0691726
1826 Ga0496102_0007637
1827 Ga0496102_0039187
1828 Ga0496102_0079462
1829 Ga0496102_0480677
1830 Ga0496102_0960843
1831 Ga0496103_0001066
1832 Ga0496103_0362944
1833 Ga0496104_0005780
1834 Ga0496104_0036010
1835 Ga0496104_0050061
1836 Ga0496104_0232760
1837 Ga0496104_0365402
1838 Ga0496105_0007945
1839 Ga0496105_0098561
1840 Ga0496106_0005311
1841 Ga0496106_0039298
1842 Ga0496106_0078332
1843 Ga0496106_0525154
1844 Ga0496107_0002318
1845 Ga0496107_0009193
1846 Ga0496107_0115296
1847 Ga0496108_0016355
1848 Ga0496108_0093351
1849 Ga0496108_0167765
1850 Ga0496108_0329922
1851 Ga0496109_0041331
1852 Ga0496109_0086868
1853 Ga0496109_0095694
1854 Ga0496109_0292591
1855 Ga0496109_0533594
1856 Ga0496109_0568499
1857 Ga0496109_0578251
1858 Ga0496109_0612738
1859 Ga0496110_0077437
1860 Ga0496110_0124682
1861 Ga0496110_0448083
1862 Ga0496110_0939082
1863 Ga0496111_0027434
1864 Ga0496111_0027782
1865 Ga0496111_0343651
1866 Ga0496111_0631796
1867 Ga0496112_0007218
1868 Ga0496112_0174514
1869 Ga0496112_0262483
1870 Ga0496113_0000496
1871 Ga0496113_0176032
1872 Ga0496113_0292011
1873 Ga0496113_0341690
1874 Ga0496114_0012038
1875 Ga0496114_0013035
1876 Ga0496114_0017866
1877 Ga0496115_0004434
1878 Ga0496115_0008313
1879 Ga0496115_0016948
1880 Ga0496115_0095081
1881 Ga0496115_0113133
1882 Ga0496115_0145338
1883 Ga0496115_0220163
1884 Ga0496115_0273588
1885 Ga0496117_0059519
1886 Ga0496118_0027985
1887 Ga0496118_0234457
1888 Ga0496119_0109364
1889 Ga0496119_0165871
1890 Ga0496121_0004660
1891 Ga0496121_0008147
1892 Ga0496121_0135528
1893 Ga0496121_0215611
1894 Ga0496121_0217523
1895 Ga0496121_0368273
1896 Ga0496121_0431675
1897 Ga0496124_0271024
1898 Ga0496124_0284551
1899 Ga0496125_0077413
1900 Ga0496126_0079844
1901 Ga0496126_0113508
1902 Ga0496126_0198212
1903 Ga0496126_0200586
1904 Ga0496126_0423541
1905 Ga0496126_0972875
1906 Ga0495682_0110488
1907 Ga0495682_0257162
1908 Ga0501032_0003836
1909 Ga0501034_0586099
1910 Ga0501036_0020722
1911 Ga0501038_0046870
1912 Ga0501039_0100043
1913 Ga0501039_0110674
1914 Ga0501039_0710315
1915 Ga0501040_0205164
1916 Ga0501040_0322621
1917 Ga0501041_0877641
1918 Ga0501042_0064693
1919 Ga0501043_0006408
1920 Ga0501043_0164435
1921 Ga0501047_0061951
1922 Ga0501069_0160057
1923 Ga0501071_0017478
1924 Ga0501072_0007865
1925 Ga0501072_0101152
1926 Ga0501072_0109837
1927 Ga0501072_0578457
1928 Ga0501072_1096633
1929 Ga0501073_0389655
1930 Ga0501075_0019695
1931 Ga0501075_0223053
1932 Ga0501075_0519414
1933 Ga0501075_0937640
1934 Ga0501075_0962829
1935 Ga0501076_0047740
1936 Ga0501076_0087775
1937 Ga0501076_0215183
1938 Ga0501076_0468036
1939 Ga0501077_0045269
1940 Ga0501079_0010693
1941 Ga0501079_0367945
1942 Ga0501079_0559658
1943 Ga0501080_0184430
1944 Ga0501083_0009952
1945 Ga0501083_0073057
1946 Ga0501044_0018129
1947 Ga0501045_0041315
1948 Ga0501045_0455647
1949 Ga0501045_0627801
1950 nmdc:mga03683_182057_c1
1951 nmdc:mga03683_30172_c1
1952 nmdc:mga03683_84916_c1
1953 nmdc:mga03n38_1239_c1
1954 nmdc:mga03n38_153340_c1
1955 nmdc:mga03n38_172242_c1
1956 nmdc:mga03n38_28159_c1
1957 nmdc:mga00v17_463660_c1
1958 nmdc:mga0yw44_273642_c1
1959 nmdc:mga0yw44_28870_c1
1960 nmdc:mga0yw44_294353_c1
1961 nmdc:mga0yw44_394_c1
1962 nmdc:mga0yw44_41173_c1
1963 nmdc:mga0yw44_55712_c1
1964 nmdc:mga0yw44_623756_c1
1965 nmdc:mga0yw44_95498_c1
1966 nmdc:mga0k408_121842_c1
1967 nmdc:mga0k408_165252_c1
1968 nmdc:mga0k408_46098_c1
1969 nmdc:mga0k408_54794_c1
1970 nmdc:mga0k408_58624_c1
1971 nmdc:mga06z11_114328_c1
1972 nmdc:mga06z11_1922_c1
1973 nmdc:mga06z11_305965_c1
1974 nmdc:mga06z11_39510_c1
1975 nmdc:mga06z11_523797_c1
1976 nmdc:mga06z11_61050_c1
1977 nmdc:mga04h51_216872_c1
1978 nmdc:mga07m45_228324_c1
1979 nmdc:mga07m45_25926_c1
1980 nmdc:mga07m45_354960_c1
1981 nmdc:mga07m45_55327_c1
1982 nmdc:mga07m45_55888_c1
1983 nmdc:mga05p37_1167662_c1
1984 nmdc:mga05p37_191752_c1
1985 nmdc:mga05p37_973969_c1
1986 nmdc:mga09592_339522_c1
1987 nmdc:mga09592_475031_c1
1988 nmdc:mga0qj67_117654_c1
1989 nmdc:mga0qj67_352417_c1
1990 nmdc:mga06r32_596912_c1
1991 nmdc:mga08y16_312765_c1
1992 nmdc:mga08y16_858895_c1
1993 nmdc:mga08y16_89632_c1
1994 nmdc:mga0n895_429563_c1
1995 nmdc:mga0n895_462834_c1
1996 nmdc:mga0n895_606063_c1
1997 nmdc:mga0n895_797909_c1
1998 nmdc:mga0rr50_219400_c1
1999 nmdc:mga0a205_220424_c1
2000 nmdc:mga0a205_767259_c1
2001 nmdc:mga0a205_94603_c1
2002 nmdc:mga0sz30_21420_c1
2003 nmdc:mga0sz30_39231_c1
2004 Ga0495601_0077341
2005 Ga0495601_0109745
2006 Ga0495601_0174905
2007 Ga0495601_0618217
2008 Ga0495612_0235846
2009 Ga0495612_0275843
2010 Ga0500635_0020830
2011 Ga0495655_0006368
2012 Ga0495655_0116089
2013 Ga0495655_0219671
2014 Ga0495595_0011279
2015 Ga0495595_0026945
2016 Ga0495619_0154365
2017 Ga0495619_0174953
2018 Ga0500643_028564
2019 Ga0500583_0224640
2020 Ga0500651_0010878
2021 Ga0500651_0505754
2022 Ga0500566_0007378
2023 Ga0500566_0008620
2024 Ga0500654_144857
2025 Ga0500554_008364
2026 Ga0500554_010211
2027 Ga0500555_023317
2028 Ga0500593_205228
2029 Ga0500595_005128
2030 Ga0500595_032129
2031 Ga0500595_068216
2032 Ga0500597_273417
2033 Ga0500608_130298
2034 Ga0500618_105851
2035 Ga0500621_034574
2036 Ga0500628_147191
2037 Ga0500642_0027046
2038 Ga0500642_0287771
2039 Ga0500642_0326926
2040 Ga0500652_044110
2041 Ga0500655_043240
2042 Ga0500559_0282552
2043 Ga0500568_0009009
2044 Ga0500568_0083592
2045 Ga0500568_0238613
2046 Ga0500577_0123315
2047 Ga0500579_186773
2048 Ga0500588_0226501
2049 Ga0500603_000894
2050 Ga0500604_0040349
2051 Ga0500604_0121397
2052 Ga0500616_0013390
2053 Ga0500616_0020223
2054 Ga0500620_227568
2055 Ga0500633_0193109
2056 Ga0500634_0091390
2057 Ga0500638_049422
2058 Ga0500636_0012016
2059 Ga0500637_0000172
2060 Ga0500570_163665
2061 Ga0500645_007164
2062 Ga0500609_011699
2063 Ga0500609_012446
2064 Ga0500587_038440
2065 Ga0501084_0021975
2066 Ga0501084_0030992
2067 Ga0501084_0045308
2068 Ga0501084_0093765
2069 Ga0501084_0100816
2070 Ga0501084_0872106
2071 Ga0500661_000719
2072 Ga0590071_046384
2073 Ga0501082_0177554
2074 Ga0501082_0194582
2075 Ga0501082_0414460
2076 Ga0501082_1561435
2077 Ga0530510_0027025
2078 2513653116
2079 2513694326
2080 2513699143
2081 2723849151
2082 2793078492
2083 2818243388
2084 2824622545
2085 2824633906
2086 2824642349
2087 2824649889
2088 2824684151
2089 2824722367
2090 2824730133
2091 2824738869
2092 2824752531
2093 2842044073
2094 2842051938
2095 2857515809
2096 2874606910
2097 2874621429
2098 2879112580
2099 2885368176
2100 2888378822
2101 2888391200
2102 2889036154
2103 2904668098
2104 2906635062
2105 2908783012
2106 2922364532
2107 2922389216
2108 2922400957
2109 2935634722
2110 2941511948
2111 2941519650
2112 2941527658
2113 3005509715
2114 8006928191
2115 8006967692
2116 8006992654
2117 8006998359
2118 8056678397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

35

192

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uwa-assembly1.cif.gz_A crystal structure of a probable peptide deformylase from synechococcus phage s-ssm7 0.963 16 166
1s17-assembly2.cif.gz_B identification of novel potent bicyclic peptide deformylase inhibitors 0.955 14 182
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.955 16 167
1lry-assembly1.cif.gz_A crystal structure of p. aeruginosa peptide deformylase complexed with antibiotic actinonin 0.9547 14 182
3fwx-assembly2.cif.gz_B the crystal structure of the peptide deformylase from vibrio cholerae o1 biovar el tor str. n16961 0.9547 16 183
ID Description Score Start End Superfamily
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9547 16 167 3.90.45.10
3uwaA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9506 16 166 3.90.45.10
3uwaA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9378 16 166 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9237 17 162 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9228 16 167 3.90.45.10
ID Description Score Start End GO Terms
AF-A5ESQ7-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9986 16 187 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A7Y6WAE8-F1-model_v4 deleted 0.9878 13 187
AF-A0A840GKR2-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9867 13 185 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-Q1QH78-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9851 13 187 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A346A0W7-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9837 13 185 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map