F489125
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1054 | 322 | 1054 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300026067|Ga0207678_10293719|Ga0207678_102937192 |
| Length | 245 |
| Sequence | MRKVAESTVRRLSLYLRFLEEFEGQGIGTVSSGALASRGGTTSAQVRKDLSFFGSFGKRGLGYPVPELADRLREILGLKRRYRVGMIGAGKIGSALVQYRGFKQRGFDIVAIFDSDPGKVGRQWNGLTVLDIGSLEKELQHRPVDMAVLVVPADVAQAVTDRLVSLRIKAILNFAPVQLSVPGRSGTTWSLSSARRPATRLRYRPLVASTPVGTAAAGTPSASSRVRSATRTGIGPAGSEPRRHR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 186 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 196 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 197 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 198 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 210 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 211 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 212 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 213 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 214 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 215 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 216 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 217 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 220 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 223 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 250 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 251 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 254 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 258 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 289 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 290 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 291 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 293 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 295 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 300 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 301 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 302 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 303 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 318 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 319 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 320 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.65 |
| Rhizosphere | 95.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10007216 | 3300005293 | Unclassified | 4966 |
| 2 | Ga0065715_10128475 | 3300005293 | Unclassified | 2054 |
| 3 | Ga0065715_10312085 | 3300005293 | Bacteria | 1018 |
| 4 | Ga0070658_10447835 | 3300005327 | Bacteria | 1112 |
| 5 | Ga0070676_10004346 | 3300005328 | Bacteria | 7442 |
| 6 | Ga0070676_10043650 | 3300005328 | Bacteria | 2606 |
| 7 | Ga0070683_100007640 | 3300005329 | Bacteria | 9148 |
| 8 | Ga0070683_100021254 | 3300005329 | Bacteria | 5788 |
| 9 | Ga0070683_100027949 | 3300005329 | Bacteria | 5093 |
| 10 | Ga0070683_100067628 | 3300005329 | Unclassified | 3328 |
| 11 | Ga0070683_100093088 | 3300005329 | Unclassified | 2831 |
| 12 | Ga0070690_100134340 | 3300005330 | Bacteria | 1674 |
| 13 | Ga0070670_100007272 | 3300005331 | Bacteria | 9388 |
| 14 | Ga0070670_100018024 | 3300005331 | Bacteria | 6059 |
| 15 | Ga0068869_100010103 | 3300005334 | Bacteria | 6142 |
| 16 | Ga0068869_100045781 | 3300005334 | Unclassified | 3151 |
| 17 | Ga0068869_100213560 | 3300005334 | Bacteria | 1526 |
| 18 | Ga0070666_10043206 | 3300005335 | Bacteria | 3017 |
| 19 | Ga0070666_10215595 | 3300005335 | Viruses | 1353 |
| 20 | Ga0070680_100017722 | 3300005336 | Bacteria | 5617 |
| 21 | Ga0070680_100019668 | 3300005336 | Bacteria | 5355 |
| 22 | Ga0070680_100021822 | 3300005336 | Bacteria | 5093 |
| 23 | Ga0070680_100077626 | 3300005336 | Bacteria | 2735 |
| 24 | Ga0070680_101006097 | 3300005336 | Bacteria | 720 |
| 25 | Ga0068868_100479970 | 3300005338 | Viruses | 1086 |
| 26 | Ga0070660_100012909 | 3300005339 | Bacteria | 5977 |
| 27 | Ga0070660_100788044 | 3300005339 | Bacteria | 799 |
| 28 | Ga0070689_100014547 | 3300005340 | Bacteria | 5719 |
| 29 | Ga0070689_100497411 | 3300005340 | Bacteria | 1044 |
| 30 | Ga0070689_100588177 | 3300005340 | Unclassified | 963 |
| 31 | Ga0070691_10038281 | 3300005341 | Unclassified | 2264 |
| 32 | Ga0070691_10154926 | 3300005341 | Bacteria | 1177 |
| 33 | Ga0070687_100000721 | 3300005343 | Bacteria | 10993 |
| 34 | Ga0070687_100039931 | 3300005343 | Bacteria | 2361 |
| 35 | Ga0070687_100239869 | 3300005343 | Unclassified | 1120 |
| 36 | Ga0070687_100405796 | 3300005343 | Unclassified | 895 |
| 37 | Ga0070661_100002985 | 3300005344 | Bacteria | 11659 |
| 38 | Ga0070661_100003797 | 3300005344 | Bacteria | 10410 |
| 39 | Ga0070661_100010685 | 3300005344 | Bacteria | 6387 |
| 40 | Ga0070661_100190236 | 3300005344 | Bacteria | 1565 |
| 41 | Ga0070692_10017287 | 3300005345 | Bacteria | 3444 |
| 42 | Ga0070692_10121601 | 3300005345 | Bacteria | 1457 |
| 43 | Ga0070668_100003043 | 3300005347 | Bacteria | 12405 |
| 44 | Ga0070668_100006902 | 3300005347 | Bacteria | 8416 |
| 45 | Ga0070668_100216914 | 3300005347 | Bacteria | 1576 |
| 46 | Ga0070668_100292142 | 3300005347 | Bacteria | 1365 |
| 47 | Ga0070668_100350769 | 3300005347 | Unclassified | 1249 |
| 48 | Ga0070668_100686890 | 3300005347 | Bacteria | 902 |
| 49 | Ga0070669_100003079 | 3300005353 | Bacteria | 12001 |
| 50 | Ga0070669_100017058 | 3300005353 | Bacteria | 5181 |
| 51 | Ga0070669_100075028 | 3300005353 | Unclassified | 2507 |
| 52 | Ga0070675_100002631 | 3300005354 | Bacteria | 13492 |
| 53 | Ga0070675_100002663 | 3300005354 | Bacteria | 13424 |
| 54 | Ga0070675_100138851 | 3300005354 | Bacteria | 2076 |
| 55 | Ga0070675_100214432 | 3300005354 | Unclassified | 1675 |
| 56 | Ga0070675_100247540 | 3300005354 | Bacteria | 1559 |
| 57 | Ga0070671_100008957 | 3300005355 | Bacteria | 8031 |
| 58 | Ga0070671_100046843 | 3300005355 | Bacteria | 3596 |
| 59 | Ga0070671_100364816 | 3300005355 | Bacteria | 1233 |
| 60 | Ga0070674_100000488 | 3300005356 | Bacteria | 19938 |
| 61 | Ga0070674_100072803 | 3300005356 | Bacteria | 2435 |
| 62 | Ga0070674_100190297 | 3300005356 | Bacteria | 1578 |
| 63 | Ga0070673_100209157 | 3300005364 | Bacteria | 1684 |
| 64 | Ga0070673_100665717 | 3300005364 | Viruses | 954 |
| 65 | Ga0070659_100032565 | 3300005366 | Bacteria | 4044 |
| 66 | Ga0070659_100040066 | 3300005366 | Bacteria | 3660 |
| 67 | Ga0070659_100106827 | 3300005366 | Bacteria | 2257 |
| 68 | Ga0070667_100031097 | 3300005367 | Bacteria | 4450 |
| 69 | Ga0070667_100034583 | 3300005367 | Bacteria | 4229 |
| 70 | Ga0070703_10010292 | 3300005406 | Bacteria | 2636 |
| 71 | Ga0070703_10036920 | 3300005406 | Bacteria | 1504 |
| 72 | Ga0070709_10001038 | 3300005434 | Bacteria | 15360 |
| 73 | Ga0070714_100695684 | 3300005435 | Unclassified | 981 |
| 74 | Ga0070714_101315730 | 3300005435 | Unclassified | 705 |
| 75 | Ga0070710_10473430 | 3300005437 | Bacteria | 853 |
| 76 | Ga0070701_10001843 | 3300005438 | Bacteria | 8029 |
| 77 | Ga0070701_10036828 | 3300005438 | Bacteria | 2467 |
| 78 | Ga0070701_10145421 | 3300005438 | Viruses | 1360 |
| 79 | Ga0070701_10291613 | 3300005438 | Bacteria | 1000 |
| 80 | Ga0070711_100000466 | 3300005439 | Bacteria | 21169 |
| 81 | Ga0070711_100023504 | 3300005439 | Bacteria | 4010 |
| 82 | Ga0070711_100848300 | 3300005439 | Unclassified | 777 |
| 83 | Ga0070705_100006728 | 3300005440 | Bacteria | 5651 |
| 84 | Ga0070705_100007632 | 3300005440 | Bacteria | 5333 |
| 85 | Ga0070705_100017903 | 3300005440 | Bacteria | 3704 |
| 86 | Ga0070705_100026351 | 3300005440 | Unclassified | 3163 |
| 87 | Ga0070705_100043456 | 3300005440 | Bacteria | 2575 |
| 88 | Ga0070705_100062806 | 3300005440 | Bacteria | 2213 |
| 89 | Ga0070705_100074184 | 3300005440 | Bacteria | 2067 |
| 90 | Ga0070705_100126097 | 3300005440 | Bacteria | 1662 |
| 91 | Ga0070705_100127156 | 3300005440 | Bacteria | 1656 |
| 92 | Ga0070705_100135142 | 3300005440 | Bacteria | 1614 |
| 93 | Ga0070705_100334102 | 3300005440 | Bacteria | 1099 |
| 94 | Ga0070700_100348856 | 3300005441 | Bacteria | 1096 |
| 95 | Ga0070694_100003097 | 3300005444 | Bacteria | 9899 |
| 96 | Ga0070694_100030940 | 3300005444 | Bacteria | 3506 |
| 97 | Ga0070694_100056858 | 3300005444 | Bacteria | 2658 |
| 98 | Ga0070694_100057125 | 3300005444 | Bacteria | 2652 |
| 99 | Ga0070694_100073489 | 3300005444 | Unclassified | 2362 |
| 100 | Ga0070694_100096665 | 3300005444 | Unclassified | 2082 |
| 101 | Ga0070694_100274155 | 3300005444 | Bacteria | 1284 |
| 102 | Ga0070694_100384377 | 3300005444 | Bacteria | 1095 |
| 103 | Ga0070694_100440633 | 3300005444 | Bacteria | 1027 |
| 104 | Ga0070694_100550095 | 3300005444 | Viruses | 924 |
| 105 | Ga0070708_100001912 | 3300005445 | Bacteria | 16029 |
| 106 | Ga0070708_100006646 | 3300005445 | Bacteria | 9207 |
| 107 | Ga0070708_100010515 | 3300005445 | Bacteria | 7502 |
| 108 | Ga0070708_100036977 | 3300005445 | Bacteria | 4257 |
| 109 | Ga0070708_100084138 | 3300005445 | Unclassified | 2885 |
| 110 | Ga0070708_100128115 | 3300005445 | Bacteria | 2348 |
| 111 | Ga0070708_100128852 | 3300005445 | Bacteria | 2341 |
| 112 | Ga0070708_100248140 | 3300005445 | Bacteria | 1672 |
| 113 | Ga0070708_100592787 | 3300005445 | Bacteria | 1045 |
| 114 | Ga0070708_100669044 | 3300005445 | Unclassified | 978 |
| 115 | Ga0070708_100687208 | 3300005445 | Bacteria | 963 |
| 116 | Ga0070708_100922511 | 3300005445 | Unclassified | 820 |
| 117 | Ga0070708_100934980 | 3300005445 | Bacteria | 814 |
| 118 | Ga0070678_100161220 | 3300005456 | Unclassified | 1817 |
| 119 | Ga0070662_100000129 | 3300005457 | Bacteria | 42187 |
| 120 | Ga0070662_100000760 | 3300005457 | Bacteria | 19801 |
| 121 | Ga0070662_100008788 | 3300005457 | Bacteria | 6588 |
| 122 | Ga0070662_100065735 | 3300005457 | Bacteria | 2659 |
| 123 | Ga0070662_100182492 | 3300005457 | Unclassified | 1655 |
| 124 | Ga0070662_100594760 | 3300005457 | Unclassified | 930 |
| 125 | Ga0070681_10000404 | 3300005458 | Bacteria | 35078 |
| 126 | Ga0070681_10008932 | 3300005458 | Bacteria | 9851 |
| 127 | Ga0070681_10034221 | 3300005458 | Bacteria | 5103 |
| 128 | Ga0070681_10034328 | 3300005458 | Bacteria | 5093 |
| 129 | Ga0070681_10066860 | 3300005458 | Bacteria | 3563 |
| 130 | Ga0070681_10441395 | 3300005458 | Bacteria | 1213 |
| 131 | Ga0068867_100124515 | 3300005459 | Bacteria | 1996 |
| 132 | Ga0068867_100143039 | 3300005459 | Bacteria | 1871 |
| 133 | Ga0068867_100148924 | 3300005459 | Unclassified | 1837 |
| 134 | Ga0068867_100565452 | 3300005459 | Bacteria | 987 |
| 135 | Ga0070685_10005049 | 3300005466 | Bacteria | 6692 |
| 136 | Ga0070685_10202810 | 3300005466 | Bacteria | 1290 |
| 137 | Ga0070685_10371405 | 3300005466 | Bacteria | 983 |
| 138 | Ga0070706_100002003 | 3300005467 | Bacteria | 20963 |
| 139 | Ga0070706_100007900 | 3300005467 | Bacteria | 9934 |
| 140 | Ga0070706_100011664 | 3300005467 | Bacteria | 8163 |
| 141 | Ga0070706_100124841 | 3300005467 | Bacteria | 2400 |
| 142 | Ga0070706_100217196 | 3300005467 | Bacteria | 1785 |
| 143 | Ga0070706_100373973 | 3300005467 | Unclassified | 1327 |
| 144 | Ga0070707_100001277 | 3300005468 | Bacteria | 24773 |
| 145 | Ga0070707_100038114 | 3300005468 | Bacteria | 4590 |
| 146 | Ga0070707_100046622 | 3300005468 | Bacteria | 4148 |
| 147 | Ga0070707_100048969 | 3300005468 | Bacteria | 4050 |
| 148 | Ga0070707_100058383 | 3300005468 | Bacteria | 3700 |
| 149 | Ga0070707_100066765 | 3300005468 | Bacteria | 3457 |
| 150 | Ga0070707_100075107 | 3300005468 | Bacteria | 3260 |
| 151 | Ga0070707_100085921 | 3300005468 | Bacteria | 3042 |
| 152 | Ga0070707_100102325 | 3300005468 | Bacteria | 2775 |
| 153 | Ga0070707_100170879 | 3300005468 | Unclassified | 2118 |
| 154 | Ga0070707_100244924 | 3300005468 | Bacteria | 1744 |
| 155 | Ga0070707_100499887 | 3300005468 | Bacteria | 1178 |
| 156 | Ga0070707_100533355 | 3300005468 | Unclassified | 1136 |
| 157 | Ga0070707_100669126 | 3300005468 | Unclassified | 1001 |
| 158 | Ga0070707_100919206 | 3300005468 | Archaea | 840 |
| 159 | Ga0070698_100000416 | 3300005471 | Bacteria | 45414 |
| 160 | Ga0070698_100090622 | 3300005471 | Bacteria | 3041 |
| 161 | Ga0070698_100100245 | 3300005471 | Unclassified | 2869 |
| 162 | Ga0070698_100100765 | 3300005471 | Bacteria | 2860 |
| 163 | Ga0070698_100123841 | 3300005471 | Bacteria | 2543 |
| 164 | Ga0070698_100128532 | 3300005471 | Bacteria | 2490 |
| 165 | Ga0070698_100431334 | 3300005471 | Bacteria | 1253 |
| 166 | Ga0070698_100528810 | 3300005471 | Bacteria | 1118 |
| 167 | Ga0070699_100003038 | 3300005518 | Bacteria | 14886 |
| 168 | Ga0070699_100009267 | 3300005518 | Bacteria | 8527 |
| 169 | Ga0070699_100010664 | 3300005518 | Bacteria | 7953 |
| 170 | Ga0070699_100013305 | 3300005518 | Bacteria | 7096 |
| 171 | Ga0070699_100014085 | 3300005518 | Bacteria | 6880 |
| 172 | Ga0070699_100017344 | 3300005518 | Bacteria | 6183 |
| 173 | Ga0070699_100018436 | 3300005518 | Bacteria | 5995 |
| 174 | Ga0070699_100079657 | 3300005518 | Unclassified | 2854 |
| 175 | Ga0070699_100179100 | 3300005518 | Bacteria | 1880 |
| 176 | Ga0070699_100199342 | 3300005518 | Bacteria | 1780 |
| 177 | Ga0070679_100033038 | 3300005530 | Bacteria | 5120 |
| 178 | Ga0070679_100066262 | 3300005530 | Bacteria | 3599 |
| 179 | Ga0070679_100067534 | 3300005530 | Bacteria | 3565 |
| 180 | Ga0070679_100214351 | 3300005530 | Unclassified | 1888 |
| 181 | Ga0070679_100423381 | 3300005530 | Bacteria | 1277 |
| 182 | Ga0070679_100483111 | 3300005530 | Bacteria | 1183 |
| 183 | Ga0070684_100035266 | 3300005535 | Bacteria | 4281 |
| 184 | Ga0070684_100154609 | 3300005535 | Bacteria | 2079 |
| 185 | Ga0070684_100879141 | 3300005535 | Unclassified | 839 |
| 186 | Ga0070697_100026418 | 3300005536 | Bacteria | 4637 |
| 187 | Ga0070697_100030232 | 3300005536 | Bacteria | 4351 |
| 188 | Ga0070697_100035632 | 3300005536 | Bacteria | 4015 |
| 189 | Ga0070697_100129065 | 3300005536 | Bacteria | 2119 |
| 190 | Ga0070697_100130880 | 3300005536 | Bacteria | 2104 |
| 191 | Ga0070697_100189640 | 3300005536 | Bacteria | 1744 |
| 192 | Ga0070697_100207453 | 3300005536 | Unclassified | 1667 |
| 193 | Ga0070697_100245902 | 3300005536 | Unclassified | 1529 |
| 194 | Ga0070697_100597370 | 3300005536 | Unclassified | 970 |
| 195 | Ga0070697_100824964 | 3300005536 | Bacteria | 821 |
| 196 | Ga0068853_100035310 | 3300005539 | Bacteria | 4246 |
| 197 | Ga0068853_100041839 | 3300005539 | Bacteria | 3916 |
| 198 | Ga0068853_100878130 | 3300005539 | Bacteria | 861 |
| 199 | Ga0070672_100004984 | 3300005543 | Bacteria | 8750 |
| 200 | Ga0070672_100007479 | 3300005543 | Bacteria | 7416 |
| 201 | Ga0070672_100276024 | 3300005543 | Unclassified | 1420 |
| 202 | Ga0070686_100000009 | 3300005544 | Bacteria | 202453 |
| 203 | Ga0070686_100362911 | 3300005544 | Bacteria | 1092 |
| 204 | Ga0070695_100001483 | 3300005545 | Bacteria | 13033 |
| 205 | Ga0070695_100024381 | 3300005545 | Bacteria | 3725 |
| 206 | Ga0070695_100030673 | 3300005545 | Bacteria | 3349 |
| 207 | Ga0070695_100054884 | 3300005545 | Bacteria | 2566 |
| 208 | Ga0070695_100062812 | 3300005545 | Bacteria | 2412 |
| 209 | Ga0070696_100001111 | 3300005546 | Bacteria | 17408 |
| 210 | Ga0070696_100001375 | 3300005546 | Bacteria | 15888 |
| 211 | Ga0070696_100005541 | 3300005546 | Bacteria | 8430 |
| 212 | Ga0070696_100013879 | 3300005546 | Bacteria | 5409 |
| 213 | Ga0070696_100018452 | 3300005546 | Bacteria | 4715 |
| 214 | Ga0070696_100029352 | 3300005546 | Bacteria | 3758 |
| 215 | Ga0070696_100043304 | 3300005546 | Bacteria | 3114 |
| 216 | Ga0070696_100076908 | 3300005546 | Bacteria | 2357 |
| 217 | Ga0070696_100236896 | 3300005546 | Unclassified | 1375 |
| 218 | Ga0070696_100313931 | 3300005546 | Bacteria | 1204 |
| 219 | Ga0070696_100352650 | 3300005546 | Bacteria | 1140 |
| 220 | Ga0070696_100377528 | 3300005546 | Unclassified | 1104 |
| 221 | Ga0070696_100797357 | 3300005546 | Unclassified | 777 |
| 222 | Ga0070665_100038936 | 3300005548 | Bacteria | 4780 |
| 223 | Ga0070665_100222772 | 3300005548 | Bacteria | 1887 |
| 224 | Ga0070704_100000588 | 3300005549 | Bacteria | 17506 |
| 225 | Ga0070704_100003470 | 3300005549 | Bacteria | 9046 |
| 226 | Ga0070704_100007259 | 3300005549 | Bacteria | 6592 |
| 227 | Ga0070704_100013024 | 3300005549 | Bacteria | 5149 |
| 228 | Ga0070704_100039533 | 3300005549 | Bacteria | 3239 |
| 229 | Ga0070704_100045565 | 3300005549 | Bacteria | 3052 |
| 230 | Ga0070704_100063131 | 3300005549 | Bacteria | 2658 |
| 231 | Ga0070704_100071452 | 3300005549 | Bacteria | 2522 |
| 232 | Ga0070704_100098504 | 3300005549 | Unclassified | 2197 |
| 233 | Ga0070704_100102755 | 3300005549 | Bacteria | 2157 |
| 234 | Ga0070704_100597461 | 3300005549 | Unclassified | 969 |
| 235 | Ga0068855_100002169 | 3300005563 | Bacteria | 24243 |
| 236 | Ga0068855_100008571 | 3300005563 | Bacteria | 12363 |
| 237 | Ga0068855_100431684 | 3300005563 | Bacteria | 1440 |
| 238 | Ga0070664_100013154 | 3300005564 | Bacteria | 6738 |
| 239 | Ga0070664_100055026 | 3300005564 | Bacteria | 3377 |
| 240 | Ga0070664_100178129 | 3300005564 | Unclassified | 1888 |
| 241 | Ga0070664_100655957 | 3300005564 | Viruses | 975 |
| 242 | Ga0068857_100012151 | 3300005577 | Bacteria | 7490 |
| 243 | Ga0068857_100015739 | 3300005577 | Bacteria | 6617 |
| 244 | Ga0068857_100038294 | 3300005577 | Bacteria | 4247 |
| 245 | Ga0068857_100321695 | 3300005577 | Bacteria | 1429 |
| 246 | Ga0068854_100000340 | 3300005578 | Bacteria | 30112 |
| 247 | Ga0068854_100022362 | 3300005578 | Bacteria | 4306 |
| 248 | Ga0068854_100033175 | 3300005578 | Unclassified | 3598 |
| 249 | Ga0068854_100252585 | 3300005578 | Viruses | 1408 |
| 250 | Ga0068856_100279771 | 3300005614 | Bacteria | 1685 |
| 251 | Ga0070702_100069343 | 3300005615 | Bacteria | 2077 |
| 252 | Ga0070702_100313996 | 3300005615 | Unclassified | 1089 |
| 253 | Ga0070702_100472602 | 3300005615 | Bacteria | 914 |
| 254 | Ga0068852_100014974 | 3300005616 | Bacteria | 5995 |
| 255 | Ga0068852_100341916 | 3300005616 | Bacteria | 1459 |
| 256 | Ga0068852_100532599 | 3300005616 | Unclassified | 1173 |
| 257 | Ga0068859_100024587 | 3300005617 | Bacteria | 6043 |
| 258 | Ga0068859_100041401 | 3300005617 | Bacteria | 4627 |
| 259 | Ga0068859_100084308 | 3300005617 | Bacteria | 3223 |
| 260 | Ga0068859_100092148 | 3300005617 | Unclassified | 3082 |
| 261 | Ga0068859_100123908 | 3300005617 | Unclassified | 2652 |
| 262 | Ga0068859_100207078 | 3300005617 | Unclassified | 2047 |
| 263 | Ga0068864_100005386 | 3300005618 | Bacteria | 10484 |
| 264 | Ga0068864_100028566 | 3300005618 | Bacteria | 4716 |
| 265 | Ga0068864_100160067 | 3300005618 | Bacteria | 2046 |
| 266 | Ga0068864_100312225 | 3300005618 | Bacteria | 1474 |
| 267 | Ga0068866_10034008 | 3300005718 | Unclassified | 2479 |
| 268 | Ga0068866_10261636 | 3300005718 | Bacteria | 1063 |
| 269 | Ga0068861_100001019 | 3300005719 | Bacteria | 17119 |
| 270 | Ga0068861_100029592 | 3300005719 | Bacteria | 4007 |
| 271 | Ga0068861_100120743 | 3300005719 | Bacteria | 2114 |
| 272 | Ga0068851_10019723 | 3300005834 | Unclassified | 3259 |
| 273 | Ga0068851_10152903 | 3300005834 | Bacteria | 1263 |
| 274 | Ga0068870_10034892 | 3300005840 | Bacteria | 2577 |
| 275 | Ga0068863_100197091 | 3300005841 | Unclassified | 1936 |
| 276 | Ga0068858_100022826 | 3300005842 | Bacteria | 5836 |
| 277 | Ga0068858_100606486 | 3300005842 | Bacteria | 1062 |
| 278 | Ga0068860_100051734 | 3300005843 | Unclassified | 3907 |
| 279 | Ga0068862_100000376 | 3300005844 | Bacteria | 48418 |
| 280 | Ga0068862_100041901 | 3300005844 | Bacteria | 3897 |
| 281 | Ga0068862_100324123 | 3300005844 | Unclassified | 1423 |
| 282 | Ga0068862_100334963 | 3300005844 | Viruses | 1400 |
| 283 | Ga0068862_100364246 | 3300005844 | Bacteria | 1344 |
| 284 | Ga0068862_100567900 | 3300005844 | Unclassified | 1085 |
| 285 | Ga0068862_100982150 | 3300005844 | Bacteria | 834 |
| 286 | Ga0081455_10062368 | 3300005937 | Unclassified | 3133 |
| 287 | Ga0070716_100000833 | 3300006173 | Bacteria | 13306 |
| 288 | Ga0070716_100021974 | 3300006173 | Bacteria | 3368 |
| 289 | Ga0097621_100193378 | 3300006237 | Bacteria | 1763 |
| 290 | Ga0097621_100407040 | 3300006237 | Bacteria | 1219 |
| 291 | Ga0068871_100129749 | 3300006358 | Bacteria | 2136 |
| 292 | Ga0068871_100203893 | 3300006358 | Bacteria | 1708 |
| 293 | Ga0075428_100012227 | 3300006844 | Bacteria | 9544 |
| 294 | Ga0075428_100039690 | 3300006844 | Bacteria | 5181 |
| 295 | Ga0075428_100053259 | 3300006844 | Bacteria | 4433 |
| 296 | Ga0075428_100072344 | 3300006844 | Bacteria | 3767 |
| 297 | Ga0075428_100145551 | 3300006844 | Bacteria | 2575 |
| 298 | Ga0075428_100223245 | 3300006844 | Bacteria | 2034 |
| 299 | Ga0075428_100365366 | 3300006844 | Unclassified | 1548 |
| 300 | Ga0075428_100764461 | 3300006844 | Bacteria | 1028 |
| 301 | Ga0075428_100951921 | 3300006844 | Unclassified | 910 |
| 302 | Ga0075430_100001512 | 3300006846 | Bacteria | 18961 |
| 303 | Ga0075430_100076112 | 3300006846 | Bacteria | 2813 |
| 304 | Ga0075430_100082279 | 3300006846 | Bacteria | 2698 |
| 305 | Ga0075430_100323968 | 3300006846 | Bacteria | 1274 |
| 306 | Ga0075430_100542015 | 3300006846 | Bacteria | 960 |
| 307 | Ga0075430_100668780 | 3300006846 | Bacteria | 856 |
| 308 | Ga0075431_100018358 | 3300006847 | Bacteria | 7122 |
| 309 | Ga0075431_100026846 | 3300006847 | Bacteria | 5906 |
| 310 | Ga0075431_100033603 | 3300006847 | Bacteria | 5285 |
| 311 | Ga0075431_100063746 | 3300006847 | Bacteria | 3803 |
| 312 | Ga0075431_100147443 | 3300006847 | Bacteria | 2424 |
| 313 | Ga0075431_100158257 | 3300006847 | Bacteria | 2330 |
| 314 | Ga0075431_100250032 | 3300006847 | Bacteria | 1801 |
| 315 | Ga0075433_10000946 | 3300006852 | Bacteria | 20505 |
| 316 | Ga0075433_10005348 | 3300006852 | Bacteria | 10079 |
| 317 | Ga0075433_10025979 | 3300006852 | Bacteria | 4953 |
| 318 | Ga0075433_10321274 | 3300006852 | Bacteria | 1369 |
| 319 | Ga0075433_10440267 | 3300006852 | Bacteria | 1149 |
| 320 | Ga0075433_10639739 | 3300006852 | Unclassified | 933 |
| 321 | Ga0075433_10807733 | 3300006852 | Bacteria | 819 |
| 322 | Ga0075434_100001804 | 3300006871 | Bacteria | 18514 |
| 323 | Ga0075434_100019680 | 3300006871 | Bacteria | 6533 |
| 324 | Ga0075434_100024095 | 3300006871 | Bacteria | 5945 |
| 325 | Ga0075434_100024719 | 3300006871 | Bacteria | 5874 |
| 326 | Ga0075434_100040831 | 3300006871 | Bacteria | 4595 |
| 327 | Ga0075434_100068612 | 3300006871 | Bacteria | 3533 |
| 328 | Ga0075434_100069113 | 3300006871 | Unclassified | 3521 |
| 329 | Ga0075434_100171720 | 3300006871 | Unclassified | 2188 |
| 330 | Ga0075434_100238699 | 3300006871 | Bacteria | 1838 |
| 331 | Ga0075434_100336748 | 3300006871 | Bacteria | 1529 |
| 332 | Ga0075434_100679966 | 3300006871 | Bacteria | 1047 |
| 333 | Ga0075434_100925217 | 3300006871 | Bacteria | 887 |
| 334 | Ga0075429_100000283 | 3300006880 | Bacteria | 35844 |
| 335 | Ga0075429_100047346 | 3300006880 | Bacteria | 3740 |
| 336 | Ga0075429_100086698 | 3300006880 | Bacteria | 2729 |
| 337 | Ga0075429_100336505 | 3300006880 | Unclassified | 1321 |
| 338 | Ga0075429_100428266 | 3300006880 | Bacteria | 1159 |
| 339 | Ga0075429_101039616 | 3300006880 | Bacteria | 716 |
| 340 | Ga0068865_100001514 | 3300006881 | Bacteria | 13558 |
| 341 | Ga0075436_100000724 | 3300006914 | Bacteria | 21850 |
| 342 | Ga0075436_100011903 | 3300006914 | Bacteria | 5969 |
| 343 | Ga0075436_100017487 | 3300006914 | Bacteria | 4909 |
| 344 | Ga0075436_100020245 | 3300006914 | Bacteria | 4566 |
| 345 | Ga0075436_100021360 | 3300006914 | Bacteria | 4444 |
| 346 | Ga0075436_100051691 | 3300006914 | Bacteria | 2835 |
| 347 | Ga0075436_100063252 | 3300006914 | Bacteria | 2558 |
| 348 | Ga0075436_100095001 | 3300006914 | Bacteria | 2073 |
| 349 | Ga0075436_100111267 | 3300006914 | Unclassified | 1912 |
| 350 | Ga0075436_100248356 | 3300006914 | Bacteria | 1267 |
| 351 | Ga0075436_100285399 | 3300006914 | Bacteria | 1181 |
| 352 | Ga0075436_100310931 | 3300006914 | Unclassified | 1131 |
| 353 | Ga0097620_100024587 | 3300006931 | Bacteria | 6043 |
| 354 | Ga0097620_100041401 | 3300006931 | Bacteria | 4627 |
| 355 | Ga0097620_100084305 | 3300006931 | Bacteria | 3223 |
| 356 | Ga0097620_100092145 | 3300006931 | Unclassified | 3082 |
| 357 | Ga0097620_100123906 | 3300006931 | Unclassified | 2652 |
| 358 | Ga0097620_100207071 | 3300006931 | Unclassified | 2047 |
| 359 | Ga0075435_100018599 | 3300007076 | Bacteria | 5290 |
| 360 | Ga0075435_100029043 | 3300007076 | Unclassified | 4339 |
| 361 | Ga0075435_100054584 | 3300007076 | Bacteria | 3225 |
| 362 | Ga0075435_100079712 | 3300007076 | Bacteria | 2687 |
| 363 | Ga0075435_100107146 | 3300007076 | Bacteria | 2321 |
| 364 | Ga0075435_100272455 | 3300007076 | Bacteria | 1444 |
| 365 | Ga0075435_100283173 | 3300007076 | Unclassified | 1415 |
| 366 | Ga0075435_100326916 | 3300007076 | Bacteria | 1313 |
| 367 | Ga0075435_100477580 | 3300007076 | Bacteria | 1076 |
| 368 | Ga0075435_100586612 | 3300007076 | Unclassified | 966 |
| 369 | Ga0099794_10000151 | 3300007265 | Bacteria | 25673 |
| 370 | Ga0099794_10252118 | 3300007265 | Archaea | 910 |
| 371 | Ga0099795_10074192 | 3300007788 | Bacteria | 1289 |
| 372 | Ga0105240_10009204 | 3300009093 | Bacteria | 14007 |
| 373 | Ga0105240_10073620 | 3300009093 | Bacteria | 4218 |
| 374 | Ga0105240_10247240 | 3300009093 | Bacteria | 2065 |
| 375 | Ga0105240_10250937 | 3300009093 | Unclassified | 2046 |
| 376 | Ga0105240_10634142 | 3300009093 | Viruses | 1173 |
| 377 | Ga0111539_10040798 | 3300009094 | Bacteria | 5585 |
| 378 | Ga0111539_10042342 | 3300009094 | Bacteria | 5469 |
| 379 | Ga0111539_10198280 | 3300009094 | Bacteria | 2342 |
| 380 | Ga0111539_10458637 | 3300009094 | Bacteria | 1484 |
| 381 | Ga0111539_10796253 | 3300009094 | Bacteria | 1100 |
| 382 | Ga0105245_10259377 | 3300009098 | Bacteria | 1691 |
| 383 | Ga0105245_10851268 | 3300009098 | Bacteria | 952 |
| 384 | Ga0105245_11322516 | 3300009098 | Bacteria | 770 |
| 385 | Ga0105247_10468529 | 3300009101 | Bacteria | 912 |
| 386 | Ga0114129_10000918 | 3300009147 | Bacteria | 38424 |
| 387 | Ga0114129_10063870 | 3300009147 | Bacteria | 5139 |
| 388 | Ga0114129_10172875 | 3300009147 | Bacteria | 2944 |
| 389 | Ga0114129_10234795 | 3300009147 | Bacteria | 2468 |
| 390 | Ga0114129_10314094 | 3300009147 | Unclassified | 2085 |
| 391 | Ga0114129_10408301 | 3300009147 | Unclassified | 1789 |
| 392 | Ga0114129_10936551 | 3300009147 | Bacteria | 1095 |
| 393 | Ga0114129_11171065 | 3300009147 | Bacteria | 959 |
| 394 | Ga0114129_11224902 | 3300009147 | Bacteria | 934 |
| 395 | Ga0114129_11792669 | 3300009147 | Unclassified | 747 |
| 396 | Ga0105243_10097773 | 3300009148 | Bacteria | 2430 |
| 397 | Ga0105241_10024142 | 3300009174 | Bacteria | 4515 |
| 398 | Ga0105242_10011475 | 3300009176 | Bacteria | 6812 |
| 399 | Ga0105242_11075700 | 3300009176 | Bacteria | 817 |
| 400 | Ga0105248_10009365 | 3300009177 | Bacteria | 10781 |
| 401 | Ga0105248_10011120 | 3300009177 | Bacteria | 9932 |
| 402 | Ga0105248_10025929 | 3300009177 | Bacteria | 6519 |
| 403 | Ga0105248_10130172 | 3300009177 | Bacteria | 2839 |
| 404 | Ga0105248_10224601 | 3300009177 | Bacteria | 2114 |
| 405 | Ga0105248_10243631 | 3300009177 | Bacteria | 2024 |
| 406 | Ga0105248_10289252 | 3300009177 | Unclassified | 1845 |
| 407 | Ga0105248_10479142 | 3300009177 | Unclassified | 1402 |
| 408 | Ga0105248_11548738 | 3300009177 | Bacteria | 751 |
| 409 | Ga0105238_10000082 | 3300009551 | Bacteria | 107565 |
| 410 | Ga0105238_10235186 | 3300009551 | Bacteria | 1809 |
| 411 | Ga0105249_10000115 | 3300009553 | Bacteria | 108581 |
| 412 | Ga0105249_10000454 | 3300009553 | Bacteria | 38498 |
| 413 | Ga0105249_10020862 | 3300009553 | Bacteria | 5858 |
| 414 | Ga0105249_10108483 | 3300009553 | Bacteria | 2621 |
| 415 | Ga0105249_11413995 | 3300009553 | Bacteria | 768 |
| 416 | Ga0105249_11636261 | 3300009553 | Unclassified | 716 |
| 417 | Ga0105239_10033512 | 3300010375 | Bacteria | 5640 |
| 418 | Ga0105246_10019318 | 3300011119 | Bacteria | 4352 |
| 419 | Ga0105246_10517035 | 3300011119 | Bacteria | 1017 |
| 420 | Ga0157373_10001473 | 3300013100 | Bacteria | 17949 |
| 421 | Ga0157373_10266861 | 3300013100 | Bacteria | 1212 |
| 422 | Ga0157373_10538689 | 3300013100 | Bacteria | 846 |
| 423 | Ga0157371_10007275 | 3300013102 | Bacteria | 8992 |
| 424 | Ga0157370_10044947 | 3300013104 | Bacteria | 4241 |
| 425 | Ga0157370_10120885 | 3300013104 | Unclassified | 2445 |
| 426 | Ga0157370_10140254 | 3300013104 | Bacteria | 2252 |
| 427 | Ga0157370_10459742 | 3300013104 | Unclassified | 1170 |
| 428 | Ga0157369_10083371 | 3300013105 | Bacteria | 3420 |
| 429 | Ga0157369_10107160 | 3300013105 | Bacteria | 2973 |
| 430 | Ga0157369_10241902 | 3300013105 | Unclassified | 1885 |
| 431 | Ga0157369_10302334 | 3300013105 | Bacteria | 1664 |
| 432 | Ga0157374_10235614 | 3300013296 | Viruses | 1799 |
| 433 | Ga0157378_10061192 | 3300013297 | Bacteria | 3359 |
| 434 | Ga0157378_10709408 | 3300013297 | Unclassified | 1026 |
| 435 | Ga0163162_10001492 | 3300013306 | Bacteria | 21813 |
| 436 | Ga0163162_10009352 | 3300013306 | Bacteria | 9529 |
| 437 | Ga0163162_10013828 | 3300013306 | Bacteria | 7885 |
| 438 | Ga0157372_10015470 | 3300013307 | Bacteria | 8178 |
| 439 | Ga0157372_10019583 | 3300013307 | Bacteria | 7293 |
| 440 | Ga0157372_10126831 | 3300013307 | Bacteria | 2935 |
| 441 | Ga0157375_10025086 | 3300013308 | Bacteria | 5530 |
| 442 | Ga0157375_10086208 | 3300013308 | Unclassified | 3191 |
| 443 | Ga0157375_10149733 | 3300013308 | Bacteria | 2468 |
| 444 | Ga0157375_10326904 | 3300013308 | Bacteria | 1698 |
| 445 | Ga0157375_10696491 | 3300013308 | Unclassified | 1170 |
| 446 | Ga0157375_11193294 | 3300013308 | Unclassified | 893 |
| 447 | Ga0163163_10068100 | 3300014325 | Bacteria | 3541 |
| 448 | Ga0157380_10007646 | 3300014326 | Bacteria | 7684 |
| 449 | Ga0157380_10027037 | 3300014326 | Bacteria | 4360 |
| 450 | Ga0157380_10615788 | 3300014326 | Bacteria | 1077 |
| 451 | Ga0182008_10009299 | 3300014497 | Bacteria | 5312 |
| 452 | Ga0157377_10005403 | 3300014745 | Bacteria | 6004 |
| 453 | Ga0157379_10098332 | 3300014968 | Bacteria | 2627 |
| 454 | Ga0157376_10050743 | 3300014969 | Unclassified | 3443 |
| 455 | Ga0157376_10401354 | 3300014969 | Unclassified | 1326 |
| 456 | Ga0163161_10033434 | 3300017792 | Bacteria | 3675 |
| 457 | Ga0163161_10039316 | 3300017792 | Bacteria | 3395 |
| 458 | Ga0163161_10339454 | 3300017792 | Bacteria | 1191 |
| 459 | Ga0213875_10016088 | 3300021388 | Bacteria | 3628 |
| 460 | Ga0207697_10013577 | 3300025315 | Bacteria | 3397 |
| 461 | Ga0207656_10020155 | 3300025321 | Unclassified | 2647 |
| 462 | Ga0207653_10000333 | 3300025885 | Bacteria | 24834 |
| 463 | Ga0207653_10004243 | 3300025885 | Bacteria | 4502 |
| 464 | Ga0207653_10007863 | 3300025885 | Bacteria | 3323 |
| 465 | Ga0207653_10009549 | 3300025885 | Bacteria | 3024 |
| 466 | Ga0207653_10027001 | 3300025885 | Bacteria | 1842 |
| 467 | Ga0207642_10008584 | 3300025899 | Unclassified | 3514 |
| 468 | Ga0207680_10062554 | 3300025903 | Bacteria | 2275 |
| 469 | Ga0207680_10584370 | 3300025903 | Bacteria | 798 |
| 470 | Ga0207685_10410385 | 3300025905 | Bacteria | 696 |
| 471 | Ga0207699_10003303 | 3300025906 | Bacteria | 7687 |
| 472 | Ga0207699_10004172 | 3300025906 | Bacteria | 6922 |
| 473 | Ga0207645_10000246 | 3300025907 | Bacteria | 44995 |
| 474 | Ga0207645_10000971 | 3300025907 | Bacteria | 23712 |
| 475 | Ga0207643_10049854 | 3300025908 | Bacteria | 2373 |
| 476 | Ga0207684_10025853 | 3300025910 | Bacteria | 5003 |
| 477 | Ga0207684_10049207 | 3300025910 | Bacteria | 3576 |
| 478 | Ga0207684_10052400 | 3300025910 | Bacteria | 3463 |
| 479 | Ga0207684_10056409 | 3300025910 | Bacteria | 3332 |
| 480 | Ga0207684_10194667 | 3300025910 | Bacteria | 1749 |
| 481 | Ga0207684_10289501 | 3300025910 | Bacteria | 1412 |
| 482 | Ga0207684_10373488 | 3300025910 | Bacteria | 1227 |
| 483 | Ga0207684_10469940 | 3300025910 | Unclassified | 1079 |
| 484 | Ga0207654_10086132 | 3300025911 | Bacteria | 1904 |
| 485 | Ga0207707_10000929 | 3300025912 | Bacteria | 28400 |
| 486 | Ga0207707_10004279 | 3300025912 | Bacteria | 12632 |
| 487 | Ga0207707_10012211 | 3300025912 | Bacteria | 7468 |
| 488 | Ga0207707_10018172 | 3300025912 | Bacteria | 6127 |
| 489 | Ga0207707_10355257 | 3300025912 | Bacteria | 1262 |
| 490 | Ga0207695_10001441 | 3300025913 | Bacteria | 39845 |
| 491 | Ga0207695_10020766 | 3300025913 | Bacteria | 7513 |
| 492 | Ga0207695_10296436 | 3300025913 | Unclassified | 1509 |
| 493 | Ga0207693_10054679 | 3300025915 | Bacteria | 3131 |
| 494 | Ga0207663_10000556 | 3300025916 | Bacteria | 16472 |
| 495 | Ga0207663_10152376 | 3300025916 | Bacteria | 1623 |
| 496 | Ga0207663_10425943 | 3300025916 | Unclassified | 1019 |
| 497 | Ga0207660_10001809 | 3300025917 | Bacteria | 14242 |
| 498 | Ga0207660_10013503 | 3300025917 | Bacteria | 5353 |
| 499 | Ga0207660_10061332 | 3300025917 | Bacteria | 2706 |
| 500 | Ga0207660_10061487 | 3300025917 | Bacteria | 2703 |
| 501 | Ga0207660_10066366 | 3300025917 | Bacteria | 2610 |
| 502 | Ga0207660_10131532 | 3300025917 | Unclassified | 1905 |
| 503 | Ga0207660_10365278 | 3300025917 | Unclassified | 1158 |
| 504 | Ga0207660_10430414 | 3300025917 | Bacteria | 1065 |
| 505 | Ga0207662_10003079 | 3300025918 | Bacteria | 8511 |
| 506 | Ga0207662_10039369 | 3300025918 | Unclassified | 2773 |
| 507 | Ga0207662_10356264 | 3300025918 | Unclassified | 984 |
| 508 | Ga0207657_10021232 | 3300025919 | Bacteria | 6115 |
| 509 | Ga0207657_10069828 | 3300025919 | Unclassified | 2979 |
| 510 | Ga0207649_10025399 | 3300025920 | Bacteria | 3454 |
| 511 | Ga0207649_10082210 | 3300025920 | Bacteria | 2088 |
| 512 | Ga0207649_10203801 | 3300025920 | Unclassified | 1399 |
| 513 | Ga0207649_10482632 | 3300025920 | Viruses | 940 |
| 514 | Ga0207649_10664380 | 3300025920 | Bacteria | 806 |
| 515 | Ga0207649_10845717 | 3300025920 | Bacteria | 716 |
| 516 | Ga0207652_10000470 | 3300025921 | Bacteria | 41380 |
| 517 | Ga0207652_10008367 | 3300025921 | Bacteria | 8321 |
| 518 | Ga0207652_10253236 | 3300025921 | Bacteria | 1588 |
| 519 | Ga0207652_10625068 | 3300025921 | Unclassified | 964 |
| 520 | Ga0207652_10708038 | 3300025921 | Viruses | 898 |
| 521 | Ga0207652_11017790 | 3300025921 | Bacteria | 727 |
| 522 | Ga0207646_10003762 | 3300025922 | Bacteria | 16914 |
| 523 | Ga0207646_10013412 | 3300025922 | Bacteria | 7838 |
| 524 | Ga0207646_10021064 | 3300025922 | Bacteria | 6029 |
| 525 | Ga0207646_10040328 | 3300025922 | Bacteria | 4199 |
| 526 | Ga0207646_10044148 | 3300025922 | Bacteria | 4001 |
| 527 | Ga0207646_10076152 | 3300025922 | Bacteria | 2998 |
| 528 | Ga0207646_10082816 | 3300025922 | Unclassified | 2869 |
| 529 | Ga0207646_10090878 | 3300025922 | Bacteria | 2733 |
| 530 | Ga0207646_10153252 | 3300025922 | Bacteria | 2078 |
| 531 | Ga0207646_10329127 | 3300025922 | Bacteria | 1380 |
| 532 | Ga0207646_10490266 | 3300025922 | Bacteria | 1108 |
| 533 | Ga0207681_10002554 | 3300025923 | Bacteria | 11555 |
| 534 | Ga0207681_10009785 | 3300025923 | Bacteria | 5864 |
| 535 | Ga0207681_10576670 | 3300025923 | Bacteria | 928 |
| 536 | Ga0207694_10000031 | 3300025924 | Bacteria | 223403 |
| 537 | Ga0207650_10004487 | 3300025925 | Bacteria | 9540 |
| 538 | Ga0207659_10024660 | 3300025926 | Bacteria | 4033 |
| 539 | Ga0207659_10158062 | 3300025926 | Unclassified | 1777 |
| 540 | Ga0207659_10365751 | 3300025926 | Bacteria | 1200 |
| 541 | Ga0207687_10220796 | 3300025927 | Bacteria | 1492 |
| 542 | Ga0207700_10493556 | 3300025928 | Unclassified | 1083 |
| 543 | Ga0207664_10039793 | 3300025929 | Unclassified | 3650 |
| 544 | Ga0207664_10485805 | 3300025929 | Unclassified | 1105 |
| 545 | Ga0207644_10006147 | 3300025931 | Bacteria | 7830 |
| 546 | Ga0207690_10092018 | 3300025932 | Bacteria | 2145 |
| 547 | Ga0207690_10823234 | 3300025932 | Bacteria | 768 |
| 548 | Ga0207706_10000065 | 3300025933 | Bacteria | 109080 |
| 549 | Ga0207706_10000240 | 3300025933 | Bacteria | 60370 |
| 550 | Ga0207706_10000357 | 3300025933 | Bacteria | 49369 |
| 551 | Ga0207706_10091758 | 3300025933 | Bacteria | 2670 |
| 552 | Ga0207706_10107710 | 3300025933 | Unclassified | 2452 |
| 553 | Ga0207706_10254057 | 3300025933 | Unclassified | 1535 |
| 554 | Ga0207686_10001117 | 3300025934 | Bacteria | 15528 |
| 555 | Ga0207686_10038002 | 3300025934 | Unclassified | 2909 |
| 556 | Ga0207709_10207796 | 3300025935 | Bacteria | 1403 |
| 557 | Ga0207709_10656970 | 3300025935 | Viruses | 835 |
| 558 | Ga0207669_10001479 | 3300025937 | Bacteria | 10039 |
| 559 | Ga0207669_10013476 | 3300025937 | Bacteria | 4062 |
| 560 | Ga0207704_10024309 | 3300025938 | Bacteria | 3283 |
| 561 | Ga0207704_10030332 | 3300025938 | Bacteria | 3031 |
| 562 | Ga0207704_10701737 | 3300025938 | Bacteria | 838 |
| 563 | Ga0207665_10001273 | 3300025939 | Bacteria | 17022 |
| 564 | Ga0207665_10144401 | 3300025939 | Bacteria | 1700 |
| 565 | Ga0207691_10022438 | 3300025940 | Bacteria | 5953 |
| 566 | Ga0207691_10042373 | 3300025940 | Bacteria | 4197 |
| 567 | Ga0207691_10069335 | 3300025940 | Bacteria | 3185 |
| 568 | Ga0207691_10310100 | 3300025940 | Bacteria | 1354 |
| 569 | Ga0207691_10358062 | 3300025940 | Bacteria | 1248 |
| 570 | Ga0207691_10717182 | 3300025940 | Bacteria | 843 |
| 571 | Ga0207711_10028892 | 3300025941 | Bacteria | 4671 |
| 572 | Ga0207711_10453324 | 3300025941 | Viruses | 1194 |
| 573 | Ga0207711_10477947 | 3300025941 | Unclassified | 1161 |
| 574 | Ga0207711_10486027 | 3300025941 | Bacteria | 1150 |
| 575 | Ga0207689_10007750 | 3300025942 | Bacteria | 9398 |
| 576 | Ga0207689_10027696 | 3300025942 | Unclassified | 4743 |
| 577 | Ga0207661_10001946 | 3300025944 | Bacteria | 14195 |
| 578 | Ga0207661_10011833 | 3300025944 | Bacteria | 6336 |
| 579 | Ga0207661_10076562 | 3300025944 | Bacteria | 2748 |
| 580 | Ga0207661_10619641 | 3300025944 | Unclassified | 994 |
| 581 | Ga0207679_10000484 | 3300025945 | Bacteria | 27676 |
| 582 | Ga0207679_10006509 | 3300025945 | Bacteria | 7385 |
| 583 | Ga0207679_10009273 | 3300025945 | Bacteria | 6296 |
| 584 | Ga0207679_10119853 | 3300025945 | Bacteria | 2092 |
| 585 | Ga0207667_10011137 | 3300025949 | Bacteria | 10468 |
| 586 | Ga0207667_10229710 | 3300025949 | Unclassified | 1900 |
| 587 | Ga0207667_10398274 | 3300025949 | Bacteria | 1402 |
| 588 | Ga0207712_10000499 | 3300025961 | Bacteria | 32439 |
| 589 | Ga0207712_10001176 | 3300025961 | Bacteria | 18145 |
| 590 | Ga0207712_10013123 | 3300025961 | Bacteria | 5308 |
| 591 | Ga0207712_10195094 | 3300025961 | Viruses | 1601 |
| 592 | Ga0207712_11069500 | 3300025961 | Unclassified | 717 |
| 593 | Ga0207668_10003474 | 3300025972 | Bacteria | 9246 |
| 594 | Ga0207668_10103366 | 3300025972 | Unclassified | 2121 |
| 595 | Ga0207668_10181836 | 3300025972 | Bacteria | 1659 |
| 596 | Ga0207668_10278097 | 3300025972 | Bacteria | 1371 |
| 597 | Ga0207668_10520089 | 3300025972 | Bacteria | 1026 |
| 598 | Ga0207640_10001456 | 3300025981 | Bacteria | 12799 |
| 599 | Ga0207640_10097863 | 3300025981 | Unclassified | 2049 |
| 600 | Ga0207640_10168468 | 3300025981 | Bacteria | 1629 |
| 601 | Ga0207640_10287036 | 3300025981 | Unclassified | 1295 |
| 602 | Ga0207658_10069022 | 3300025986 | Unclassified | 2669 |
| 603 | Ga0207658_10086716 | 3300025986 | Bacteria | 2415 |
| 604 | Ga0207677_10090705 | 3300026023 | Unclassified | 2221 |
| 605 | Ga0207703_10013898 | 3300026035 | Bacteria | 6276 |
| 606 | Ga0207703_10123347 | 3300026035 | Bacteria | 2227 |
| 607 | Ga0207639_10004358 | 3300026041 | Bacteria | 9545 |
| 608 | Ga0207639_10081332 | 3300026041 | Unclassified | 2565 |
| 609 | Ga0207639_10719660 | 3300026041 | Bacteria | 927 |
| 610 | Ga0207678_10293719 | 3300026067 | Bacteria | 1396 |
| 611 | Ga0207678_10418043 | 3300026067 | Unclassified | 1162 |
| 612 | Ga0207708_10048583 | 3300026075 | Unclassified | 3230 |
| 613 | Ga0207708_10718818 | 3300026075 | Bacteria | 855 |
| 614 | Ga0207702_10493602 | 3300026078 | Unclassified | 1193 |
| 615 | Ga0207641_10027354 | 3300026088 | Bacteria | 4709 |
| 616 | Ga0207641_10053544 | 3300026088 | Bacteria | 3421 |
| 617 | Ga0207648_10001169 | 3300026089 | Bacteria | 29362 |
| 618 | Ga0207648_10005220 | 3300026089 | Bacteria | 13139 |
| 619 | Ga0207648_10032931 | 3300026089 | Bacteria | 4573 |
| 620 | Ga0207648_10081119 | 3300026089 | Bacteria | 2830 |
| 621 | Ga0207648_10405160 | 3300026089 | Bacteria | 1236 |
| 622 | Ga0207676_10085386 | 3300026095 | Bacteria | 2576 |
| 623 | Ga0207676_10094646 | 3300026095 | Bacteria | 2462 |
| 624 | Ga0207676_10131582 | 3300026095 | Bacteria | 2128 |
| 625 | Ga0207676_11210984 | 3300026095 | Bacteria | 748 |
| 626 | Ga0207674_10003135 | 3300026116 | Bacteria | 20383 |
| 627 | Ga0207674_10015526 | 3300026116 | Bacteria | 8364 |
| 628 | Ga0207674_10018565 | 3300026116 | Bacteria | 7555 |
| 629 | Ga0207674_10106289 | 3300026116 | Unclassified | 2784 |
| 630 | Ga0207674_10471392 | 3300026116 | Bacteria | 1213 |
| 631 | Ga0207675_100000320 | 3300026118 | Bacteria | 45668 |
| 632 | Ga0207675_100052078 | 3300026118 | Bacteria | 3820 |
| 633 | Ga0207675_100053417 | 3300026118 | Bacteria | 3770 |
| 634 | Ga0207675_100233958 | 3300026118 | Unclassified | 1773 |
| 635 | Ga0207675_101194559 | 3300026118 | Bacteria | 781 |
| 636 | Ga0207683_10034731 | 3300026121 | Bacteria | 4383 |
| 637 | Ga0207698_10013973 | 3300026142 | Bacteria | 5318 |
| 638 | Ga0207698_10165264 | 3300026142 | Viruses | 1941 |
| 639 | Ga0207698_10597062 | 3300026142 | Bacteria | 1088 |
| 640 | Ga0209588_1003279 | 3300027671 | Bacteria | 4474 |
| 641 | Ga0209588_1053508 | 3300027671 | Bacteria | 1306 |
| 642 | Ga0209998_10021291 | 3300027717 | Unclassified | 1392 |
| 643 | Ga0209974_10032789 | 3300027876 | Unclassified | 1722 |
| 644 | Ga0209974_10035554 | 3300027876 | Bacteria | 1655 |
| 645 | Ga0209974_10053204 | 3300027876 | Unclassified | 1363 |
| 646 | Ga0207428_10070482 | 3300027907 | Unclassified | 2747 |
| 647 | Ga0207428_10279829 | 3300027907 | Bacteria | 1239 |
| 648 | Ga0207428_10344024 | 3300027907 | Unclassified | 1098 |
| 649 | Ga0268266_10297444 | 3300028379 | Bacteria | 1505 |
| 650 | Ga0268266_10345674 | 3300028379 | Bacteria | 1397 |
| 651 | Ga0268266_10606989 | 3300028379 | Bacteria | 1051 |
| 652 | Ga0268265_10002121 | 3300028380 | Bacteria | 15384 |
| 653 | Ga0268265_10385158 | 3300028380 | Bacteria | 1291 |
| 654 | Ga0268265_10904024 | 3300028380 | Bacteria | 867 |
| 655 | Ga0268264_10056897 | 3300028381 | Unclassified | 3269 |
| 656 | Ga0268264_10479044 | 3300028381 | Bacteria | 1210 |
| 657 | Ga0316182_1400452 | 3300030745 | Bacteria | 1098 |
| 658 | Ga0307408_100023852 | 3300031548 | Unclassified | 4171 |
| 659 | Ga0307408_100033838 | 3300031548 | Unclassified | 3574 |
| 660 | Ga0307408_100252115 | 3300031548 | Bacteria | 1456 |
| 661 | Ga0307408_100961497 | 3300031548 | Bacteria | 785 |
| 662 | Ga0307413_10019867 | 3300031824 | Bacteria | 3560 |
| 663 | Ga0307413_10034699 | 3300031824 | Bacteria | 2886 |
| 664 | Ga0307413_10064281 | 3300031824 | Bacteria | 2279 |
| 665 | Ga0307413_10138214 | 3300031824 | Unclassified | 1679 |
| 666 | Ga0307413_10342712 | 3300031824 | Bacteria | 1150 |
| 667 | Ga0307410_10002152 | 3300031852 | Bacteria | 9368 |
| 668 | Ga0307410_10034713 | 3300031852 | Bacteria | 3270 |
| 669 | Ga0307410_10066181 | 3300031852 | Bacteria | 2488 |
| 670 | Ga0307410_10085329 | 3300031852 | Unclassified | 2228 |
| 671 | Ga0307410_10111755 | 3300031852 | Bacteria | 1978 |
| 672 | Ga0307410_10159460 | 3300031852 | Bacteria | 1689 |
| 673 | Ga0307410_10260503 | 3300031852 | Unclassified | 1352 |
| 674 | Ga0307410_10397990 | 3300031852 | Bacteria | 1112 |
| 675 | Ga0307410_10406662 | 3300031852 | Bacteria | 1101 |
| 676 | Ga0307406_10001688 | 3300031901 | Bacteria | 12133 |
| 677 | Ga0307406_10002595 | 3300031901 | Bacteria | 9848 |
| 678 | Ga0307406_10212389 | 3300031901 | Bacteria | 1432 |
| 679 | Ga0307406_10396758 | 3300031901 | Unclassified | 1092 |
| 680 | Ga0307406_10731548 | 3300031901 | Bacteria | 829 |
| 681 | Ga0307407_10046330 | 3300031903 | Unclassified | 2461 |
| 682 | Ga0307407_10082309 | 3300031903 | Bacteria | 1950 |
| 683 | Ga0307407_10084847 | 3300031903 | Bacteria | 1925 |
| 684 | Ga0307407_10229529 | 3300031903 | Bacteria | 1260 |
| 685 | Ga0307412_10026367 | 3300031911 | Unclassified | 3612 |
| 686 | Ga0307412_10179634 | 3300031911 | Bacteria | 1590 |
| 687 | Ga0307412_10472627 | 3300031911 | Bacteria | 1038 |
| 688 | Ga0307409_100000144 | 3300031995 | Bacteria | 26764 |
| 689 | Ga0307409_100092871 | 3300031995 | Unclassified | 2478 |
| 690 | Ga0307409_100130147 | 3300031995 | Unclassified | 2149 |
| 691 | Ga0307409_100189263 | 3300031995 | Unclassified | 1830 |
| 692 | Ga0307409_100460620 | 3300031995 | Unclassified | 1229 |
| 693 | Ga0307409_100482112 | 3300031995 | Bacteria | 1204 |
| 694 | Ga0307409_100602088 | 3300031995 | Bacteria | 1086 |
| 695 | Ga0307409_100673242 | 3300031995 | Bacteria | 1031 |
| 696 | Ga0307409_101365291 | 3300031995 | Unclassified | 734 |
| 697 | Ga0307416_100000828 | 3300032002 | Bacteria | 16247 |
| 698 | Ga0307416_100012718 | 3300032002 | Bacteria | 5685 |
| 699 | Ga0307416_100014248 | 3300032002 | Bacteria | 5438 |
| 700 | Ga0307416_100098157 | 3300032002 | Unclassified | 2539 |
| 701 | Ga0307416_100101715 | 3300032002 | Bacteria | 2503 |
| 702 | Ga0307416_100219380 | 3300032002 | Bacteria | 1822 |
| 703 | Ga0307416_100449360 | 3300032002 | Unclassified | 1341 |
| 704 | Ga0307414_10002383 | 3300032004 | Bacteria | 9831 |
| 705 | Ga0307414_10080065 | 3300032004 | Unclassified | 2387 |
| 706 | Ga0307414_10115391 | 3300032004 | Unclassified | 2054 |
| 707 | Ga0307414_10121089 | 3300032004 | Bacteria | 2012 |
| 708 | Ga0307414_10128285 | 3300032004 | Unclassified | 1964 |
| 709 | Ga0307414_10182198 | 3300032004 | Bacteria | 1690 |
| 710 | Ga0307414_10301355 | 3300032004 | Bacteria | 1356 |
| 711 | Ga0307414_10325274 | 3300032004 | Bacteria | 1310 |
| 712 | Ga0307414_10902365 | 3300032004 | Unclassified | 810 |
| 713 | Ga0307411_10010876 | 3300032005 | Unclassified | 4877 |
| 714 | Ga0307411_10017282 | 3300032005 | Bacteria | 4105 |
| 715 | Ga0307411_10043167 | 3300032005 | Bacteria | 2883 |
| 716 | Ga0307411_10212673 | 3300032005 | Bacteria | 1494 |
| 717 | Ga0307411_10572506 | 3300032005 | Unclassified | 967 |
| 718 | Ga0307411_10728649 | 3300032005 | Bacteria | 866 |
| 719 | Ga0307411_10849291 | 3300032005 | Bacteria | 807 |
| 720 | Ga0307415_100000419 | 3300032126 | Bacteria | 18192 |
| 721 | Ga0307415_100119421 | 3300032126 | Unclassified | 1973 |
| 722 | Ga0307415_100791815 | 3300032126 | Unclassified | 864 |
| 723 | Ga0373930_0013841 | 3300034816 | Unclassified | 1493 |
| 724 | Ga0373948_0028390 | 3300034817 | Bacteria | 1114 |
| 725 | Ga0373958_0051750 | 3300034819 | Viruses | 869 |
| 726 | Ga0373959_0000187 | 3300034820 | Bacteria | 13809 |
| 727 | Ga0373959_0007997 | 3300034820 | Bacteria | 1788 |
| 728 | Ga0373959_0039204 | 3300034820 | Bacteria | 988 |
| 729 | Ga0373932_0104442 | 3300035112 | Bacteria | 926 |
| 730 | Ga0373942_0077912 | 3300035207 | Bacteria | 979 |
| 731 | Ga0373961_0016222 | 3300035241 | Bacteria | 1917 |
| 732 | Ga0373931_0008014 | 3300035691 | Bacteria | 4998 |
| 733 | Ga0373931_0190774 | 3300035691 | Bacteria | 1219 |
| 734 | Ga0373937_1040561 | 3300036401 | Bacteria | 767 |
| 735 | Ga0373925_0402602 | 3300037068 | Unclassified | 1116 |
| 736 | Ga0395900_0005143 | 3300037418 | Bacteria | 13738 |
| 737 | Ga0395905_0035452 | 3300037471 | Bacteria | 4685 |
| 738 | Ga0395905_0309388 | 3300037471 | Bacteria | 1468 |
| 739 | Ga0395905_0338329 | 3300037471 | Bacteria | 1396 |
| 740 | Ga0395905_0773182 | 3300037471 | Archaea | 863 |
| 741 | Ga0436364_0532547 | 3300037853 | Bacteria | 5851 |
| 742 | Ga0436364_0890989 | 3300037853 | Bacteria | 915 |
| 743 | Ga0395901_0044634 | 3300038443 | Bacteria | 4597 |
| 744 | Ga0395901_0057802 | 3300038443 | Bacteria | 4034 |
| 745 | Ga0242419_002517 | 3300038698 | Unclassified | 1195 |
| 746 | Ga0242420_003855 | 3300038996 | Bacteria | 2238 |
| 747 | Ga0242420_053365 | 3300038996 | Bacteria | 794 |
| 748 | Ga0439439_0013448 | 3300041406 | Bacteria | 1983 |
| 749 | Ga0439462_0020084 | 3300042015 | Bacteria | 1742 |
| 750 | Ga0450896_011065 | 3300042133 | Unclassified | 1269 |
| 751 | Ga0450898_015309 | 3300042134 | Unclassified | 1298 |
| 752 | Ga0439446_0079940 | 3300042156 | Bacteria | 1011 |
| 753 | Ga0439434_0038539 | 3300042435 | Bacteria | 1465 |
| 754 | Ga0439435_0037204 | 3300042436 | Bacteria | 1348 |
| 755 | Ga0439435_0121832 | 3300042436 | Bacteria | 818 |
| 756 | Ga0451577_0036034 | 3300042876 | Bacteria | 4456 |
| 757 | Ga0451577_0063065 | 3300042876 | Unclassified | 3305 |
| 758 | Ga0451577_0354058 | 3300042876 | Bacteria | 1332 |
| 759 | Ga0451577_0415277 | 3300042876 | Bacteria | 1222 |
| 760 | Ga0451577_0497896 | 3300042876 | Bacteria | 1106 |
| 761 | Ga0451577_0530573 | 3300042876 | Unclassified | 1069 |
| 762 | Ga0466969_0142939 | 3300044656 | Bacteria | 1105 |
| 763 | Ga0453683_0006036 | 3300044673 | Bacteria | 8348 |
| 764 | Ga0453683_0067639 | 3300044673 | Unclassified | 2233 |
| 765 | Ga0453683_0097817 | 3300044673 | Unclassified | 1842 |
| 766 | Ga0453683_0168349 | 3300044673 | Bacteria | 1388 |
| 767 | Ga0453683_0169580 | 3300044673 | Bacteria | 1382 |
| 768 | Ga0453683_0448630 | 3300044673 | Unclassified | 834 |
| 769 | Ga0466961_0025997 | 3300044693 | Bacteria | 3763 |
| 770 | Ga0453684_0678154 | 3300044712 | Bacteria | 1122 |
| 771 | Ga0466960_0116553 | 3300044901 | Bacteria | 1394 |
| 772 | Ga0451576_0011287 | 3300045051 | Bacteria | 10167 |
| 773 | Ga0451576_0018762 | 3300045051 | Bacteria | 7564 |
| 774 | Ga0451576_0043756 | 3300045051 | Bacteria | 4723 |
| 775 | Ga0451576_0045737 | 3300045051 | Bacteria | 4608 |
| 776 | Ga0451576_0046962 | 3300045051 | Bacteria | 4542 |
| 777 | Ga0451576_0074983 | 3300045051 | Unclassified | 3520 |
| 778 | Ga0451576_0374847 | 3300045051 | Bacteria | 1491 |
| 779 | Ga0451576_0447126 | 3300045051 | Unclassified | 1356 |
| 780 | Ga0451576_0915442 | 3300045051 | Unclassified | 920 |
| 781 | Ga0495603_0012157 | 3300046455 | Bacteria | 5213 |
| 782 | Ga0495603_0209644 | 3300046455 | Bacteria | 1125 |
| 783 | Ga0495629_0305980 | 3300046459 | Unclassified | 1088 |
| 784 | Ga0495580_0170505 | 3300046472 | Bacteria | 1505 |
| 785 | Ga0495582_0032465 | 3300046473 | Bacteria | 2871 |
| 786 | Ga0495582_0270231 | 3300046473 | Unclassified | 975 |
| 787 | Ga0495594_0021241 | 3300046499 | Bacteria | 3464 |
| 788 | Ga0495594_0022950 | 3300046499 | Bacteria | 3341 |
| 789 | Ga0495630_0091977 | 3300046517 | Bacteria | 2292 |
| 790 | Ga0495663_0018531 | 3300046525 | Unclassified | 1983 |
| 791 | Ga0495666_0046762 | 3300046526 | Bacteria | 2085 |
| 792 | Ga0495640_0104669 | 3300046533 | Bacteria | 1854 |
| 793 | Ga0495586_0029017 | 3300046535 | Bacteria | 2961 |
| 794 | Ga0495621_0176849 | 3300046539 | Bacteria | 850 |
| 795 | Ga0495667_0079978 | 3300046559 | Bacteria | 2125 |
| 796 | Ga0495634_0033648 | 3300046642 | Bacteria | 3521 |
| 797 | Ga0495647_0039774 | 3300046681 | Bacteria | 1784 |
| 798 | Ga0495647_0075435 | 3300046681 | Unclassified | 1357 |
| 799 | Ga0495658_0161334 | 3300046683 | Bacteria | 1383 |
| 800 | Ga0495613_0133508 | 3300046689 | Bacteria | 1777 |
| 801 | Ga0495636_0135626 | 3300047318 | Bacteria | 1097 |
| 802 | Ga0495636_0198977 | 3300047318 | Unclassified | 914 |
| 803 | Ga0495674_0280408 | 3300047319 | Bacteria | 1365 |
| 804 | Ga0495676_0174190 | 3300047321 | Bacteria | 1512 |
| 805 | Ga0495680_0059177 | 3300047322 | Bacteria | 2959 |
| 806 | Ga0495684_0069778 | 3300047471 | Bacteria | 2672 |
| 807 | Ga0496100_0071497 | 3300048903 | Unclassified | 2317 |
| 808 | Ga0496100_0075999 | 3300048903 | Bacteria | 2254 |
| 809 | Ga0496101_0033035 | 3300048904 | Bacteria | 3647 |
| 810 | Ga0496101_0173058 | 3300048904 | Bacteria | 1660 |
| 811 | Ga0496101_0534814 | 3300048904 | Bacteria | 926 |
| 812 | Ga0496101_0547385 | 3300048904 | Bacteria | 915 |
| 813 | Ga0496102_0056144 | 3300048905 | Bacteria | 3592 |
| 814 | Ga0496102_0079042 | 3300048905 | Unclassified | 3028 |
| 815 | Ga0496102_0126992 | 3300048905 | Bacteria | 2384 |
| 816 | Ga0496102_0250840 | 3300048905 | Unclassified | 1669 |
| 817 | Ga0496103_0051176 | 3300048906 | Unclassified | 2556 |
| 818 | Ga0496104_0004744 | 3300048907 | Bacteria | 11832 |
| 819 | Ga0496104_0094784 | 3300048907 | Bacteria | 2855 |
| 820 | Ga0496104_0156483 | 3300048907 | Unclassified | 2187 |
| 821 | Ga0496105_0036834 | 3300048908 | Bacteria | 4031 |
| 822 | Ga0496105_0155523 | 3300048908 | Unclassified | 1878 |
| 823 | Ga0496106_0083506 | 3300048909 | Bacteria | 2457 |
| 824 | Ga0496106_0124142 | 3300048909 | Unclassified | 2020 |
| 825 | Ga0496106_0135676 | 3300048909 | Unclassified | 1933 |
| 826 | Ga0496107_0052279 | 3300048910 | Unclassified | 2947 |
| 827 | Ga0496107_0113073 | 3300048910 | Unclassified | 1996 |
| 828 | Ga0496107_0417776 | 3300048910 | Unclassified | 997 |
| 829 | Ga0496108_0001291 | 3300048911 | Bacteria | 19664 |
| 830 | Ga0496108_0005237 | 3300048911 | Bacteria | 10474 |
| 831 | Ga0496108_0006989 | 3300048911 | Bacteria | 9135 |
| 832 | Ga0496108_0017435 | 3300048911 | Bacteria | 5876 |
| 833 | Ga0496108_0453683 | 3300048911 | Bacteria | 1120 |
| 834 | Ga0496109_0031135 | 3300048912 | Unclassified | 4785 |
| 835 | Ga0496109_0035270 | 3300048912 | Bacteria | 4511 |
| 836 | Ga0496109_0229173 | 3300048912 | Bacteria | 1747 |
| 837 | Ga0496109_0407550 | 3300048912 | Bacteria | 1284 |
| 838 | Ga0496110_0012229 | 3300048913 | Bacteria | 7053 |
| 839 | Ga0496110_0437024 | 3300048913 | Bacteria | 1193 |
| 840 | Ga0496110_0905928 | 3300048913 | Bacteria | 788 |
| 841 | Ga0496111_0442463 | 3300048914 | Bacteria | 959 |
| 842 | Ga0496112_0001950 | 3300048915 | Bacteria | 16300 |
| 843 | Ga0496112_0022068 | 3300048915 | Bacteria | 6062 |
| 844 | Ga0496112_0124946 | 3300048915 | Unclassified | 2543 |
| 845 | Ga0496112_0586514 | 3300048915 | Bacteria | 1047 |
| 846 | Ga0496113_0000769 | 3300048916 | Bacteria | 16520 |
| 847 | Ga0496113_0003336 | 3300048916 | Bacteria | 9589 |
| 848 | Ga0496113_0012516 | 3300048916 | Bacteria | 5705 |
| 849 | Ga0496113_0053330 | 3300048916 | Bacteria | 3023 |
| 850 | Ga0496113_0893651 | 3300048916 | Unclassified | 703 |
| 851 | Ga0496114_0320445 | 3300048917 | Bacteria | 1370 |
| 852 | Ga0496114_0689274 | 3300048917 | Bacteria | 897 |
| 853 | Ga0496115_0048377 | 3300048918 | Unclassified | 3401 |
| 854 | Ga0496115_0157500 | 3300048918 | Unclassified | 1876 |
| 855 | Ga0496115_0574060 | 3300048918 | Unclassified | 899 |
| 856 | Ga0501031_0075042 | 3300049568 | Bacteria | 2202 |
| 857 | Ga0501032_0426933 | 3300049569 | Unclassified | 850 |
| 858 | Ga0501032_0621217 | 3300049569 | Bacteria | 687 |
| 859 | Ga0501033_0150262 | 3300049570 | Bacteria | 1681 |
| 860 | Ga0501033_0295651 | 3300049570 | Bacteria | 1141 |
| 861 | Ga0501033_0461899 | 3300049570 | Unclassified | 881 |
| 862 | Ga0501034_0703208 | 3300049571 | Unclassified | 909 |
| 863 | Ga0501036_0021910 | 3300049572 | Bacteria | 5373 |
| 864 | Ga0501036_0327258 | 3300049572 | Bacteria | 1280 |
| 865 | Ga0501037_0184209 | 3300049573 | Bacteria | 1481 |
| 866 | Ga0501038_0425201 | 3300049574 | Bacteria | 1024 |
| 867 | Ga0501038_0517989 | 3300049574 | Bacteria | 910 |
| 868 | Ga0501039_0019178 | 3300049575 | Bacteria | 5248 |
| 869 | Ga0501039_0166360 | 3300049575 | Unclassified | 1734 |
| 870 | Ga0501039_0718754 | 3300049575 | Bacteria | 781 |
| 871 | Ga0501040_0057253 | 3300049576 | Unclassified | 2676 |
| 872 | Ga0501040_0120347 | 3300049576 | Bacteria | 1842 |
| 873 | Ga0501040_0126415 | 3300049576 | Bacteria | 1796 |
| 874 | Ga0501041_0038824 | 3300049577 | Bacteria | 2888 |
| 875 | Ga0501042_0014700 | 3300049578 | Bacteria | 5345 |
| 876 | Ga0501043_0330964 | 3300049579 | Bacteria | 1160 |
| 877 | Ga0501043_0391276 | 3300049579 | Unclassified | 1051 |
| 878 | Ga0501046_0080712 | 3300049580 | Bacteria | 2513 |
| 879 | Ga0501046_0090170 | 3300049580 | Bacteria | 2359 |
| 880 | Ga0501047_0000842 | 3300049581 | Bacteria | 31665 |
| 881 | Ga0501047_0198749 | 3300049581 | Bacteria | 1866 |
| 882 | Ga0501048_0055429 | 3300049582 | Bacteria | 2814 |
| 883 | Ga0501048_0082582 | 3300049582 | Bacteria | 2267 |
| 884 | Ga0501067_0025968 | 3300049583 | Bacteria | 3245 |
| 885 | Ga0501067_0050374 | 3300049583 | Bacteria | 2308 |
| 886 | Ga0501067_0081298 | 3300049583 | Unclassified | 1796 |
| 887 | Ga0501068_0000022 | 3300049584 | Bacteria | 58879 |
| 888 | Ga0501068_0001339 | 3300049584 | Bacteria | 13056 |
| 889 | Ga0501068_0188264 | 3300049584 | Unclassified | 1307 |
| 890 | Ga0501069_0006160 | 3300049585 | Bacteria | 6263 |
| 891 | Ga0501069_0022349 | 3300049585 | Bacteria | 3440 |
| 892 | Ga0501069_0059353 | 3300049585 | Bacteria | 2134 |
| 893 | Ga0501070_0000192 | 3300049586 | Bacteria | 57359 |
| 894 | Ga0501070_0004268 | 3300049586 | Bacteria | 12290 |
| 895 | Ga0501070_0022042 | 3300049586 | Bacteria | 5336 |
| 896 | Ga0501071_0000678 | 3300049587 | Bacteria | 17791 |
| 897 | Ga0501071_0033592 | 3300049587 | Bacteria | 3644 |
| 898 | Ga0501071_0117590 | 3300049587 | Bacteria | 1969 |
| 899 | Ga0501071_0226470 | 3300049587 | Bacteria | 1408 |
| 900 | Ga0501071_0407114 | 3300049587 | Bacteria | 1039 |
| 901 | Ga0501071_0614928 | 3300049587 | Unclassified | 835 |
| 902 | Ga0501071_0955418 | 3300049587 | Bacteria | 662 |
| 903 | Ga0501072_0014674 | 3300049588 | Bacteria | 6007 |
| 904 | Ga0501072_0097467 | 3300049588 | Bacteria | 2337 |
| 905 | Ga0501072_0161051 | 3300049588 | Bacteria | 1790 |
| 906 | Ga0501072_0190259 | 3300049588 | Bacteria | 1637 |
| 907 | Ga0501072_0332578 | 3300049588 | Bacteria | 1207 |
| 908 | Ga0501073_0000949 | 3300049589 | Bacteria | 20906 |
| 909 | Ga0501073_0062982 | 3300049589 | Bacteria | 2586 |
| 910 | Ga0501073_0398573 | 3300049589 | Unclassified | 951 |
| 911 | Ga0501074_0000171 | 3300049590 | Bacteria | 34937 |
| 912 | Ga0501074_0000742 | 3300049590 | Bacteria | 20488 |
| 913 | Ga0501074_0062345 | 3300049590 | Unclassified | 2685 |
| 914 | Ga0501075_0076581 | 3300049591 | Bacteria | 2530 |
| 915 | Ga0501075_0106483 | 3300049591 | Bacteria | 2131 |
| 916 | Ga0501075_0670972 | 3300049591 | Bacteria | 790 |
| 917 | Ga0501076_0020253 | 3300049592 | Bacteria | 5090 |
| 918 | Ga0501076_0367266 | 3300049592 | Unclassified | 1182 |
| 919 | Ga0501076_0375112 | 3300049592 | Bacteria | 1169 |
| 920 | Ga0501077_0004768 | 3300049593 | Bacteria | 8242 |
| 921 | Ga0501077_0053011 | 3300049593 | Bacteria | 2575 |
| 922 | Ga0501077_0058114 | 3300049593 | Bacteria | 2455 |
| 923 | Ga0501202_029946 | 3300049652 | Unclassified | 1131 |
| 924 | Ga0501209_002047 | 3300049656 | Unclassified | 3006 |
| 925 | Ga0501217_088428 | 3300049661 | Bacteria | 867 |
| 926 | Ga0501235_003401 | 3300049669 | Unclassified | 3445 |
| 927 | Ga0501221_015900 | 3300049704 | Unclassified | 1417 |
| 928 | Ga0501225_0021352 | 3300049705 | Unclassified | 1788 |
| 929 | Ga0501234_009350 | 3300049707 | Bacteria | 1528 |
| 930 | Ga0501079_0060874 | 3300049741 | Bacteria | 2912 |
| 931 | Ga0501079_0554862 | 3300049741 | Bacteria | 903 |
| 932 | Ga0501079_0820871 | 3300049741 | Bacteria | 732 |
| 933 | Ga0501080_0000060 | 3300049742 | Bacteria | 71292 |
| 934 | Ga0501080_0107525 | 3300049742 | Bacteria | 2585 |
| 935 | Ga0501080_0495018 | 3300049742 | Bacteria | 1093 |
| 936 | Ga0501081_0063800 | 3300049743 | Unclassified | 2557 |
| 937 | Ga0501081_0066384 | 3300049743 | Bacteria | 2509 |
| 938 | Ga0501081_0074081 | 3300049743 | Bacteria | 2375 |
| 939 | Ga0501081_0142005 | 3300049743 | Bacteria | 1721 |
| 940 | Ga0501081_0162742 | 3300049743 | Bacteria | 1608 |
| 941 | Ga0501083_0001978 | 3300049744 | Bacteria | 14097 |
| 942 | Ga0501083_0059235 | 3300049744 | Bacteria | 2561 |
| 943 | Ga0501083_0162068 | 3300049744 | Unclassified | 1463 |
| 944 | Ga0501083_0306257 | 3300049744 | Bacteria | 1033 |
| 945 | Ga0501263_005113 | 3300049760 | Bacteria | 1470 |
| 946 | Ga0501268_012154 | 3300049765 | Unclassified | 1372 |
| 947 | Ga0501268_045961 | 3300049765 | Bacteria | 834 |
| 948 | Ga0501270_004688 | 3300049767 | Bacteria | 1548 |
| 949 | Ga0501272_000560 | 3300049769 | Unclassified | 3295 |
| 950 | Ga0501279_027846 | 3300049775 | Unclassified | 829 |
| 951 | Ga0501035_0017508 | 3300049822 | Bacteria | 6610 |
| 952 | Ga0501035_0110624 | 3300049822 | Bacteria | 2408 |
| 953 | Ga0501035_0432634 | 3300049822 | Unclassified | 1091 |
| 954 | Ga0501035_0694981 | 3300049822 | Bacteria | 821 |
| 955 | Ga0501044_0000734 | 3300049823 | Bacteria | 39508 |
| 956 | Ga0501044_0194333 | 3300049823 | Bacteria | 1990 |
| 957 | Ga0501044_0318067 | 3300049823 | Bacteria | 1481 |
| 958 | Ga0501045_0014038 | 3300049824 | Bacteria | 5670 |
| 959 | Ga0501045_0094602 | 3300049824 | Bacteria | 2210 |
| 960 | Ga0501045_0118557 | 3300049824 | Bacteria | 1964 |
| 961 | Ga0501045_0324111 | 3300049824 | Unclassified | 1146 |
| 962 | nmdc:mga05p37_138827_c1 | 3300050507 | Bacteria | 2978 |
| 963 | nmdc:mga05p37_24458_c2 | 3300050507 | Bacteria | 4909 |
| 964 | nmdc:mga05p37_24982_c1 | 3300050507 | Bacteria | 7262 |
| 965 | nmdc:mga05p37_284551_c1 | 3300050507 | Unclassified | 1970 |
| 966 | nmdc:mga05p37_371760_c1 | 3300050507 | Bacteria | 1677 |
| 967 | nmdc:mga05p37_414393_c1 | 3300050507 | Bacteria | 1569 |
| 968 | nmdc:mga05p37_51636_c1 | 3300050507 | Bacteria | 5055 |
| 969 | nmdc:mga05p37_561756_c1 | 3300050507 | Unclassified | 1296 |
| 970 | nmdc:mga05p37_75331_c1 | 3300050507 | Bacteria | 4153 |
| 971 | nmdc:mga09592_125585_c1 | 3300050508 | Bacteria | 2205 |
| 972 | nmdc:mga09592_19135_c1 | 3300050508 | Bacteria | 5619 |
| 973 | nmdc:mga09592_3967_c1 | 3300050508 | Bacteria | 11923 |
| 974 | nmdc:mga0qj67_10094_c1 | 3300050509 | Bacteria | 7046 |
| 975 | nmdc:mga0qj67_255813_c1 | 3300050509 | Bacteria | 1421 |
| 976 | nmdc:mga0qj67_3022_c1 | 3300050509 | Bacteria | 12093 |
| 977 | nmdc:mga0qj67_41359_c1 | 3300050509 | Bacteria | 3625 |
| 978 | nmdc:mga0qj67_427435_c1 | 3300050509 | Unclassified | 1068 |
| 979 | nmdc:mga0qj67_584417_c1 | 3300050509 | Bacteria | 894 |
| 980 | nmdc:mga06r32_118220_c1 | 3300050510 | Bacteria | 2613 |
| 981 | nmdc:mga06r32_22435_c1 | 3300050510 | Bacteria | 5837 |
| 982 | nmdc:mga06r32_269914_c1 | 3300050510 | Bacteria | 1689 |
| 983 | nmdc:mga06r32_29277_c1 | 3300050510 | Bacteria | 5159 |
| 984 | nmdc:mga06r32_339589_c1 | 3300050510 | Bacteria | 1487 |
| 985 | nmdc:mga06r32_356899_c1 | 3300050510 | Bacteria | 1446 |
| 986 | nmdc:mga06r32_383154_c1 | 3300050510 | Bacteria | 1389 |
| 987 | nmdc:mga06r32_45554_c1 | 3300050510 | Bacteria | 4182 |
| 988 | nmdc:mga06r32_804066_c1 | 3300050510 | Bacteria | 901 |
| 989 | nmdc:mga06r32_857504_c1 | 3300050510 | Bacteria | 866 |
| 990 | nmdc:mga08y16_232930_c1 | 3300050511 | Bacteria | 1905 |
| 991 | nmdc:mga08y16_542655_c1 | 3300050511 | Bacteria | 1177 |
| 992 | nmdc:mga08y16_71880_c1 | 3300050511 | Bacteria | 3605 |
| 993 | nmdc:mga08y16_9037_c1 | 3300050511 | Bacteria | 10459 |
| 994 | nmdc:mga0n895_1129540_c1 | 3300050512 | Bacteria | 760 |
| 995 | nmdc:mga0n895_11503_c1 | 3300050512 | Bacteria | 7899 |
| 996 | nmdc:mga0n895_13422_c1 | 3300050512 | Bacteria | 7389 |
| 997 | nmdc:mga0n895_1342658_c1 | 3300050512 | Bacteria | 685 |
| 998 | nmdc:mga0n895_141908_c1 | 3300050512 | Bacteria | 2431 |
| 999 | nmdc:mga0n895_19615_c1 | 3300050512 | Bacteria | 6287 |
| 1000 | nmdc:mga0n895_21697_c1 | 3300050512 | Bacteria | 6010 |
| 1001 | nmdc:mga0n895_274249_c1 | 3300050512 | Unclassified | 1711 |
| 1002 | nmdc:mga0n895_3234_c1 | 3300050512 | Bacteria | 13055 |
| 1003 | nmdc:mga0n895_40283_c1 | 3300050512 | Bacteria | 4537 |
| 1004 | nmdc:mga0n895_532041_c1 | 3300050512 | Bacteria | 1182 |
| 1005 | nmdc:mga0n895_603579_c1 | 3300050512 | Bacteria | 1100 |
| 1006 | nmdc:mga0n895_60762_c1 | 3300050512 | Bacteria | 3729 |
| 1007 | nmdc:mga0n895_639749_c1 | 3300050512 | Unclassified | 1063 |
| 1008 | nmdc:mga0n895_77744_c1 | 3300050512 | Bacteria | 3302 |
| 1009 | nmdc:mga0rr50_104391_c1 | 3300050513 | Bacteria | 2232 |
| 1010 | nmdc:mga0rr50_127494_c1 | 3300050513 | Bacteria | 2034 |
| 1011 | nmdc:mga0rr50_259408_c1 | 3300050513 | Bacteria | 1446 |
| 1012 | nmdc:mga0rr50_345316_c1 | 3300050513 | Bacteria | 1251 |
| 1013 | nmdc:mga0rr50_51554_c1 | 3300050513 | Bacteria | 3054 |
| 1014 | nmdc:mga0rr50_611973_c1 | 3300050513 | Unclassified | 929 |
| 1015 | nmdc:mga0rr50_7588_c1 | 3300050513 | Bacteria | 6704 |
| 1016 | nmdc:mga0rr50_79036_c1 | 3300050513 | Bacteria | 2533 |
| 1017 | nmdc:mga08x19_102252_c1 | 3300050514 | Bacteria | 1903 |
| 1018 | nmdc:mga08x19_2813_c1 | 3300050514 | Bacteria | 10493 |
| 1019 | nmdc:mga08x19_28964_c1 | 3300050514 | Bacteria | 3473 |
| 1020 | nmdc:mga08x19_34468_c1 | 3300050514 | Bacteria | 3200 |
| 1021 | nmdc:mga08x19_51234_c1 | 3300050514 | Unclassified | 2651 |
| 1022 | nmdc:mga08x19_63696_c1 | 3300050514 | Bacteria | 1893 |
| 1023 | nmdc:mga08x19_637349_c1 | 3300050514 | Bacteria | 756 |
| 1024 | nmdc:mga08x19_8445_c1 | 3300050514 | Bacteria | 6134 |
| 1025 | nmdc:mga08x19_90860_c1 | 3300050514 | Unclassified | 2015 |
| 1026 | nmdc:mga0a205_108546_c1 | 3300050515 | Bacteria | 2674 |
| 1027 | nmdc:mga0a205_128056_c1 | 3300050515 | Bacteria | 2439 |
| 1028 | nmdc:mga0a205_185777_c1 | 3300050515 | Bacteria | 1972 |
| 1029 | nmdc:mga0a205_209869_c1 | 3300050515 | Bacteria | 1836 |
| 1030 | nmdc:mga0a205_247330_c2 | 3300050515 | Unclassified | 1053 |
| 1031 | nmdc:mga0a205_37263_c1 | 3300050515 | Bacteria | 4676 |
| 1032 | nmdc:mga0a205_784485_c1 | 3300050515 | Bacteria | 801 |
| 1033 | nmdc:mga0a205_80583_c1 | 3300050515 | Unclassified | 2797 |
| 1034 | nmdc:mga0a205_823_c1 | 3300050515 | Bacteria | 25240 |
| 1035 | Ga0501084_0001187 | 3300054114 | Bacteria | 20381 |
| 1036 | Ga0501084_0022610 | 3300054114 | Bacteria | 5248 |
| 1037 | Ga0501084_0091875 | 3300054114 | Bacteria | 2548 |
| 1038 | Ga0501084_0431681 | 3300054114 | Bacteria | 1114 |
| 1039 | Ga0501084_0493686 | 3300054114 | Bacteria | 1034 |
| 1040 | Ga0590071_011011 | 3300059421 | Bacteria | 2116 |
| 1041 | Ga0590071_017913 | 3300059421 | Unclassified | 1665 |
| 1042 | Ga0590071_093083 | 3300059421 | Bacteria | 756 |
| 1043 | Ga0590074_038811 | 3300059423 | Bacteria | 854 |
| 1044 | Ga0590075_014608 | 3300059424 | Bacteria | 1921 |
| 1045 | Ga0590077_091099 | 3300059426 | Unclassified | 707 |
| 1046 | Ga0501082_0002066 | 3300060353 | Bacteria | 17658 |
| 1047 | Ga0501082_0009721 | 3300060353 | Bacteria | 8284 |
| 1048 | Ga0501082_0055172 | 3300060353 | Bacteria | 3423 |
| 1049 | Ga0501082_0084001 | 3300060353 | Bacteria | 2747 |
| 1050 | Ga0501082_0784771 | 3300060353 | Bacteria | 833 |
| 1051 | Ga0530510_0021297 | 3300061734 | Bacteria | 4613 |
| 1052 | Ga0530510_0037427 | 3300061734 | Bacteria | 3499 |
| 1053 | Ga0530510_0174044 | 3300061734 | Bacteria | 1595 |
| 1054 | Ga0530510_0255175 | 3300061734 | Bacteria | 1307 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10044947 | Ga0157370_100449472 | 193 |
| 2 | 3300013104 | Ga0157370_10140254 | Ga0157370_101402542 | 193 |
| 3 | 3300009093 | Ga0105240_10009204 | Ga0105240_100092044 | 195 |
| 4 | 3300013100 | Ga0157373_10538689 | Ga0157373_105386891 | 195 |
| 5 | 3300013307 | Ga0157372_10019583 | Ga0157372_100195834 | 195 |
| 6 | 3300049587 | Ga0501071_0955418 | Ga0501071_0955418_59_652 | 195 |
| 7 | 3300005536 | Ga0070697_100824964 | Ga0070697_1008249641 | 196 |
| 8 | 3300026067 | Ga0207678_10293719 | Ga0207678_102937192 | 196 |
| 9 | 3300005328 | Ga0070676_10043650 | Ga0070676_100436502 | 197 |
| 10 | 3300005330 | Ga0070690_100134340 | Ga0070690_1001343401 | 197 |
| 11 | 3300005334 | Ga0068869_100010103 | Ga0068869_1000101038 | 197 |
| 12 | 3300005335 | Ga0070666_10043206 | Ga0070666_100432063 | 197 |
| 13 | 3300005341 | Ga0070691_10038281 | Ga0070691_100382813 | 197 |
| 14 | 3300005347 | Ga0070668_100292142 | Ga0070668_1002921422 | 197 |
| 15 | 3300005355 | Ga0070671_100364816 | Ga0070671_1003648162 | 197 |
| 16 | 3300005356 | Ga0070674_100000488 | Ga0070674_10000048820 | 197 |
| 17 | 3300005364 | Ga0070673_100209157 | Ga0070673_1002091571 | 197 |
| 18 | 3300005367 | Ga0070667_100034583 | Ga0070667_1000345833 | 197 |
| 19 | 3300005438 | Ga0070701_10291613 | Ga0070701_102916131 | 197 |
| 20 | 3300005440 | Ga0070705_100007632 | Ga0070705_1000076323 | 197 |
| 21 | 3300005444 | Ga0070694_100073489 | Ga0070694_1000734892 | 197 |
| 22 | 3300005456 | Ga0070678_100161220 | Ga0070678_1001612203 | 197 |
| 23 | 3300005457 | Ga0070662_100000760 | Ga0070662_1000007603 | 197 |
| 24 | 3300005459 | Ga0068867_100143039 | Ga0068867_1001430391 | 197 |
| 25 | 3300005530 | Ga0070679_100483111 | Ga0070679_1004831112 | 197 |
| 26 | 3300005544 | Ga0070686_100362911 | Ga0070686_1003629111 | 197 |
| 27 | 3300005545 | Ga0070695_100001483 | Ga0070695_10000148312 | 197 |
| 28 | 3300005546 | Ga0070696_100005541 | Ga0070696_1000055412 | 197 |
| 29 | 3300005549 | Ga0070704_100071452 | Ga0070704_1000714522 | 197 |
| 30 | 3300005577 | Ga0068857_100321695 | Ga0068857_1003216952 | 197 |
| 31 | 3300005578 | Ga0068854_100000340 | Ga0068854_10000034025 | 197 |
| 32 | 3300005614 | Ga0068856_100279771 | Ga0068856_1002797713 | 197 |
| 33 | 3300005615 | Ga0070702_100069343 | Ga0070702_1000693433 | 197 |
| 34 | 3300005718 | Ga0068866_10034008 | Ga0068866_100340082 | 197 |
| 35 | 3300006358 | Ga0068871_100203893 | Ga0068871_1002038932 | 197 |
| 36 | 3300009093 | Ga0105240_10250937 | Ga0105240_102509372 | 197 |
| 37 | 3300009098 | Ga0105245_10259377 | Ga0105245_102593772 | 197 |
| 38 | 3300009101 | Ga0105247_10468529 | Ga0105247_104685291 | 197 |
| 39 | 3300009148 | Ga0105243_10097773 | Ga0105243_100977733 | 197 |
| 40 | 3300009174 | Ga0105241_10024142 | Ga0105241_100241421 | 197 |
| 41 | 3300009176 | Ga0105242_10011475 | Ga0105242_100114752 | 197 |
| 42 | 3300009177 | Ga0105248_10011120 | Ga0105248_100111206 | 197 |
| 43 | 3300009551 | Ga0105238_10235186 | Ga0105238_102351861 | 197 |
| 44 | 3300011119 | Ga0105246_10019318 | Ga0105246_100193183 | 197 |
| 45 | 3300013297 | Ga0157378_10061192 | Ga0157378_100611921 | 197 |
| 46 | 3300013308 | Ga0157375_10086208 | Ga0157375_100862083 | 197 |
| 47 | 3300014968 | Ga0157379_10098332 | Ga0157379_100983323 | 197 |
| 48 | 3300017792 | Ga0163161_10039316 | Ga0163161_100393163 | 197 |
| 49 | 3300025899 | Ga0207642_10008584 | Ga0207642_100085844 | 197 |
| 50 | 3300025903 | Ga0207680_10062554 | Ga0207680_100625541 | 197 |
| 51 | 3300025907 | Ga0207645_10000971 | Ga0207645_100009719 | 197 |
| 52 | 3300025911 | Ga0207654_10086132 | Ga0207654_100861323 | 197 |
| 53 | 3300025913 | Ga0207695_10296436 | Ga0207695_102964362 | 197 |
| 54 | 3300025923 | Ga0207681_10576670 | Ga0207681_105766701 | 197 |
| 55 | 3300025927 | Ga0207687_10220796 | Ga0207687_102207962 | 197 |
| 56 | 3300025932 | Ga0207690_10823234 | Ga0207690_108232341 | 197 |
| 57 | 3300025933 | Ga0207706_10000065 | Ga0207706_1000006519 | 197 |
| 58 | 3300025934 | Ga0207686_10001117 | Ga0207686_100011172 | 197 |
| 59 | 3300025935 | Ga0207709_10207796 | Ga0207709_102077962 | 197 |
| 60 | 3300025937 | Ga0207669_10001479 | Ga0207669_1000147911 | 197 |
| 61 | 3300025938 | Ga0207704_10030332 | Ga0207704_100303323 | 197 |
| 62 | 3300025940 | Ga0207691_10358062 | Ga0207691_103580622 | 197 |
| 63 | 3300025941 | Ga0207711_10028892 | Ga0207711_100288921 | 197 |
| 64 | 3300025942 | Ga0207689_10007750 | Ga0207689_100077508 | 197 |
| 65 | 3300025972 | Ga0207668_10520089 | Ga0207668_105200892 | 197 |
| 66 | 3300025981 | Ga0207640_10168468 | Ga0207640_101684682 | 197 |
| 67 | 3300025986 | Ga0207658_10086716 | Ga0207658_100867162 | 197 |
| 68 | 3300026035 | Ga0207703_10123347 | Ga0207703_101233473 | 197 |
| 69 | 3300026089 | Ga0207648_10001169 | Ga0207648_100011693 | 197 |
| 70 | 3300026095 | Ga0207676_11210984 | Ga0207676_112109841 | 197 |
| 71 | 3300026116 | Ga0207674_10106289 | Ga0207674_101062894 | 197 |
| 72 | 3300026118 | Ga0207675_100233958 | Ga0207675_1002339582 | 197 |
| 73 | 3300028381 | Ga0268264_10479044 | Ga0268264_104790441 | 197 |
| 74 | 3300042876 | Ga0451577_0063065 | Ga0451577_0063065_217_837 | 197 |
| 75 | 3300044712 | Ga0453684_0678154 | Ga0453684_0678154_113_733 | 197 |
| 76 | 3300045051 | Ga0451576_0447126 | Ga0451576_0447126_556_1176 | 197 |
| 77 | 3300048904 | Ga0496101_0173058 | Ga0496101_0173058_31_651 | 197 |
| 78 | 3300048909 | Ga0496106_0083506 | Ga0496106_0083506_1414_2034 | 197 |
| 79 | 3300005406 | Ga0070703_10010292 | Ga0070703_100102923 | 198 |
| 80 | 3300005844 | Ga0068862_100041901 | Ga0068862_1000419011 | 198 |
| 81 | 3300025885 | Ga0207653_10007863 | Ga0207653_100078634 | 198 |
| 82 | 3300005334 | Ga0068869_100213560 | Ga0068869_1002135601 | 203 |
| 83 | 3300005336 | Ga0070680_100077626 | Ga0070680_1000776263 | 203 |
| 84 | 3300005345 | Ga0070692_10121601 | Ga0070692_101216012 | 203 |
| 85 | 3300005438 | Ga0070701_10001843 | Ga0070701_1000184310 | 203 |
| 86 | 3300005440 | Ga0070705_100074184 | Ga0070705_1000741841 | 203 |
| 87 | 3300005444 | Ga0070694_100030940 | Ga0070694_1000309403 | 203 |
| 88 | 3300005444 | Ga0070694_100384377 | Ga0070694_1003843772 | 203 |
| 89 | 3300005445 | Ga0070708_100128115 | Ga0070708_1001281152 | 203 |
| 90 | 3300005445 | Ga0070708_100687208 | Ga0070708_1006872081 | 203 |
| 91 | 3300005468 | Ga0070707_100066765 | Ga0070707_1000667654 | 203 |
| 92 | 3300005468 | Ga0070707_100919206 | Ga0070707_1009192062 | 203 |
| 93 | 3300005471 | Ga0070698_100431334 | Ga0070698_1004313341 | 203 |
| 94 | 3300005518 | Ga0070699_100199342 | Ga0070699_1001993422 | 203 |
| 95 | 3300005536 | Ga0070697_100189640 | Ga0070697_1001896402 | 203 |
| 96 | 3300005545 | Ga0070695_100024381 | Ga0070695_1000243815 | 203 |
| 97 | 3300005546 | Ga0070696_100076908 | Ga0070696_1000769085 | 203 |
| 98 | 3300005546 | Ga0070696_100352650 | Ga0070696_1003526502 | 203 |
| 99 | 3300005549 | Ga0070704_100003470 | Ga0070704_1000034703 | 203 |
| 100 | 3300005549 | Ga0070704_100039533 | Ga0070704_1000395335 | 203 |
| 101 | 3300005549 | Ga0070704_100102755 | Ga0070704_1001027552 | 203 |
| 102 | 3300005615 | Ga0070702_100313996 | Ga0070702_1003139962 | 203 |
| 103 | 3300005844 | Ga0068862_100364246 | Ga0068862_1003642462 | 203 |
| 104 | 3300006844 | Ga0075428_100053259 | Ga0075428_1000532592 | 203 |
| 105 | 3300006844 | Ga0075428_100145551 | Ga0075428_1001455513 | 203 |
| 106 | 3300006846 | Ga0075430_100323968 | Ga0075430_1003239682 | 203 |
| 107 | 3300006847 | Ga0075431_100250032 | Ga0075431_1002500323 | 203 |
| 108 | 3300006852 | Ga0075433_10025979 | Ga0075433_100259792 | 203 |
| 109 | 3300006852 | Ga0075433_10807733 | Ga0075433_108077332 | 203 |
| 110 | 3300006871 | Ga0075434_100024719 | Ga0075434_1000247192 | 203 |
| 111 | 3300006871 | Ga0075434_100040831 | Ga0075434_1000408312 | 203 |
| 112 | 3300006914 | Ga0075436_100011903 | Ga0075436_1000119032 | 203 |
| 113 | 3300006914 | Ga0075436_100021360 | Ga0075436_1000213605 | 203 |
| 114 | 3300006914 | Ga0075436_100095001 | Ga0075436_1000950012 | 203 |
| 115 | 3300006914 | Ga0075436_100248356 | Ga0075436_1002483561 | 203 |
| 116 | 3300007076 | Ga0075435_100018599 | Ga0075435_1000185994 | 203 |
| 117 | 3300007076 | Ga0075435_100054584 | Ga0075435_1000545843 | 203 |
| 118 | 3300007265 | Ga0099794_10000151 | Ga0099794_1000015117 | 203 |
| 119 | 3300007265 | Ga0099794_10252118 | Ga0099794_102521181 | 203 |
| 120 | 3300009094 | Ga0111539_10198280 | Ga0111539_101982802 | 203 |
| 121 | 3300009098 | Ga0105245_10851268 | Ga0105245_108512682 | 203 |
| 122 | 3300009147 | Ga0114129_10408301 | Ga0114129_104083012 | 203 |
| 123 | 3300025910 | Ga0207684_10194667 | Ga0207684_101946672 | 203 |
| 124 | 3300025910 | Ga0207684_10373488 | Ga0207684_103734882 | 203 |
| 125 | 3300025917 | Ga0207660_10061332 | Ga0207660_100613322 | 203 |
| 126 | 3300025917 | Ga0207660_10365278 | Ga0207660_103652782 | 203 |
| 127 | 3300025922 | Ga0207646_10044148 | Ga0207646_100441483 | 203 |
| 128 | 3300027671 | Ga0209588_1003279 | Ga0209588_10032792 | 203 |
| 129 | 3300027671 | Ga0209588_1053508 | Ga0209588_10535082 | 203 |
| 130 | 3300044673 | Ga0453683_0169580 | Ga0453683_0169580_257_868 | 203 |
| 131 | 3300045051 | Ga0451576_0011287 | Ga0451576_0011287_5685_6296 | 203 |
| 132 | 3300045051 | Ga0451576_0018762 | Ga0451576_0018762_2101_2712 | 203 |
| 133 | 3300045051 | Ga0451576_0043756 | Ga0451576_0043756_2212_2823 | 203 |
| 134 | 3300046525 | Ga0495663_0018531 | Ga0495663_0018531_858_1469 | 203 |
| 135 | 3300047318 | Ga0495636_0135626 | Ga0495636_0135626_414_1025 | 203 |
| 136 | 3300050510 | nmdc:mga06r32_804066_c1 | nmdc:mga06r32_804066_c1_232_843 | 203 |
| 137 | 3300050512 | nmdc:mga0n895_1342658_c1 | nmdc:mga0n895_1342658_c1_64_675 | 203 |
| 138 | 3300050512 | nmdc:mga0n895_19615_c1 | nmdc:mga0n895_19615_c1_5610_6221 | 203 |
| 139 | 3300050512 | nmdc:mga0n895_274249_c1 | nmdc:mga0n895_274249_c1_216_827 | 203 |
| 140 | 3300050514 | nmdc:mga08x19_63696_c1 | nmdc:mga08x19_63696_c1_640_1251 | 203 |
| 141 | 3300050514 | nmdc:mga08x19_637349_c1 | nmdc:mga08x19_637349_c1_46_657 | 203 |
| 142 | 3300050514 | nmdc:mga08x19_90860_c1 | nmdc:mga08x19_90860_c1_1324_1935 | 203 |
| 143 | 3300050515 | nmdc:mga0a205_128056_c1 | nmdc:mga0a205_128056_c1_1722_2333 | 203 |
| 144 | 3300050515 | nmdc:mga0a205_185777_c1 | nmdc:mga0a205_185777_c1_820_1431 | 203 |
| 145 | 3300005293 | Ga0065715_10007216 | Ga0065715_100072162 | 206 |
| 146 | 3300005293 | Ga0065715_10128475 | Ga0065715_101284751 | 206 |
| 147 | 3300005293 | Ga0065715_10312085 | Ga0065715_103120851 | 206 |
| 148 | 3300005327 | Ga0070658_10447835 | Ga0070658_104478352 | 206 |
| 149 | 3300005328 | Ga0070676_10004346 | Ga0070676_100043464 | 206 |
| 150 | 3300005329 | Ga0070683_100007640 | Ga0070683_1000076407 | 206 |
| 151 | 3300005329 | Ga0070683_100021254 | Ga0070683_1000212545 | 206 |
| 152 | 3300005329 | Ga0070683_100027949 | Ga0070683_1000279493 | 206 |
| 153 | 3300005329 | Ga0070683_100067628 | Ga0070683_1000676283 | 206 |
| 154 | 3300005329 | Ga0070683_100093088 | Ga0070683_1000930881 | 206 |
| 155 | 3300005331 | Ga0070670_100007272 | Ga0070670_1000072726 | 206 |
| 156 | 3300005331 | Ga0070670_100018024 | Ga0070670_1000180243 | 206 |
| 157 | 3300005334 | Ga0068869_100045781 | Ga0068869_1000457812 | 206 |
| 158 | 3300005335 | Ga0070666_10215595 | Ga0070666_102155952 | 206 |
| 159 | 3300005336 | Ga0070680_100017722 | Ga0070680_1000177223 | 206 |
| 160 | 3300005336 | Ga0070680_100019668 | Ga0070680_1000196684 | 206 |
| 161 | 3300005336 | Ga0070680_100021822 | Ga0070680_1000218223 | 206 |
| 162 | 3300005336 | Ga0070680_101006097 | Ga0070680_1010060971 | 206 |
| 163 | 3300005338 | Ga0068868_100479970 | Ga0068868_1004799701 | 206 |
| 164 | 3300005339 | Ga0070660_100012909 | Ga0070660_1000129096 | 206 |
| 165 | 3300005339 | Ga0070660_100788044 | Ga0070660_1007880441 | 206 |
| 166 | 3300005340 | Ga0070689_100014547 | Ga0070689_1000145473 | 206 |
| 167 | 3300005340 | Ga0070689_100497411 | Ga0070689_1004974112 | 206 |
| 168 | 3300005340 | Ga0070689_100588177 | Ga0070689_1005881771 | 206 |
| 169 | 3300005341 | Ga0070691_10154926 | Ga0070691_101549262 | 206 |
| 170 | 3300005343 | Ga0070687_100000721 | Ga0070687_1000007215 | 206 |
| 171 | 3300005343 | Ga0070687_100039931 | Ga0070687_1000399312 | 206 |
| 172 | 3300005343 | Ga0070687_100239869 | Ga0070687_1002398691 | 206 |
| 173 | 3300005343 | Ga0070687_100405796 | Ga0070687_1004057961 | 206 |
| 174 | 3300005344 | Ga0070661_100002985 | Ga0070661_1000029859 | 206 |
| 175 | 3300005344 | Ga0070661_100003797 | Ga0070661_10000379711 | 206 |
| 176 | 3300005344 | Ga0070661_100010685 | Ga0070661_1000106855 | 206 |
| 177 | 3300005344 | Ga0070661_100190236 | Ga0070661_1001902362 | 206 |
| 178 | 3300005345 | Ga0070692_10017287 | Ga0070692_100172873 | 206 |
| 179 | 3300005347 | Ga0070668_100003043 | Ga0070668_10000304312 | 206 |
| 180 | 3300005347 | Ga0070668_100006902 | Ga0070668_1000069028 | 206 |
| 181 | 3300005347 | Ga0070668_100216914 | Ga0070668_1002169142 | 206 |
| 182 | 3300005347 | Ga0070668_100350769 | Ga0070668_1003507692 | 206 |
| 183 | 3300005347 | Ga0070668_100686890 | Ga0070668_1006868901 | 206 |
| 184 | 3300005353 | Ga0070669_100003079 | Ga0070669_10000307910 | 206 |
| 185 | 3300005353 | Ga0070669_100017058 | Ga0070669_1000170582 | 206 |
| 186 | 3300005353 | Ga0070669_100075028 | Ga0070669_1000750282 | 206 |
| 187 | 3300005354 | Ga0070675_100002631 | Ga0070675_1000026316 | 206 |
| 188 | 3300005354 | Ga0070675_100002663 | Ga0070675_1000026638 | 206 |
| 189 | 3300005354 | Ga0070675_100138851 | Ga0070675_1001388512 | 206 |
| 190 | 3300005354 | Ga0070675_100214432 | Ga0070675_1002144322 | 206 |
| 191 | 3300005354 | Ga0070675_100247540 | Ga0070675_1002475402 | 206 |
| 192 | 3300005355 | Ga0070671_100008957 | Ga0070671_1000089578 | 206 |
| 193 | 3300005355 | Ga0070671_100046843 | Ga0070671_1000468432 | 206 |
| 194 | 3300005356 | Ga0070674_100072803 | Ga0070674_1000728032 | 206 |
| 195 | 3300005356 | Ga0070674_100190297 | Ga0070674_1001902972 | 206 |
| 196 | 3300005364 | Ga0070673_100665717 | Ga0070673_1006657171 | 206 |
| 197 | 3300005366 | Ga0070659_100032565 | Ga0070659_1000325653 | 206 |
| 198 | 3300005366 | Ga0070659_100040066 | Ga0070659_1000400662 | 206 |
| 199 | 3300005366 | Ga0070659_100106827 | Ga0070659_1001068272 | 206 |
| 200 | 3300005367 | Ga0070667_100031097 | Ga0070667_1000310974 | 206 |
| 201 | 3300005406 | Ga0070703_10036920 | Ga0070703_100369202 | 206 |
| 202 | 3300005434 | Ga0070709_10001038 | Ga0070709_1000103815 | 206 |
| 203 | 3300005435 | Ga0070714_100695684 | Ga0070714_1006956842 | 206 |
| 204 | 3300005435 | Ga0070714_101315730 | Ga0070714_1013157301 | 206 |
| 205 | 3300005437 | Ga0070710_10473430 | Ga0070710_104734301 | 206 |
| 206 | 3300005438 | Ga0070701_10036828 | Ga0070701_100368282 | 206 |
| 207 | 3300005438 | Ga0070701_10145421 | Ga0070701_101454212 | 206 |
| 208 | 3300005439 | Ga0070711_100000466 | Ga0070711_10000046610 | 206 |
| 209 | 3300005439 | Ga0070711_100023504 | Ga0070711_1000235043 | 206 |
| 210 | 3300005439 | Ga0070711_100848300 | Ga0070711_1008483001 | 206 |
| 211 | 3300005440 | Ga0070705_100006728 | Ga0070705_1000067285 | 206 |
| 212 | 3300005440 | Ga0070705_100017903 | Ga0070705_1000179031 | 206 |
| 213 | 3300005440 | Ga0070705_100026351 | Ga0070705_1000263513 | 206 |
| 214 | 3300005440 | Ga0070705_100043456 | Ga0070705_1000434562 | 206 |
| 215 | 3300005440 | Ga0070705_100062806 | Ga0070705_1000628063 | 206 |
| 216 | 3300005440 | Ga0070705_100126097 | Ga0070705_1001260972 | 206 |
| 217 | 3300005440 | Ga0070705_100127156 | Ga0070705_1001271562 | 206 |
| 218 | 3300005440 | Ga0070705_100135142 | Ga0070705_1001351422 | 206 |
| 219 | 3300005440 | Ga0070705_100334102 | Ga0070705_1003341022 | 206 |
| 220 | 3300005441 | Ga0070700_100348856 | Ga0070700_1003488561 | 206 |
| 221 | 3300005444 | Ga0070694_100003097 | Ga0070694_10000309710 | 206 |
| 222 | 3300005444 | Ga0070694_100056858 | Ga0070694_1000568583 | 206 |
| 223 | 3300005444 | Ga0070694_100057125 | Ga0070694_1000571252 | 206 |
| 224 | 3300005444 | Ga0070694_100096665 | Ga0070694_1000966652 | 206 |
| 225 | 3300005444 | Ga0070694_100274155 | Ga0070694_1002741551 | 206 |
| 226 | 3300005444 | Ga0070694_100440633 | Ga0070694_1004406332 | 206 |
| 227 | 3300005444 | Ga0070694_100550095 | Ga0070694_1005500952 | 206 |
| 228 | 3300005445 | Ga0070708_100001912 | Ga0070708_10000191212 | 206 |
| 229 | 3300005445 | Ga0070708_100006646 | Ga0070708_1000066469 | 206 |
| 230 | 3300005445 | Ga0070708_100010515 | Ga0070708_1000105153 | 206 |
| 231 | 3300005445 | Ga0070708_100036977 | Ga0070708_1000369773 | 206 |
| 232 | 3300005445 | Ga0070708_100084138 | Ga0070708_1000841382 | 206 |
| 233 | 3300005445 | Ga0070708_100128852 | Ga0070708_1001288522 | 206 |
| 234 | 3300005445 | Ga0070708_100248140 | Ga0070708_1002481402 | 206 |
| 235 | 3300005445 | Ga0070708_100592787 | Ga0070708_1005927872 | 206 |
| 236 | 3300005445 | Ga0070708_100669044 | Ga0070708_1006690441 | 206 |
| 237 | 3300005445 | Ga0070708_100922511 | Ga0070708_1009225111 | 206 |
| 238 | 3300005445 | Ga0070708_100934980 | Ga0070708_1009349801 | 206 |
| 239 | 3300005457 | Ga0070662_100000129 | Ga0070662_10000012915 | 206 |
| 240 | 3300005457 | Ga0070662_100008788 | Ga0070662_1000087887 | 206 |
| 241 | 3300005457 | Ga0070662_100065735 | Ga0070662_1000657353 | 206 |
| 242 | 3300005457 | Ga0070662_100182492 | Ga0070662_1001824922 | 206 |
| 243 | 3300005457 | Ga0070662_100594760 | Ga0070662_1005947602 | 206 |
| 244 | 3300005458 | Ga0070681_10000404 | Ga0070681_1000040432 | 206 |
| 245 | 3300005458 | Ga0070681_10008932 | Ga0070681_100089324 | 206 |
| 246 | 3300005458 | Ga0070681_10034221 | Ga0070681_100342212 | 206 |
| 247 | 3300005458 | Ga0070681_10034328 | Ga0070681_100343283 | 206 |
| 248 | 3300005458 | Ga0070681_10066860 | Ga0070681_100668603 | 206 |
| 249 | 3300005458 | Ga0070681_10441395 | Ga0070681_104413952 | 206 |
| 250 | 3300005459 | Ga0068867_100124515 | Ga0068867_1001245151 | 206 |
| 251 | 3300005459 | Ga0068867_100148924 | Ga0068867_1001489243 | 206 |
| 252 | 3300005459 | Ga0068867_100565452 | Ga0068867_1005654521 | 206 |
| 253 | 3300005466 | Ga0070685_10005049 | Ga0070685_100050497 | 206 |
| 254 | 3300005466 | Ga0070685_10202810 | Ga0070685_102028102 | 206 |
| 255 | 3300005466 | Ga0070685_10371405 | Ga0070685_103714051 | 206 |
| 256 | 3300005467 | Ga0070706_100002003 | Ga0070706_10000200322 | 206 |
| 257 | 3300005467 | Ga0070706_100007900 | Ga0070706_1000079009 | 206 |
| 258 | 3300005467 | Ga0070706_100011664 | Ga0070706_1000116649 | 206 |
| 259 | 3300005467 | Ga0070706_100124841 | Ga0070706_1001248412 | 206 |
| 260 | 3300005467 | Ga0070706_100217196 | Ga0070706_1002171962 | 206 |
| 261 | 3300005467 | Ga0070706_100373973 | Ga0070706_1003739731 | 206 |
| 262 | 3300005468 | Ga0070707_100001277 | Ga0070707_10000127719 | 206 |
| 263 | 3300005468 | Ga0070707_100038114 | Ga0070707_1000381142 | 206 |
| 264 | 3300005468 | Ga0070707_100046622 | Ga0070707_1000466223 | 206 |
| 265 | 3300005468 | Ga0070707_100048969 | Ga0070707_1000489693 | 206 |
| 266 | 3300005468 | Ga0070707_100058383 | Ga0070707_1000583833 | 206 |
| 267 | 3300005468 | Ga0070707_100075107 | Ga0070707_1000751072 | 206 |
| 268 | 3300005468 | Ga0070707_100085921 | Ga0070707_1000859212 | 206 |
| 269 | 3300005468 | Ga0070707_100102325 | Ga0070707_1001023253 | 206 |
| 270 | 3300005468 | Ga0070707_100170879 | Ga0070707_1001708792 | 206 |
| 271 | 3300005468 | Ga0070707_100244924 | Ga0070707_1002449241 | 206 |
| 272 | 3300005468 | Ga0070707_100499887 | Ga0070707_1004998872 | 206 |
| 273 | 3300005468 | Ga0070707_100533355 | Ga0070707_1005333552 | 206 |
| 274 | 3300005468 | Ga0070707_100669126 | Ga0070707_1006691261 | 206 |
| 275 | 3300005471 | Ga0070698_100000416 | Ga0070698_10000041618 | 206 |
| 276 | 3300005471 | Ga0070698_100090622 | Ga0070698_1000906223 | 206 |
| 277 | 3300005471 | Ga0070698_100100245 | Ga0070698_1001002452 | 206 |
| 278 | 3300005471 | Ga0070698_100100765 | Ga0070698_1001007652 | 206 |
| 279 | 3300005471 | Ga0070698_100123841 | Ga0070698_1001238413 | 206 |
| 280 | 3300005471 | Ga0070698_100128532 | Ga0070698_1001285322 | 206 |
| 281 | 3300005471 | Ga0070698_100528810 | Ga0070698_1005288102 | 206 |
| 282 | 3300005518 | Ga0070699_100003038 | Ga0070699_10000303815 | 206 |
| 283 | 3300005518 | Ga0070699_100009267 | Ga0070699_1000092677 | 206 |
| 284 | 3300005518 | Ga0070699_100010664 | Ga0070699_1000106649 | 206 |
| 285 | 3300005518 | Ga0070699_100013305 | Ga0070699_1000133057 | 206 |
| 286 | 3300005518 | Ga0070699_100014085 | Ga0070699_1000140854 | 206 |
| 287 | 3300005518 | Ga0070699_100017344 | Ga0070699_1000173443 | 206 |
| 288 | 3300005518 | Ga0070699_100018436 | Ga0070699_1000184364 | 206 |
| 289 | 3300005518 | Ga0070699_100079657 | Ga0070699_1000796572 | 206 |
| 290 | 3300005518 | Ga0070699_100179100 | Ga0070699_1001791002 | 206 |
| 291 | 3300005530 | Ga0070679_100033038 | Ga0070679_1000330381 | 206 |
| 292 | 3300005530 | Ga0070679_100066262 | Ga0070679_1000662621 | 206 |
| 293 | 3300005530 | Ga0070679_100067534 | Ga0070679_1000675343 | 206 |
| 294 | 3300005530 | Ga0070679_100214351 | Ga0070679_1002143511 | 206 |
| 295 | 3300005530 | Ga0070679_100423381 | Ga0070679_1004233811 | 206 |
| 296 | 3300005535 | Ga0070684_100035266 | Ga0070684_1000352664 | 206 |
| 297 | 3300005535 | Ga0070684_100154609 | Ga0070684_1001546092 | 206 |
| 298 | 3300005535 | Ga0070684_100879141 | Ga0070684_1008791412 | 206 |
| 299 | 3300005536 | Ga0070697_100026418 | Ga0070697_1000264183 | 206 |
| 300 | 3300005536 | Ga0070697_100030232 | Ga0070697_1000302321 | 206 |
| 301 | 3300005536 | Ga0070697_100035632 | Ga0070697_1000356322 | 206 |
| 302 | 3300005536 | Ga0070697_100129065 | Ga0070697_1001290652 | 206 |
| 303 | 3300005536 | Ga0070697_100130880 | Ga0070697_1001308802 | 206 |
| 304 | 3300005536 | Ga0070697_100207453 | Ga0070697_1002074532 | 206 |
| 305 | 3300005536 | Ga0070697_100245902 | Ga0070697_1002459021 | 206 |
| 306 | 3300005536 | Ga0070697_100597370 | Ga0070697_1005973702 | 206 |
| 307 | 3300005539 | Ga0068853_100035310 | Ga0068853_1000353102 | 206 |
| 308 | 3300005539 | Ga0068853_100041839 | Ga0068853_1000418392 | 206 |
| 309 | 3300005539 | Ga0068853_100878130 | Ga0068853_1008781301 | 206 |
| 310 | 3300005543 | Ga0070672_100004984 | Ga0070672_1000049846 | 206 |
| 311 | 3300005543 | Ga0070672_100007479 | Ga0070672_1000074792 | 206 |
| 312 | 3300005543 | Ga0070672_100276024 | Ga0070672_1002760241 | 206 |
| 313 | 3300005544 | Ga0070686_100000009 | Ga0070686_100000009168 | 206 |
| 314 | 3300005545 | Ga0070695_100030673 | Ga0070695_1000306733 | 206 |
| 315 | 3300005545 | Ga0070695_100054884 | Ga0070695_1000548842 | 206 |
| 316 | 3300005545 | Ga0070695_100062812 | Ga0070695_1000628122 | 206 |
| 317 | 3300005546 | Ga0070696_100001111 | Ga0070696_1000011116 | 206 |
| 318 | 3300005546 | Ga0070696_100001375 | Ga0070696_10000137512 | 206 |
| 319 | 3300005546 | Ga0070696_100013879 | Ga0070696_1000138796 | 206 |
| 320 | 3300005546 | Ga0070696_100018452 | Ga0070696_1000184526 | 206 |
| 321 | 3300005546 | Ga0070696_100029352 | Ga0070696_1000293523 | 206 |
| 322 | 3300005546 | Ga0070696_100043304 | Ga0070696_1000433043 | 206 |
| 323 | 3300005546 | Ga0070696_100236896 | Ga0070696_1002368962 | 206 |
| 324 | 3300005546 | Ga0070696_100313931 | Ga0070696_1003139312 | 206 |
| 325 | 3300005546 | Ga0070696_100377528 | Ga0070696_1003775281 | 206 |
| 326 | 3300005546 | Ga0070696_100797357 | Ga0070696_1007973571 | 206 |
| 327 | 3300005548 | Ga0070665_100038936 | Ga0070665_1000389362 | 206 |
| 328 | 3300005548 | Ga0070665_100222772 | Ga0070665_1002227722 | 206 |
| 329 | 3300005549 | Ga0070704_100000588 | Ga0070704_10000058816 | 206 |
| 330 | 3300005549 | Ga0070704_100007259 | Ga0070704_1000072598 | 206 |
| 331 | 3300005549 | Ga0070704_100013024 | Ga0070704_1000130242 | 206 |
| 332 | 3300005549 | Ga0070704_100045565 | Ga0070704_1000455652 | 206 |
| 333 | 3300005549 | Ga0070704_100063131 | Ga0070704_1000631312 | 206 |
| 334 | 3300005549 | Ga0070704_100098504 | Ga0070704_1000985042 | 206 |
| 335 | 3300005549 | Ga0070704_100597461 | Ga0070704_1005974612 | 206 |
| 336 | 3300005563 | Ga0068855_100002169 | Ga0068855_10000216926 | 206 |
| 337 | 3300005563 | Ga0068855_100008571 | Ga0068855_1000085713 | 206 |
| 338 | 3300005563 | Ga0068855_100431684 | Ga0068855_1004316842 | 206 |
| 339 | 3300005564 | Ga0070664_100013154 | Ga0070664_1000131546 | 206 |
| 340 | 3300005564 | Ga0070664_100055026 | Ga0070664_1000550262 | 206 |
| 341 | 3300005564 | Ga0070664_100178129 | Ga0070664_1001781292 | 206 |
| 342 | 3300005564 | Ga0070664_100655957 | Ga0070664_1006559571 | 206 |
| 343 | 3300005577 | Ga0068857_100012151 | Ga0068857_1000121516 | 206 |
| 344 | 3300005577 | Ga0068857_100015739 | Ga0068857_1000157394 | 206 |
| 345 | 3300005577 | Ga0068857_100038294 | Ga0068857_1000382944 | 206 |
| 346 | 3300005578 | Ga0068854_100022362 | Ga0068854_1000223624 | 206 |
| 347 | 3300005578 | Ga0068854_100033175 | Ga0068854_1000331753 | 206 |
| 348 | 3300005578 | Ga0068854_100252585 | Ga0068854_1002525852 | 206 |
| 349 | 3300005615 | Ga0070702_100472602 | Ga0070702_1004726022 | 206 |
| 350 | 3300005616 | Ga0068852_100014974 | Ga0068852_1000149746 | 206 |
| 351 | 3300005616 | Ga0068852_100341916 | Ga0068852_1003419162 | 206 |
| 352 | 3300005616 | Ga0068852_100532599 | Ga0068852_1005325992 | 206 |
| 353 | 3300005617 | Ga0068859_100024587 | Ga0068859_1000245875 | 206 |
| 354 | 3300005617 | Ga0068859_100041401 | Ga0068859_1000414012 | 206 |
| 355 | 3300005617 | Ga0068859_100084308 | Ga0068859_1000843083 | 206 |
| 356 | 3300005617 | Ga0068859_100092148 | Ga0068859_1000921482 | 206 |
| 357 | 3300005617 | Ga0068859_100123908 | Ga0068859_1001239083 | 206 |
| 358 | 3300005617 | Ga0068859_100207078 | Ga0068859_1002070781 | 206 |
| 359 | 3300005618 | Ga0068864_100005386 | Ga0068864_1000053864 | 206 |
| 360 | 3300005618 | Ga0068864_100028566 | Ga0068864_1000285662 | 206 |
| 361 | 3300005618 | Ga0068864_100160067 | Ga0068864_1001600672 | 206 |
| 362 | 3300005618 | Ga0068864_100312225 | Ga0068864_1003122252 | 206 |
| 363 | 3300005718 | Ga0068866_10261636 | Ga0068866_102616362 | 206 |
| 364 | 3300005719 | Ga0068861_100001019 | Ga0068861_1000010197 | 206 |
| 365 | 3300005719 | Ga0068861_100029592 | Ga0068861_1000295921 | 206 |
| 366 | 3300005719 | Ga0068861_100120743 | Ga0068861_1001207433 | 206 |
| 367 | 3300005834 | Ga0068851_10019723 | Ga0068851_100197233 | 206 |
| 368 | 3300005834 | Ga0068851_10152903 | Ga0068851_101529032 | 206 |
| 369 | 3300005840 | Ga0068870_10034892 | Ga0068870_100348922 | 206 |
| 370 | 3300005841 | Ga0068863_100197091 | Ga0068863_1001970912 | 206 |
| 371 | 3300005842 | Ga0068858_100022826 | Ga0068858_1000228266 | 206 |
| 372 | 3300005842 | Ga0068858_100606486 | Ga0068858_1006064861 | 206 |
| 373 | 3300005843 | Ga0068860_100051734 | Ga0068860_1000517342 | 206 |
| 374 | 3300005844 | Ga0068862_100000376 | Ga0068862_10000037615 | 206 |
| 375 | 3300005844 | Ga0068862_100324123 | Ga0068862_1003241232 | 206 |
| 376 | 3300005844 | Ga0068862_100334963 | Ga0068862_1003349632 | 206 |
| 377 | 3300005844 | Ga0068862_100567900 | Ga0068862_1005679001 | 206 |
| 378 | 3300005844 | Ga0068862_100982150 | Ga0068862_1009821501 | 206 |
| 379 | 3300005937 | Ga0081455_10062368 | Ga0081455_100623685 | 206 |
| 380 | 3300006173 | Ga0070716_100000833 | Ga0070716_1000008332 | 206 |
| 381 | 3300006173 | Ga0070716_100021974 | Ga0070716_1000219742 | 206 |
| 382 | 3300006237 | Ga0097621_100193378 | Ga0097621_1001933783 | 206 |
| 383 | 3300006237 | Ga0097621_100407040 | Ga0097621_1004070402 | 206 |
| 384 | 3300006358 | Ga0068871_100129749 | Ga0068871_1001297492 | 206 |
| 385 | 3300006844 | Ga0075428_100012227 | Ga0075428_1000122273 | 206 |
| 386 | 3300006844 | Ga0075428_100039690 | Ga0075428_1000396906 | 206 |
| 387 | 3300006844 | Ga0075428_100072344 | Ga0075428_1000723445 | 206 |
| 388 | 3300006844 | Ga0075428_100223245 | Ga0075428_1002232451 | 206 |
| 389 | 3300006844 | Ga0075428_100365366 | Ga0075428_1003653662 | 206 |
| 390 | 3300006844 | Ga0075428_100764461 | Ga0075428_1007644612 | 206 |
| 391 | 3300006844 | Ga0075428_100951921 | Ga0075428_1009519212 | 206 |
| 392 | 3300006846 | Ga0075430_100001512 | Ga0075430_10000151218 | 206 |
| 393 | 3300006846 | Ga0075430_100076112 | Ga0075430_1000761121 | 206 |
| 394 | 3300006846 | Ga0075430_100082279 | Ga0075430_1000822793 | 206 |
| 395 | 3300006846 | Ga0075430_100542015 | Ga0075430_1005420152 | 206 |
| 396 | 3300006846 | Ga0075430_100668780 | Ga0075430_1006687801 | 206 |
| 397 | 3300006847 | Ga0075431_100018358 | Ga0075431_1000183585 | 206 |
| 398 | 3300006847 | Ga0075431_100026846 | Ga0075431_1000268462 | 206 |
| 399 | 3300006847 | Ga0075431_100033603 | Ga0075431_1000336036 | 206 |
| 400 | 3300006847 | Ga0075431_100063746 | Ga0075431_1000637464 | 206 |
| 401 | 3300006847 | Ga0075431_100147443 | Ga0075431_1001474433 | 206 |
| 402 | 3300006847 | Ga0075431_100158257 | Ga0075431_1001582572 | 206 |
| 403 | 3300006852 | Ga0075433_10000946 | Ga0075433_100009466 | 206 |
| 404 | 3300006852 | Ga0075433_10005348 | Ga0075433_100053484 | 206 |
| 405 | 3300006852 | Ga0075433_10321274 | Ga0075433_103212741 | 206 |
| 406 | 3300006852 | Ga0075433_10440267 | Ga0075433_104402671 | 206 |
| 407 | 3300006852 | Ga0075433_10639739 | Ga0075433_106397391 | 206 |
| 408 | 3300006871 | Ga0075434_100001804 | Ga0075434_10000180417 | 206 |
| 409 | 3300006871 | Ga0075434_100019680 | Ga0075434_1000196809 | 206 |
| 410 | 3300006871 | Ga0075434_100024095 | Ga0075434_1000240954 | 206 |
| 411 | 3300006871 | Ga0075434_100068612 | Ga0075434_1000686122 | 206 |
| 412 | 3300006871 | Ga0075434_100069113 | Ga0075434_1000691133 | 206 |
| 413 | 3300006871 | Ga0075434_100171720 | Ga0075434_1001717202 | 206 |
| 414 | 3300006871 | Ga0075434_100238699 | Ga0075434_1002386992 | 206 |
| 415 | 3300006871 | Ga0075434_100336748 | Ga0075434_1003367482 | 206 |
| 416 | 3300006871 | Ga0075434_100679966 | Ga0075434_1006799662 | 206 |
| 417 | 3300006871 | Ga0075434_100925217 | Ga0075434_1009252172 | 206 |
| 418 | 3300006880 | Ga0075429_100000283 | Ga0075429_10000028319 | 206 |
| 419 | 3300006880 | Ga0075429_100047346 | Ga0075429_1000473464 | 206 |
| 420 | 3300006880 | Ga0075429_100086698 | Ga0075429_1000866983 | 206 |
| 421 | 3300006880 | Ga0075429_100336505 | Ga0075429_1003365052 | 206 |
| 422 | 3300006880 | Ga0075429_100428266 | Ga0075429_1004282662 | 206 |
| 423 | 3300006880 | Ga0075429_101039616 | Ga0075429_1010396161 | 206 |
| 424 | 3300006881 | Ga0068865_100001514 | Ga0068865_1000015144 | 206 |
| 425 | 3300006914 | Ga0075436_100000724 | Ga0075436_10000072422 | 206 |
| 426 | 3300006914 | Ga0075436_100017487 | Ga0075436_1000174873 | 206 |
| 427 | 3300006914 | Ga0075436_100020245 | Ga0075436_1000202456 | 206 |
| 428 | 3300006914 | Ga0075436_100051691 | Ga0075436_1000516913 | 206 |
| 429 | 3300006914 | Ga0075436_100063252 | Ga0075436_1000632522 | 206 |
| 430 | 3300006914 | Ga0075436_100111267 | Ga0075436_1001112673 | 206 |
| 431 | 3300006914 | Ga0075436_100285399 | Ga0075436_1002853992 | 206 |
| 432 | 3300006914 | Ga0075436_100310931 | Ga0075436_1003109312 | 206 |
| 433 | 3300006931 | Ga0097620_100024587 | Ga0097620_1000245874 | 206 |
| 434 | 3300006931 | Ga0097620_100041401 | Ga0097620_1000414012 | 206 |
| 435 | 3300006931 | Ga0097620_100084305 | Ga0097620_1000843052 | 206 |
| 436 | 3300006931 | Ga0097620_100092145 | Ga0097620_1000921453 | 206 |
| 437 | 3300006931 | Ga0097620_100123906 | Ga0097620_1001239063 | 206 |
| 438 | 3300006931 | Ga0097620_100207071 | Ga0097620_1002070711 | 206 |
| 439 | 3300007076 | Ga0075435_100029043 | Ga0075435_1000290437 | 206 |
| 440 | 3300007076 | Ga0075435_100079712 | Ga0075435_1000797123 | 206 |
| 441 | 3300007076 | Ga0075435_100107146 | Ga0075435_1001071462 | 206 |
| 442 | 3300007076 | Ga0075435_100272455 | Ga0075435_1002724551 | 206 |
| 443 | 3300007076 | Ga0075435_100283173 | Ga0075435_1002831732 | 206 |
| 444 | 3300007076 | Ga0075435_100326916 | Ga0075435_1003269161 | 206 |
| 445 | 3300007076 | Ga0075435_100477580 | Ga0075435_1004775802 | 206 |
| 446 | 3300007076 | Ga0075435_100586612 | Ga0075435_1005866122 | 206 |
| 447 | 3300007788 | Ga0099795_10074192 | Ga0099795_100741922 | 206 |
| 448 | 3300009093 | Ga0105240_10073620 | Ga0105240_100736203 | 206 |
| 449 | 3300009093 | Ga0105240_10247240 | Ga0105240_102472402 | 206 |
| 450 | 3300009093 | Ga0105240_10634142 | Ga0105240_106341422 | 206 |
| 451 | 3300009094 | Ga0111539_10040798 | Ga0111539_100407984 | 206 |
| 452 | 3300009094 | Ga0111539_10042342 | Ga0111539_100423421 | 206 |
| 453 | 3300009094 | Ga0111539_10458637 | Ga0111539_104586372 | 206 |
| 454 | 3300009094 | Ga0111539_10796253 | Ga0111539_107962532 | 206 |
| 455 | 3300009098 | Ga0105245_11322516 | Ga0105245_113225161 | 206 |
| 456 | 3300009147 | Ga0114129_10000918 | Ga0114129_1000091826 | 206 |
| 457 | 3300009147 | Ga0114129_10063870 | Ga0114129_100638704 | 206 |
| 458 | 3300009147 | Ga0114129_10172875 | Ga0114129_101728752 | 206 |
| 459 | 3300009147 | Ga0114129_10234795 | Ga0114129_102347953 | 206 |
| 460 | 3300009147 | Ga0114129_10314094 | Ga0114129_103140943 | 206 |
| 461 | 3300009147 | Ga0114129_10936551 | Ga0114129_109365512 | 206 |
| 462 | 3300009147 | Ga0114129_11171065 | Ga0114129_111710652 | 206 |
| 463 | 3300009147 | Ga0114129_11224902 | Ga0114129_112249021 | 206 |
| 464 | 3300009147 | Ga0114129_11792669 | Ga0114129_117926692 | 206 |
| 465 | 3300009176 | Ga0105242_11075700 | Ga0105242_110757001 | 206 |
| 466 | 3300009177 | Ga0105248_10009365 | Ga0105248_1000936510 | 206 |
| 467 | 3300009177 | Ga0105248_10025929 | Ga0105248_100259294 | 206 |
| 468 | 3300009177 | Ga0105248_10130172 | Ga0105248_101301721 | 206 |
| 469 | 3300009177 | Ga0105248_10224601 | Ga0105248_102246012 | 206 |
| 470 | 3300009177 | Ga0105248_10243631 | Ga0105248_102436312 | 206 |
| 471 | 3300009177 | Ga0105248_10289252 | Ga0105248_102892522 | 206 |
| 472 | 3300009177 | Ga0105248_10479142 | Ga0105248_104791422 | 206 |
| 473 | 3300009177 | Ga0105248_11548738 | Ga0105248_115487381 | 206 |
| 474 | 3300009551 | Ga0105238_10000082 | Ga0105238_1000008279 | 206 |
| 475 | 3300009553 | Ga0105249_10000115 | Ga0105249_100001155 | 206 |
| 476 | 3300009553 | Ga0105249_10000454 | Ga0105249_1000045425 | 206 |
| 477 | 3300009553 | Ga0105249_10020862 | Ga0105249_100208623 | 206 |
| 478 | 3300009553 | Ga0105249_10108483 | Ga0105249_101084833 | 206 |
| 479 | 3300009553 | Ga0105249_11413995 | Ga0105249_114139951 | 206 |
| 480 | 3300009553 | Ga0105249_11636261 | Ga0105249_116362611 | 206 |
| 481 | 3300010375 | Ga0105239_10033512 | Ga0105239_100335126 | 206 |
| 482 | 3300011119 | Ga0105246_10517035 | Ga0105246_105170352 | 206 |
| 483 | 3300013100 | Ga0157373_10001473 | Ga0157373_1000147317 | 206 |
| 484 | 3300013100 | Ga0157373_10266861 | Ga0157373_102668612 | 206 |
| 485 | 3300013102 | Ga0157371_10007275 | Ga0157371_100072756 | 206 |
| 486 | 3300013104 | Ga0157370_10120885 | Ga0157370_101208852 | 206 |
| 487 | 3300013104 | Ga0157370_10459742 | Ga0157370_104597421 | 206 |
| 488 | 3300013105 | Ga0157369_10083371 | Ga0157369_100833714 | 206 |
| 489 | 3300013105 | Ga0157369_10107160 | Ga0157369_101071603 | 206 |
| 490 | 3300013105 | Ga0157369_10241902 | Ga0157369_102419022 | 206 |
| 491 | 3300013105 | Ga0157369_10302334 | Ga0157369_103023342 | 206 |
| 492 | 3300013296 | Ga0157374_10235614 | Ga0157374_102356141 | 206 |
| 493 | 3300013297 | Ga0157378_10709408 | Ga0157378_107094082 | 206 |
| 494 | 3300013306 | Ga0163162_10001492 | Ga0163162_1000149218 | 206 |
| 495 | 3300013306 | Ga0163162_10009352 | Ga0163162_100093524 | 206 |
| 496 | 3300013306 | Ga0163162_10013828 | Ga0163162_100138286 | 206 |
| 497 | 3300013307 | Ga0157372_10015470 | Ga0157372_100154704 | 206 |
| 498 | 3300013307 | Ga0157372_10126831 | Ga0157372_101268311 | 206 |
| 499 | 3300013308 | Ga0157375_10025086 | Ga0157375_100250867 | 206 |
| 500 | 3300013308 | Ga0157375_10149733 | Ga0157375_101497332 | 206 |
| 501 | 3300013308 | Ga0157375_10326904 | Ga0157375_103269042 | 206 |
| 502 | 3300013308 | Ga0157375_10696491 | Ga0157375_106964912 | 206 |
| 503 | 3300013308 | Ga0157375_11193294 | Ga0157375_111932941 | 206 |
| 504 | 3300014325 | Ga0163163_10068100 | Ga0163163_100681003 | 206 |
| 505 | 3300014326 | Ga0157380_10007646 | Ga0157380_100076463 | 206 |
| 506 | 3300014326 | Ga0157380_10027037 | Ga0157380_100270376 | 206 |
| 507 | 3300014326 | Ga0157380_10615788 | Ga0157380_106157882 | 206 |
| 508 | 3300014497 | Ga0182008_10009299 | Ga0182008_100092997 | 206 |
| 509 | 3300014745 | Ga0157377_10005403 | Ga0157377_100054036 | 206 |
| 510 | 3300014969 | Ga0157376_10050743 | Ga0157376_100507433 | 206 |
| 511 | 3300014969 | Ga0157376_10401354 | Ga0157376_104013542 | 206 |
| 512 | 3300017792 | Ga0163161_10033434 | Ga0163161_100334343 | 206 |
| 513 | 3300017792 | Ga0163161_10339454 | Ga0163161_103394542 | 206 |
| 514 | 3300021388 | Ga0213875_10016088 | Ga0213875_100160883 | 206 |
| 515 | 3300025315 | Ga0207697_10013577 | Ga0207697_100135772 | 206 |
| 516 | 3300025321 | Ga0207656_10020155 | Ga0207656_100201552 | 206 |
| 517 | 3300025885 | Ga0207653_10000333 | Ga0207653_1000033319 | 206 |
| 518 | 3300025885 | Ga0207653_10004243 | Ga0207653_100042433 | 206 |
| 519 | 3300025885 | Ga0207653_10009549 | Ga0207653_100095491 | 206 |
| 520 | 3300025885 | Ga0207653_10027001 | Ga0207653_100270012 | 206 |
| 521 | 3300025903 | Ga0207680_10584370 | Ga0207680_105843702 | 206 |
| 522 | 3300025905 | Ga0207685_10410385 | Ga0207685_104103851 | 206 |
| 523 | 3300025906 | Ga0207699_10003303 | Ga0207699_100033034 | 206 |
| 524 | 3300025906 | Ga0207699_10004172 | Ga0207699_100041724 | 206 |
| 525 | 3300025907 | Ga0207645_10000246 | Ga0207645_1000024625 | 206 |
| 526 | 3300025908 | Ga0207643_10049854 | Ga0207643_100498542 | 206 |
| 527 | 3300025910 | Ga0207684_10025853 | Ga0207684_100258537 | 206 |
| 528 | 3300025910 | Ga0207684_10049207 | Ga0207684_100492073 | 206 |
| 529 | 3300025910 | Ga0207684_10052400 | Ga0207684_100524002 | 206 |
| 530 | 3300025910 | Ga0207684_10056409 | Ga0207684_100564092 | 206 |
| 531 | 3300025910 | Ga0207684_10289501 | Ga0207684_102895012 | 206 |
| 532 | 3300025910 | Ga0207684_10469940 | Ga0207684_104699402 | 206 |
| 533 | 3300025912 | Ga0207707_10000929 | Ga0207707_1000092912 | 206 |
| 534 | 3300025912 | Ga0207707_10004279 | Ga0207707_1000427912 | 206 |
| 535 | 3300025912 | Ga0207707_10012211 | Ga0207707_100122113 | 206 |
| 536 | 3300025912 | Ga0207707_10018172 | Ga0207707_100181725 | 206 |
| 537 | 3300025912 | Ga0207707_10355257 | Ga0207707_103552572 | 206 |
| 538 | 3300025913 | Ga0207695_10001441 | Ga0207695_1000144119 | 206 |
| 539 | 3300025913 | Ga0207695_10020766 | Ga0207695_100207666 | 206 |
| 540 | 3300025915 | Ga0207693_10054679 | Ga0207693_100546793 | 206 |
| 541 | 3300025916 | Ga0207663_10000556 | Ga0207663_1000055610 | 206 |
| 542 | 3300025916 | Ga0207663_10152376 | Ga0207663_101523762 | 206 |
| 543 | 3300025916 | Ga0207663_10425943 | Ga0207663_104259431 | 206 |
| 544 | 3300025917 | Ga0207660_10001809 | Ga0207660_100018095 | 206 |
| 545 | 3300025917 | Ga0207660_10013503 | Ga0207660_100135033 | 206 |
| 546 | 3300025917 | Ga0207660_10061487 | Ga0207660_100614873 | 206 |
| 547 | 3300025917 | Ga0207660_10066366 | Ga0207660_100663663 | 206 |
| 548 | 3300025917 | Ga0207660_10131532 | Ga0207660_101315322 | 206 |
| 549 | 3300025917 | Ga0207660_10430414 | Ga0207660_104304142 | 206 |
| 550 | 3300025918 | Ga0207662_10003079 | Ga0207662_100030795 | 206 |
| 551 | 3300025918 | Ga0207662_10039369 | Ga0207662_100393692 | 206 |
| 552 | 3300025918 | Ga0207662_10356264 | Ga0207662_103562642 | 206 |
| 553 | 3300025919 | Ga0207657_10021232 | Ga0207657_100212326 | 206 |
| 554 | 3300025919 | Ga0207657_10069828 | Ga0207657_100698283 | 206 |
| 555 | 3300025920 | Ga0207649_10025399 | Ga0207649_100253991 | 206 |
| 556 | 3300025920 | Ga0207649_10082210 | Ga0207649_100822103 | 206 |
| 557 | 3300025920 | Ga0207649_10203801 | Ga0207649_102038012 | 206 |
| 558 | 3300025920 | Ga0207649_10482632 | Ga0207649_104826321 | 206 |
| 559 | 3300025920 | Ga0207649_10664380 | Ga0207649_106643801 | 206 |
| 560 | 3300025920 | Ga0207649_10845717 | Ga0207649_108457171 | 206 |
| 561 | 3300025921 | Ga0207652_10000470 | Ga0207652_1000047024 | 206 |
| 562 | 3300025921 | Ga0207652_10008367 | Ga0207652_100083678 | 206 |
| 563 | 3300025921 | Ga0207652_10253236 | Ga0207652_102532362 | 206 |
| 564 | 3300025921 | Ga0207652_10625068 | Ga0207652_106250682 | 206 |
| 565 | 3300025921 | Ga0207652_10708038 | Ga0207652_107080382 | 206 |
| 566 | 3300025921 | Ga0207652_11017790 | Ga0207652_110177901 | 206 |
| 567 | 3300025922 | Ga0207646_10003762 | Ga0207646_100037626 | 206 |
| 568 | 3300025922 | Ga0207646_10013412 | Ga0207646_100134129 | 206 |
| 569 | 3300025922 | Ga0207646_10021064 | Ga0207646_100210648 | 206 |
| 570 | 3300025922 | Ga0207646_10040328 | Ga0207646_100403282 | 206 |
| 571 | 3300025922 | Ga0207646_10076152 | Ga0207646_100761522 | 206 |
| 572 | 3300025922 | Ga0207646_10082816 | Ga0207646_100828163 | 206 |
| 573 | 3300025922 | Ga0207646_10090878 | Ga0207646_100908783 | 206 |
| 574 | 3300025922 | Ga0207646_10153252 | Ga0207646_101532522 | 206 |
| 575 | 3300025922 | Ga0207646_10329127 | Ga0207646_103291272 | 206 |
| 576 | 3300025922 | Ga0207646_10490266 | Ga0207646_104902662 | 206 |
| 577 | 3300025923 | Ga0207681_10002554 | Ga0207681_100025541 | 206 |
| 578 | 3300025923 | Ga0207681_10009785 | Ga0207681_100097853 | 206 |
| 579 | 3300025924 | Ga0207694_10000031 | Ga0207694_10000031160 | 206 |
| 580 | 3300025925 | Ga0207650_10004487 | Ga0207650_100044878 | 206 |
| 581 | 3300025926 | Ga0207659_10024660 | Ga0207659_100246603 | 206 |
| 582 | 3300025926 | Ga0207659_10158062 | Ga0207659_101580621 | 206 |
| 583 | 3300025926 | Ga0207659_10365751 | Ga0207659_103657512 | 206 |
| 584 | 3300025928 | Ga0207700_10493556 | Ga0207700_104935561 | 206 |
| 585 | 3300025929 | Ga0207664_10039793 | Ga0207664_100397935 | 206 |
| 586 | 3300025929 | Ga0207664_10485805 | Ga0207664_104858052 | 206 |
| 587 | 3300025931 | Ga0207644_10006147 | Ga0207644_100061473 | 206 |
| 588 | 3300025932 | Ga0207690_10092018 | Ga0207690_100920182 | 206 |
| 589 | 3300025933 | Ga0207706_10000240 | Ga0207706_1000024029 | 206 |
| 590 | 3300025933 | Ga0207706_10000357 | Ga0207706_1000035725 | 206 |
| 591 | 3300025933 | Ga0207706_10091758 | Ga0207706_100917583 | 206 |
| 592 | 3300025933 | Ga0207706_10107710 | Ga0207706_101077102 | 206 |
| 593 | 3300025933 | Ga0207706_10254057 | Ga0207706_102540572 | 206 |
| 594 | 3300025934 | Ga0207686_10038002 | Ga0207686_100380022 | 206 |
| 595 | 3300025935 | Ga0207709_10656970 | Ga0207709_106569702 | 206 |
| 596 | 3300025937 | Ga0207669_10013476 | Ga0207669_100134763 | 206 |
| 597 | 3300025938 | Ga0207704_10024309 | Ga0207704_100243092 | 206 |
| 598 | 3300025938 | Ga0207704_10701737 | Ga0207704_107017371 | 206 |
| 599 | 3300025939 | Ga0207665_10001273 | Ga0207665_1000127319 | 206 |
| 600 | 3300025939 | Ga0207665_10144401 | Ga0207665_101444012 | 206 |
| 601 | 3300025940 | Ga0207691_10022438 | Ga0207691_100224382 | 206 |
| 602 | 3300025940 | Ga0207691_10042373 | Ga0207691_100423736 | 206 |
| 603 | 3300025940 | Ga0207691_10069335 | Ga0207691_100693352 | 206 |
| 604 | 3300025940 | Ga0207691_10310100 | Ga0207691_103101002 | 206 |
| 605 | 3300025940 | Ga0207691_10717182 | Ga0207691_107171822 | 206 |
| 606 | 3300025941 | Ga0207711_10453324 | Ga0207711_104533242 | 206 |
| 607 | 3300025941 | Ga0207711_10477947 | Ga0207711_104779472 | 206 |
| 608 | 3300025941 | Ga0207711_10486027 | Ga0207711_104860271 | 206 |
| 609 | 3300025942 | Ga0207689_10027696 | Ga0207689_100276964 | 206 |
| 610 | 3300025944 | Ga0207661_10001946 | Ga0207661_100019463 | 206 |
| 611 | 3300025944 | Ga0207661_10011833 | Ga0207661_100118336 | 206 |
| 612 | 3300025944 | Ga0207661_10076562 | Ga0207661_100765623 | 206 |
| 613 | 3300025944 | Ga0207661_10619641 | Ga0207661_106196411 | 206 |
| 614 | 3300025945 | Ga0207679_10000484 | Ga0207679_1000048411 | 206 |
| 615 | 3300025945 | Ga0207679_10006509 | Ga0207679_100065098 | 206 |
| 616 | 3300025945 | Ga0207679_10009273 | Ga0207679_100092738 | 206 |
| 617 | 3300025945 | Ga0207679_10119853 | Ga0207679_101198532 | 206 |
| 618 | 3300025949 | Ga0207667_10011137 | Ga0207667_100111378 | 206 |
| 619 | 3300025949 | Ga0207667_10229710 | Ga0207667_102297101 | 206 |
| 620 | 3300025949 | Ga0207667_10398274 | Ga0207667_103982742 | 206 |
| 621 | 3300025961 | Ga0207712_10000499 | Ga0207712_1000049921 | 206 |
| 622 | 3300025961 | Ga0207712_10001176 | Ga0207712_100011767 | 206 |
| 623 | 3300025961 | Ga0207712_10013123 | Ga0207712_100131233 | 206 |
| 624 | 3300025961 | Ga0207712_10195094 | Ga0207712_101950941 | 206 |
| 625 | 3300025961 | Ga0207712_11069500 | Ga0207712_110695001 | 206 |
| 626 | 3300025972 | Ga0207668_10003474 | Ga0207668_100034748 | 206 |
| 627 | 3300025972 | Ga0207668_10103366 | Ga0207668_101033662 | 206 |
| 628 | 3300025972 | Ga0207668_10181836 | Ga0207668_101818362 | 206 |
| 629 | 3300025972 | Ga0207668_10278097 | Ga0207668_102780972 | 206 |
| 630 | 3300025981 | Ga0207640_10001456 | Ga0207640_1000145612 | 206 |
| 631 | 3300025981 | Ga0207640_10097863 | Ga0207640_100978633 | 206 |
| 632 | 3300025981 | Ga0207640_10287036 | Ga0207640_102870362 | 206 |
| 633 | 3300025986 | Ga0207658_10069022 | Ga0207658_100690223 | 206 |
| 634 | 3300026023 | Ga0207677_10090705 | Ga0207677_100907051 | 206 |
| 635 | 3300026035 | Ga0207703_10013898 | Ga0207703_100138986 | 206 |
| 636 | 3300026041 | Ga0207639_10004358 | Ga0207639_100043587 | 206 |
| 637 | 3300026041 | Ga0207639_10081332 | Ga0207639_100813323 | 206 |
| 638 | 3300026041 | Ga0207639_10719660 | Ga0207639_107196602 | 206 |
| 639 | 3300026067 | Ga0207678_10418043 | Ga0207678_104180431 | 206 |
| 640 | 3300026075 | Ga0207708_10048583 | Ga0207708_100485833 | 206 |
| 641 | 3300026075 | Ga0207708_10718818 | Ga0207708_107188181 | 206 |
| 642 | 3300026078 | Ga0207702_10493602 | Ga0207702_104936021 | 206 |
| 643 | 3300026088 | Ga0207641_10027354 | Ga0207641_100273546 | 206 |
| 644 | 3300026088 | Ga0207641_10053544 | Ga0207641_100535441 | 206 |
| 645 | 3300026089 | Ga0207648_10005220 | Ga0207648_100052208 | 206 |
| 646 | 3300026089 | Ga0207648_10032931 | Ga0207648_100329314 | 206 |
| 647 | 3300026089 | Ga0207648_10081119 | Ga0207648_100811193 | 206 |
| 648 | 3300026089 | Ga0207648_10405160 | Ga0207648_104051601 | 206 |
| 649 | 3300026095 | Ga0207676_10085386 | Ga0207676_100853862 | 206 |
| 650 | 3300026095 | Ga0207676_10094646 | Ga0207676_100946462 | 206 |
| 651 | 3300026095 | Ga0207676_10131582 | Ga0207676_101315822 | 206 |
| 652 | 3300026116 | Ga0207674_10003135 | Ga0207674_1000313519 | 206 |
| 653 | 3300026116 | Ga0207674_10015526 | Ga0207674_100155264 | 206 |
| 654 | 3300026116 | Ga0207674_10018565 | Ga0207674_100185654 | 206 |
| 655 | 3300026116 | Ga0207674_10471392 | Ga0207674_104713921 | 206 |
| 656 | 3300026118 | Ga0207675_100000320 | Ga0207675_10000032021 | 206 |
| 657 | 3300026118 | Ga0207675_100052078 | Ga0207675_1000520783 | 206 |
| 658 | 3300026118 | Ga0207675_100053417 | Ga0207675_1000534172 | 206 |
| 659 | 3300026118 | Ga0207675_101194559 | Ga0207675_1011945591 | 206 |
| 660 | 3300026121 | Ga0207683_10034731 | Ga0207683_100347312 | 206 |
| 661 | 3300026142 | Ga0207698_10013973 | Ga0207698_100139732 | 206 |
| 662 | 3300026142 | Ga0207698_10165264 | Ga0207698_101652642 | 206 |
| 663 | 3300026142 | Ga0207698_10597062 | Ga0207698_105970622 | 206 |
| 664 | 3300027717 | Ga0209998_10021291 | Ga0209998_100212912 | 206 |
| 665 | 3300027876 | Ga0209974_10032789 | Ga0209974_100327892 | 206 |
| 666 | 3300027876 | Ga0209974_10035554 | Ga0209974_100355541 | 206 |
| 667 | 3300027876 | Ga0209974_10053204 | Ga0209974_100532042 | 206 |
| 668 | 3300027907 | Ga0207428_10070482 | Ga0207428_100704821 | 206 |
| 669 | 3300027907 | Ga0207428_10279829 | Ga0207428_102798291 | 206 |
| 670 | 3300027907 | Ga0207428_10344024 | Ga0207428_103440242 | 206 |
| 671 | 3300028379 | Ga0268266_10297444 | Ga0268266_102974442 | 206 |
| 672 | 3300028379 | Ga0268266_10345674 | Ga0268266_103456742 | 206 |
| 673 | 3300028379 | Ga0268266_10606989 | Ga0268266_106069892 | 206 |
| 674 | 3300028380 | Ga0268265_10002121 | Ga0268265_100021213 | 206 |
| 675 | 3300028380 | Ga0268265_10385158 | Ga0268265_103851582 | 206 |
| 676 | 3300028380 | Ga0268265_10904024 | Ga0268265_109040241 | 206 |
| 677 | 3300028381 | Ga0268264_10056897 | Ga0268264_100568973 | 206 |
| 678 | 3300030745 | Ga0316182_1400452 | Ga0316182_14004522 | 206 |
| 679 | 3300031548 | Ga0307408_100023852 | Ga0307408_1000238522 | 206 |
| 680 | 3300031548 | Ga0307408_100033838 | Ga0307408_1000338382 | 206 |
| 681 | 3300031548 | Ga0307408_100252115 | Ga0307408_1002521152 | 206 |
| 682 | 3300031548 | Ga0307408_100961497 | Ga0307408_1009614971 | 206 |
| 683 | 3300031824 | Ga0307413_10019867 | Ga0307413_100198673 | 206 |
| 684 | 3300031824 | Ga0307413_10034699 | Ga0307413_100346991 | 206 |
| 685 | 3300031824 | Ga0307413_10064281 | Ga0307413_100642813 | 206 |
| 686 | 3300031824 | Ga0307413_10138214 | Ga0307413_101382142 | 206 |
| 687 | 3300031824 | Ga0307413_10342712 | Ga0307413_103427122 | 206 |
| 688 | 3300031852 | Ga0307410_10002152 | Ga0307410_1000215210 | 206 |
| 689 | 3300031852 | Ga0307410_10034713 | Ga0307410_100347133 | 206 |
| 690 | 3300031852 | Ga0307410_10066181 | Ga0307410_100661812 | 206 |
| 691 | 3300031852 | Ga0307410_10085329 | Ga0307410_100853293 | 206 |
| 692 | 3300031852 | Ga0307410_10111755 | Ga0307410_101117552 | 206 |
| 693 | 3300031852 | Ga0307410_10159460 | Ga0307410_101594601 | 206 |
| 694 | 3300031852 | Ga0307410_10260503 | Ga0307410_102605032 | 206 |
| 695 | 3300031852 | Ga0307410_10397990 | Ga0307410_103979902 | 206 |
| 696 | 3300031852 | Ga0307410_10406662 | Ga0307410_104066623 | 206 |
| 697 | 3300031901 | Ga0307406_10001688 | Ga0307406_100016888 | 206 |
| 698 | 3300031901 | Ga0307406_10002595 | Ga0307406_100025954 | 206 |
| 699 | 3300031901 | Ga0307406_10212389 | Ga0307406_102123892 | 206 |
| 700 | 3300031901 | Ga0307406_10396758 | Ga0307406_103967581 | 206 |
| 701 | 3300031901 | Ga0307406_10731548 | Ga0307406_107315481 | 206 |
| 702 | 3300031903 | Ga0307407_10046330 | Ga0307407_100463302 | 206 |
| 703 | 3300031903 | Ga0307407_10082309 | Ga0307407_100823092 | 206 |
| 704 | 3300031903 | Ga0307407_10084847 | Ga0307407_100848472 | 206 |
| 705 | 3300031903 | Ga0307407_10229529 | Ga0307407_102295291 | 206 |
| 706 | 3300031911 | Ga0307412_10026367 | Ga0307412_100263673 | 206 |
| 707 | 3300031911 | Ga0307412_10179634 | Ga0307412_101796342 | 206 |
| 708 | 3300031911 | Ga0307412_10472627 | Ga0307412_104726272 | 206 |
| 709 | 3300031995 | Ga0307409_100000144 | Ga0307409_10000014410 | 206 |
| 710 | 3300031995 | Ga0307409_100092871 | Ga0307409_1000928713 | 206 |
| 711 | 3300031995 | Ga0307409_100130147 | Ga0307409_1001301472 | 206 |
| 712 | 3300031995 | Ga0307409_100189263 | Ga0307409_1001892632 | 206 |
| 713 | 3300031995 | Ga0307409_100460620 | Ga0307409_1004606201 | 206 |
| 714 | 3300031995 | Ga0307409_100482112 | Ga0307409_1004821122 | 206 |
| 715 | 3300031995 | Ga0307409_100602088 | Ga0307409_1006020881 | 206 |
| 716 | 3300031995 | Ga0307409_100673242 | Ga0307409_1006732422 | 206 |
| 717 | 3300031995 | Ga0307409_101365291 | Ga0307409_1013652911 | 206 |
| 718 | 3300032002 | Ga0307416_100000828 | Ga0307416_1000008288 | 206 |
| 719 | 3300032002 | Ga0307416_100012718 | Ga0307416_1000127182 | 206 |
| 720 | 3300032002 | Ga0307416_100014248 | Ga0307416_1000142487 | 206 |
| 721 | 3300032002 | Ga0307416_100098157 | Ga0307416_1000981573 | 206 |
| 722 | 3300032002 | Ga0307416_100101715 | Ga0307416_1001017153 | 206 |
| 723 | 3300032002 | Ga0307416_100219380 | Ga0307416_1002193801 | 206 |
| 724 | 3300032002 | Ga0307416_100449360 | Ga0307416_1004493602 | 206 |
| 725 | 3300032004 | Ga0307414_10002383 | Ga0307414_100023839 | 206 |
| 726 | 3300032004 | Ga0307414_10080065 | Ga0307414_100800653 | 206 |
| 727 | 3300032004 | Ga0307414_10115391 | Ga0307414_101153911 | 206 |
| 728 | 3300032004 | Ga0307414_10121089 | Ga0307414_101210893 | 206 |
| 729 | 3300032004 | Ga0307414_10128285 | Ga0307414_101282852 | 206 |
| 730 | 3300032004 | Ga0307414_10182198 | Ga0307414_101821983 | 206 |
| 731 | 3300032004 | Ga0307414_10301355 | Ga0307414_103013552 | 206 |
| 732 | 3300032004 | Ga0307414_10325274 | Ga0307414_103252742 | 206 |
| 733 | 3300032004 | Ga0307414_10902365 | Ga0307414_109023651 | 206 |
| 734 | 3300032005 | Ga0307411_10010876 | Ga0307411_100108765 | 206 |
| 735 | 3300032005 | Ga0307411_10017282 | Ga0307411_100172822 | 206 |
| 736 | 3300032005 | Ga0307411_10043167 | Ga0307411_100431673 | 206 |
| 737 | 3300032005 | Ga0307411_10212673 | Ga0307411_102126732 | 206 |
| 738 | 3300032005 | Ga0307411_10572506 | Ga0307411_105725061 | 206 |
| 739 | 3300032005 | Ga0307411_10728649 | Ga0307411_107286491 | 206 |
| 740 | 3300032005 | Ga0307411_10849291 | Ga0307411_108492912 | 206 |
| 741 | 3300032126 | Ga0307415_100000419 | Ga0307415_10000041913 | 206 |
| 742 | 3300032126 | Ga0307415_100119421 | Ga0307415_1001194213 | 206 |
| 743 | 3300032126 | Ga0307415_100791815 | Ga0307415_1007918152 | 206 |
| 744 | 3300034816 | Ga0373930_0013841 | Ga0373930_0013841_599_1225 | 206 |
| 745 | 3300034817 | Ga0373948_0028390 | Ga0373948_0028390_430_1059 | 206 |
| 746 | 3300034819 | Ga0373958_0051750 | Ga0373958_0051750_53_679 | 206 |
| 747 | 3300034820 | Ga0373959_0000187 | Ga0373959_0000187_5429_6094 | 206 |
| 748 | 3300034820 | Ga0373959_0007997 | Ga0373959_0007997_541_1170 | 206 |
| 749 | 3300034820 | Ga0373959_0039204 | Ga0373959_0039204_76_696 | 206 |
| 750 | 3300035112 | Ga0373932_0104442 | Ga0373932_0104442_276_905 | 206 |
| 751 | 3300035207 | Ga0373942_0077912 | Ga0373942_0077912_166_795 | 206 |
| 752 | 3300035241 | Ga0373961_0016222 | Ga0373961_0016222_197_817 | 206 |
| 753 | 3300035691 | Ga0373931_0008014 | Ga0373931_0008014_2770_3390 | 206 |
| 754 | 3300035691 | Ga0373931_0190774 | Ga0373931_0190774_519_1148 | 206 |
| 755 | 3300036401 | Ga0373937_1040561 | Ga0373937_1040561_31_651 | 206 |
| 756 | 3300037068 | Ga0373925_0402602 | Ga0373925_0402602_38_664 | 206 |
| 757 | 3300037418 | Ga0395900_0005143 | Ga0395900_0005143_9634_10257 | 206 |
| 758 | 3300037471 | Ga0395905_0035452 | Ga0395905_0035452_648_1271 | 206 |
| 759 | 3300037471 | Ga0395905_0309388 | Ga0395905_0309388_508_1128 | 206 |
| 760 | 3300037471 | Ga0395905_0338329 | Ga0395905_0338329_96_716 | 206 |
| 761 | 3300037471 | Ga0395905_0773182 | Ga0395905_0773182_213_836 | 206 |
| 762 | 3300037853 | Ga0436364_0532547 | Ga0436364_0532547_1795_2415 | 206 |
| 763 | 3300037853 | Ga0436364_0890989 | Ga0436364_0890989_173_868 | 206 |
| 764 | 3300038443 | Ga0395901_0044634 | Ga0395901_0044634_174_869 | 206 |
| 765 | 3300038443 | Ga0395901_0057802 | Ga0395901_0057802_2700_3323 | 206 |
| 766 | 3300038698 | Ga0242419_002517 | Ga0242419_002517_275_895 | 206 |
| 767 | 3300038996 | Ga0242420_003855 | Ga0242420_003855_191_811 | 206 |
| 768 | 3300038996 | Ga0242420_053365 | Ga0242420_053365_106_726 | 206 |
| 769 | 3300041406 | Ga0439439_0013448 | Ga0439439_0013448_849_1472 | 206 |
| 770 | 3300042015 | Ga0439462_0020084 | Ga0439462_0020084_1029_1652 | 206 |
| 771 | 3300042133 | Ga0450896_011065 | Ga0450896_011065_12_632 | 206 |
| 772 | 3300042134 | Ga0450898_015309 | Ga0450898_015309_52_672 | 206 |
| 773 | 3300042156 | Ga0439446_0079940 | Ga0439446_0079940_248_871 | 206 |
| 774 | 3300042435 | Ga0439434_0038539 | Ga0439434_0038539_240_863 | 206 |
| 775 | 3300042436 | Ga0439435_0037204 | Ga0439435_0037204_52_678 | 206 |
| 776 | 3300042436 | Ga0439435_0121832 | Ga0439435_0121832_34_663 | 206 |
| 777 | 3300042876 | Ga0451577_0036034 | Ga0451577_0036034_2021_2641 | 206 |
| 778 | 3300042876 | Ga0451577_0354058 | Ga0451577_0354058_355_975 | 206 |
| 779 | 3300042876 | Ga0451577_0415277 | Ga0451577_0415277_531_1160 | 206 |
| 780 | 3300042876 | Ga0451577_0497896 | Ga0451577_0497896_392_1012 | 206 |
| 781 | 3300042876 | Ga0451577_0530573 | Ga0451577_0530573_403_1023 | 206 |
| 782 | 3300044656 | Ga0466969_0142939 | Ga0466969_0142939_107_733 | 206 |
| 783 | 3300044673 | Ga0453683_0006036 | Ga0453683_0006036_2093_2713 | 206 |
| 784 | 3300044673 | Ga0453683_0067639 | Ga0453683_0067639_255_875 | 206 |
| 785 | 3300044673 | Ga0453683_0097817 | Ga0453683_0097817_976_1596 | 206 |
| 786 | 3300044673 | Ga0453683_0168349 | Ga0453683_0168349_494_1114 | 206 |
| 787 | 3300044673 | Ga0453683_0448630 | Ga0453683_0448630_40_660 | 206 |
| 788 | 3300044693 | Ga0466961_0025997 | Ga0466961_0025997_912_1538 | 206 |
| 789 | 3300044901 | Ga0466960_0116553 | Ga0466960_0116553_23_655 | 206 |
| 790 | 3300045051 | Ga0451576_0045737 | Ga0451576_0045737_3089_3709 | 206 |
| 791 | 3300045051 | Ga0451576_0046962 | Ga0451576_0046962_2942_3562 | 206 |
| 792 | 3300045051 | Ga0451576_0074983 | Ga0451576_0074983_2631_3257 | 206 |
| 793 | 3300045051 | Ga0451576_0374847 | Ga0451576_0374847_784_1404 | 206 |
| 794 | 3300045051 | Ga0451576_0915442 | Ga0451576_0915442_30_650 | 206 |
| 795 | 3300046455 | Ga0495603_0012157 | Ga0495603_0012157_3662_4282 | 206 |
| 796 | 3300046455 | Ga0495603_0209644 | Ga0495603_0209644_240_860 | 206 |
| 797 | 3300046459 | Ga0495629_0305980 | Ga0495629_0305980_60_680 | 206 |
| 798 | 3300046472 | Ga0495580_0170505 | Ga0495580_0170505_844_1464 | 206 |
| 799 | 3300046473 | Ga0495582_0032465 | Ga0495582_0032465_985_1605 | 206 |
| 800 | 3300046473 | Ga0495582_0270231 | Ga0495582_0270231_298_924 | 206 |
| 801 | 3300046499 | Ga0495594_0021241 | Ga0495594_0021241_780_1400 | 206 |
| 802 | 3300046499 | Ga0495594_0022950 | Ga0495594_0022950_78_698 | 206 |
| 803 | 3300046517 | Ga0495630_0091977 | Ga0495630_0091977_1037_1657 | 206 |
| 804 | 3300046526 | Ga0495666_0046762 | Ga0495666_0046762_834_1454 | 206 |
| 805 | 3300046533 | Ga0495640_0104669 | Ga0495640_0104669_858_1478 | 206 |
| 806 | 3300046535 | Ga0495586_0029017 | Ga0495586_0029017_2126_2746 | 206 |
| 807 | 3300046539 | Ga0495621_0176849 | Ga0495621_0176849_100_720 | 206 |
| 808 | 3300046559 | Ga0495667_0079978 | Ga0495667_0079978_1135_1755 | 206 |
| 809 | 3300046642 | Ga0495634_0033648 | Ga0495634_0033648_2733_3353 | 206 |
| 810 | 3300046681 | Ga0495647_0039774 | Ga0495647_0039774_423_1043 | 206 |
| 811 | 3300046681 | Ga0495647_0075435 | Ga0495647_0075435_668_1294 | 206 |
| 812 | 3300046683 | Ga0495658_0161334 | Ga0495658_0161334_309_929 | 206 |
| 813 | 3300046689 | Ga0495613_0133508 | Ga0495613_0133508_55_675 | 206 |
| 814 | 3300047318 | Ga0495636_0198977 | Ga0495636_0198977_281_901 | 206 |
| 815 | 3300047319 | Ga0495674_0280408 | Ga0495674_0280408_130_750 | 206 |
| 816 | 3300047321 | Ga0495676_0174190 | Ga0495676_0174190_651_1271 | 206 |
| 817 | 3300047322 | Ga0495680_0059177 | Ga0495680_0059177_1286_1906 | 206 |
| 818 | 3300047471 | Ga0495684_0069778 | Ga0495684_0069778_1342_1962 | 206 |
| 819 | 3300048903 | Ga0496100_0071497 | Ga0496100_0071497_450_1070 | 206 |
| 820 | 3300048903 | Ga0496100_0075999 | Ga0496100_0075999_1151_1780 | 206 |
| 821 | 3300048904 | Ga0496101_0033035 | Ga0496101_0033035_1133_1762 | 206 |
| 822 | 3300048904 | Ga0496101_0534814 | Ga0496101_0534814_283_903 | 206 |
| 823 | 3300048904 | Ga0496101_0547385 | Ga0496101_0547385_186_806 | 206 |
| 824 | 3300048905 | Ga0496102_0056144 | Ga0496102_0056144_766_1386 | 206 |
| 825 | 3300048905 | Ga0496102_0079042 | Ga0496102_0079042_647_1267 | 206 |
| 826 | 3300048905 | Ga0496102_0126992 | Ga0496102_0126992_259_888 | 206 |
| 827 | 3300048905 | Ga0496102_0250840 | Ga0496102_0250840_258_983 | 206 |
| 828 | 3300048906 | Ga0496103_0051176 | Ga0496103_0051176_991_1611 | 206 |
| 829 | 3300048907 | Ga0496104_0004744 | Ga0496104_0004744_6229_6858 | 206 |
| 830 | 3300048907 | Ga0496104_0094784 | Ga0496104_0094784_238_867 | 206 |
| 831 | 3300048907 | Ga0496104_0156483 | Ga0496104_0156483_1512_2132 | 206 |
| 832 | 3300048908 | Ga0496105_0036834 | Ga0496105_0036834_249_878 | 206 |
| 833 | 3300048908 | Ga0496105_0155523 | Ga0496105_0155523_343_963 | 206 |
| 834 | 3300048909 | Ga0496106_0124142 | Ga0496106_0124142_999_1619 | 206 |
| 835 | 3300048909 | Ga0496106_0135676 | Ga0496106_0135676_1209_1829 | 206 |
| 836 | 3300048910 | Ga0496107_0052279 | Ga0496107_0052279_1103_1723 | 206 |
| 837 | 3300048910 | Ga0496107_0113073 | Ga0496107_0113073_729_1454 | 206 |
| 838 | 3300048910 | Ga0496107_0417776 | Ga0496107_0417776_124_744 | 206 |
| 839 | 3300048911 | Ga0496108_0001291 | Ga0496108_0001291_1335_1955 | 206 |
| 840 | 3300048911 | Ga0496108_0005237 | Ga0496108_0005237_5339_5968 | 206 |
| 841 | 3300048911 | Ga0496108_0006989 | Ga0496108_0006989_6639_7259 | 206 |
| 842 | 3300048911 | Ga0496108_0017435 | Ga0496108_0017435_5229_5858 | 206 |
| 843 | 3300048911 | Ga0496108_0453683 | Ga0496108_0453683_380_1006 | 206 |
| 844 | 3300048912 | Ga0496109_0031135 | Ga0496109_0031135_2664_3284 | 206 |
| 845 | 3300048912 | Ga0496109_0035270 | Ga0496109_0035270_830_1456 | 206 |
| 846 | 3300048912 | Ga0496109_0229173 | Ga0496109_0229173_1061_1681 | 206 |
| 847 | 3300048912 | Ga0496109_0407550 | Ga0496109_0407550_546_1175 | 206 |
| 848 | 3300048913 | Ga0496110_0012229 | Ga0496110_0012229_1370_1990 | 206 |
| 849 | 3300048913 | Ga0496110_0437024 | Ga0496110_0437024_56_676 | 206 |
| 850 | 3300048913 | Ga0496110_0905928 | Ga0496110_0905928_32_661 | 206 |
| 851 | 3300048914 | Ga0496111_0442463 | Ga0496111_0442463_249_878 | 206 |
| 852 | 3300048915 | Ga0496112_0001950 | Ga0496112_0001950_13735_14364 | 206 |
| 853 | 3300048915 | Ga0496112_0022068 | Ga0496112_0022068_95_724 | 206 |
| 854 | 3300048915 | Ga0496112_0124946 | Ga0496112_0124946_601_1221 | 206 |
| 855 | 3300048915 | Ga0496112_0586514 | Ga0496112_0586514_134_763 | 206 |
| 856 | 3300048916 | Ga0496113_0000769 | Ga0496113_0000769_12271_12900 | 206 |
| 857 | 3300048916 | Ga0496113_0003336 | Ga0496113_0003336_4612_5232 | 206 |
| 858 | 3300048916 | Ga0496113_0012516 | Ga0496113_0012516_627_1247 | 206 |
| 859 | 3300048916 | Ga0496113_0053330 | Ga0496113_0053330_2274_2903 | 206 |
| 860 | 3300048916 | Ga0496113_0893651 | Ga0496113_0893651_29_655 | 206 |
| 861 | 3300048917 | Ga0496114_0320445 | Ga0496114_0320445_531_1151 | 206 |
| 862 | 3300048917 | Ga0496114_0689274 | Ga0496114_0689274_123_773 | 206 |
| 863 | 3300048918 | Ga0496115_0048377 | Ga0496115_0048377_2295_3020 | 206 |
| 864 | 3300048918 | Ga0496115_0157500 | Ga0496115_0157500_706_1326 | 206 |
| 865 | 3300048918 | Ga0496115_0574060 | Ga0496115_0574060_256_882 | 206 |
| 866 | 3300049568 | Ga0501031_0075042 | Ga0501031_0075042_157_816 | 206 |
| 867 | 3300049569 | Ga0501032_0426933 | Ga0501032_0426933_132_797 | 206 |
| 868 | 3300049569 | Ga0501032_0621217 | Ga0501032_0621217_25_654 | 206 |
| 869 | 3300049570 | Ga0501033_0150262 | Ga0501033_0150262_239_862 | 206 |
| 870 | 3300049570 | Ga0501033_0295651 | Ga0501033_0295651_228_896 | 206 |
| 871 | 3300049570 | Ga0501033_0461899 | Ga0501033_0461899_188_817 | 206 |
| 872 | 3300049571 | Ga0501034_0703208 | Ga0501034_0703208_217_840 | 206 |
| 873 | 3300049572 | Ga0501036_0021910 | Ga0501036_0021910_988_1620 | 206 |
| 874 | 3300049572 | Ga0501036_0327258 | Ga0501036_0327258_407_1036 | 206 |
| 875 | 3300049573 | Ga0501037_0184209 | Ga0501037_0184209_653_1273 | 206 |
| 876 | 3300049574 | Ga0501038_0425201 | Ga0501038_0425201_242_871 | 206 |
| 877 | 3300049574 | Ga0501038_0517989 | Ga0501038_0517989_192_857 | 206 |
| 878 | 3300049575 | Ga0501039_0019178 | Ga0501039_0019178_1243_1872 | 206 |
| 879 | 3300049575 | Ga0501039_0166360 | Ga0501039_0166360_95_727 | 206 |
| 880 | 3300049575 | Ga0501039_0718754 | Ga0501039_0718754_113_733 | 206 |
| 881 | 3300049576 | Ga0501040_0057253 | Ga0501040_0057253_164_796 | 206 |
| 882 | 3300049576 | Ga0501040_0120347 | Ga0501040_0120347_766_1419 | 206 |
| 883 | 3300049576 | Ga0501040_0126415 | Ga0501040_0126415_1143_1763 | 206 |
| 884 | 3300049577 | Ga0501041_0038824 | Ga0501041_0038824_936_1565 | 206 |
| 885 | 3300049578 | Ga0501042_0014700 | Ga0501042_0014700_1909_2538 | 206 |
| 886 | 3300049579 | Ga0501043_0330964 | Ga0501043_0330964_288_953 | 206 |
| 887 | 3300049579 | Ga0501043_0391276 | Ga0501043_0391276_280_912 | 206 |
| 888 | 3300049580 | Ga0501046_0080712 | Ga0501046_0080712_173_838 | 206 |
| 889 | 3300049580 | Ga0501046_0090170 | Ga0501046_0090170_1503_2132 | 206 |
| 890 | 3300049581 | Ga0501047_0000842 | Ga0501047_0000842_17886_18554 | 206 |
| 891 | 3300049581 | Ga0501047_0198749 | Ga0501047_0198749_745_1374 | 206 |
| 892 | 3300049582 | Ga0501048_0055429 | Ga0501048_0055429_771_1400 | 206 |
| 893 | 3300049582 | Ga0501048_0082582 | Ga0501048_0082582_1309_1968 | 206 |
| 894 | 3300049583 | Ga0501067_0025968 | Ga0501067_0025968_1645_2274 | 206 |
| 895 | 3300049583 | Ga0501067_0050374 | Ga0501067_0050374_1324_1953 | 206 |
| 896 | 3300049583 | Ga0501067_0081298 | Ga0501067_0081298_471_1091 | 206 |
| 897 | 3300049584 | Ga0501068_0000022 | Ga0501068_0000022_33402_34031 | 206 |
| 898 | 3300049584 | Ga0501068_0001339 | Ga0501068_0001339_7802_8431 | 206 |
| 899 | 3300049584 | Ga0501068_0188264 | Ga0501068_0188264_509_1129 | 206 |
| 900 | 3300049585 | Ga0501069_0006160 | Ga0501069_0006160_4649_5278 | 206 |
| 901 | 3300049585 | Ga0501069_0022349 | Ga0501069_0022349_2478_3098 | 206 |
| 902 | 3300049585 | Ga0501069_0059353 | Ga0501069_0059353_531_1160 | 206 |
| 903 | 3300049586 | Ga0501070_0000192 | Ga0501070_0000192_18132_18761 | 206 |
| 904 | 3300049586 | Ga0501070_0004268 | Ga0501070_0004268_985_1614 | 206 |
| 905 | 3300049586 | Ga0501070_0022042 | Ga0501070_0022042_1151_1780 | 206 |
| 906 | 3300049587 | Ga0501071_0000678 | Ga0501071_0000678_16696_17325 | 206 |
| 907 | 3300049587 | Ga0501071_0033592 | Ga0501071_0033592_876_1505 | 206 |
| 908 | 3300049587 | Ga0501071_0117590 | Ga0501071_0117590_157_786 | 206 |
| 909 | 3300049587 | Ga0501071_0226470 | Ga0501071_0226470_637_1266 | 206 |
| 910 | 3300049587 | Ga0501071_0407114 | Ga0501071_0407114_346_981 | 206 |
| 911 | 3300049587 | Ga0501071_0614928 | Ga0501071_0614928_148_777 | 206 |
| 912 | 3300049588 | Ga0501072_0014674 | Ga0501072_0014674_948_1577 | 206 |
| 913 | 3300049588 | Ga0501072_0097467 | Ga0501072_0097467_1576_2205 | 206 |
| 914 | 3300049588 | Ga0501072_0161051 | Ga0501072_0161051_129_749 | 206 |
| 915 | 3300049588 | Ga0501072_0190259 | Ga0501072_0190259_273_908 | 206 |
| 916 | 3300049588 | Ga0501072_0332578 | Ga0501072_0332578_351_977 | 206 |
| 917 | 3300049589 | Ga0501073_0000949 | Ga0501073_0000949_293_922 | 206 |
| 918 | 3300049589 | Ga0501073_0062982 | Ga0501073_0062982_986_1615 | 206 |
| 919 | 3300049589 | Ga0501073_0398573 | Ga0501073_0398573_263_895 | 206 |
| 920 | 3300049590 | Ga0501074_0000171 | Ga0501074_0000171_1091_1720 | 206 |
| 921 | 3300049590 | Ga0501074_0000742 | Ga0501074_0000742_4877_5506 | 206 |
| 922 | 3300049590 | Ga0501074_0062345 | Ga0501074_0062345_1970_2602 | 206 |
| 923 | 3300049591 | Ga0501075_0076581 | Ga0501075_0076581_1781_2410 | 206 |
| 924 | 3300049591 | Ga0501075_0106483 | Ga0501075_0106483_104_724 | 206 |
| 925 | 3300049591 | Ga0501075_0670972 | Ga0501075_0670972_78_698 | 206 |
| 926 | 3300049592 | Ga0501076_0020253 | Ga0501076_0020253_1791_2420 | 206 |
| 927 | 3300049592 | Ga0501076_0367266 | Ga0501076_0367266_76_696 | 206 |
| 928 | 3300049592 | Ga0501076_0375112 | Ga0501076_0375112_283_942 | 206 |
| 929 | 3300049593 | Ga0501077_0004768 | Ga0501077_0004768_2236_2856 | 206 |
| 930 | 3300049593 | Ga0501077_0053011 | Ga0501077_0053011_673_1305 | 206 |
| 931 | 3300049593 | Ga0501077_0058114 | Ga0501077_0058114_1716_2345 | 206 |
| 932 | 3300049652 | Ga0501202_029946 | Ga0501202_029946_384_1004 | 206 |
| 933 | 3300049656 | Ga0501209_002047 | Ga0501209_002047_165_785 | 206 |
| 934 | 3300049661 | Ga0501217_088428 | Ga0501217_088428_190_810 | 206 |
| 935 | 3300049669 | Ga0501235_003401 | Ga0501235_003401_2177_2797 | 206 |
| 936 | 3300049704 | Ga0501221_015900 | Ga0501221_015900_626_1246 | 206 |
| 937 | 3300049705 | Ga0501225_0021352 | Ga0501225_0021352_104_724 | 206 |
| 938 | 3300049707 | Ga0501234_009350 | Ga0501234_009350_491_1111 | 206 |
| 939 | 3300049741 | Ga0501079_0060874 | Ga0501079_0060874_566_1195 | 206 |
| 940 | 3300049741 | Ga0501079_0554862 | Ga0501079_0554862_166_843 | 206 |
| 941 | 3300049741 | Ga0501079_0820871 | Ga0501079_0820871_95_715 | 206 |
| 942 | 3300049742 | Ga0501080_0000060 | Ga0501080_0000060_16688_17317 | 206 |
| 943 | 3300049742 | Ga0501080_0107525 | Ga0501080_0107525_985_1614 | 206 |
| 944 | 3300049742 | Ga0501080_0495018 | Ga0501080_0495018_52_711 | 206 |
| 945 | 3300049743 | Ga0501081_0063800 | Ga0501081_0063800_15_647 | 206 |
| 946 | 3300049743 | Ga0501081_0066384 | Ga0501081_0066384_943_1602 | 206 |
| 947 | 3300049743 | Ga0501081_0074081 | Ga0501081_0074081_68_697 | 206 |
| 948 | 3300049743 | Ga0501081_0142005 | Ga0501081_0142005_29_649 | 206 |
| 949 | 3300049743 | Ga0501081_0162742 | Ga0501081_0162742_909_1538 | 206 |
| 950 | 3300049744 | Ga0501083_0001978 | Ga0501083_0001978_9226_9855 | 206 |
| 951 | 3300049744 | Ga0501083_0059235 | Ga0501083_0059235_1129_1758 | 206 |
| 952 | 3300049744 | Ga0501083_0162068 | Ga0501083_0162068_45_677 | 206 |
| 953 | 3300049744 | Ga0501083_0306257 | Ga0501083_0306257_134_769 | 206 |
| 954 | 3300049760 | Ga0501263_005113 | Ga0501263_005113_521_1141 | 206 |
| 955 | 3300049765 | Ga0501268_012154 | Ga0501268_012154_205_825 | 206 |
| 956 | 3300049765 | Ga0501268_045961 | Ga0501268_045961_33_659 | 206 |
| 957 | 3300049767 | Ga0501270_004688 | Ga0501270_004688_643_1263 | 206 |
| 958 | 3300049769 | Ga0501272_000560 | Ga0501272_000560_376_996 | 206 |
| 959 | 3300049775 | Ga0501279_027846 | Ga0501279_027846_69_689 | 206 |
| 960 | 3300049822 | Ga0501035_0017508 | Ga0501035_0017508_1197_1865 | 206 |
| 961 | 3300049822 | Ga0501035_0110624 | Ga0501035_0110624_1194_1853 | 206 |
| 962 | 3300049822 | Ga0501035_0432634 | Ga0501035_0432634_177_800 | 206 |
| 963 | 3300049822 | Ga0501035_0694981 | Ga0501035_0694981_38_658 | 206 |
| 964 | 3300049823 | Ga0501044_0000734 | Ga0501044_0000734_21487_22155 | 206 |
| 965 | 3300049823 | Ga0501044_0194333 | Ga0501044_0194333_1300_1923 | 206 |
| 966 | 3300049823 | Ga0501044_0318067 | Ga0501044_0318067_753_1418 | 206 |
| 967 | 3300049824 | Ga0501045_0014038 | Ga0501045_0014038_87_707 | 206 |
| 968 | 3300049824 | Ga0501045_0094602 | Ga0501045_0094602_1125_1784 | 206 |
| 969 | 3300049824 | Ga0501045_0118557 | Ga0501045_0118557_247_876 | 206 |
| 970 | 3300049824 | Ga0501045_0324111 | Ga0501045_0324111_392_1027 | 206 |
| 971 | 3300050507 | nmdc:mga05p37_138827_c1 | nmdc:mga05p37_138827_c1_1236_1856 | 206 |
| 972 | 3300050507 | nmdc:mga05p37_24458_c2 | nmdc:mga05p37_24458_c2_1430_2056 | 206 |
| 973 | 3300050507 | nmdc:mga05p37_24982_c1 | nmdc:mga05p37_24982_c1_6368_6988 | 206 |
| 974 | 3300050507 | nmdc:mga05p37_284551_c1 | nmdc:mga05p37_284551_c1_94_744 | 206 |
| 975 | 3300050507 | nmdc:mga05p37_371760_c1 | nmdc:mga05p37_371760_c1_803_1429 | 206 |
| 976 | 3300050507 | nmdc:mga05p37_414393_c1 | nmdc:mga05p37_414393_c1_642_1292 | 206 |
| 977 | 3300050507 | nmdc:mga05p37_51636_c1 | nmdc:mga05p37_51636_c1_4153_4782 | 206 |
| 978 | 3300050507 | nmdc:mga05p37_561756_c1 | nmdc:mga05p37_561756_c1_658_1278 | 206 |
| 979 | 3300050507 | nmdc:mga05p37_75331_c1 | nmdc:mga05p37_75331_c1_1360_1980 | 206 |
| 980 | 3300050508 | nmdc:mga09592_125585_c1 | nmdc:mga09592_125585_c1_1349_1975 | 206 |
| 981 | 3300050508 | nmdc:mga09592_19135_c1 | nmdc:mga09592_19135_c1_46_666 | 206 |
| 982 | 3300050508 | nmdc:mga09592_3967_c1 | nmdc:mga09592_3967_c1_6183_6803 | 206 |
| 983 | 3300050509 | nmdc:mga0qj67_10094_c1 | nmdc:mga0qj67_10094_c1_5649_6284 | 206 |
| 984 | 3300050509 | nmdc:mga0qj67_255813_c1 | nmdc:mga0qj67_255813_c1_109_759 | 206 |
| 985 | 3300050509 | nmdc:mga0qj67_3022_c1 | nmdc:mga0qj67_3022_c1_7629_8255 | 206 |
| 986 | 3300050509 | nmdc:mga0qj67_41359_c1 | nmdc:mga0qj67_41359_c1_1558_2184 | 206 |
| 987 | 3300050509 | nmdc:mga0qj67_427435_c1 | nmdc:mga0qj67_427435_c1_392_1018 | 206 |
| 988 | 3300050509 | nmdc:mga0qj67_584417_c1 | nmdc:mga0qj67_584417_c1_103_723 | 206 |
| 989 | 3300050510 | nmdc:mga06r32_118220_c1 | nmdc:mga06r32_118220_c1_464_1099 | 206 |
| 990 | 3300050510 | nmdc:mga06r32_22435_c1 | nmdc:mga06r32_22435_c1_2923_3549 | 206 |
| 991 | 3300050510 | nmdc:mga06r32_269914_c1 | nmdc:mga06r32_269914_c1_1026_1652 | 206 |
| 992 | 3300050510 | nmdc:mga06r32_29277_c1 | nmdc:mga06r32_29277_c1_1737_2363 | 206 |
| 993 | 3300050510 | nmdc:mga06r32_339589_c1 | nmdc:mga06r32_339589_c1_203_853 | 206 |
| 994 | 3300050510 | nmdc:mga06r32_356899_c1 | nmdc:mga06r32_356899_c1_266_892 | 206 |
| 995 | 3300050510 | nmdc:mga06r32_383154_c1 | nmdc:mga06r32_383154_c1_111_731 | 206 |
| 996 | 3300050510 | nmdc:mga06r32_45554_c1 | nmdc:mga06r32_45554_c1_3185_3805 | 206 |
| 997 | 3300050510 | nmdc:mga06r32_857504_c1 | nmdc:mga06r32_857504_c1_82_708 | 206 |
| 998 | 3300050511 | nmdc:mga08y16_232930_c1 | nmdc:mga08y16_232930_c1_913_1545 | 206 |
| 999 | 3300050511 | nmdc:mga08y16_542655_c1 | nmdc:mga08y16_542655_c1_488_1108 | 206 |
| 1000 | 3300050511 | nmdc:mga08y16_71880_c1 | nmdc:mga08y16_71880_c1_2718_3344 | 206 |
| 1001 | 3300050511 | nmdc:mga08y16_9037_c1 | nmdc:mga08y16_9037_c1_120_770 | 206 |
| 1002 | 3300050512 | nmdc:mga0n895_1129540_c1 | nmdc:mga0n895_1129540_c1_96_725 | 206 |
| 1003 | 3300050512 | nmdc:mga0n895_11503_c1 | nmdc:mga0n895_11503_c1_4175_4795 | 206 |
| 1004 | 3300050512 | nmdc:mga0n895_13422_c1 | nmdc:mga0n895_13422_c1_2782_3402 | 206 |
| 1005 | 3300050512 | nmdc:mga0n895_141908_c1 | nmdc:mga0n895_141908_c1_231_857 | 206 |
| 1006 | 3300050512 | nmdc:mga0n895_21697_c1 | nmdc:mga0n895_21697_c1_4826_5446 | 206 |
| 1007 | 3300050512 | nmdc:mga0n895_3234_c1 | nmdc:mga0n895_3234_c1_11406_12026 | 206 |
| 1008 | 3300050512 | nmdc:mga0n895_40283_c1 | nmdc:mga0n895_40283_c1_3148_3768 | 206 |
| 1009 | 3300050512 | nmdc:mga0n895_532041_c1 | nmdc:mga0n895_532041_c1_11_640 | 206 |
| 1010 | 3300050512 | nmdc:mga0n895_603579_c1 | nmdc:mga0n895_603579_c1_415_1035 | 206 |
| 1011 | 3300050512 | nmdc:mga0n895_60762_c1 | nmdc:mga0n895_60762_c1_1089_1709 | 206 |
| 1012 | 3300050512 | nmdc:mga0n895_639749_c1 | nmdc:mga0n895_639749_c1_68_688 | 206 |
| 1013 | 3300050512 | nmdc:mga0n895_77744_c1 | nmdc:mga0n895_77744_c1_1796_2416 | 206 |
| 1014 | 3300050513 | nmdc:mga0rr50_104391_c1 | nmdc:mga0rr50_104391_c1_1087_1707 | 206 |
| 1015 | 3300050513 | nmdc:mga0rr50_127494_c1 | nmdc:mga0rr50_127494_c1_1114_1734 | 206 |
| 1016 | 3300050513 | nmdc:mga0rr50_259408_c1 | nmdc:mga0rr50_259408_c1_521_1141 | 206 |
| 1017 | 3300050513 | nmdc:mga0rr50_345316_c1 | nmdc:mga0rr50_345316_c1_383_1003 | 206 |
| 1018 | 3300050513 | nmdc:mga0rr50_51554_c1 | nmdc:mga0rr50_51554_c1_347_967 | 206 |
| 1019 | 3300050513 | nmdc:mga0rr50_611973_c1 | nmdc:mga0rr50_611973_c1_232_852 | 206 |
| 1020 | 3300050513 | nmdc:mga0rr50_7588_c1 | nmdc:mga0rr50_7588_c1_3874_4494 | 206 |
| 1021 | 3300050513 | nmdc:mga0rr50_79036_c1 | nmdc:mga0rr50_79036_c1_1620_2240 | 206 |
| 1022 | 3300050514 | nmdc:mga08x19_102252_c1 | nmdc:mga08x19_102252_c1_38_658 | 206 |
| 1023 | 3300050514 | nmdc:mga08x19_2813_c1 | nmdc:mga08x19_2813_c1_682_1302 | 206 |
| 1024 | 3300050514 | nmdc:mga08x19_28964_c1 | nmdc:mga08x19_28964_c1_857_1477 | 206 |
| 1025 | 3300050514 | nmdc:mga08x19_34468_c1 | nmdc:mga08x19_34468_c1_888_1508 | 206 |
| 1026 | 3300050514 | nmdc:mga08x19_51234_c1 | nmdc:mga08x19_51234_c1_456_1076 | 206 |
| 1027 | 3300050514 | nmdc:mga08x19_8445_c1 | nmdc:mga08x19_8445_c1_4169_4789 | 206 |
| 1028 | 3300050515 | nmdc:mga0a205_108546_c1 | nmdc:mga0a205_108546_c1_128_748 | 206 |
| 1029 | 3300050515 | nmdc:mga0a205_209869_c1 | nmdc:mga0a205_209869_c1_388_1008 | 206 |
| 1030 | 3300050515 | nmdc:mga0a205_247330_c2 | nmdc:mga0a205_247330_c2_346_966 | 206 |
| 1031 | 3300050515 | nmdc:mga0a205_37263_c1 | nmdc:mga0a205_37263_c1_3474_4094 | 206 |
| 1032 | 3300050515 | nmdc:mga0a205_784485_c1 | nmdc:mga0a205_784485_c1_13_633 | 206 |
| 1033 | 3300050515 | nmdc:mga0a205_80583_c1 | nmdc:mga0a205_80583_c1_255_875 | 206 |
| 1034 | 3300050515 | nmdc:mga0a205_823_c1 | nmdc:mga0a205_823_c1_4699_5319 | 206 |
| 1035 | 3300054114 | Ga0501084_0001187 | Ga0501084_0001187_17930_18559 | 206 |
| 1036 | 3300054114 | Ga0501084_0022610 | Ga0501084_0022610_2892_3521 | 206 |
| 1037 | 3300054114 | Ga0501084_0091875 | Ga0501084_0091875_220_849 | 206 |
| 1038 | 3300054114 | Ga0501084_0431681 | Ga0501084_0431681_156_815 | 206 |
| 1039 | 3300054114 | Ga0501084_0493686 | Ga0501084_0493686_332_952 | 206 |
| 1040 | 3300059421 | Ga0590071_011011 | Ga0590071_011011_1025_1654 | 206 |
| 1041 | 3300059421 | Ga0590071_017913 | Ga0590071_017913_839_1465 | 206 |
| 1042 | 3300059421 | Ga0590071_093083 | Ga0590071_093083_91_711 | 206 |
| 1043 | 3300059423 | Ga0590074_038811 | Ga0590074_038811_87_716 | 206 |
| 1044 | 3300059424 | Ga0590075_014608 | Ga0590075_014608_1074_1715 | 206 |
| 1045 | 3300059426 | Ga0590077_091099 | Ga0590077_091099_50_691 | 206 |
| 1046 | 3300060353 | Ga0501082_0002066 | Ga0501082_0002066_171_800 | 206 |
| 1047 | 3300060353 | Ga0501082_0009721 | Ga0501082_0009721_6031_6663 | 206 |
| 1048 | 3300060353 | Ga0501082_0055172 | Ga0501082_0055172_729_1358 | 206 |
| 1049 | 3300060353 | Ga0501082_0084001 | Ga0501082_0084001_1509_2138 | 206 |
| 1050 | 3300060353 | Ga0501082_0784771 | Ga0501082_0784771_75_710 | 206 |
| 1051 | 3300061734 | Ga0530510_0021297 | Ga0530510_0021297_2699_3331 | 206 |
| 1052 | 3300061734 | Ga0530510_0037427 | Ga0530510_0037427_2834_3463 | 206 |
| 1053 | 3300061734 | Ga0530510_0174044 | Ga0530510_0174044_70_690 | 206 |
| 1054 | 3300061734 | Ga0530510_0255175 | Ga0530510_0255175_607_1227 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wgh-assembly1.cif.gz_A | crystal structure of rsp in complex with beta-nadh | 0.9494 | 1 | 205 |
| 3wgh-assembly1.cif.gz_B | crystal structure of rsp in complex with beta-nadh | 0.9484 | 1 | 205 |
| 3wg9-assembly1.cif.gz_A | crystal structure of rsp, a rex-family repressor | 0.9428 | 1 | 205 |
| 3wgi-assembly1.cif.gz_A | crystal structure of rsp in complex with beta-nad+ and operator dna | 0.9358 | 1 | 205 |
| 3wg9-assembly2.cif.gz_D | crystal structure of rsp, a rex-family repressor | 0.9299 | 1 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xcbB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9712 | 5 | 73 | 1.10.10.10 |
| 5zz6C01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9676 | 3 | 72 | 1.10.10.10 |
| 3iktA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9662 | 3 | 73 | 1.10.10.10 |
| 1xcbF01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9653 | 4 | 73 | 1.10.10.10 |
| 1r72C01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9602 | 5 | 73 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A644XMJ9-F1-model_v4 | Redox-sensing transcriptional repressor Rex | 0.977 | 80 | 205 |
GO:0003677
GO:0005737 GO:0045892 GO:0051775 |
| AF-A0A3M1GUN8-F1-model_v4 | Redox-sensing transcriptional repressor Rex | 0.975 | 1 | 205 |
GO:0003677
GO:0003700 GO:0005737 GO:0045892 GO:0051775 |
| AF-A0A849H2L9-F1-model_v4 | Redox-sensing transcriptional repressor Rex | 0.9695 | 4 | 205 |
GO:0003677
GO:0003700 GO:0005737 GO:0045892 GO:0051775 |
| AF-A0A352IM06-F1-model_v4 | deleted | 0.9684 | 9 | 190 |
|
| AF-A0A2N2B627-F1-model_v4 | Redox-sensing transcriptional repressor Rex | 0.9681 | 67 | 204 |
GO:0003677
GO:0005737 GO:0045892 GO:0051775 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar