F489125

General Info

Members Datasets Scaffolds Average Seq Length
1054 322 1054 207

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10293719|Ga0207678_102937192
Length 245
Sequence MRKVAESTVRRLSLYLRFLEEFEGQGIGTVSSGALASRGGTTSAQVRKDLSFFGSFGKRGLGYPVPELADRLREILGLKRRYRVGMIGAGKIGSALVQYRGFKQRGFDIVAIFDSDPGKVGRQWNGLTVLDIGSLEKELQHRPVDMAVLVVPADVAQAVTDRLVSLRIKAILNFAPVQLSVPGRSGTTWSLSSARRPATRLRYRPLVASTPVGTAAAGTPSASSRVRSATRTGIGPAGSEPRRHR

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
196 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
197 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
198 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
210 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
211 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
212 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
213 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
214 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
215 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
216 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
217 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
289 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
290 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
291 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
292 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
293 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
294 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
298 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
299 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
300 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
301 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
302 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
303 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
318 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
319 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
320 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.65
Rhizosphere 95.07
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10007216 3300005293 Unclassified 4966
2 Ga0065715_10128475 3300005293 Unclassified 2054
3 Ga0065715_10312085 3300005293 Bacteria 1018
4 Ga0070658_10447835 3300005327 Bacteria 1112
5 Ga0070676_10004346 3300005328 Bacteria 7442
6 Ga0070676_10043650 3300005328 Bacteria 2606
7 Ga0070683_100007640 3300005329 Bacteria 9148
8 Ga0070683_100021254 3300005329 Bacteria 5788
9 Ga0070683_100027949 3300005329 Bacteria 5093
10 Ga0070683_100067628 3300005329 Unclassified 3328
11 Ga0070683_100093088 3300005329 Unclassified 2831
12 Ga0070690_100134340 3300005330 Bacteria 1674
13 Ga0070670_100007272 3300005331 Bacteria 9388
14 Ga0070670_100018024 3300005331 Bacteria 6059
15 Ga0068869_100010103 3300005334 Bacteria 6142
16 Ga0068869_100045781 3300005334 Unclassified 3151
17 Ga0068869_100213560 3300005334 Bacteria 1526
18 Ga0070666_10043206 3300005335 Bacteria 3017
19 Ga0070666_10215595 3300005335 Viruses 1353
20 Ga0070680_100017722 3300005336 Bacteria 5617
21 Ga0070680_100019668 3300005336 Bacteria 5355
22 Ga0070680_100021822 3300005336 Bacteria 5093
23 Ga0070680_100077626 3300005336 Bacteria 2735
24 Ga0070680_101006097 3300005336 Bacteria 720
25 Ga0068868_100479970 3300005338 Viruses 1086
26 Ga0070660_100012909 3300005339 Bacteria 5977
27 Ga0070660_100788044 3300005339 Bacteria 799
28 Ga0070689_100014547 3300005340 Bacteria 5719
29 Ga0070689_100497411 3300005340 Bacteria 1044
30 Ga0070689_100588177 3300005340 Unclassified 963
31 Ga0070691_10038281 3300005341 Unclassified 2264
32 Ga0070691_10154926 3300005341 Bacteria 1177
33 Ga0070687_100000721 3300005343 Bacteria 10993
34 Ga0070687_100039931 3300005343 Bacteria 2361
35 Ga0070687_100239869 3300005343 Unclassified 1120
36 Ga0070687_100405796 3300005343 Unclassified 895
37 Ga0070661_100002985 3300005344 Bacteria 11659
38 Ga0070661_100003797 3300005344 Bacteria 10410
39 Ga0070661_100010685 3300005344 Bacteria 6387
40 Ga0070661_100190236 3300005344 Bacteria 1565
41 Ga0070692_10017287 3300005345 Bacteria 3444
42 Ga0070692_10121601 3300005345 Bacteria 1457
43 Ga0070668_100003043 3300005347 Bacteria 12405
44 Ga0070668_100006902 3300005347 Bacteria 8416
45 Ga0070668_100216914 3300005347 Bacteria 1576
46 Ga0070668_100292142 3300005347 Bacteria 1365
47 Ga0070668_100350769 3300005347 Unclassified 1249
48 Ga0070668_100686890 3300005347 Bacteria 902
49 Ga0070669_100003079 3300005353 Bacteria 12001
50 Ga0070669_100017058 3300005353 Bacteria 5181
51 Ga0070669_100075028 3300005353 Unclassified 2507
52 Ga0070675_100002631 3300005354 Bacteria 13492
53 Ga0070675_100002663 3300005354 Bacteria 13424
54 Ga0070675_100138851 3300005354 Bacteria 2076
55 Ga0070675_100214432 3300005354 Unclassified 1675
56 Ga0070675_100247540 3300005354 Bacteria 1559
57 Ga0070671_100008957 3300005355 Bacteria 8031
58 Ga0070671_100046843 3300005355 Bacteria 3596
59 Ga0070671_100364816 3300005355 Bacteria 1233
60 Ga0070674_100000488 3300005356 Bacteria 19938
61 Ga0070674_100072803 3300005356 Bacteria 2435
62 Ga0070674_100190297 3300005356 Bacteria 1578
63 Ga0070673_100209157 3300005364 Bacteria 1684
64 Ga0070673_100665717 3300005364 Viruses 954
65 Ga0070659_100032565 3300005366 Bacteria 4044
66 Ga0070659_100040066 3300005366 Bacteria 3660
67 Ga0070659_100106827 3300005366 Bacteria 2257
68 Ga0070667_100031097 3300005367 Bacteria 4450
69 Ga0070667_100034583 3300005367 Bacteria 4229
70 Ga0070703_10010292 3300005406 Bacteria 2636
71 Ga0070703_10036920 3300005406 Bacteria 1504
72 Ga0070709_10001038 3300005434 Bacteria 15360
73 Ga0070714_100695684 3300005435 Unclassified 981
74 Ga0070714_101315730 3300005435 Unclassified 705
75 Ga0070710_10473430 3300005437 Bacteria 853
76 Ga0070701_10001843 3300005438 Bacteria 8029
77 Ga0070701_10036828 3300005438 Bacteria 2467
78 Ga0070701_10145421 3300005438 Viruses 1360
79 Ga0070701_10291613 3300005438 Bacteria 1000
80 Ga0070711_100000466 3300005439 Bacteria 21169
81 Ga0070711_100023504 3300005439 Bacteria 4010
82 Ga0070711_100848300 3300005439 Unclassified 777
83 Ga0070705_100006728 3300005440 Bacteria 5651
84 Ga0070705_100007632 3300005440 Bacteria 5333
85 Ga0070705_100017903 3300005440 Bacteria 3704
86 Ga0070705_100026351 3300005440 Unclassified 3163
87 Ga0070705_100043456 3300005440 Bacteria 2575
88 Ga0070705_100062806 3300005440 Bacteria 2213
89 Ga0070705_100074184 3300005440 Bacteria 2067
90 Ga0070705_100126097 3300005440 Bacteria 1662
91 Ga0070705_100127156 3300005440 Bacteria 1656
92 Ga0070705_100135142 3300005440 Bacteria 1614
93 Ga0070705_100334102 3300005440 Bacteria 1099
94 Ga0070700_100348856 3300005441 Bacteria 1096
95 Ga0070694_100003097 3300005444 Bacteria 9899
96 Ga0070694_100030940 3300005444 Bacteria 3506
97 Ga0070694_100056858 3300005444 Bacteria 2658
98 Ga0070694_100057125 3300005444 Bacteria 2652
99 Ga0070694_100073489 3300005444 Unclassified 2362
100 Ga0070694_100096665 3300005444 Unclassified 2082
101 Ga0070694_100274155 3300005444 Bacteria 1284
102 Ga0070694_100384377 3300005444 Bacteria 1095
103 Ga0070694_100440633 3300005444 Bacteria 1027
104 Ga0070694_100550095 3300005444 Viruses 924
105 Ga0070708_100001912 3300005445 Bacteria 16029
106 Ga0070708_100006646 3300005445 Bacteria 9207
107 Ga0070708_100010515 3300005445 Bacteria 7502
108 Ga0070708_100036977 3300005445 Bacteria 4257
109 Ga0070708_100084138 3300005445 Unclassified 2885
110 Ga0070708_100128115 3300005445 Bacteria 2348
111 Ga0070708_100128852 3300005445 Bacteria 2341
112 Ga0070708_100248140 3300005445 Bacteria 1672
113 Ga0070708_100592787 3300005445 Bacteria 1045
114 Ga0070708_100669044 3300005445 Unclassified 978
115 Ga0070708_100687208 3300005445 Bacteria 963
116 Ga0070708_100922511 3300005445 Unclassified 820
117 Ga0070708_100934980 3300005445 Bacteria 814
118 Ga0070678_100161220 3300005456 Unclassified 1817
119 Ga0070662_100000129 3300005457 Bacteria 42187
120 Ga0070662_100000760 3300005457 Bacteria 19801
121 Ga0070662_100008788 3300005457 Bacteria 6588
122 Ga0070662_100065735 3300005457 Bacteria 2659
123 Ga0070662_100182492 3300005457 Unclassified 1655
124 Ga0070662_100594760 3300005457 Unclassified 930
125 Ga0070681_10000404 3300005458 Bacteria 35078
126 Ga0070681_10008932 3300005458 Bacteria 9851
127 Ga0070681_10034221 3300005458 Bacteria 5103
128 Ga0070681_10034328 3300005458 Bacteria 5093
129 Ga0070681_10066860 3300005458 Bacteria 3563
130 Ga0070681_10441395 3300005458 Bacteria 1213
131 Ga0068867_100124515 3300005459 Bacteria 1996
132 Ga0068867_100143039 3300005459 Bacteria 1871
133 Ga0068867_100148924 3300005459 Unclassified 1837
134 Ga0068867_100565452 3300005459 Bacteria 987
135 Ga0070685_10005049 3300005466 Bacteria 6692
136 Ga0070685_10202810 3300005466 Bacteria 1290
137 Ga0070685_10371405 3300005466 Bacteria 983
138 Ga0070706_100002003 3300005467 Bacteria 20963
139 Ga0070706_100007900 3300005467 Bacteria 9934
140 Ga0070706_100011664 3300005467 Bacteria 8163
141 Ga0070706_100124841 3300005467 Bacteria 2400
142 Ga0070706_100217196 3300005467 Bacteria 1785
143 Ga0070706_100373973 3300005467 Unclassified 1327
144 Ga0070707_100001277 3300005468 Bacteria 24773
145 Ga0070707_100038114 3300005468 Bacteria 4590
146 Ga0070707_100046622 3300005468 Bacteria 4148
147 Ga0070707_100048969 3300005468 Bacteria 4050
148 Ga0070707_100058383 3300005468 Bacteria 3700
149 Ga0070707_100066765 3300005468 Bacteria 3457
150 Ga0070707_100075107 3300005468 Bacteria 3260
151 Ga0070707_100085921 3300005468 Bacteria 3042
152 Ga0070707_100102325 3300005468 Bacteria 2775
153 Ga0070707_100170879 3300005468 Unclassified 2118
154 Ga0070707_100244924 3300005468 Bacteria 1744
155 Ga0070707_100499887 3300005468 Bacteria 1178
156 Ga0070707_100533355 3300005468 Unclassified 1136
157 Ga0070707_100669126 3300005468 Unclassified 1001
158 Ga0070707_100919206 3300005468 Archaea 840
159 Ga0070698_100000416 3300005471 Bacteria 45414
160 Ga0070698_100090622 3300005471 Bacteria 3041
161 Ga0070698_100100245 3300005471 Unclassified 2869
162 Ga0070698_100100765 3300005471 Bacteria 2860
163 Ga0070698_100123841 3300005471 Bacteria 2543
164 Ga0070698_100128532 3300005471 Bacteria 2490
165 Ga0070698_100431334 3300005471 Bacteria 1253
166 Ga0070698_100528810 3300005471 Bacteria 1118
167 Ga0070699_100003038 3300005518 Bacteria 14886
168 Ga0070699_100009267 3300005518 Bacteria 8527
169 Ga0070699_100010664 3300005518 Bacteria 7953
170 Ga0070699_100013305 3300005518 Bacteria 7096
171 Ga0070699_100014085 3300005518 Bacteria 6880
172 Ga0070699_100017344 3300005518 Bacteria 6183
173 Ga0070699_100018436 3300005518 Bacteria 5995
174 Ga0070699_100079657 3300005518 Unclassified 2854
175 Ga0070699_100179100 3300005518 Bacteria 1880
176 Ga0070699_100199342 3300005518 Bacteria 1780
177 Ga0070679_100033038 3300005530 Bacteria 5120
178 Ga0070679_100066262 3300005530 Bacteria 3599
179 Ga0070679_100067534 3300005530 Bacteria 3565
180 Ga0070679_100214351 3300005530 Unclassified 1888
181 Ga0070679_100423381 3300005530 Bacteria 1277
182 Ga0070679_100483111 3300005530 Bacteria 1183
183 Ga0070684_100035266 3300005535 Bacteria 4281
184 Ga0070684_100154609 3300005535 Bacteria 2079
185 Ga0070684_100879141 3300005535 Unclassified 839
186 Ga0070697_100026418 3300005536 Bacteria 4637
187 Ga0070697_100030232 3300005536 Bacteria 4351
188 Ga0070697_100035632 3300005536 Bacteria 4015
189 Ga0070697_100129065 3300005536 Bacteria 2119
190 Ga0070697_100130880 3300005536 Bacteria 2104
191 Ga0070697_100189640 3300005536 Bacteria 1744
192 Ga0070697_100207453 3300005536 Unclassified 1667
193 Ga0070697_100245902 3300005536 Unclassified 1529
194 Ga0070697_100597370 3300005536 Unclassified 970
195 Ga0070697_100824964 3300005536 Bacteria 821
196 Ga0068853_100035310 3300005539 Bacteria 4246
197 Ga0068853_100041839 3300005539 Bacteria 3916
198 Ga0068853_100878130 3300005539 Bacteria 861
199 Ga0070672_100004984 3300005543 Bacteria 8750
200 Ga0070672_100007479 3300005543 Bacteria 7416
201 Ga0070672_100276024 3300005543 Unclassified 1420
202 Ga0070686_100000009 3300005544 Bacteria 202453
203 Ga0070686_100362911 3300005544 Bacteria 1092
204 Ga0070695_100001483 3300005545 Bacteria 13033
205 Ga0070695_100024381 3300005545 Bacteria 3725
206 Ga0070695_100030673 3300005545 Bacteria 3349
207 Ga0070695_100054884 3300005545 Bacteria 2566
208 Ga0070695_100062812 3300005545 Bacteria 2412
209 Ga0070696_100001111 3300005546 Bacteria 17408
210 Ga0070696_100001375 3300005546 Bacteria 15888
211 Ga0070696_100005541 3300005546 Bacteria 8430
212 Ga0070696_100013879 3300005546 Bacteria 5409
213 Ga0070696_100018452 3300005546 Bacteria 4715
214 Ga0070696_100029352 3300005546 Bacteria 3758
215 Ga0070696_100043304 3300005546 Bacteria 3114
216 Ga0070696_100076908 3300005546 Bacteria 2357
217 Ga0070696_100236896 3300005546 Unclassified 1375
218 Ga0070696_100313931 3300005546 Bacteria 1204
219 Ga0070696_100352650 3300005546 Bacteria 1140
220 Ga0070696_100377528 3300005546 Unclassified 1104
221 Ga0070696_100797357 3300005546 Unclassified 777
222 Ga0070665_100038936 3300005548 Bacteria 4780
223 Ga0070665_100222772 3300005548 Bacteria 1887
224 Ga0070704_100000588 3300005549 Bacteria 17506
225 Ga0070704_100003470 3300005549 Bacteria 9046
226 Ga0070704_100007259 3300005549 Bacteria 6592
227 Ga0070704_100013024 3300005549 Bacteria 5149
228 Ga0070704_100039533 3300005549 Bacteria 3239
229 Ga0070704_100045565 3300005549 Bacteria 3052
230 Ga0070704_100063131 3300005549 Bacteria 2658
231 Ga0070704_100071452 3300005549 Bacteria 2522
232 Ga0070704_100098504 3300005549 Unclassified 2197
233 Ga0070704_100102755 3300005549 Bacteria 2157
234 Ga0070704_100597461 3300005549 Unclassified 969
235 Ga0068855_100002169 3300005563 Bacteria 24243
236 Ga0068855_100008571 3300005563 Bacteria 12363
237 Ga0068855_100431684 3300005563 Bacteria 1440
238 Ga0070664_100013154 3300005564 Bacteria 6738
239 Ga0070664_100055026 3300005564 Bacteria 3377
240 Ga0070664_100178129 3300005564 Unclassified 1888
241 Ga0070664_100655957 3300005564 Viruses 975
242 Ga0068857_100012151 3300005577 Bacteria 7490
243 Ga0068857_100015739 3300005577 Bacteria 6617
244 Ga0068857_100038294 3300005577 Bacteria 4247
245 Ga0068857_100321695 3300005577 Bacteria 1429
246 Ga0068854_100000340 3300005578 Bacteria 30112
247 Ga0068854_100022362 3300005578 Bacteria 4306
248 Ga0068854_100033175 3300005578 Unclassified 3598
249 Ga0068854_100252585 3300005578 Viruses 1408
250 Ga0068856_100279771 3300005614 Bacteria 1685
251 Ga0070702_100069343 3300005615 Bacteria 2077
252 Ga0070702_100313996 3300005615 Unclassified 1089
253 Ga0070702_100472602 3300005615 Bacteria 914
254 Ga0068852_100014974 3300005616 Bacteria 5995
255 Ga0068852_100341916 3300005616 Bacteria 1459
256 Ga0068852_100532599 3300005616 Unclassified 1173
257 Ga0068859_100024587 3300005617 Bacteria 6043
258 Ga0068859_100041401 3300005617 Bacteria 4627
259 Ga0068859_100084308 3300005617 Bacteria 3223
260 Ga0068859_100092148 3300005617 Unclassified 3082
261 Ga0068859_100123908 3300005617 Unclassified 2652
262 Ga0068859_100207078 3300005617 Unclassified 2047
263 Ga0068864_100005386 3300005618 Bacteria 10484
264 Ga0068864_100028566 3300005618 Bacteria 4716
265 Ga0068864_100160067 3300005618 Bacteria 2046
266 Ga0068864_100312225 3300005618 Bacteria 1474
267 Ga0068866_10034008 3300005718 Unclassified 2479
268 Ga0068866_10261636 3300005718 Bacteria 1063
269 Ga0068861_100001019 3300005719 Bacteria 17119
270 Ga0068861_100029592 3300005719 Bacteria 4007
271 Ga0068861_100120743 3300005719 Bacteria 2114
272 Ga0068851_10019723 3300005834 Unclassified 3259
273 Ga0068851_10152903 3300005834 Bacteria 1263
274 Ga0068870_10034892 3300005840 Bacteria 2577
275 Ga0068863_100197091 3300005841 Unclassified 1936
276 Ga0068858_100022826 3300005842 Bacteria 5836
277 Ga0068858_100606486 3300005842 Bacteria 1062
278 Ga0068860_100051734 3300005843 Unclassified 3907
279 Ga0068862_100000376 3300005844 Bacteria 48418
280 Ga0068862_100041901 3300005844 Bacteria 3897
281 Ga0068862_100324123 3300005844 Unclassified 1423
282 Ga0068862_100334963 3300005844 Viruses 1400
283 Ga0068862_100364246 3300005844 Bacteria 1344
284 Ga0068862_100567900 3300005844 Unclassified 1085
285 Ga0068862_100982150 3300005844 Bacteria 834
286 Ga0081455_10062368 3300005937 Unclassified 3133
287 Ga0070716_100000833 3300006173 Bacteria 13306
288 Ga0070716_100021974 3300006173 Bacteria 3368
289 Ga0097621_100193378 3300006237 Bacteria 1763
290 Ga0097621_100407040 3300006237 Bacteria 1219
291 Ga0068871_100129749 3300006358 Bacteria 2136
292 Ga0068871_100203893 3300006358 Bacteria 1708
293 Ga0075428_100012227 3300006844 Bacteria 9544
294 Ga0075428_100039690 3300006844 Bacteria 5181
295 Ga0075428_100053259 3300006844 Bacteria 4433
296 Ga0075428_100072344 3300006844 Bacteria 3767
297 Ga0075428_100145551 3300006844 Bacteria 2575
298 Ga0075428_100223245 3300006844 Bacteria 2034
299 Ga0075428_100365366 3300006844 Unclassified 1548
300 Ga0075428_100764461 3300006844 Bacteria 1028
301 Ga0075428_100951921 3300006844 Unclassified 910
302 Ga0075430_100001512 3300006846 Bacteria 18961
303 Ga0075430_100076112 3300006846 Bacteria 2813
304 Ga0075430_100082279 3300006846 Bacteria 2698
305 Ga0075430_100323968 3300006846 Bacteria 1274
306 Ga0075430_100542015 3300006846 Bacteria 960
307 Ga0075430_100668780 3300006846 Bacteria 856
308 Ga0075431_100018358 3300006847 Bacteria 7122
309 Ga0075431_100026846 3300006847 Bacteria 5906
310 Ga0075431_100033603 3300006847 Bacteria 5285
311 Ga0075431_100063746 3300006847 Bacteria 3803
312 Ga0075431_100147443 3300006847 Bacteria 2424
313 Ga0075431_100158257 3300006847 Bacteria 2330
314 Ga0075431_100250032 3300006847 Bacteria 1801
315 Ga0075433_10000946 3300006852 Bacteria 20505
316 Ga0075433_10005348 3300006852 Bacteria 10079
317 Ga0075433_10025979 3300006852 Bacteria 4953
318 Ga0075433_10321274 3300006852 Bacteria 1369
319 Ga0075433_10440267 3300006852 Bacteria 1149
320 Ga0075433_10639739 3300006852 Unclassified 933
321 Ga0075433_10807733 3300006852 Bacteria 819
322 Ga0075434_100001804 3300006871 Bacteria 18514
323 Ga0075434_100019680 3300006871 Bacteria 6533
324 Ga0075434_100024095 3300006871 Bacteria 5945
325 Ga0075434_100024719 3300006871 Bacteria 5874
326 Ga0075434_100040831 3300006871 Bacteria 4595
327 Ga0075434_100068612 3300006871 Bacteria 3533
328 Ga0075434_100069113 3300006871 Unclassified 3521
329 Ga0075434_100171720 3300006871 Unclassified 2188
330 Ga0075434_100238699 3300006871 Bacteria 1838
331 Ga0075434_100336748 3300006871 Bacteria 1529
332 Ga0075434_100679966 3300006871 Bacteria 1047
333 Ga0075434_100925217 3300006871 Bacteria 887
334 Ga0075429_100000283 3300006880 Bacteria 35844
335 Ga0075429_100047346 3300006880 Bacteria 3740
336 Ga0075429_100086698 3300006880 Bacteria 2729
337 Ga0075429_100336505 3300006880 Unclassified 1321
338 Ga0075429_100428266 3300006880 Bacteria 1159
339 Ga0075429_101039616 3300006880 Bacteria 716
340 Ga0068865_100001514 3300006881 Bacteria 13558
341 Ga0075436_100000724 3300006914 Bacteria 21850
342 Ga0075436_100011903 3300006914 Bacteria 5969
343 Ga0075436_100017487 3300006914 Bacteria 4909
344 Ga0075436_100020245 3300006914 Bacteria 4566
345 Ga0075436_100021360 3300006914 Bacteria 4444
346 Ga0075436_100051691 3300006914 Bacteria 2835
347 Ga0075436_100063252 3300006914 Bacteria 2558
348 Ga0075436_100095001 3300006914 Bacteria 2073
349 Ga0075436_100111267 3300006914 Unclassified 1912
350 Ga0075436_100248356 3300006914 Bacteria 1267
351 Ga0075436_100285399 3300006914 Bacteria 1181
352 Ga0075436_100310931 3300006914 Unclassified 1131
353 Ga0097620_100024587 3300006931 Bacteria 6043
354 Ga0097620_100041401 3300006931 Bacteria 4627
355 Ga0097620_100084305 3300006931 Bacteria 3223
356 Ga0097620_100092145 3300006931 Unclassified 3082
357 Ga0097620_100123906 3300006931 Unclassified 2652
358 Ga0097620_100207071 3300006931 Unclassified 2047
359 Ga0075435_100018599 3300007076 Bacteria 5290
360 Ga0075435_100029043 3300007076 Unclassified 4339
361 Ga0075435_100054584 3300007076 Bacteria 3225
362 Ga0075435_100079712 3300007076 Bacteria 2687
363 Ga0075435_100107146 3300007076 Bacteria 2321
364 Ga0075435_100272455 3300007076 Bacteria 1444
365 Ga0075435_100283173 3300007076 Unclassified 1415
366 Ga0075435_100326916 3300007076 Bacteria 1313
367 Ga0075435_100477580 3300007076 Bacteria 1076
368 Ga0075435_100586612 3300007076 Unclassified 966
369 Ga0099794_10000151 3300007265 Bacteria 25673
370 Ga0099794_10252118 3300007265 Archaea 910
371 Ga0099795_10074192 3300007788 Bacteria 1289
372 Ga0105240_10009204 3300009093 Bacteria 14007
373 Ga0105240_10073620 3300009093 Bacteria 4218
374 Ga0105240_10247240 3300009093 Bacteria 2065
375 Ga0105240_10250937 3300009093 Unclassified 2046
376 Ga0105240_10634142 3300009093 Viruses 1173
377 Ga0111539_10040798 3300009094 Bacteria 5585
378 Ga0111539_10042342 3300009094 Bacteria 5469
379 Ga0111539_10198280 3300009094 Bacteria 2342
380 Ga0111539_10458637 3300009094 Bacteria 1484
381 Ga0111539_10796253 3300009094 Bacteria 1100
382 Ga0105245_10259377 3300009098 Bacteria 1691
383 Ga0105245_10851268 3300009098 Bacteria 952
384 Ga0105245_11322516 3300009098 Bacteria 770
385 Ga0105247_10468529 3300009101 Bacteria 912
386 Ga0114129_10000918 3300009147 Bacteria 38424
387 Ga0114129_10063870 3300009147 Bacteria 5139
388 Ga0114129_10172875 3300009147 Bacteria 2944
389 Ga0114129_10234795 3300009147 Bacteria 2468
390 Ga0114129_10314094 3300009147 Unclassified 2085
391 Ga0114129_10408301 3300009147 Unclassified 1789
392 Ga0114129_10936551 3300009147 Bacteria 1095
393 Ga0114129_11171065 3300009147 Bacteria 959
394 Ga0114129_11224902 3300009147 Bacteria 934
395 Ga0114129_11792669 3300009147 Unclassified 747
396 Ga0105243_10097773 3300009148 Bacteria 2430
397 Ga0105241_10024142 3300009174 Bacteria 4515
398 Ga0105242_10011475 3300009176 Bacteria 6812
399 Ga0105242_11075700 3300009176 Bacteria 817
400 Ga0105248_10009365 3300009177 Bacteria 10781
401 Ga0105248_10011120 3300009177 Bacteria 9932
402 Ga0105248_10025929 3300009177 Bacteria 6519
403 Ga0105248_10130172 3300009177 Bacteria 2839
404 Ga0105248_10224601 3300009177 Bacteria 2114
405 Ga0105248_10243631 3300009177 Bacteria 2024
406 Ga0105248_10289252 3300009177 Unclassified 1845
407 Ga0105248_10479142 3300009177 Unclassified 1402
408 Ga0105248_11548738 3300009177 Bacteria 751
409 Ga0105238_10000082 3300009551 Bacteria 107565
410 Ga0105238_10235186 3300009551 Bacteria 1809
411 Ga0105249_10000115 3300009553 Bacteria 108581
412 Ga0105249_10000454 3300009553 Bacteria 38498
413 Ga0105249_10020862 3300009553 Bacteria 5858
414 Ga0105249_10108483 3300009553 Bacteria 2621
415 Ga0105249_11413995 3300009553 Bacteria 768
416 Ga0105249_11636261 3300009553 Unclassified 716
417 Ga0105239_10033512 3300010375 Bacteria 5640
418 Ga0105246_10019318 3300011119 Bacteria 4352
419 Ga0105246_10517035 3300011119 Bacteria 1017
420 Ga0157373_10001473 3300013100 Bacteria 17949
421 Ga0157373_10266861 3300013100 Bacteria 1212
422 Ga0157373_10538689 3300013100 Bacteria 846
423 Ga0157371_10007275 3300013102 Bacteria 8992
424 Ga0157370_10044947 3300013104 Bacteria 4241
425 Ga0157370_10120885 3300013104 Unclassified 2445
426 Ga0157370_10140254 3300013104 Bacteria 2252
427 Ga0157370_10459742 3300013104 Unclassified 1170
428 Ga0157369_10083371 3300013105 Bacteria 3420
429 Ga0157369_10107160 3300013105 Bacteria 2973
430 Ga0157369_10241902 3300013105 Unclassified 1885
431 Ga0157369_10302334 3300013105 Bacteria 1664
432 Ga0157374_10235614 3300013296 Viruses 1799
433 Ga0157378_10061192 3300013297 Bacteria 3359
434 Ga0157378_10709408 3300013297 Unclassified 1026
435 Ga0163162_10001492 3300013306 Bacteria 21813
436 Ga0163162_10009352 3300013306 Bacteria 9529
437 Ga0163162_10013828 3300013306 Bacteria 7885
438 Ga0157372_10015470 3300013307 Bacteria 8178
439 Ga0157372_10019583 3300013307 Bacteria 7293
440 Ga0157372_10126831 3300013307 Bacteria 2935
441 Ga0157375_10025086 3300013308 Bacteria 5530
442 Ga0157375_10086208 3300013308 Unclassified 3191
443 Ga0157375_10149733 3300013308 Bacteria 2468
444 Ga0157375_10326904 3300013308 Bacteria 1698
445 Ga0157375_10696491 3300013308 Unclassified 1170
446 Ga0157375_11193294 3300013308 Unclassified 893
447 Ga0163163_10068100 3300014325 Bacteria 3541
448 Ga0157380_10007646 3300014326 Bacteria 7684
449 Ga0157380_10027037 3300014326 Bacteria 4360
450 Ga0157380_10615788 3300014326 Bacteria 1077
451 Ga0182008_10009299 3300014497 Bacteria 5312
452 Ga0157377_10005403 3300014745 Bacteria 6004
453 Ga0157379_10098332 3300014968 Bacteria 2627
454 Ga0157376_10050743 3300014969 Unclassified 3443
455 Ga0157376_10401354 3300014969 Unclassified 1326
456 Ga0163161_10033434 3300017792 Bacteria 3675
457 Ga0163161_10039316 3300017792 Bacteria 3395
458 Ga0163161_10339454 3300017792 Bacteria 1191
459 Ga0213875_10016088 3300021388 Bacteria 3628
460 Ga0207697_10013577 3300025315 Bacteria 3397
461 Ga0207656_10020155 3300025321 Unclassified 2647
462 Ga0207653_10000333 3300025885 Bacteria 24834
463 Ga0207653_10004243 3300025885 Bacteria 4502
464 Ga0207653_10007863 3300025885 Bacteria 3323
465 Ga0207653_10009549 3300025885 Bacteria 3024
466 Ga0207653_10027001 3300025885 Bacteria 1842
467 Ga0207642_10008584 3300025899 Unclassified 3514
468 Ga0207680_10062554 3300025903 Bacteria 2275
469 Ga0207680_10584370 3300025903 Bacteria 798
470 Ga0207685_10410385 3300025905 Bacteria 696
471 Ga0207699_10003303 3300025906 Bacteria 7687
472 Ga0207699_10004172 3300025906 Bacteria 6922
473 Ga0207645_10000246 3300025907 Bacteria 44995
474 Ga0207645_10000971 3300025907 Bacteria 23712
475 Ga0207643_10049854 3300025908 Bacteria 2373
476 Ga0207684_10025853 3300025910 Bacteria 5003
477 Ga0207684_10049207 3300025910 Bacteria 3576
478 Ga0207684_10052400 3300025910 Bacteria 3463
479 Ga0207684_10056409 3300025910 Bacteria 3332
480 Ga0207684_10194667 3300025910 Bacteria 1749
481 Ga0207684_10289501 3300025910 Bacteria 1412
482 Ga0207684_10373488 3300025910 Bacteria 1227
483 Ga0207684_10469940 3300025910 Unclassified 1079
484 Ga0207654_10086132 3300025911 Bacteria 1904
485 Ga0207707_10000929 3300025912 Bacteria 28400
486 Ga0207707_10004279 3300025912 Bacteria 12632
487 Ga0207707_10012211 3300025912 Bacteria 7468
488 Ga0207707_10018172 3300025912 Bacteria 6127
489 Ga0207707_10355257 3300025912 Bacteria 1262
490 Ga0207695_10001441 3300025913 Bacteria 39845
491 Ga0207695_10020766 3300025913 Bacteria 7513
492 Ga0207695_10296436 3300025913 Unclassified 1509
493 Ga0207693_10054679 3300025915 Bacteria 3131
494 Ga0207663_10000556 3300025916 Bacteria 16472
495 Ga0207663_10152376 3300025916 Bacteria 1623
496 Ga0207663_10425943 3300025916 Unclassified 1019
497 Ga0207660_10001809 3300025917 Bacteria 14242
498 Ga0207660_10013503 3300025917 Bacteria 5353
499 Ga0207660_10061332 3300025917 Bacteria 2706
500 Ga0207660_10061487 3300025917 Bacteria 2703
501 Ga0207660_10066366 3300025917 Bacteria 2610
502 Ga0207660_10131532 3300025917 Unclassified 1905
503 Ga0207660_10365278 3300025917 Unclassified 1158
504 Ga0207660_10430414 3300025917 Bacteria 1065
505 Ga0207662_10003079 3300025918 Bacteria 8511
506 Ga0207662_10039369 3300025918 Unclassified 2773
507 Ga0207662_10356264 3300025918 Unclassified 984
508 Ga0207657_10021232 3300025919 Bacteria 6115
509 Ga0207657_10069828 3300025919 Unclassified 2979
510 Ga0207649_10025399 3300025920 Bacteria 3454
511 Ga0207649_10082210 3300025920 Bacteria 2088
512 Ga0207649_10203801 3300025920 Unclassified 1399
513 Ga0207649_10482632 3300025920 Viruses 940
514 Ga0207649_10664380 3300025920 Bacteria 806
515 Ga0207649_10845717 3300025920 Bacteria 716
516 Ga0207652_10000470 3300025921 Bacteria 41380
517 Ga0207652_10008367 3300025921 Bacteria 8321
518 Ga0207652_10253236 3300025921 Bacteria 1588
519 Ga0207652_10625068 3300025921 Unclassified 964
520 Ga0207652_10708038 3300025921 Viruses 898
521 Ga0207652_11017790 3300025921 Bacteria 727
522 Ga0207646_10003762 3300025922 Bacteria 16914
523 Ga0207646_10013412 3300025922 Bacteria 7838
524 Ga0207646_10021064 3300025922 Bacteria 6029
525 Ga0207646_10040328 3300025922 Bacteria 4199
526 Ga0207646_10044148 3300025922 Bacteria 4001
527 Ga0207646_10076152 3300025922 Bacteria 2998
528 Ga0207646_10082816 3300025922 Unclassified 2869
529 Ga0207646_10090878 3300025922 Bacteria 2733
530 Ga0207646_10153252 3300025922 Bacteria 2078
531 Ga0207646_10329127 3300025922 Bacteria 1380
532 Ga0207646_10490266 3300025922 Bacteria 1108
533 Ga0207681_10002554 3300025923 Bacteria 11555
534 Ga0207681_10009785 3300025923 Bacteria 5864
535 Ga0207681_10576670 3300025923 Bacteria 928
536 Ga0207694_10000031 3300025924 Bacteria 223403
537 Ga0207650_10004487 3300025925 Bacteria 9540
538 Ga0207659_10024660 3300025926 Bacteria 4033
539 Ga0207659_10158062 3300025926 Unclassified 1777
540 Ga0207659_10365751 3300025926 Bacteria 1200
541 Ga0207687_10220796 3300025927 Bacteria 1492
542 Ga0207700_10493556 3300025928 Unclassified 1083
543 Ga0207664_10039793 3300025929 Unclassified 3650
544 Ga0207664_10485805 3300025929 Unclassified 1105
545 Ga0207644_10006147 3300025931 Bacteria 7830
546 Ga0207690_10092018 3300025932 Bacteria 2145
547 Ga0207690_10823234 3300025932 Bacteria 768
548 Ga0207706_10000065 3300025933 Bacteria 109080
549 Ga0207706_10000240 3300025933 Bacteria 60370
550 Ga0207706_10000357 3300025933 Bacteria 49369
551 Ga0207706_10091758 3300025933 Bacteria 2670
552 Ga0207706_10107710 3300025933 Unclassified 2452
553 Ga0207706_10254057 3300025933 Unclassified 1535
554 Ga0207686_10001117 3300025934 Bacteria 15528
555 Ga0207686_10038002 3300025934 Unclassified 2909
556 Ga0207709_10207796 3300025935 Bacteria 1403
557 Ga0207709_10656970 3300025935 Viruses 835
558 Ga0207669_10001479 3300025937 Bacteria 10039
559 Ga0207669_10013476 3300025937 Bacteria 4062
560 Ga0207704_10024309 3300025938 Bacteria 3283
561 Ga0207704_10030332 3300025938 Bacteria 3031
562 Ga0207704_10701737 3300025938 Bacteria 838
563 Ga0207665_10001273 3300025939 Bacteria 17022
564 Ga0207665_10144401 3300025939 Bacteria 1700
565 Ga0207691_10022438 3300025940 Bacteria 5953
566 Ga0207691_10042373 3300025940 Bacteria 4197
567 Ga0207691_10069335 3300025940 Bacteria 3185
568 Ga0207691_10310100 3300025940 Bacteria 1354
569 Ga0207691_10358062 3300025940 Bacteria 1248
570 Ga0207691_10717182 3300025940 Bacteria 843
571 Ga0207711_10028892 3300025941 Bacteria 4671
572 Ga0207711_10453324 3300025941 Viruses 1194
573 Ga0207711_10477947 3300025941 Unclassified 1161
574 Ga0207711_10486027 3300025941 Bacteria 1150
575 Ga0207689_10007750 3300025942 Bacteria 9398
576 Ga0207689_10027696 3300025942 Unclassified 4743
577 Ga0207661_10001946 3300025944 Bacteria 14195
578 Ga0207661_10011833 3300025944 Bacteria 6336
579 Ga0207661_10076562 3300025944 Bacteria 2748
580 Ga0207661_10619641 3300025944 Unclassified 994
581 Ga0207679_10000484 3300025945 Bacteria 27676
582 Ga0207679_10006509 3300025945 Bacteria 7385
583 Ga0207679_10009273 3300025945 Bacteria 6296
584 Ga0207679_10119853 3300025945 Bacteria 2092
585 Ga0207667_10011137 3300025949 Bacteria 10468
586 Ga0207667_10229710 3300025949 Unclassified 1900
587 Ga0207667_10398274 3300025949 Bacteria 1402
588 Ga0207712_10000499 3300025961 Bacteria 32439
589 Ga0207712_10001176 3300025961 Bacteria 18145
590 Ga0207712_10013123 3300025961 Bacteria 5308
591 Ga0207712_10195094 3300025961 Viruses 1601
592 Ga0207712_11069500 3300025961 Unclassified 717
593 Ga0207668_10003474 3300025972 Bacteria 9246
594 Ga0207668_10103366 3300025972 Unclassified 2121
595 Ga0207668_10181836 3300025972 Bacteria 1659
596 Ga0207668_10278097 3300025972 Bacteria 1371
597 Ga0207668_10520089 3300025972 Bacteria 1026
598 Ga0207640_10001456 3300025981 Bacteria 12799
599 Ga0207640_10097863 3300025981 Unclassified 2049
600 Ga0207640_10168468 3300025981 Bacteria 1629
601 Ga0207640_10287036 3300025981 Unclassified 1295
602 Ga0207658_10069022 3300025986 Unclassified 2669
603 Ga0207658_10086716 3300025986 Bacteria 2415
604 Ga0207677_10090705 3300026023 Unclassified 2221
605 Ga0207703_10013898 3300026035 Bacteria 6276
606 Ga0207703_10123347 3300026035 Bacteria 2227
607 Ga0207639_10004358 3300026041 Bacteria 9545
608 Ga0207639_10081332 3300026041 Unclassified 2565
609 Ga0207639_10719660 3300026041 Bacteria 927
610 Ga0207678_10293719 3300026067 Bacteria 1396
611 Ga0207678_10418043 3300026067 Unclassified 1162
612 Ga0207708_10048583 3300026075 Unclassified 3230
613 Ga0207708_10718818 3300026075 Bacteria 855
614 Ga0207702_10493602 3300026078 Unclassified 1193
615 Ga0207641_10027354 3300026088 Bacteria 4709
616 Ga0207641_10053544 3300026088 Bacteria 3421
617 Ga0207648_10001169 3300026089 Bacteria 29362
618 Ga0207648_10005220 3300026089 Bacteria 13139
619 Ga0207648_10032931 3300026089 Bacteria 4573
620 Ga0207648_10081119 3300026089 Bacteria 2830
621 Ga0207648_10405160 3300026089 Bacteria 1236
622 Ga0207676_10085386 3300026095 Bacteria 2576
623 Ga0207676_10094646 3300026095 Bacteria 2462
624 Ga0207676_10131582 3300026095 Bacteria 2128
625 Ga0207676_11210984 3300026095 Bacteria 748
626 Ga0207674_10003135 3300026116 Bacteria 20383
627 Ga0207674_10015526 3300026116 Bacteria 8364
628 Ga0207674_10018565 3300026116 Bacteria 7555
629 Ga0207674_10106289 3300026116 Unclassified 2784
630 Ga0207674_10471392 3300026116 Bacteria 1213
631 Ga0207675_100000320 3300026118 Bacteria 45668
632 Ga0207675_100052078 3300026118 Bacteria 3820
633 Ga0207675_100053417 3300026118 Bacteria 3770
634 Ga0207675_100233958 3300026118 Unclassified 1773
635 Ga0207675_101194559 3300026118 Bacteria 781
636 Ga0207683_10034731 3300026121 Bacteria 4383
637 Ga0207698_10013973 3300026142 Bacteria 5318
638 Ga0207698_10165264 3300026142 Viruses 1941
639 Ga0207698_10597062 3300026142 Bacteria 1088
640 Ga0209588_1003279 3300027671 Bacteria 4474
641 Ga0209588_1053508 3300027671 Bacteria 1306
642 Ga0209998_10021291 3300027717 Unclassified 1392
643 Ga0209974_10032789 3300027876 Unclassified 1722
644 Ga0209974_10035554 3300027876 Bacteria 1655
645 Ga0209974_10053204 3300027876 Unclassified 1363
646 Ga0207428_10070482 3300027907 Unclassified 2747
647 Ga0207428_10279829 3300027907 Bacteria 1239
648 Ga0207428_10344024 3300027907 Unclassified 1098
649 Ga0268266_10297444 3300028379 Bacteria 1505
650 Ga0268266_10345674 3300028379 Bacteria 1397
651 Ga0268266_10606989 3300028379 Bacteria 1051
652 Ga0268265_10002121 3300028380 Bacteria 15384
653 Ga0268265_10385158 3300028380 Bacteria 1291
654 Ga0268265_10904024 3300028380 Bacteria 867
655 Ga0268264_10056897 3300028381 Unclassified 3269
656 Ga0268264_10479044 3300028381 Bacteria 1210
657 Ga0316182_1400452 3300030745 Bacteria 1098
658 Ga0307408_100023852 3300031548 Unclassified 4171
659 Ga0307408_100033838 3300031548 Unclassified 3574
660 Ga0307408_100252115 3300031548 Bacteria 1456
661 Ga0307408_100961497 3300031548 Bacteria 785
662 Ga0307413_10019867 3300031824 Bacteria 3560
663 Ga0307413_10034699 3300031824 Bacteria 2886
664 Ga0307413_10064281 3300031824 Bacteria 2279
665 Ga0307413_10138214 3300031824 Unclassified 1679
666 Ga0307413_10342712 3300031824 Bacteria 1150
667 Ga0307410_10002152 3300031852 Bacteria 9368
668 Ga0307410_10034713 3300031852 Bacteria 3270
669 Ga0307410_10066181 3300031852 Bacteria 2488
670 Ga0307410_10085329 3300031852 Unclassified 2228
671 Ga0307410_10111755 3300031852 Bacteria 1978
672 Ga0307410_10159460 3300031852 Bacteria 1689
673 Ga0307410_10260503 3300031852 Unclassified 1352
674 Ga0307410_10397990 3300031852 Bacteria 1112
675 Ga0307410_10406662 3300031852 Bacteria 1101
676 Ga0307406_10001688 3300031901 Bacteria 12133
677 Ga0307406_10002595 3300031901 Bacteria 9848
678 Ga0307406_10212389 3300031901 Bacteria 1432
679 Ga0307406_10396758 3300031901 Unclassified 1092
680 Ga0307406_10731548 3300031901 Bacteria 829
681 Ga0307407_10046330 3300031903 Unclassified 2461
682 Ga0307407_10082309 3300031903 Bacteria 1950
683 Ga0307407_10084847 3300031903 Bacteria 1925
684 Ga0307407_10229529 3300031903 Bacteria 1260
685 Ga0307412_10026367 3300031911 Unclassified 3612
686 Ga0307412_10179634 3300031911 Bacteria 1590
687 Ga0307412_10472627 3300031911 Bacteria 1038
688 Ga0307409_100000144 3300031995 Bacteria 26764
689 Ga0307409_100092871 3300031995 Unclassified 2478
690 Ga0307409_100130147 3300031995 Unclassified 2149
691 Ga0307409_100189263 3300031995 Unclassified 1830
692 Ga0307409_100460620 3300031995 Unclassified 1229
693 Ga0307409_100482112 3300031995 Bacteria 1204
694 Ga0307409_100602088 3300031995 Bacteria 1086
695 Ga0307409_100673242 3300031995 Bacteria 1031
696 Ga0307409_101365291 3300031995 Unclassified 734
697 Ga0307416_100000828 3300032002 Bacteria 16247
698 Ga0307416_100012718 3300032002 Bacteria 5685
699 Ga0307416_100014248 3300032002 Bacteria 5438
700 Ga0307416_100098157 3300032002 Unclassified 2539
701 Ga0307416_100101715 3300032002 Bacteria 2503
702 Ga0307416_100219380 3300032002 Bacteria 1822
703 Ga0307416_100449360 3300032002 Unclassified 1341
704 Ga0307414_10002383 3300032004 Bacteria 9831
705 Ga0307414_10080065 3300032004 Unclassified 2387
706 Ga0307414_10115391 3300032004 Unclassified 2054
707 Ga0307414_10121089 3300032004 Bacteria 2012
708 Ga0307414_10128285 3300032004 Unclassified 1964
709 Ga0307414_10182198 3300032004 Bacteria 1690
710 Ga0307414_10301355 3300032004 Bacteria 1356
711 Ga0307414_10325274 3300032004 Bacteria 1310
712 Ga0307414_10902365 3300032004 Unclassified 810
713 Ga0307411_10010876 3300032005 Unclassified 4877
714 Ga0307411_10017282 3300032005 Bacteria 4105
715 Ga0307411_10043167 3300032005 Bacteria 2883
716 Ga0307411_10212673 3300032005 Bacteria 1494
717 Ga0307411_10572506 3300032005 Unclassified 967
718 Ga0307411_10728649 3300032005 Bacteria 866
719 Ga0307411_10849291 3300032005 Bacteria 807
720 Ga0307415_100000419 3300032126 Bacteria 18192
721 Ga0307415_100119421 3300032126 Unclassified 1973
722 Ga0307415_100791815 3300032126 Unclassified 864
723 Ga0373930_0013841 3300034816 Unclassified 1493
724 Ga0373948_0028390 3300034817 Bacteria 1114
725 Ga0373958_0051750 3300034819 Viruses 869
726 Ga0373959_0000187 3300034820 Bacteria 13809
727 Ga0373959_0007997 3300034820 Bacteria 1788
728 Ga0373959_0039204 3300034820 Bacteria 988
729 Ga0373932_0104442 3300035112 Bacteria 926
730 Ga0373942_0077912 3300035207 Bacteria 979
731 Ga0373961_0016222 3300035241 Bacteria 1917
732 Ga0373931_0008014 3300035691 Bacteria 4998
733 Ga0373931_0190774 3300035691 Bacteria 1219
734 Ga0373937_1040561 3300036401 Bacteria 767
735 Ga0373925_0402602 3300037068 Unclassified 1116
736 Ga0395900_0005143 3300037418 Bacteria 13738
737 Ga0395905_0035452 3300037471 Bacteria 4685
738 Ga0395905_0309388 3300037471 Bacteria 1468
739 Ga0395905_0338329 3300037471 Bacteria 1396
740 Ga0395905_0773182 3300037471 Archaea 863
741 Ga0436364_0532547 3300037853 Bacteria 5851
742 Ga0436364_0890989 3300037853 Bacteria 915
743 Ga0395901_0044634 3300038443 Bacteria 4597
744 Ga0395901_0057802 3300038443 Bacteria 4034
745 Ga0242419_002517 3300038698 Unclassified 1195
746 Ga0242420_003855 3300038996 Bacteria 2238
747 Ga0242420_053365 3300038996 Bacteria 794
748 Ga0439439_0013448 3300041406 Bacteria 1983
749 Ga0439462_0020084 3300042015 Bacteria 1742
750 Ga0450896_011065 3300042133 Unclassified 1269
751 Ga0450898_015309 3300042134 Unclassified 1298
752 Ga0439446_0079940 3300042156 Bacteria 1011
753 Ga0439434_0038539 3300042435 Bacteria 1465
754 Ga0439435_0037204 3300042436 Bacteria 1348
755 Ga0439435_0121832 3300042436 Bacteria 818
756 Ga0451577_0036034 3300042876 Bacteria 4456
757 Ga0451577_0063065 3300042876 Unclassified 3305
758 Ga0451577_0354058 3300042876 Bacteria 1332
759 Ga0451577_0415277 3300042876 Bacteria 1222
760 Ga0451577_0497896 3300042876 Bacteria 1106
761 Ga0451577_0530573 3300042876 Unclassified 1069
762 Ga0466969_0142939 3300044656 Bacteria 1105
763 Ga0453683_0006036 3300044673 Bacteria 8348
764 Ga0453683_0067639 3300044673 Unclassified 2233
765 Ga0453683_0097817 3300044673 Unclassified 1842
766 Ga0453683_0168349 3300044673 Bacteria 1388
767 Ga0453683_0169580 3300044673 Bacteria 1382
768 Ga0453683_0448630 3300044673 Unclassified 834
769 Ga0466961_0025997 3300044693 Bacteria 3763
770 Ga0453684_0678154 3300044712 Bacteria 1122
771 Ga0466960_0116553 3300044901 Bacteria 1394
772 Ga0451576_0011287 3300045051 Bacteria 10167
773 Ga0451576_0018762 3300045051 Bacteria 7564
774 Ga0451576_0043756 3300045051 Bacteria 4723
775 Ga0451576_0045737 3300045051 Bacteria 4608
776 Ga0451576_0046962 3300045051 Bacteria 4542
777 Ga0451576_0074983 3300045051 Unclassified 3520
778 Ga0451576_0374847 3300045051 Bacteria 1491
779 Ga0451576_0447126 3300045051 Unclassified 1356
780 Ga0451576_0915442 3300045051 Unclassified 920
781 Ga0495603_0012157 3300046455 Bacteria 5213
782 Ga0495603_0209644 3300046455 Bacteria 1125
783 Ga0495629_0305980 3300046459 Unclassified 1088
784 Ga0495580_0170505 3300046472 Bacteria 1505
785 Ga0495582_0032465 3300046473 Bacteria 2871
786 Ga0495582_0270231 3300046473 Unclassified 975
787 Ga0495594_0021241 3300046499 Bacteria 3464
788 Ga0495594_0022950 3300046499 Bacteria 3341
789 Ga0495630_0091977 3300046517 Bacteria 2292
790 Ga0495663_0018531 3300046525 Unclassified 1983
791 Ga0495666_0046762 3300046526 Bacteria 2085
792 Ga0495640_0104669 3300046533 Bacteria 1854
793 Ga0495586_0029017 3300046535 Bacteria 2961
794 Ga0495621_0176849 3300046539 Bacteria 850
795 Ga0495667_0079978 3300046559 Bacteria 2125
796 Ga0495634_0033648 3300046642 Bacteria 3521
797 Ga0495647_0039774 3300046681 Bacteria 1784
798 Ga0495647_0075435 3300046681 Unclassified 1357
799 Ga0495658_0161334 3300046683 Bacteria 1383
800 Ga0495613_0133508 3300046689 Bacteria 1777
801 Ga0495636_0135626 3300047318 Bacteria 1097
802 Ga0495636_0198977 3300047318 Unclassified 914
803 Ga0495674_0280408 3300047319 Bacteria 1365
804 Ga0495676_0174190 3300047321 Bacteria 1512
805 Ga0495680_0059177 3300047322 Bacteria 2959
806 Ga0495684_0069778 3300047471 Bacteria 2672
807 Ga0496100_0071497 3300048903 Unclassified 2317
808 Ga0496100_0075999 3300048903 Bacteria 2254
809 Ga0496101_0033035 3300048904 Bacteria 3647
810 Ga0496101_0173058 3300048904 Bacteria 1660
811 Ga0496101_0534814 3300048904 Bacteria 926
812 Ga0496101_0547385 3300048904 Bacteria 915
813 Ga0496102_0056144 3300048905 Bacteria 3592
814 Ga0496102_0079042 3300048905 Unclassified 3028
815 Ga0496102_0126992 3300048905 Bacteria 2384
816 Ga0496102_0250840 3300048905 Unclassified 1669
817 Ga0496103_0051176 3300048906 Unclassified 2556
818 Ga0496104_0004744 3300048907 Bacteria 11832
819 Ga0496104_0094784 3300048907 Bacteria 2855
820 Ga0496104_0156483 3300048907 Unclassified 2187
821 Ga0496105_0036834 3300048908 Bacteria 4031
822 Ga0496105_0155523 3300048908 Unclassified 1878
823 Ga0496106_0083506 3300048909 Bacteria 2457
824 Ga0496106_0124142 3300048909 Unclassified 2020
825 Ga0496106_0135676 3300048909 Unclassified 1933
826 Ga0496107_0052279 3300048910 Unclassified 2947
827 Ga0496107_0113073 3300048910 Unclassified 1996
828 Ga0496107_0417776 3300048910 Unclassified 997
829 Ga0496108_0001291 3300048911 Bacteria 19664
830 Ga0496108_0005237 3300048911 Bacteria 10474
831 Ga0496108_0006989 3300048911 Bacteria 9135
832 Ga0496108_0017435 3300048911 Bacteria 5876
833 Ga0496108_0453683 3300048911 Bacteria 1120
834 Ga0496109_0031135 3300048912 Unclassified 4785
835 Ga0496109_0035270 3300048912 Bacteria 4511
836 Ga0496109_0229173 3300048912 Bacteria 1747
837 Ga0496109_0407550 3300048912 Bacteria 1284
838 Ga0496110_0012229 3300048913 Bacteria 7053
839 Ga0496110_0437024 3300048913 Bacteria 1193
840 Ga0496110_0905928 3300048913 Bacteria 788
841 Ga0496111_0442463 3300048914 Bacteria 959
842 Ga0496112_0001950 3300048915 Bacteria 16300
843 Ga0496112_0022068 3300048915 Bacteria 6062
844 Ga0496112_0124946 3300048915 Unclassified 2543
845 Ga0496112_0586514 3300048915 Bacteria 1047
846 Ga0496113_0000769 3300048916 Bacteria 16520
847 Ga0496113_0003336 3300048916 Bacteria 9589
848 Ga0496113_0012516 3300048916 Bacteria 5705
849 Ga0496113_0053330 3300048916 Bacteria 3023
850 Ga0496113_0893651 3300048916 Unclassified 703
851 Ga0496114_0320445 3300048917 Bacteria 1370
852 Ga0496114_0689274 3300048917 Bacteria 897
853 Ga0496115_0048377 3300048918 Unclassified 3401
854 Ga0496115_0157500 3300048918 Unclassified 1876
855 Ga0496115_0574060 3300048918 Unclassified 899
856 Ga0501031_0075042 3300049568 Bacteria 2202
857 Ga0501032_0426933 3300049569 Unclassified 850
858 Ga0501032_0621217 3300049569 Bacteria 687
859 Ga0501033_0150262 3300049570 Bacteria 1681
860 Ga0501033_0295651 3300049570 Bacteria 1141
861 Ga0501033_0461899 3300049570 Unclassified 881
862 Ga0501034_0703208 3300049571 Unclassified 909
863 Ga0501036_0021910 3300049572 Bacteria 5373
864 Ga0501036_0327258 3300049572 Bacteria 1280
865 Ga0501037_0184209 3300049573 Bacteria 1481
866 Ga0501038_0425201 3300049574 Bacteria 1024
867 Ga0501038_0517989 3300049574 Bacteria 910
868 Ga0501039_0019178 3300049575 Bacteria 5248
869 Ga0501039_0166360 3300049575 Unclassified 1734
870 Ga0501039_0718754 3300049575 Bacteria 781
871 Ga0501040_0057253 3300049576 Unclassified 2676
872 Ga0501040_0120347 3300049576 Bacteria 1842
873 Ga0501040_0126415 3300049576 Bacteria 1796
874 Ga0501041_0038824 3300049577 Bacteria 2888
875 Ga0501042_0014700 3300049578 Bacteria 5345
876 Ga0501043_0330964 3300049579 Bacteria 1160
877 Ga0501043_0391276 3300049579 Unclassified 1051
878 Ga0501046_0080712 3300049580 Bacteria 2513
879 Ga0501046_0090170 3300049580 Bacteria 2359
880 Ga0501047_0000842 3300049581 Bacteria 31665
881 Ga0501047_0198749 3300049581 Bacteria 1866
882 Ga0501048_0055429 3300049582 Bacteria 2814
883 Ga0501048_0082582 3300049582 Bacteria 2267
884 Ga0501067_0025968 3300049583 Bacteria 3245
885 Ga0501067_0050374 3300049583 Bacteria 2308
886 Ga0501067_0081298 3300049583 Unclassified 1796
887 Ga0501068_0000022 3300049584 Bacteria 58879
888 Ga0501068_0001339 3300049584 Bacteria 13056
889 Ga0501068_0188264 3300049584 Unclassified 1307
890 Ga0501069_0006160 3300049585 Bacteria 6263
891 Ga0501069_0022349 3300049585 Bacteria 3440
892 Ga0501069_0059353 3300049585 Bacteria 2134
893 Ga0501070_0000192 3300049586 Bacteria 57359
894 Ga0501070_0004268 3300049586 Bacteria 12290
895 Ga0501070_0022042 3300049586 Bacteria 5336
896 Ga0501071_0000678 3300049587 Bacteria 17791
897 Ga0501071_0033592 3300049587 Bacteria 3644
898 Ga0501071_0117590 3300049587 Bacteria 1969
899 Ga0501071_0226470 3300049587 Bacteria 1408
900 Ga0501071_0407114 3300049587 Bacteria 1039
901 Ga0501071_0614928 3300049587 Unclassified 835
902 Ga0501071_0955418 3300049587 Bacteria 662
903 Ga0501072_0014674 3300049588 Bacteria 6007
904 Ga0501072_0097467 3300049588 Bacteria 2337
905 Ga0501072_0161051 3300049588 Bacteria 1790
906 Ga0501072_0190259 3300049588 Bacteria 1637
907 Ga0501072_0332578 3300049588 Bacteria 1207
908 Ga0501073_0000949 3300049589 Bacteria 20906
909 Ga0501073_0062982 3300049589 Bacteria 2586
910 Ga0501073_0398573 3300049589 Unclassified 951
911 Ga0501074_0000171 3300049590 Bacteria 34937
912 Ga0501074_0000742 3300049590 Bacteria 20488
913 Ga0501074_0062345 3300049590 Unclassified 2685
914 Ga0501075_0076581 3300049591 Bacteria 2530
915 Ga0501075_0106483 3300049591 Bacteria 2131
916 Ga0501075_0670972 3300049591 Bacteria 790
917 Ga0501076_0020253 3300049592 Bacteria 5090
918 Ga0501076_0367266 3300049592 Unclassified 1182
919 Ga0501076_0375112 3300049592 Bacteria 1169
920 Ga0501077_0004768 3300049593 Bacteria 8242
921 Ga0501077_0053011 3300049593 Bacteria 2575
922 Ga0501077_0058114 3300049593 Bacteria 2455
923 Ga0501202_029946 3300049652 Unclassified 1131
924 Ga0501209_002047 3300049656 Unclassified 3006
925 Ga0501217_088428 3300049661 Bacteria 867
926 Ga0501235_003401 3300049669 Unclassified 3445
927 Ga0501221_015900 3300049704 Unclassified 1417
928 Ga0501225_0021352 3300049705 Unclassified 1788
929 Ga0501234_009350 3300049707 Bacteria 1528
930 Ga0501079_0060874 3300049741 Bacteria 2912
931 Ga0501079_0554862 3300049741 Bacteria 903
932 Ga0501079_0820871 3300049741 Bacteria 732
933 Ga0501080_0000060 3300049742 Bacteria 71292
934 Ga0501080_0107525 3300049742 Bacteria 2585
935 Ga0501080_0495018 3300049742 Bacteria 1093
936 Ga0501081_0063800 3300049743 Unclassified 2557
937 Ga0501081_0066384 3300049743 Bacteria 2509
938 Ga0501081_0074081 3300049743 Bacteria 2375
939 Ga0501081_0142005 3300049743 Bacteria 1721
940 Ga0501081_0162742 3300049743 Bacteria 1608
941 Ga0501083_0001978 3300049744 Bacteria 14097
942 Ga0501083_0059235 3300049744 Bacteria 2561
943 Ga0501083_0162068 3300049744 Unclassified 1463
944 Ga0501083_0306257 3300049744 Bacteria 1033
945 Ga0501263_005113 3300049760 Bacteria 1470
946 Ga0501268_012154 3300049765 Unclassified 1372
947 Ga0501268_045961 3300049765 Bacteria 834
948 Ga0501270_004688 3300049767 Bacteria 1548
949 Ga0501272_000560 3300049769 Unclassified 3295
950 Ga0501279_027846 3300049775 Unclassified 829
951 Ga0501035_0017508 3300049822 Bacteria 6610
952 Ga0501035_0110624 3300049822 Bacteria 2408
953 Ga0501035_0432634 3300049822 Unclassified 1091
954 Ga0501035_0694981 3300049822 Bacteria 821
955 Ga0501044_0000734 3300049823 Bacteria 39508
956 Ga0501044_0194333 3300049823 Bacteria 1990
957 Ga0501044_0318067 3300049823 Bacteria 1481
958 Ga0501045_0014038 3300049824 Bacteria 5670
959 Ga0501045_0094602 3300049824 Bacteria 2210
960 Ga0501045_0118557 3300049824 Bacteria 1964
961 Ga0501045_0324111 3300049824 Unclassified 1146
962 nmdc:mga05p37_138827_c1 3300050507 Bacteria 2978
963 nmdc:mga05p37_24458_c2 3300050507 Bacteria 4909
964 nmdc:mga05p37_24982_c1 3300050507 Bacteria 7262
965 nmdc:mga05p37_284551_c1 3300050507 Unclassified 1970
966 nmdc:mga05p37_371760_c1 3300050507 Bacteria 1677
967 nmdc:mga05p37_414393_c1 3300050507 Bacteria 1569
968 nmdc:mga05p37_51636_c1 3300050507 Bacteria 5055
969 nmdc:mga05p37_561756_c1 3300050507 Unclassified 1296
970 nmdc:mga05p37_75331_c1 3300050507 Bacteria 4153
971 nmdc:mga09592_125585_c1 3300050508 Bacteria 2205
972 nmdc:mga09592_19135_c1 3300050508 Bacteria 5619
973 nmdc:mga09592_3967_c1 3300050508 Bacteria 11923
974 nmdc:mga0qj67_10094_c1 3300050509 Bacteria 7046
975 nmdc:mga0qj67_255813_c1 3300050509 Bacteria 1421
976 nmdc:mga0qj67_3022_c1 3300050509 Bacteria 12093
977 nmdc:mga0qj67_41359_c1 3300050509 Bacteria 3625
978 nmdc:mga0qj67_427435_c1 3300050509 Unclassified 1068
979 nmdc:mga0qj67_584417_c1 3300050509 Bacteria 894
980 nmdc:mga06r32_118220_c1 3300050510 Bacteria 2613
981 nmdc:mga06r32_22435_c1 3300050510 Bacteria 5837
982 nmdc:mga06r32_269914_c1 3300050510 Bacteria 1689
983 nmdc:mga06r32_29277_c1 3300050510 Bacteria 5159
984 nmdc:mga06r32_339589_c1 3300050510 Bacteria 1487
985 nmdc:mga06r32_356899_c1 3300050510 Bacteria 1446
986 nmdc:mga06r32_383154_c1 3300050510 Bacteria 1389
987 nmdc:mga06r32_45554_c1 3300050510 Bacteria 4182
988 nmdc:mga06r32_804066_c1 3300050510 Bacteria 901
989 nmdc:mga06r32_857504_c1 3300050510 Bacteria 866
990 nmdc:mga08y16_232930_c1 3300050511 Bacteria 1905
991 nmdc:mga08y16_542655_c1 3300050511 Bacteria 1177
992 nmdc:mga08y16_71880_c1 3300050511 Bacteria 3605
993 nmdc:mga08y16_9037_c1 3300050511 Bacteria 10459
994 nmdc:mga0n895_1129540_c1 3300050512 Bacteria 760
995 nmdc:mga0n895_11503_c1 3300050512 Bacteria 7899
996 nmdc:mga0n895_13422_c1 3300050512 Bacteria 7389
997 nmdc:mga0n895_1342658_c1 3300050512 Bacteria 685
998 nmdc:mga0n895_141908_c1 3300050512 Bacteria 2431
999 nmdc:mga0n895_19615_c1 3300050512 Bacteria 6287
1000 nmdc:mga0n895_21697_c1 3300050512 Bacteria 6010
1001 nmdc:mga0n895_274249_c1 3300050512 Unclassified 1711
1002 nmdc:mga0n895_3234_c1 3300050512 Bacteria 13055
1003 nmdc:mga0n895_40283_c1 3300050512 Bacteria 4537
1004 nmdc:mga0n895_532041_c1 3300050512 Bacteria 1182
1005 nmdc:mga0n895_603579_c1 3300050512 Bacteria 1100
1006 nmdc:mga0n895_60762_c1 3300050512 Bacteria 3729
1007 nmdc:mga0n895_639749_c1 3300050512 Unclassified 1063
1008 nmdc:mga0n895_77744_c1 3300050512 Bacteria 3302
1009 nmdc:mga0rr50_104391_c1 3300050513 Bacteria 2232
1010 nmdc:mga0rr50_127494_c1 3300050513 Bacteria 2034
1011 nmdc:mga0rr50_259408_c1 3300050513 Bacteria 1446
1012 nmdc:mga0rr50_345316_c1 3300050513 Bacteria 1251
1013 nmdc:mga0rr50_51554_c1 3300050513 Bacteria 3054
1014 nmdc:mga0rr50_611973_c1 3300050513 Unclassified 929
1015 nmdc:mga0rr50_7588_c1 3300050513 Bacteria 6704
1016 nmdc:mga0rr50_79036_c1 3300050513 Bacteria 2533
1017 nmdc:mga08x19_102252_c1 3300050514 Bacteria 1903
1018 nmdc:mga08x19_2813_c1 3300050514 Bacteria 10493
1019 nmdc:mga08x19_28964_c1 3300050514 Bacteria 3473
1020 nmdc:mga08x19_34468_c1 3300050514 Bacteria 3200
1021 nmdc:mga08x19_51234_c1 3300050514 Unclassified 2651
1022 nmdc:mga08x19_63696_c1 3300050514 Bacteria 1893
1023 nmdc:mga08x19_637349_c1 3300050514 Bacteria 756
1024 nmdc:mga08x19_8445_c1 3300050514 Bacteria 6134
1025 nmdc:mga08x19_90860_c1 3300050514 Unclassified 2015
1026 nmdc:mga0a205_108546_c1 3300050515 Bacteria 2674
1027 nmdc:mga0a205_128056_c1 3300050515 Bacteria 2439
1028 nmdc:mga0a205_185777_c1 3300050515 Bacteria 1972
1029 nmdc:mga0a205_209869_c1 3300050515 Bacteria 1836
1030 nmdc:mga0a205_247330_c2 3300050515 Unclassified 1053
1031 nmdc:mga0a205_37263_c1 3300050515 Bacteria 4676
1032 nmdc:mga0a205_784485_c1 3300050515 Bacteria 801
1033 nmdc:mga0a205_80583_c1 3300050515 Unclassified 2797
1034 nmdc:mga0a205_823_c1 3300050515 Bacteria 25240
1035 Ga0501084_0001187 3300054114 Bacteria 20381
1036 Ga0501084_0022610 3300054114 Bacteria 5248
1037 Ga0501084_0091875 3300054114 Bacteria 2548
1038 Ga0501084_0431681 3300054114 Bacteria 1114
1039 Ga0501084_0493686 3300054114 Bacteria 1034
1040 Ga0590071_011011 3300059421 Bacteria 2116
1041 Ga0590071_017913 3300059421 Unclassified 1665
1042 Ga0590071_093083 3300059421 Bacteria 756
1043 Ga0590074_038811 3300059423 Bacteria 854
1044 Ga0590075_014608 3300059424 Bacteria 1921
1045 Ga0590077_091099 3300059426 Unclassified 707
1046 Ga0501082_0002066 3300060353 Bacteria 17658
1047 Ga0501082_0009721 3300060353 Bacteria 8284
1048 Ga0501082_0055172 3300060353 Bacteria 3423
1049 Ga0501082_0084001 3300060353 Bacteria 2747
1050 Ga0501082_0784771 3300060353 Bacteria 833
1051 Ga0530510_0021297 3300061734 Bacteria 4613
1052 Ga0530510_0037427 3300061734 Bacteria 3499
1053 Ga0530510_0174044 3300061734 Bacteria 1595
1054 Ga0530510_0255175 3300061734 Bacteria 1307

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10044947 Ga0157370_100449472 193
2 3300013104 Ga0157370_10140254 Ga0157370_101402542 193
3 3300009093 Ga0105240_10009204 Ga0105240_100092044 195
4 3300013100 Ga0157373_10538689 Ga0157373_105386891 195
5 3300013307 Ga0157372_10019583 Ga0157372_100195834 195
6 3300049587 Ga0501071_0955418 Ga0501071_0955418_59_652 195
7 3300005536 Ga0070697_100824964 Ga0070697_1008249641 196
8 3300026067 Ga0207678_10293719 Ga0207678_102937192 196
9 3300005328 Ga0070676_10043650 Ga0070676_100436502 197
10 3300005330 Ga0070690_100134340 Ga0070690_1001343401 197
11 3300005334 Ga0068869_100010103 Ga0068869_1000101038 197
12 3300005335 Ga0070666_10043206 Ga0070666_100432063 197
13 3300005341 Ga0070691_10038281 Ga0070691_100382813 197
14 3300005347 Ga0070668_100292142 Ga0070668_1002921422 197
15 3300005355 Ga0070671_100364816 Ga0070671_1003648162 197
16 3300005356 Ga0070674_100000488 Ga0070674_10000048820 197
17 3300005364 Ga0070673_100209157 Ga0070673_1002091571 197
18 3300005367 Ga0070667_100034583 Ga0070667_1000345833 197
19 3300005438 Ga0070701_10291613 Ga0070701_102916131 197
20 3300005440 Ga0070705_100007632 Ga0070705_1000076323 197
21 3300005444 Ga0070694_100073489 Ga0070694_1000734892 197
22 3300005456 Ga0070678_100161220 Ga0070678_1001612203 197
23 3300005457 Ga0070662_100000760 Ga0070662_1000007603 197
24 3300005459 Ga0068867_100143039 Ga0068867_1001430391 197
25 3300005530 Ga0070679_100483111 Ga0070679_1004831112 197
26 3300005544 Ga0070686_100362911 Ga0070686_1003629111 197
27 3300005545 Ga0070695_100001483 Ga0070695_10000148312 197
28 3300005546 Ga0070696_100005541 Ga0070696_1000055412 197
29 3300005549 Ga0070704_100071452 Ga0070704_1000714522 197
30 3300005577 Ga0068857_100321695 Ga0068857_1003216952 197
31 3300005578 Ga0068854_100000340 Ga0068854_10000034025 197
32 3300005614 Ga0068856_100279771 Ga0068856_1002797713 197
33 3300005615 Ga0070702_100069343 Ga0070702_1000693433 197
34 3300005718 Ga0068866_10034008 Ga0068866_100340082 197
35 3300006358 Ga0068871_100203893 Ga0068871_1002038932 197
36 3300009093 Ga0105240_10250937 Ga0105240_102509372 197
37 3300009098 Ga0105245_10259377 Ga0105245_102593772 197
38 3300009101 Ga0105247_10468529 Ga0105247_104685291 197
39 3300009148 Ga0105243_10097773 Ga0105243_100977733 197
40 3300009174 Ga0105241_10024142 Ga0105241_100241421 197
41 3300009176 Ga0105242_10011475 Ga0105242_100114752 197
42 3300009177 Ga0105248_10011120 Ga0105248_100111206 197
43 3300009551 Ga0105238_10235186 Ga0105238_102351861 197
44 3300011119 Ga0105246_10019318 Ga0105246_100193183 197
45 3300013297 Ga0157378_10061192 Ga0157378_100611921 197
46 3300013308 Ga0157375_10086208 Ga0157375_100862083 197
47 3300014968 Ga0157379_10098332 Ga0157379_100983323 197
48 3300017792 Ga0163161_10039316 Ga0163161_100393163 197
49 3300025899 Ga0207642_10008584 Ga0207642_100085844 197
50 3300025903 Ga0207680_10062554 Ga0207680_100625541 197
51 3300025907 Ga0207645_10000971 Ga0207645_100009719 197
52 3300025911 Ga0207654_10086132 Ga0207654_100861323 197
53 3300025913 Ga0207695_10296436 Ga0207695_102964362 197
54 3300025923 Ga0207681_10576670 Ga0207681_105766701 197
55 3300025927 Ga0207687_10220796 Ga0207687_102207962 197
56 3300025932 Ga0207690_10823234 Ga0207690_108232341 197
57 3300025933 Ga0207706_10000065 Ga0207706_1000006519 197
58 3300025934 Ga0207686_10001117 Ga0207686_100011172 197
59 3300025935 Ga0207709_10207796 Ga0207709_102077962 197
60 3300025937 Ga0207669_10001479 Ga0207669_1000147911 197
61 3300025938 Ga0207704_10030332 Ga0207704_100303323 197
62 3300025940 Ga0207691_10358062 Ga0207691_103580622 197
63 3300025941 Ga0207711_10028892 Ga0207711_100288921 197
64 3300025942 Ga0207689_10007750 Ga0207689_100077508 197
65 3300025972 Ga0207668_10520089 Ga0207668_105200892 197
66 3300025981 Ga0207640_10168468 Ga0207640_101684682 197
67 3300025986 Ga0207658_10086716 Ga0207658_100867162 197
68 3300026035 Ga0207703_10123347 Ga0207703_101233473 197
69 3300026089 Ga0207648_10001169 Ga0207648_100011693 197
70 3300026095 Ga0207676_11210984 Ga0207676_112109841 197
71 3300026116 Ga0207674_10106289 Ga0207674_101062894 197
72 3300026118 Ga0207675_100233958 Ga0207675_1002339582 197
73 3300028381 Ga0268264_10479044 Ga0268264_104790441 197
74 3300042876 Ga0451577_0063065 Ga0451577_0063065_217_837 197
75 3300044712 Ga0453684_0678154 Ga0453684_0678154_113_733 197
76 3300045051 Ga0451576_0447126 Ga0451576_0447126_556_1176 197
77 3300048904 Ga0496101_0173058 Ga0496101_0173058_31_651 197
78 3300048909 Ga0496106_0083506 Ga0496106_0083506_1414_2034 197
79 3300005406 Ga0070703_10010292 Ga0070703_100102923 198
80 3300005844 Ga0068862_100041901 Ga0068862_1000419011 198
81 3300025885 Ga0207653_10007863 Ga0207653_100078634 198
82 3300005334 Ga0068869_100213560 Ga0068869_1002135601 203
83 3300005336 Ga0070680_100077626 Ga0070680_1000776263 203
84 3300005345 Ga0070692_10121601 Ga0070692_101216012 203
85 3300005438 Ga0070701_10001843 Ga0070701_1000184310 203
86 3300005440 Ga0070705_100074184 Ga0070705_1000741841 203
87 3300005444 Ga0070694_100030940 Ga0070694_1000309403 203
88 3300005444 Ga0070694_100384377 Ga0070694_1003843772 203
89 3300005445 Ga0070708_100128115 Ga0070708_1001281152 203
90 3300005445 Ga0070708_100687208 Ga0070708_1006872081 203
91 3300005468 Ga0070707_100066765 Ga0070707_1000667654 203
92 3300005468 Ga0070707_100919206 Ga0070707_1009192062 203
93 3300005471 Ga0070698_100431334 Ga0070698_1004313341 203
94 3300005518 Ga0070699_100199342 Ga0070699_1001993422 203
95 3300005536 Ga0070697_100189640 Ga0070697_1001896402 203
96 3300005545 Ga0070695_100024381 Ga0070695_1000243815 203
97 3300005546 Ga0070696_100076908 Ga0070696_1000769085 203
98 3300005546 Ga0070696_100352650 Ga0070696_1003526502 203
99 3300005549 Ga0070704_100003470 Ga0070704_1000034703 203
100 3300005549 Ga0070704_100039533 Ga0070704_1000395335 203
101 3300005549 Ga0070704_100102755 Ga0070704_1001027552 203
102 3300005615 Ga0070702_100313996 Ga0070702_1003139962 203
103 3300005844 Ga0068862_100364246 Ga0068862_1003642462 203
104 3300006844 Ga0075428_100053259 Ga0075428_1000532592 203
105 3300006844 Ga0075428_100145551 Ga0075428_1001455513 203
106 3300006846 Ga0075430_100323968 Ga0075430_1003239682 203
107 3300006847 Ga0075431_100250032 Ga0075431_1002500323 203
108 3300006852 Ga0075433_10025979 Ga0075433_100259792 203
109 3300006852 Ga0075433_10807733 Ga0075433_108077332 203
110 3300006871 Ga0075434_100024719 Ga0075434_1000247192 203
111 3300006871 Ga0075434_100040831 Ga0075434_1000408312 203
112 3300006914 Ga0075436_100011903 Ga0075436_1000119032 203
113 3300006914 Ga0075436_100021360 Ga0075436_1000213605 203
114 3300006914 Ga0075436_100095001 Ga0075436_1000950012 203
115 3300006914 Ga0075436_100248356 Ga0075436_1002483561 203
116 3300007076 Ga0075435_100018599 Ga0075435_1000185994 203
117 3300007076 Ga0075435_100054584 Ga0075435_1000545843 203
118 3300007265 Ga0099794_10000151 Ga0099794_1000015117 203
119 3300007265 Ga0099794_10252118 Ga0099794_102521181 203
120 3300009094 Ga0111539_10198280 Ga0111539_101982802 203
121 3300009098 Ga0105245_10851268 Ga0105245_108512682 203
122 3300009147 Ga0114129_10408301 Ga0114129_104083012 203
123 3300025910 Ga0207684_10194667 Ga0207684_101946672 203
124 3300025910 Ga0207684_10373488 Ga0207684_103734882 203
125 3300025917 Ga0207660_10061332 Ga0207660_100613322 203
126 3300025917 Ga0207660_10365278 Ga0207660_103652782 203
127 3300025922 Ga0207646_10044148 Ga0207646_100441483 203
128 3300027671 Ga0209588_1003279 Ga0209588_10032792 203
129 3300027671 Ga0209588_1053508 Ga0209588_10535082 203
130 3300044673 Ga0453683_0169580 Ga0453683_0169580_257_868 203
131 3300045051 Ga0451576_0011287 Ga0451576_0011287_5685_6296 203
132 3300045051 Ga0451576_0018762 Ga0451576_0018762_2101_2712 203
133 3300045051 Ga0451576_0043756 Ga0451576_0043756_2212_2823 203
134 3300046525 Ga0495663_0018531 Ga0495663_0018531_858_1469 203
135 3300047318 Ga0495636_0135626 Ga0495636_0135626_414_1025 203
136 3300050510 nmdc:mga06r32_804066_c1 nmdc:mga06r32_804066_c1_232_843 203
137 3300050512 nmdc:mga0n895_1342658_c1 nmdc:mga0n895_1342658_c1_64_675 203
138 3300050512 nmdc:mga0n895_19615_c1 nmdc:mga0n895_19615_c1_5610_6221 203
139 3300050512 nmdc:mga0n895_274249_c1 nmdc:mga0n895_274249_c1_216_827 203
140 3300050514 nmdc:mga08x19_63696_c1 nmdc:mga08x19_63696_c1_640_1251 203
141 3300050514 nmdc:mga08x19_637349_c1 nmdc:mga08x19_637349_c1_46_657 203
142 3300050514 nmdc:mga08x19_90860_c1 nmdc:mga08x19_90860_c1_1324_1935 203
143 3300050515 nmdc:mga0a205_128056_c1 nmdc:mga0a205_128056_c1_1722_2333 203
144 3300050515 nmdc:mga0a205_185777_c1 nmdc:mga0a205_185777_c1_820_1431 203
145 3300005293 Ga0065715_10007216 Ga0065715_100072162 206
146 3300005293 Ga0065715_10128475 Ga0065715_101284751 206
147 3300005293 Ga0065715_10312085 Ga0065715_103120851 206
148 3300005327 Ga0070658_10447835 Ga0070658_104478352 206
149 3300005328 Ga0070676_10004346 Ga0070676_100043464 206
150 3300005329 Ga0070683_100007640 Ga0070683_1000076407 206
151 3300005329 Ga0070683_100021254 Ga0070683_1000212545 206
152 3300005329 Ga0070683_100027949 Ga0070683_1000279493 206
153 3300005329 Ga0070683_100067628 Ga0070683_1000676283 206
154 3300005329 Ga0070683_100093088 Ga0070683_1000930881 206
155 3300005331 Ga0070670_100007272 Ga0070670_1000072726 206
156 3300005331 Ga0070670_100018024 Ga0070670_1000180243 206
157 3300005334 Ga0068869_100045781 Ga0068869_1000457812 206
158 3300005335 Ga0070666_10215595 Ga0070666_102155952 206
159 3300005336 Ga0070680_100017722 Ga0070680_1000177223 206
160 3300005336 Ga0070680_100019668 Ga0070680_1000196684 206
161 3300005336 Ga0070680_100021822 Ga0070680_1000218223 206
162 3300005336 Ga0070680_101006097 Ga0070680_1010060971 206
163 3300005338 Ga0068868_100479970 Ga0068868_1004799701 206
164 3300005339 Ga0070660_100012909 Ga0070660_1000129096 206
165 3300005339 Ga0070660_100788044 Ga0070660_1007880441 206
166 3300005340 Ga0070689_100014547 Ga0070689_1000145473 206
167 3300005340 Ga0070689_100497411 Ga0070689_1004974112 206
168 3300005340 Ga0070689_100588177 Ga0070689_1005881771 206
169 3300005341 Ga0070691_10154926 Ga0070691_101549262 206
170 3300005343 Ga0070687_100000721 Ga0070687_1000007215 206
171 3300005343 Ga0070687_100039931 Ga0070687_1000399312 206
172 3300005343 Ga0070687_100239869 Ga0070687_1002398691 206
173 3300005343 Ga0070687_100405796 Ga0070687_1004057961 206
174 3300005344 Ga0070661_100002985 Ga0070661_1000029859 206
175 3300005344 Ga0070661_100003797 Ga0070661_10000379711 206
176 3300005344 Ga0070661_100010685 Ga0070661_1000106855 206
177 3300005344 Ga0070661_100190236 Ga0070661_1001902362 206
178 3300005345 Ga0070692_10017287 Ga0070692_100172873 206
179 3300005347 Ga0070668_100003043 Ga0070668_10000304312 206
180 3300005347 Ga0070668_100006902 Ga0070668_1000069028 206
181 3300005347 Ga0070668_100216914 Ga0070668_1002169142 206
182 3300005347 Ga0070668_100350769 Ga0070668_1003507692 206
183 3300005347 Ga0070668_100686890 Ga0070668_1006868901 206
184 3300005353 Ga0070669_100003079 Ga0070669_10000307910 206
185 3300005353 Ga0070669_100017058 Ga0070669_1000170582 206
186 3300005353 Ga0070669_100075028 Ga0070669_1000750282 206
187 3300005354 Ga0070675_100002631 Ga0070675_1000026316 206
188 3300005354 Ga0070675_100002663 Ga0070675_1000026638 206
189 3300005354 Ga0070675_100138851 Ga0070675_1001388512 206
190 3300005354 Ga0070675_100214432 Ga0070675_1002144322 206
191 3300005354 Ga0070675_100247540 Ga0070675_1002475402 206
192 3300005355 Ga0070671_100008957 Ga0070671_1000089578 206
193 3300005355 Ga0070671_100046843 Ga0070671_1000468432 206
194 3300005356 Ga0070674_100072803 Ga0070674_1000728032 206
195 3300005356 Ga0070674_100190297 Ga0070674_1001902972 206
196 3300005364 Ga0070673_100665717 Ga0070673_1006657171 206
197 3300005366 Ga0070659_100032565 Ga0070659_1000325653 206
198 3300005366 Ga0070659_100040066 Ga0070659_1000400662 206
199 3300005366 Ga0070659_100106827 Ga0070659_1001068272 206
200 3300005367 Ga0070667_100031097 Ga0070667_1000310974 206
201 3300005406 Ga0070703_10036920 Ga0070703_100369202 206
202 3300005434 Ga0070709_10001038 Ga0070709_1000103815 206
203 3300005435 Ga0070714_100695684 Ga0070714_1006956842 206
204 3300005435 Ga0070714_101315730 Ga0070714_1013157301 206
205 3300005437 Ga0070710_10473430 Ga0070710_104734301 206
206 3300005438 Ga0070701_10036828 Ga0070701_100368282 206
207 3300005438 Ga0070701_10145421 Ga0070701_101454212 206
208 3300005439 Ga0070711_100000466 Ga0070711_10000046610 206
209 3300005439 Ga0070711_100023504 Ga0070711_1000235043 206
210 3300005439 Ga0070711_100848300 Ga0070711_1008483001 206
211 3300005440 Ga0070705_100006728 Ga0070705_1000067285 206
212 3300005440 Ga0070705_100017903 Ga0070705_1000179031 206
213 3300005440 Ga0070705_100026351 Ga0070705_1000263513 206
214 3300005440 Ga0070705_100043456 Ga0070705_1000434562 206
215 3300005440 Ga0070705_100062806 Ga0070705_1000628063 206
216 3300005440 Ga0070705_100126097 Ga0070705_1001260972 206
217 3300005440 Ga0070705_100127156 Ga0070705_1001271562 206
218 3300005440 Ga0070705_100135142 Ga0070705_1001351422 206
219 3300005440 Ga0070705_100334102 Ga0070705_1003341022 206
220 3300005441 Ga0070700_100348856 Ga0070700_1003488561 206
221 3300005444 Ga0070694_100003097 Ga0070694_10000309710 206
222 3300005444 Ga0070694_100056858 Ga0070694_1000568583 206
223 3300005444 Ga0070694_100057125 Ga0070694_1000571252 206
224 3300005444 Ga0070694_100096665 Ga0070694_1000966652 206
225 3300005444 Ga0070694_100274155 Ga0070694_1002741551 206
226 3300005444 Ga0070694_100440633 Ga0070694_1004406332 206
227 3300005444 Ga0070694_100550095 Ga0070694_1005500952 206
228 3300005445 Ga0070708_100001912 Ga0070708_10000191212 206
229 3300005445 Ga0070708_100006646 Ga0070708_1000066469 206
230 3300005445 Ga0070708_100010515 Ga0070708_1000105153 206
231 3300005445 Ga0070708_100036977 Ga0070708_1000369773 206
232 3300005445 Ga0070708_100084138 Ga0070708_1000841382 206
233 3300005445 Ga0070708_100128852 Ga0070708_1001288522 206
234 3300005445 Ga0070708_100248140 Ga0070708_1002481402 206
235 3300005445 Ga0070708_100592787 Ga0070708_1005927872 206
236 3300005445 Ga0070708_100669044 Ga0070708_1006690441 206
237 3300005445 Ga0070708_100922511 Ga0070708_1009225111 206
238 3300005445 Ga0070708_100934980 Ga0070708_1009349801 206
239 3300005457 Ga0070662_100000129 Ga0070662_10000012915 206
240 3300005457 Ga0070662_100008788 Ga0070662_1000087887 206
241 3300005457 Ga0070662_100065735 Ga0070662_1000657353 206
242 3300005457 Ga0070662_100182492 Ga0070662_1001824922 206
243 3300005457 Ga0070662_100594760 Ga0070662_1005947602 206
244 3300005458 Ga0070681_10000404 Ga0070681_1000040432 206
245 3300005458 Ga0070681_10008932 Ga0070681_100089324 206
246 3300005458 Ga0070681_10034221 Ga0070681_100342212 206
247 3300005458 Ga0070681_10034328 Ga0070681_100343283 206
248 3300005458 Ga0070681_10066860 Ga0070681_100668603 206
249 3300005458 Ga0070681_10441395 Ga0070681_104413952 206
250 3300005459 Ga0068867_100124515 Ga0068867_1001245151 206
251 3300005459 Ga0068867_100148924 Ga0068867_1001489243 206
252 3300005459 Ga0068867_100565452 Ga0068867_1005654521 206
253 3300005466 Ga0070685_10005049 Ga0070685_100050497 206
254 3300005466 Ga0070685_10202810 Ga0070685_102028102 206
255 3300005466 Ga0070685_10371405 Ga0070685_103714051 206
256 3300005467 Ga0070706_100002003 Ga0070706_10000200322 206
257 3300005467 Ga0070706_100007900 Ga0070706_1000079009 206
258 3300005467 Ga0070706_100011664 Ga0070706_1000116649 206
259 3300005467 Ga0070706_100124841 Ga0070706_1001248412 206
260 3300005467 Ga0070706_100217196 Ga0070706_1002171962 206
261 3300005467 Ga0070706_100373973 Ga0070706_1003739731 206
262 3300005468 Ga0070707_100001277 Ga0070707_10000127719 206
263 3300005468 Ga0070707_100038114 Ga0070707_1000381142 206
264 3300005468 Ga0070707_100046622 Ga0070707_1000466223 206
265 3300005468 Ga0070707_100048969 Ga0070707_1000489693 206
266 3300005468 Ga0070707_100058383 Ga0070707_1000583833 206
267 3300005468 Ga0070707_100075107 Ga0070707_1000751072 206
268 3300005468 Ga0070707_100085921 Ga0070707_1000859212 206
269 3300005468 Ga0070707_100102325 Ga0070707_1001023253 206
270 3300005468 Ga0070707_100170879 Ga0070707_1001708792 206
271 3300005468 Ga0070707_100244924 Ga0070707_1002449241 206
272 3300005468 Ga0070707_100499887 Ga0070707_1004998872 206
273 3300005468 Ga0070707_100533355 Ga0070707_1005333552 206
274 3300005468 Ga0070707_100669126 Ga0070707_1006691261 206
275 3300005471 Ga0070698_100000416 Ga0070698_10000041618 206
276 3300005471 Ga0070698_100090622 Ga0070698_1000906223 206
277 3300005471 Ga0070698_100100245 Ga0070698_1001002452 206
278 3300005471 Ga0070698_100100765 Ga0070698_1001007652 206
279 3300005471 Ga0070698_100123841 Ga0070698_1001238413 206
280 3300005471 Ga0070698_100128532 Ga0070698_1001285322 206
281 3300005471 Ga0070698_100528810 Ga0070698_1005288102 206
282 3300005518 Ga0070699_100003038 Ga0070699_10000303815 206
283 3300005518 Ga0070699_100009267 Ga0070699_1000092677 206
284 3300005518 Ga0070699_100010664 Ga0070699_1000106649 206
285 3300005518 Ga0070699_100013305 Ga0070699_1000133057 206
286 3300005518 Ga0070699_100014085 Ga0070699_1000140854 206
287 3300005518 Ga0070699_100017344 Ga0070699_1000173443 206
288 3300005518 Ga0070699_100018436 Ga0070699_1000184364 206
289 3300005518 Ga0070699_100079657 Ga0070699_1000796572 206
290 3300005518 Ga0070699_100179100 Ga0070699_1001791002 206
291 3300005530 Ga0070679_100033038 Ga0070679_1000330381 206
292 3300005530 Ga0070679_100066262 Ga0070679_1000662621 206
293 3300005530 Ga0070679_100067534 Ga0070679_1000675343 206
294 3300005530 Ga0070679_100214351 Ga0070679_1002143511 206
295 3300005530 Ga0070679_100423381 Ga0070679_1004233811 206
296 3300005535 Ga0070684_100035266 Ga0070684_1000352664 206
297 3300005535 Ga0070684_100154609 Ga0070684_1001546092 206
298 3300005535 Ga0070684_100879141 Ga0070684_1008791412 206
299 3300005536 Ga0070697_100026418 Ga0070697_1000264183 206
300 3300005536 Ga0070697_100030232 Ga0070697_1000302321 206
301 3300005536 Ga0070697_100035632 Ga0070697_1000356322 206
302 3300005536 Ga0070697_100129065 Ga0070697_1001290652 206
303 3300005536 Ga0070697_100130880 Ga0070697_1001308802 206
304 3300005536 Ga0070697_100207453 Ga0070697_1002074532 206
305 3300005536 Ga0070697_100245902 Ga0070697_1002459021 206
306 3300005536 Ga0070697_100597370 Ga0070697_1005973702 206
307 3300005539 Ga0068853_100035310 Ga0068853_1000353102 206
308 3300005539 Ga0068853_100041839 Ga0068853_1000418392 206
309 3300005539 Ga0068853_100878130 Ga0068853_1008781301 206
310 3300005543 Ga0070672_100004984 Ga0070672_1000049846 206
311 3300005543 Ga0070672_100007479 Ga0070672_1000074792 206
312 3300005543 Ga0070672_100276024 Ga0070672_1002760241 206
313 3300005544 Ga0070686_100000009 Ga0070686_100000009168 206
314 3300005545 Ga0070695_100030673 Ga0070695_1000306733 206
315 3300005545 Ga0070695_100054884 Ga0070695_1000548842 206
316 3300005545 Ga0070695_100062812 Ga0070695_1000628122 206
317 3300005546 Ga0070696_100001111 Ga0070696_1000011116 206
318 3300005546 Ga0070696_100001375 Ga0070696_10000137512 206
319 3300005546 Ga0070696_100013879 Ga0070696_1000138796 206
320 3300005546 Ga0070696_100018452 Ga0070696_1000184526 206
321 3300005546 Ga0070696_100029352 Ga0070696_1000293523 206
322 3300005546 Ga0070696_100043304 Ga0070696_1000433043 206
323 3300005546 Ga0070696_100236896 Ga0070696_1002368962 206
324 3300005546 Ga0070696_100313931 Ga0070696_1003139312 206
325 3300005546 Ga0070696_100377528 Ga0070696_1003775281 206
326 3300005546 Ga0070696_100797357 Ga0070696_1007973571 206
327 3300005548 Ga0070665_100038936 Ga0070665_1000389362 206
328 3300005548 Ga0070665_100222772 Ga0070665_1002227722 206
329 3300005549 Ga0070704_100000588 Ga0070704_10000058816 206
330 3300005549 Ga0070704_100007259 Ga0070704_1000072598 206
331 3300005549 Ga0070704_100013024 Ga0070704_1000130242 206
332 3300005549 Ga0070704_100045565 Ga0070704_1000455652 206
333 3300005549 Ga0070704_100063131 Ga0070704_1000631312 206
334 3300005549 Ga0070704_100098504 Ga0070704_1000985042 206
335 3300005549 Ga0070704_100597461 Ga0070704_1005974612 206
336 3300005563 Ga0068855_100002169 Ga0068855_10000216926 206
337 3300005563 Ga0068855_100008571 Ga0068855_1000085713 206
338 3300005563 Ga0068855_100431684 Ga0068855_1004316842 206
339 3300005564 Ga0070664_100013154 Ga0070664_1000131546 206
340 3300005564 Ga0070664_100055026 Ga0070664_1000550262 206
341 3300005564 Ga0070664_100178129 Ga0070664_1001781292 206
342 3300005564 Ga0070664_100655957 Ga0070664_1006559571 206
343 3300005577 Ga0068857_100012151 Ga0068857_1000121516 206
344 3300005577 Ga0068857_100015739 Ga0068857_1000157394 206
345 3300005577 Ga0068857_100038294 Ga0068857_1000382944 206
346 3300005578 Ga0068854_100022362 Ga0068854_1000223624 206
347 3300005578 Ga0068854_100033175 Ga0068854_1000331753 206
348 3300005578 Ga0068854_100252585 Ga0068854_1002525852 206
349 3300005615 Ga0070702_100472602 Ga0070702_1004726022 206
350 3300005616 Ga0068852_100014974 Ga0068852_1000149746 206
351 3300005616 Ga0068852_100341916 Ga0068852_1003419162 206
352 3300005616 Ga0068852_100532599 Ga0068852_1005325992 206
353 3300005617 Ga0068859_100024587 Ga0068859_1000245875 206
354 3300005617 Ga0068859_100041401 Ga0068859_1000414012 206
355 3300005617 Ga0068859_100084308 Ga0068859_1000843083 206
356 3300005617 Ga0068859_100092148 Ga0068859_1000921482 206
357 3300005617 Ga0068859_100123908 Ga0068859_1001239083 206
358 3300005617 Ga0068859_100207078 Ga0068859_1002070781 206
359 3300005618 Ga0068864_100005386 Ga0068864_1000053864 206
360 3300005618 Ga0068864_100028566 Ga0068864_1000285662 206
361 3300005618 Ga0068864_100160067 Ga0068864_1001600672 206
362 3300005618 Ga0068864_100312225 Ga0068864_1003122252 206
363 3300005718 Ga0068866_10261636 Ga0068866_102616362 206
364 3300005719 Ga0068861_100001019 Ga0068861_1000010197 206
365 3300005719 Ga0068861_100029592 Ga0068861_1000295921 206
366 3300005719 Ga0068861_100120743 Ga0068861_1001207433 206
367 3300005834 Ga0068851_10019723 Ga0068851_100197233 206
368 3300005834 Ga0068851_10152903 Ga0068851_101529032 206
369 3300005840 Ga0068870_10034892 Ga0068870_100348922 206
370 3300005841 Ga0068863_100197091 Ga0068863_1001970912 206
371 3300005842 Ga0068858_100022826 Ga0068858_1000228266 206
372 3300005842 Ga0068858_100606486 Ga0068858_1006064861 206
373 3300005843 Ga0068860_100051734 Ga0068860_1000517342 206
374 3300005844 Ga0068862_100000376 Ga0068862_10000037615 206
375 3300005844 Ga0068862_100324123 Ga0068862_1003241232 206
376 3300005844 Ga0068862_100334963 Ga0068862_1003349632 206
377 3300005844 Ga0068862_100567900 Ga0068862_1005679001 206
378 3300005844 Ga0068862_100982150 Ga0068862_1009821501 206
379 3300005937 Ga0081455_10062368 Ga0081455_100623685 206
380 3300006173 Ga0070716_100000833 Ga0070716_1000008332 206
381 3300006173 Ga0070716_100021974 Ga0070716_1000219742 206
382 3300006237 Ga0097621_100193378 Ga0097621_1001933783 206
383 3300006237 Ga0097621_100407040 Ga0097621_1004070402 206
384 3300006358 Ga0068871_100129749 Ga0068871_1001297492 206
385 3300006844 Ga0075428_100012227 Ga0075428_1000122273 206
386 3300006844 Ga0075428_100039690 Ga0075428_1000396906 206
387 3300006844 Ga0075428_100072344 Ga0075428_1000723445 206
388 3300006844 Ga0075428_100223245 Ga0075428_1002232451 206
389 3300006844 Ga0075428_100365366 Ga0075428_1003653662 206
390 3300006844 Ga0075428_100764461 Ga0075428_1007644612 206
391 3300006844 Ga0075428_100951921 Ga0075428_1009519212 206
392 3300006846 Ga0075430_100001512 Ga0075430_10000151218 206
393 3300006846 Ga0075430_100076112 Ga0075430_1000761121 206
394 3300006846 Ga0075430_100082279 Ga0075430_1000822793 206
395 3300006846 Ga0075430_100542015 Ga0075430_1005420152 206
396 3300006846 Ga0075430_100668780 Ga0075430_1006687801 206
397 3300006847 Ga0075431_100018358 Ga0075431_1000183585 206
398 3300006847 Ga0075431_100026846 Ga0075431_1000268462 206
399 3300006847 Ga0075431_100033603 Ga0075431_1000336036 206
400 3300006847 Ga0075431_100063746 Ga0075431_1000637464 206
401 3300006847 Ga0075431_100147443 Ga0075431_1001474433 206
402 3300006847 Ga0075431_100158257 Ga0075431_1001582572 206
403 3300006852 Ga0075433_10000946 Ga0075433_100009466 206
404 3300006852 Ga0075433_10005348 Ga0075433_100053484 206
405 3300006852 Ga0075433_10321274 Ga0075433_103212741 206
406 3300006852 Ga0075433_10440267 Ga0075433_104402671 206
407 3300006852 Ga0075433_10639739 Ga0075433_106397391 206
408 3300006871 Ga0075434_100001804 Ga0075434_10000180417 206
409 3300006871 Ga0075434_100019680 Ga0075434_1000196809 206
410 3300006871 Ga0075434_100024095 Ga0075434_1000240954 206
411 3300006871 Ga0075434_100068612 Ga0075434_1000686122 206
412 3300006871 Ga0075434_100069113 Ga0075434_1000691133 206
413 3300006871 Ga0075434_100171720 Ga0075434_1001717202 206
414 3300006871 Ga0075434_100238699 Ga0075434_1002386992 206
415 3300006871 Ga0075434_100336748 Ga0075434_1003367482 206
416 3300006871 Ga0075434_100679966 Ga0075434_1006799662 206
417 3300006871 Ga0075434_100925217 Ga0075434_1009252172 206
418 3300006880 Ga0075429_100000283 Ga0075429_10000028319 206
419 3300006880 Ga0075429_100047346 Ga0075429_1000473464 206
420 3300006880 Ga0075429_100086698 Ga0075429_1000866983 206
421 3300006880 Ga0075429_100336505 Ga0075429_1003365052 206
422 3300006880 Ga0075429_100428266 Ga0075429_1004282662 206
423 3300006880 Ga0075429_101039616 Ga0075429_1010396161 206
424 3300006881 Ga0068865_100001514 Ga0068865_1000015144 206
425 3300006914 Ga0075436_100000724 Ga0075436_10000072422 206
426 3300006914 Ga0075436_100017487 Ga0075436_1000174873 206
427 3300006914 Ga0075436_100020245 Ga0075436_1000202456 206
428 3300006914 Ga0075436_100051691 Ga0075436_1000516913 206
429 3300006914 Ga0075436_100063252 Ga0075436_1000632522 206
430 3300006914 Ga0075436_100111267 Ga0075436_1001112673 206
431 3300006914 Ga0075436_100285399 Ga0075436_1002853992 206
432 3300006914 Ga0075436_100310931 Ga0075436_1003109312 206
433 3300006931 Ga0097620_100024587 Ga0097620_1000245874 206
434 3300006931 Ga0097620_100041401 Ga0097620_1000414012 206
435 3300006931 Ga0097620_100084305 Ga0097620_1000843052 206
436 3300006931 Ga0097620_100092145 Ga0097620_1000921453 206
437 3300006931 Ga0097620_100123906 Ga0097620_1001239063 206
438 3300006931 Ga0097620_100207071 Ga0097620_1002070711 206
439 3300007076 Ga0075435_100029043 Ga0075435_1000290437 206
440 3300007076 Ga0075435_100079712 Ga0075435_1000797123 206
441 3300007076 Ga0075435_100107146 Ga0075435_1001071462 206
442 3300007076 Ga0075435_100272455 Ga0075435_1002724551 206
443 3300007076 Ga0075435_100283173 Ga0075435_1002831732 206
444 3300007076 Ga0075435_100326916 Ga0075435_1003269161 206
445 3300007076 Ga0075435_100477580 Ga0075435_1004775802 206
446 3300007076 Ga0075435_100586612 Ga0075435_1005866122 206
447 3300007788 Ga0099795_10074192 Ga0099795_100741922 206
448 3300009093 Ga0105240_10073620 Ga0105240_100736203 206
449 3300009093 Ga0105240_10247240 Ga0105240_102472402 206
450 3300009093 Ga0105240_10634142 Ga0105240_106341422 206
451 3300009094 Ga0111539_10040798 Ga0111539_100407984 206
452 3300009094 Ga0111539_10042342 Ga0111539_100423421 206
453 3300009094 Ga0111539_10458637 Ga0111539_104586372 206
454 3300009094 Ga0111539_10796253 Ga0111539_107962532 206
455 3300009098 Ga0105245_11322516 Ga0105245_113225161 206
456 3300009147 Ga0114129_10000918 Ga0114129_1000091826 206
457 3300009147 Ga0114129_10063870 Ga0114129_100638704 206
458 3300009147 Ga0114129_10172875 Ga0114129_101728752 206
459 3300009147 Ga0114129_10234795 Ga0114129_102347953 206
460 3300009147 Ga0114129_10314094 Ga0114129_103140943 206
461 3300009147 Ga0114129_10936551 Ga0114129_109365512 206
462 3300009147 Ga0114129_11171065 Ga0114129_111710652 206
463 3300009147 Ga0114129_11224902 Ga0114129_112249021 206
464 3300009147 Ga0114129_11792669 Ga0114129_117926692 206
465 3300009176 Ga0105242_11075700 Ga0105242_110757001 206
466 3300009177 Ga0105248_10009365 Ga0105248_1000936510 206
467 3300009177 Ga0105248_10025929 Ga0105248_100259294 206
468 3300009177 Ga0105248_10130172 Ga0105248_101301721 206
469 3300009177 Ga0105248_10224601 Ga0105248_102246012 206
470 3300009177 Ga0105248_10243631 Ga0105248_102436312 206
471 3300009177 Ga0105248_10289252 Ga0105248_102892522 206
472 3300009177 Ga0105248_10479142 Ga0105248_104791422 206
473 3300009177 Ga0105248_11548738 Ga0105248_115487381 206
474 3300009551 Ga0105238_10000082 Ga0105238_1000008279 206
475 3300009553 Ga0105249_10000115 Ga0105249_100001155 206
476 3300009553 Ga0105249_10000454 Ga0105249_1000045425 206
477 3300009553 Ga0105249_10020862 Ga0105249_100208623 206
478 3300009553 Ga0105249_10108483 Ga0105249_101084833 206
479 3300009553 Ga0105249_11413995 Ga0105249_114139951 206
480 3300009553 Ga0105249_11636261 Ga0105249_116362611 206
481 3300010375 Ga0105239_10033512 Ga0105239_100335126 206
482 3300011119 Ga0105246_10517035 Ga0105246_105170352 206
483 3300013100 Ga0157373_10001473 Ga0157373_1000147317 206
484 3300013100 Ga0157373_10266861 Ga0157373_102668612 206
485 3300013102 Ga0157371_10007275 Ga0157371_100072756 206
486 3300013104 Ga0157370_10120885 Ga0157370_101208852 206
487 3300013104 Ga0157370_10459742 Ga0157370_104597421 206
488 3300013105 Ga0157369_10083371 Ga0157369_100833714 206
489 3300013105 Ga0157369_10107160 Ga0157369_101071603 206
490 3300013105 Ga0157369_10241902 Ga0157369_102419022 206
491 3300013105 Ga0157369_10302334 Ga0157369_103023342 206
492 3300013296 Ga0157374_10235614 Ga0157374_102356141 206
493 3300013297 Ga0157378_10709408 Ga0157378_107094082 206
494 3300013306 Ga0163162_10001492 Ga0163162_1000149218 206
495 3300013306 Ga0163162_10009352 Ga0163162_100093524 206
496 3300013306 Ga0163162_10013828 Ga0163162_100138286 206
497 3300013307 Ga0157372_10015470 Ga0157372_100154704 206
498 3300013307 Ga0157372_10126831 Ga0157372_101268311 206
499 3300013308 Ga0157375_10025086 Ga0157375_100250867 206
500 3300013308 Ga0157375_10149733 Ga0157375_101497332 206
501 3300013308 Ga0157375_10326904 Ga0157375_103269042 206
502 3300013308 Ga0157375_10696491 Ga0157375_106964912 206
503 3300013308 Ga0157375_11193294 Ga0157375_111932941 206
504 3300014325 Ga0163163_10068100 Ga0163163_100681003 206
505 3300014326 Ga0157380_10007646 Ga0157380_100076463 206
506 3300014326 Ga0157380_10027037 Ga0157380_100270376 206
507 3300014326 Ga0157380_10615788 Ga0157380_106157882 206
508 3300014497 Ga0182008_10009299 Ga0182008_100092997 206
509 3300014745 Ga0157377_10005403 Ga0157377_100054036 206
510 3300014969 Ga0157376_10050743 Ga0157376_100507433 206
511 3300014969 Ga0157376_10401354 Ga0157376_104013542 206
512 3300017792 Ga0163161_10033434 Ga0163161_100334343 206
513 3300017792 Ga0163161_10339454 Ga0163161_103394542 206
514 3300021388 Ga0213875_10016088 Ga0213875_100160883 206
515 3300025315 Ga0207697_10013577 Ga0207697_100135772 206
516 3300025321 Ga0207656_10020155 Ga0207656_100201552 206
517 3300025885 Ga0207653_10000333 Ga0207653_1000033319 206
518 3300025885 Ga0207653_10004243 Ga0207653_100042433 206
519 3300025885 Ga0207653_10009549 Ga0207653_100095491 206
520 3300025885 Ga0207653_10027001 Ga0207653_100270012 206
521 3300025903 Ga0207680_10584370 Ga0207680_105843702 206
522 3300025905 Ga0207685_10410385 Ga0207685_104103851 206
523 3300025906 Ga0207699_10003303 Ga0207699_100033034 206
524 3300025906 Ga0207699_10004172 Ga0207699_100041724 206
525 3300025907 Ga0207645_10000246 Ga0207645_1000024625 206
526 3300025908 Ga0207643_10049854 Ga0207643_100498542 206
527 3300025910 Ga0207684_10025853 Ga0207684_100258537 206
528 3300025910 Ga0207684_10049207 Ga0207684_100492073 206
529 3300025910 Ga0207684_10052400 Ga0207684_100524002 206
530 3300025910 Ga0207684_10056409 Ga0207684_100564092 206
531 3300025910 Ga0207684_10289501 Ga0207684_102895012 206
532 3300025910 Ga0207684_10469940 Ga0207684_104699402 206
533 3300025912 Ga0207707_10000929 Ga0207707_1000092912 206
534 3300025912 Ga0207707_10004279 Ga0207707_1000427912 206
535 3300025912 Ga0207707_10012211 Ga0207707_100122113 206
536 3300025912 Ga0207707_10018172 Ga0207707_100181725 206
537 3300025912 Ga0207707_10355257 Ga0207707_103552572 206
538 3300025913 Ga0207695_10001441 Ga0207695_1000144119 206
539 3300025913 Ga0207695_10020766 Ga0207695_100207666 206
540 3300025915 Ga0207693_10054679 Ga0207693_100546793 206
541 3300025916 Ga0207663_10000556 Ga0207663_1000055610 206
542 3300025916 Ga0207663_10152376 Ga0207663_101523762 206
543 3300025916 Ga0207663_10425943 Ga0207663_104259431 206
544 3300025917 Ga0207660_10001809 Ga0207660_100018095 206
545 3300025917 Ga0207660_10013503 Ga0207660_100135033 206
546 3300025917 Ga0207660_10061487 Ga0207660_100614873 206
547 3300025917 Ga0207660_10066366 Ga0207660_100663663 206
548 3300025917 Ga0207660_10131532 Ga0207660_101315322 206
549 3300025917 Ga0207660_10430414 Ga0207660_104304142 206
550 3300025918 Ga0207662_10003079 Ga0207662_100030795 206
551 3300025918 Ga0207662_10039369 Ga0207662_100393692 206
552 3300025918 Ga0207662_10356264 Ga0207662_103562642 206
553 3300025919 Ga0207657_10021232 Ga0207657_100212326 206
554 3300025919 Ga0207657_10069828 Ga0207657_100698283 206
555 3300025920 Ga0207649_10025399 Ga0207649_100253991 206
556 3300025920 Ga0207649_10082210 Ga0207649_100822103 206
557 3300025920 Ga0207649_10203801 Ga0207649_102038012 206
558 3300025920 Ga0207649_10482632 Ga0207649_104826321 206
559 3300025920 Ga0207649_10664380 Ga0207649_106643801 206
560 3300025920 Ga0207649_10845717 Ga0207649_108457171 206
561 3300025921 Ga0207652_10000470 Ga0207652_1000047024 206
562 3300025921 Ga0207652_10008367 Ga0207652_100083678 206
563 3300025921 Ga0207652_10253236 Ga0207652_102532362 206
564 3300025921 Ga0207652_10625068 Ga0207652_106250682 206
565 3300025921 Ga0207652_10708038 Ga0207652_107080382 206
566 3300025921 Ga0207652_11017790 Ga0207652_110177901 206
567 3300025922 Ga0207646_10003762 Ga0207646_100037626 206
568 3300025922 Ga0207646_10013412 Ga0207646_100134129 206
569 3300025922 Ga0207646_10021064 Ga0207646_100210648 206
570 3300025922 Ga0207646_10040328 Ga0207646_100403282 206
571 3300025922 Ga0207646_10076152 Ga0207646_100761522 206
572 3300025922 Ga0207646_10082816 Ga0207646_100828163 206
573 3300025922 Ga0207646_10090878 Ga0207646_100908783 206
574 3300025922 Ga0207646_10153252 Ga0207646_101532522 206
575 3300025922 Ga0207646_10329127 Ga0207646_103291272 206
576 3300025922 Ga0207646_10490266 Ga0207646_104902662 206
577 3300025923 Ga0207681_10002554 Ga0207681_100025541 206
578 3300025923 Ga0207681_10009785 Ga0207681_100097853 206
579 3300025924 Ga0207694_10000031 Ga0207694_10000031160 206
580 3300025925 Ga0207650_10004487 Ga0207650_100044878 206
581 3300025926 Ga0207659_10024660 Ga0207659_100246603 206
582 3300025926 Ga0207659_10158062 Ga0207659_101580621 206
583 3300025926 Ga0207659_10365751 Ga0207659_103657512 206
584 3300025928 Ga0207700_10493556 Ga0207700_104935561 206
585 3300025929 Ga0207664_10039793 Ga0207664_100397935 206
586 3300025929 Ga0207664_10485805 Ga0207664_104858052 206
587 3300025931 Ga0207644_10006147 Ga0207644_100061473 206
588 3300025932 Ga0207690_10092018 Ga0207690_100920182 206
589 3300025933 Ga0207706_10000240 Ga0207706_1000024029 206
590 3300025933 Ga0207706_10000357 Ga0207706_1000035725 206
591 3300025933 Ga0207706_10091758 Ga0207706_100917583 206
592 3300025933 Ga0207706_10107710 Ga0207706_101077102 206
593 3300025933 Ga0207706_10254057 Ga0207706_102540572 206
594 3300025934 Ga0207686_10038002 Ga0207686_100380022 206
595 3300025935 Ga0207709_10656970 Ga0207709_106569702 206
596 3300025937 Ga0207669_10013476 Ga0207669_100134763 206
597 3300025938 Ga0207704_10024309 Ga0207704_100243092 206
598 3300025938 Ga0207704_10701737 Ga0207704_107017371 206
599 3300025939 Ga0207665_10001273 Ga0207665_1000127319 206
600 3300025939 Ga0207665_10144401 Ga0207665_101444012 206
601 3300025940 Ga0207691_10022438 Ga0207691_100224382 206
602 3300025940 Ga0207691_10042373 Ga0207691_100423736 206
603 3300025940 Ga0207691_10069335 Ga0207691_100693352 206
604 3300025940 Ga0207691_10310100 Ga0207691_103101002 206
605 3300025940 Ga0207691_10717182 Ga0207691_107171822 206
606 3300025941 Ga0207711_10453324 Ga0207711_104533242 206
607 3300025941 Ga0207711_10477947 Ga0207711_104779472 206
608 3300025941 Ga0207711_10486027 Ga0207711_104860271 206
609 3300025942 Ga0207689_10027696 Ga0207689_100276964 206
610 3300025944 Ga0207661_10001946 Ga0207661_100019463 206
611 3300025944 Ga0207661_10011833 Ga0207661_100118336 206
612 3300025944 Ga0207661_10076562 Ga0207661_100765623 206
613 3300025944 Ga0207661_10619641 Ga0207661_106196411 206
614 3300025945 Ga0207679_10000484 Ga0207679_1000048411 206
615 3300025945 Ga0207679_10006509 Ga0207679_100065098 206
616 3300025945 Ga0207679_10009273 Ga0207679_100092738 206
617 3300025945 Ga0207679_10119853 Ga0207679_101198532 206
618 3300025949 Ga0207667_10011137 Ga0207667_100111378 206
619 3300025949 Ga0207667_10229710 Ga0207667_102297101 206
620 3300025949 Ga0207667_10398274 Ga0207667_103982742 206
621 3300025961 Ga0207712_10000499 Ga0207712_1000049921 206
622 3300025961 Ga0207712_10001176 Ga0207712_100011767 206
623 3300025961 Ga0207712_10013123 Ga0207712_100131233 206
624 3300025961 Ga0207712_10195094 Ga0207712_101950941 206
625 3300025961 Ga0207712_11069500 Ga0207712_110695001 206
626 3300025972 Ga0207668_10003474 Ga0207668_100034748 206
627 3300025972 Ga0207668_10103366 Ga0207668_101033662 206
628 3300025972 Ga0207668_10181836 Ga0207668_101818362 206
629 3300025972 Ga0207668_10278097 Ga0207668_102780972 206
630 3300025981 Ga0207640_10001456 Ga0207640_1000145612 206
631 3300025981 Ga0207640_10097863 Ga0207640_100978633 206
632 3300025981 Ga0207640_10287036 Ga0207640_102870362 206
633 3300025986 Ga0207658_10069022 Ga0207658_100690223 206
634 3300026023 Ga0207677_10090705 Ga0207677_100907051 206
635 3300026035 Ga0207703_10013898 Ga0207703_100138986 206
636 3300026041 Ga0207639_10004358 Ga0207639_100043587 206
637 3300026041 Ga0207639_10081332 Ga0207639_100813323 206
638 3300026041 Ga0207639_10719660 Ga0207639_107196602 206
639 3300026067 Ga0207678_10418043 Ga0207678_104180431 206
640 3300026075 Ga0207708_10048583 Ga0207708_100485833 206
641 3300026075 Ga0207708_10718818 Ga0207708_107188181 206
642 3300026078 Ga0207702_10493602 Ga0207702_104936021 206
643 3300026088 Ga0207641_10027354 Ga0207641_100273546 206
644 3300026088 Ga0207641_10053544 Ga0207641_100535441 206
645 3300026089 Ga0207648_10005220 Ga0207648_100052208 206
646 3300026089 Ga0207648_10032931 Ga0207648_100329314 206
647 3300026089 Ga0207648_10081119 Ga0207648_100811193 206
648 3300026089 Ga0207648_10405160 Ga0207648_104051601 206
649 3300026095 Ga0207676_10085386 Ga0207676_100853862 206
650 3300026095 Ga0207676_10094646 Ga0207676_100946462 206
651 3300026095 Ga0207676_10131582 Ga0207676_101315822 206
652 3300026116 Ga0207674_10003135 Ga0207674_1000313519 206
653 3300026116 Ga0207674_10015526 Ga0207674_100155264 206
654 3300026116 Ga0207674_10018565 Ga0207674_100185654 206
655 3300026116 Ga0207674_10471392 Ga0207674_104713921 206
656 3300026118 Ga0207675_100000320 Ga0207675_10000032021 206
657 3300026118 Ga0207675_100052078 Ga0207675_1000520783 206
658 3300026118 Ga0207675_100053417 Ga0207675_1000534172 206
659 3300026118 Ga0207675_101194559 Ga0207675_1011945591 206
660 3300026121 Ga0207683_10034731 Ga0207683_100347312 206
661 3300026142 Ga0207698_10013973 Ga0207698_100139732 206
662 3300026142 Ga0207698_10165264 Ga0207698_101652642 206
663 3300026142 Ga0207698_10597062 Ga0207698_105970622 206
664 3300027717 Ga0209998_10021291 Ga0209998_100212912 206
665 3300027876 Ga0209974_10032789 Ga0209974_100327892 206
666 3300027876 Ga0209974_10035554 Ga0209974_100355541 206
667 3300027876 Ga0209974_10053204 Ga0209974_100532042 206
668 3300027907 Ga0207428_10070482 Ga0207428_100704821 206
669 3300027907 Ga0207428_10279829 Ga0207428_102798291 206
670 3300027907 Ga0207428_10344024 Ga0207428_103440242 206
671 3300028379 Ga0268266_10297444 Ga0268266_102974442 206
672 3300028379 Ga0268266_10345674 Ga0268266_103456742 206
673 3300028379 Ga0268266_10606989 Ga0268266_106069892 206
674 3300028380 Ga0268265_10002121 Ga0268265_100021213 206
675 3300028380 Ga0268265_10385158 Ga0268265_103851582 206
676 3300028380 Ga0268265_10904024 Ga0268265_109040241 206
677 3300028381 Ga0268264_10056897 Ga0268264_100568973 206
678 3300030745 Ga0316182_1400452 Ga0316182_14004522 206
679 3300031548 Ga0307408_100023852 Ga0307408_1000238522 206
680 3300031548 Ga0307408_100033838 Ga0307408_1000338382 206
681 3300031548 Ga0307408_100252115 Ga0307408_1002521152 206
682 3300031548 Ga0307408_100961497 Ga0307408_1009614971 206
683 3300031824 Ga0307413_10019867 Ga0307413_100198673 206
684 3300031824 Ga0307413_10034699 Ga0307413_100346991 206
685 3300031824 Ga0307413_10064281 Ga0307413_100642813 206
686 3300031824 Ga0307413_10138214 Ga0307413_101382142 206
687 3300031824 Ga0307413_10342712 Ga0307413_103427122 206
688 3300031852 Ga0307410_10002152 Ga0307410_1000215210 206
689 3300031852 Ga0307410_10034713 Ga0307410_100347133 206
690 3300031852 Ga0307410_10066181 Ga0307410_100661812 206
691 3300031852 Ga0307410_10085329 Ga0307410_100853293 206
692 3300031852 Ga0307410_10111755 Ga0307410_101117552 206
693 3300031852 Ga0307410_10159460 Ga0307410_101594601 206
694 3300031852 Ga0307410_10260503 Ga0307410_102605032 206
695 3300031852 Ga0307410_10397990 Ga0307410_103979902 206
696 3300031852 Ga0307410_10406662 Ga0307410_104066623 206
697 3300031901 Ga0307406_10001688 Ga0307406_100016888 206
698 3300031901 Ga0307406_10002595 Ga0307406_100025954 206
699 3300031901 Ga0307406_10212389 Ga0307406_102123892 206
700 3300031901 Ga0307406_10396758 Ga0307406_103967581 206
701 3300031901 Ga0307406_10731548 Ga0307406_107315481 206
702 3300031903 Ga0307407_10046330 Ga0307407_100463302 206
703 3300031903 Ga0307407_10082309 Ga0307407_100823092 206
704 3300031903 Ga0307407_10084847 Ga0307407_100848472 206
705 3300031903 Ga0307407_10229529 Ga0307407_102295291 206
706 3300031911 Ga0307412_10026367 Ga0307412_100263673 206
707 3300031911 Ga0307412_10179634 Ga0307412_101796342 206
708 3300031911 Ga0307412_10472627 Ga0307412_104726272 206
709 3300031995 Ga0307409_100000144 Ga0307409_10000014410 206
710 3300031995 Ga0307409_100092871 Ga0307409_1000928713 206
711 3300031995 Ga0307409_100130147 Ga0307409_1001301472 206
712 3300031995 Ga0307409_100189263 Ga0307409_1001892632 206
713 3300031995 Ga0307409_100460620 Ga0307409_1004606201 206
714 3300031995 Ga0307409_100482112 Ga0307409_1004821122 206
715 3300031995 Ga0307409_100602088 Ga0307409_1006020881 206
716 3300031995 Ga0307409_100673242 Ga0307409_1006732422 206
717 3300031995 Ga0307409_101365291 Ga0307409_1013652911 206
718 3300032002 Ga0307416_100000828 Ga0307416_1000008288 206
719 3300032002 Ga0307416_100012718 Ga0307416_1000127182 206
720 3300032002 Ga0307416_100014248 Ga0307416_1000142487 206
721 3300032002 Ga0307416_100098157 Ga0307416_1000981573 206
722 3300032002 Ga0307416_100101715 Ga0307416_1001017153 206
723 3300032002 Ga0307416_100219380 Ga0307416_1002193801 206
724 3300032002 Ga0307416_100449360 Ga0307416_1004493602 206
725 3300032004 Ga0307414_10002383 Ga0307414_100023839 206
726 3300032004 Ga0307414_10080065 Ga0307414_100800653 206
727 3300032004 Ga0307414_10115391 Ga0307414_101153911 206
728 3300032004 Ga0307414_10121089 Ga0307414_101210893 206
729 3300032004 Ga0307414_10128285 Ga0307414_101282852 206
730 3300032004 Ga0307414_10182198 Ga0307414_101821983 206
731 3300032004 Ga0307414_10301355 Ga0307414_103013552 206
732 3300032004 Ga0307414_10325274 Ga0307414_103252742 206
733 3300032004 Ga0307414_10902365 Ga0307414_109023651 206
734 3300032005 Ga0307411_10010876 Ga0307411_100108765 206
735 3300032005 Ga0307411_10017282 Ga0307411_100172822 206
736 3300032005 Ga0307411_10043167 Ga0307411_100431673 206
737 3300032005 Ga0307411_10212673 Ga0307411_102126732 206
738 3300032005 Ga0307411_10572506 Ga0307411_105725061 206
739 3300032005 Ga0307411_10728649 Ga0307411_107286491 206
740 3300032005 Ga0307411_10849291 Ga0307411_108492912 206
741 3300032126 Ga0307415_100000419 Ga0307415_10000041913 206
742 3300032126 Ga0307415_100119421 Ga0307415_1001194213 206
743 3300032126 Ga0307415_100791815 Ga0307415_1007918152 206
744 3300034816 Ga0373930_0013841 Ga0373930_0013841_599_1225 206
745 3300034817 Ga0373948_0028390 Ga0373948_0028390_430_1059 206
746 3300034819 Ga0373958_0051750 Ga0373958_0051750_53_679 206
747 3300034820 Ga0373959_0000187 Ga0373959_0000187_5429_6094 206
748 3300034820 Ga0373959_0007997 Ga0373959_0007997_541_1170 206
749 3300034820 Ga0373959_0039204 Ga0373959_0039204_76_696 206
750 3300035112 Ga0373932_0104442 Ga0373932_0104442_276_905 206
751 3300035207 Ga0373942_0077912 Ga0373942_0077912_166_795 206
752 3300035241 Ga0373961_0016222 Ga0373961_0016222_197_817 206
753 3300035691 Ga0373931_0008014 Ga0373931_0008014_2770_3390 206
754 3300035691 Ga0373931_0190774 Ga0373931_0190774_519_1148 206
755 3300036401 Ga0373937_1040561 Ga0373937_1040561_31_651 206
756 3300037068 Ga0373925_0402602 Ga0373925_0402602_38_664 206
757 3300037418 Ga0395900_0005143 Ga0395900_0005143_9634_10257 206
758 3300037471 Ga0395905_0035452 Ga0395905_0035452_648_1271 206
759 3300037471 Ga0395905_0309388 Ga0395905_0309388_508_1128 206
760 3300037471 Ga0395905_0338329 Ga0395905_0338329_96_716 206
761 3300037471 Ga0395905_0773182 Ga0395905_0773182_213_836 206
762 3300037853 Ga0436364_0532547 Ga0436364_0532547_1795_2415 206
763 3300037853 Ga0436364_0890989 Ga0436364_0890989_173_868 206
764 3300038443 Ga0395901_0044634 Ga0395901_0044634_174_869 206
765 3300038443 Ga0395901_0057802 Ga0395901_0057802_2700_3323 206
766 3300038698 Ga0242419_002517 Ga0242419_002517_275_895 206
767 3300038996 Ga0242420_003855 Ga0242420_003855_191_811 206
768 3300038996 Ga0242420_053365 Ga0242420_053365_106_726 206
769 3300041406 Ga0439439_0013448 Ga0439439_0013448_849_1472 206
770 3300042015 Ga0439462_0020084 Ga0439462_0020084_1029_1652 206
771 3300042133 Ga0450896_011065 Ga0450896_011065_12_632 206
772 3300042134 Ga0450898_015309 Ga0450898_015309_52_672 206
773 3300042156 Ga0439446_0079940 Ga0439446_0079940_248_871 206
774 3300042435 Ga0439434_0038539 Ga0439434_0038539_240_863 206
775 3300042436 Ga0439435_0037204 Ga0439435_0037204_52_678 206
776 3300042436 Ga0439435_0121832 Ga0439435_0121832_34_663 206
777 3300042876 Ga0451577_0036034 Ga0451577_0036034_2021_2641 206
778 3300042876 Ga0451577_0354058 Ga0451577_0354058_355_975 206
779 3300042876 Ga0451577_0415277 Ga0451577_0415277_531_1160 206
780 3300042876 Ga0451577_0497896 Ga0451577_0497896_392_1012 206
781 3300042876 Ga0451577_0530573 Ga0451577_0530573_403_1023 206
782 3300044656 Ga0466969_0142939 Ga0466969_0142939_107_733 206
783 3300044673 Ga0453683_0006036 Ga0453683_0006036_2093_2713 206
784 3300044673 Ga0453683_0067639 Ga0453683_0067639_255_875 206
785 3300044673 Ga0453683_0097817 Ga0453683_0097817_976_1596 206
786 3300044673 Ga0453683_0168349 Ga0453683_0168349_494_1114 206
787 3300044673 Ga0453683_0448630 Ga0453683_0448630_40_660 206
788 3300044693 Ga0466961_0025997 Ga0466961_0025997_912_1538 206
789 3300044901 Ga0466960_0116553 Ga0466960_0116553_23_655 206
790 3300045051 Ga0451576_0045737 Ga0451576_0045737_3089_3709 206
791 3300045051 Ga0451576_0046962 Ga0451576_0046962_2942_3562 206
792 3300045051 Ga0451576_0074983 Ga0451576_0074983_2631_3257 206
793 3300045051 Ga0451576_0374847 Ga0451576_0374847_784_1404 206
794 3300045051 Ga0451576_0915442 Ga0451576_0915442_30_650 206
795 3300046455 Ga0495603_0012157 Ga0495603_0012157_3662_4282 206
796 3300046455 Ga0495603_0209644 Ga0495603_0209644_240_860 206
797 3300046459 Ga0495629_0305980 Ga0495629_0305980_60_680 206
798 3300046472 Ga0495580_0170505 Ga0495580_0170505_844_1464 206
799 3300046473 Ga0495582_0032465 Ga0495582_0032465_985_1605 206
800 3300046473 Ga0495582_0270231 Ga0495582_0270231_298_924 206
801 3300046499 Ga0495594_0021241 Ga0495594_0021241_780_1400 206
802 3300046499 Ga0495594_0022950 Ga0495594_0022950_78_698 206
803 3300046517 Ga0495630_0091977 Ga0495630_0091977_1037_1657 206
804 3300046526 Ga0495666_0046762 Ga0495666_0046762_834_1454 206
805 3300046533 Ga0495640_0104669 Ga0495640_0104669_858_1478 206
806 3300046535 Ga0495586_0029017 Ga0495586_0029017_2126_2746 206
807 3300046539 Ga0495621_0176849 Ga0495621_0176849_100_720 206
808 3300046559 Ga0495667_0079978 Ga0495667_0079978_1135_1755 206
809 3300046642 Ga0495634_0033648 Ga0495634_0033648_2733_3353 206
810 3300046681 Ga0495647_0039774 Ga0495647_0039774_423_1043 206
811 3300046681 Ga0495647_0075435 Ga0495647_0075435_668_1294 206
812 3300046683 Ga0495658_0161334 Ga0495658_0161334_309_929 206
813 3300046689 Ga0495613_0133508 Ga0495613_0133508_55_675 206
814 3300047318 Ga0495636_0198977 Ga0495636_0198977_281_901 206
815 3300047319 Ga0495674_0280408 Ga0495674_0280408_130_750 206
816 3300047321 Ga0495676_0174190 Ga0495676_0174190_651_1271 206
817 3300047322 Ga0495680_0059177 Ga0495680_0059177_1286_1906 206
818 3300047471 Ga0495684_0069778 Ga0495684_0069778_1342_1962 206
819 3300048903 Ga0496100_0071497 Ga0496100_0071497_450_1070 206
820 3300048903 Ga0496100_0075999 Ga0496100_0075999_1151_1780 206
821 3300048904 Ga0496101_0033035 Ga0496101_0033035_1133_1762 206
822 3300048904 Ga0496101_0534814 Ga0496101_0534814_283_903 206
823 3300048904 Ga0496101_0547385 Ga0496101_0547385_186_806 206
824 3300048905 Ga0496102_0056144 Ga0496102_0056144_766_1386 206
825 3300048905 Ga0496102_0079042 Ga0496102_0079042_647_1267 206
826 3300048905 Ga0496102_0126992 Ga0496102_0126992_259_888 206
827 3300048905 Ga0496102_0250840 Ga0496102_0250840_258_983 206
828 3300048906 Ga0496103_0051176 Ga0496103_0051176_991_1611 206
829 3300048907 Ga0496104_0004744 Ga0496104_0004744_6229_6858 206
830 3300048907 Ga0496104_0094784 Ga0496104_0094784_238_867 206
831 3300048907 Ga0496104_0156483 Ga0496104_0156483_1512_2132 206
832 3300048908 Ga0496105_0036834 Ga0496105_0036834_249_878 206
833 3300048908 Ga0496105_0155523 Ga0496105_0155523_343_963 206
834 3300048909 Ga0496106_0124142 Ga0496106_0124142_999_1619 206
835 3300048909 Ga0496106_0135676 Ga0496106_0135676_1209_1829 206
836 3300048910 Ga0496107_0052279 Ga0496107_0052279_1103_1723 206
837 3300048910 Ga0496107_0113073 Ga0496107_0113073_729_1454 206
838 3300048910 Ga0496107_0417776 Ga0496107_0417776_124_744 206
839 3300048911 Ga0496108_0001291 Ga0496108_0001291_1335_1955 206
840 3300048911 Ga0496108_0005237 Ga0496108_0005237_5339_5968 206
841 3300048911 Ga0496108_0006989 Ga0496108_0006989_6639_7259 206
842 3300048911 Ga0496108_0017435 Ga0496108_0017435_5229_5858 206
843 3300048911 Ga0496108_0453683 Ga0496108_0453683_380_1006 206
844 3300048912 Ga0496109_0031135 Ga0496109_0031135_2664_3284 206
845 3300048912 Ga0496109_0035270 Ga0496109_0035270_830_1456 206
846 3300048912 Ga0496109_0229173 Ga0496109_0229173_1061_1681 206
847 3300048912 Ga0496109_0407550 Ga0496109_0407550_546_1175 206
848 3300048913 Ga0496110_0012229 Ga0496110_0012229_1370_1990 206
849 3300048913 Ga0496110_0437024 Ga0496110_0437024_56_676 206
850 3300048913 Ga0496110_0905928 Ga0496110_0905928_32_661 206
851 3300048914 Ga0496111_0442463 Ga0496111_0442463_249_878 206
852 3300048915 Ga0496112_0001950 Ga0496112_0001950_13735_14364 206
853 3300048915 Ga0496112_0022068 Ga0496112_0022068_95_724 206
854 3300048915 Ga0496112_0124946 Ga0496112_0124946_601_1221 206
855 3300048915 Ga0496112_0586514 Ga0496112_0586514_134_763 206
856 3300048916 Ga0496113_0000769 Ga0496113_0000769_12271_12900 206
857 3300048916 Ga0496113_0003336 Ga0496113_0003336_4612_5232 206
858 3300048916 Ga0496113_0012516 Ga0496113_0012516_627_1247 206
859 3300048916 Ga0496113_0053330 Ga0496113_0053330_2274_2903 206
860 3300048916 Ga0496113_0893651 Ga0496113_0893651_29_655 206
861 3300048917 Ga0496114_0320445 Ga0496114_0320445_531_1151 206
862 3300048917 Ga0496114_0689274 Ga0496114_0689274_123_773 206
863 3300048918 Ga0496115_0048377 Ga0496115_0048377_2295_3020 206
864 3300048918 Ga0496115_0157500 Ga0496115_0157500_706_1326 206
865 3300048918 Ga0496115_0574060 Ga0496115_0574060_256_882 206
866 3300049568 Ga0501031_0075042 Ga0501031_0075042_157_816 206
867 3300049569 Ga0501032_0426933 Ga0501032_0426933_132_797 206
868 3300049569 Ga0501032_0621217 Ga0501032_0621217_25_654 206
869 3300049570 Ga0501033_0150262 Ga0501033_0150262_239_862 206
870 3300049570 Ga0501033_0295651 Ga0501033_0295651_228_896 206
871 3300049570 Ga0501033_0461899 Ga0501033_0461899_188_817 206
872 3300049571 Ga0501034_0703208 Ga0501034_0703208_217_840 206
873 3300049572 Ga0501036_0021910 Ga0501036_0021910_988_1620 206
874 3300049572 Ga0501036_0327258 Ga0501036_0327258_407_1036 206
875 3300049573 Ga0501037_0184209 Ga0501037_0184209_653_1273 206
876 3300049574 Ga0501038_0425201 Ga0501038_0425201_242_871 206
877 3300049574 Ga0501038_0517989 Ga0501038_0517989_192_857 206
878 3300049575 Ga0501039_0019178 Ga0501039_0019178_1243_1872 206
879 3300049575 Ga0501039_0166360 Ga0501039_0166360_95_727 206
880 3300049575 Ga0501039_0718754 Ga0501039_0718754_113_733 206
881 3300049576 Ga0501040_0057253 Ga0501040_0057253_164_796 206
882 3300049576 Ga0501040_0120347 Ga0501040_0120347_766_1419 206
883 3300049576 Ga0501040_0126415 Ga0501040_0126415_1143_1763 206
884 3300049577 Ga0501041_0038824 Ga0501041_0038824_936_1565 206
885 3300049578 Ga0501042_0014700 Ga0501042_0014700_1909_2538 206
886 3300049579 Ga0501043_0330964 Ga0501043_0330964_288_953 206
887 3300049579 Ga0501043_0391276 Ga0501043_0391276_280_912 206
888 3300049580 Ga0501046_0080712 Ga0501046_0080712_173_838 206
889 3300049580 Ga0501046_0090170 Ga0501046_0090170_1503_2132 206
890 3300049581 Ga0501047_0000842 Ga0501047_0000842_17886_18554 206
891 3300049581 Ga0501047_0198749 Ga0501047_0198749_745_1374 206
892 3300049582 Ga0501048_0055429 Ga0501048_0055429_771_1400 206
893 3300049582 Ga0501048_0082582 Ga0501048_0082582_1309_1968 206
894 3300049583 Ga0501067_0025968 Ga0501067_0025968_1645_2274 206
895 3300049583 Ga0501067_0050374 Ga0501067_0050374_1324_1953 206
896 3300049583 Ga0501067_0081298 Ga0501067_0081298_471_1091 206
897 3300049584 Ga0501068_0000022 Ga0501068_0000022_33402_34031 206
898 3300049584 Ga0501068_0001339 Ga0501068_0001339_7802_8431 206
899 3300049584 Ga0501068_0188264 Ga0501068_0188264_509_1129 206
900 3300049585 Ga0501069_0006160 Ga0501069_0006160_4649_5278 206
901 3300049585 Ga0501069_0022349 Ga0501069_0022349_2478_3098 206
902 3300049585 Ga0501069_0059353 Ga0501069_0059353_531_1160 206
903 3300049586 Ga0501070_0000192 Ga0501070_0000192_18132_18761 206
904 3300049586 Ga0501070_0004268 Ga0501070_0004268_985_1614 206
905 3300049586 Ga0501070_0022042 Ga0501070_0022042_1151_1780 206
906 3300049587 Ga0501071_0000678 Ga0501071_0000678_16696_17325 206
907 3300049587 Ga0501071_0033592 Ga0501071_0033592_876_1505 206
908 3300049587 Ga0501071_0117590 Ga0501071_0117590_157_786 206
909 3300049587 Ga0501071_0226470 Ga0501071_0226470_637_1266 206
910 3300049587 Ga0501071_0407114 Ga0501071_0407114_346_981 206
911 3300049587 Ga0501071_0614928 Ga0501071_0614928_148_777 206
912 3300049588 Ga0501072_0014674 Ga0501072_0014674_948_1577 206
913 3300049588 Ga0501072_0097467 Ga0501072_0097467_1576_2205 206
914 3300049588 Ga0501072_0161051 Ga0501072_0161051_129_749 206
915 3300049588 Ga0501072_0190259 Ga0501072_0190259_273_908 206
916 3300049588 Ga0501072_0332578 Ga0501072_0332578_351_977 206
917 3300049589 Ga0501073_0000949 Ga0501073_0000949_293_922 206
918 3300049589 Ga0501073_0062982 Ga0501073_0062982_986_1615 206
919 3300049589 Ga0501073_0398573 Ga0501073_0398573_263_895 206
920 3300049590 Ga0501074_0000171 Ga0501074_0000171_1091_1720 206
921 3300049590 Ga0501074_0000742 Ga0501074_0000742_4877_5506 206
922 3300049590 Ga0501074_0062345 Ga0501074_0062345_1970_2602 206
923 3300049591 Ga0501075_0076581 Ga0501075_0076581_1781_2410 206
924 3300049591 Ga0501075_0106483 Ga0501075_0106483_104_724 206
925 3300049591 Ga0501075_0670972 Ga0501075_0670972_78_698 206
926 3300049592 Ga0501076_0020253 Ga0501076_0020253_1791_2420 206
927 3300049592 Ga0501076_0367266 Ga0501076_0367266_76_696 206
928 3300049592 Ga0501076_0375112 Ga0501076_0375112_283_942 206
929 3300049593 Ga0501077_0004768 Ga0501077_0004768_2236_2856 206
930 3300049593 Ga0501077_0053011 Ga0501077_0053011_673_1305 206
931 3300049593 Ga0501077_0058114 Ga0501077_0058114_1716_2345 206
932 3300049652 Ga0501202_029946 Ga0501202_029946_384_1004 206
933 3300049656 Ga0501209_002047 Ga0501209_002047_165_785 206
934 3300049661 Ga0501217_088428 Ga0501217_088428_190_810 206
935 3300049669 Ga0501235_003401 Ga0501235_003401_2177_2797 206
936 3300049704 Ga0501221_015900 Ga0501221_015900_626_1246 206
937 3300049705 Ga0501225_0021352 Ga0501225_0021352_104_724 206
938 3300049707 Ga0501234_009350 Ga0501234_009350_491_1111 206
939 3300049741 Ga0501079_0060874 Ga0501079_0060874_566_1195 206
940 3300049741 Ga0501079_0554862 Ga0501079_0554862_166_843 206
941 3300049741 Ga0501079_0820871 Ga0501079_0820871_95_715 206
942 3300049742 Ga0501080_0000060 Ga0501080_0000060_16688_17317 206
943 3300049742 Ga0501080_0107525 Ga0501080_0107525_985_1614 206
944 3300049742 Ga0501080_0495018 Ga0501080_0495018_52_711 206
945 3300049743 Ga0501081_0063800 Ga0501081_0063800_15_647 206
946 3300049743 Ga0501081_0066384 Ga0501081_0066384_943_1602 206
947 3300049743 Ga0501081_0074081 Ga0501081_0074081_68_697 206
948 3300049743 Ga0501081_0142005 Ga0501081_0142005_29_649 206
949 3300049743 Ga0501081_0162742 Ga0501081_0162742_909_1538 206
950 3300049744 Ga0501083_0001978 Ga0501083_0001978_9226_9855 206
951 3300049744 Ga0501083_0059235 Ga0501083_0059235_1129_1758 206
952 3300049744 Ga0501083_0162068 Ga0501083_0162068_45_677 206
953 3300049744 Ga0501083_0306257 Ga0501083_0306257_134_769 206
954 3300049760 Ga0501263_005113 Ga0501263_005113_521_1141 206
955 3300049765 Ga0501268_012154 Ga0501268_012154_205_825 206
956 3300049765 Ga0501268_045961 Ga0501268_045961_33_659 206
957 3300049767 Ga0501270_004688 Ga0501270_004688_643_1263 206
958 3300049769 Ga0501272_000560 Ga0501272_000560_376_996 206
959 3300049775 Ga0501279_027846 Ga0501279_027846_69_689 206
960 3300049822 Ga0501035_0017508 Ga0501035_0017508_1197_1865 206
961 3300049822 Ga0501035_0110624 Ga0501035_0110624_1194_1853 206
962 3300049822 Ga0501035_0432634 Ga0501035_0432634_177_800 206
963 3300049822 Ga0501035_0694981 Ga0501035_0694981_38_658 206
964 3300049823 Ga0501044_0000734 Ga0501044_0000734_21487_22155 206
965 3300049823 Ga0501044_0194333 Ga0501044_0194333_1300_1923 206
966 3300049823 Ga0501044_0318067 Ga0501044_0318067_753_1418 206
967 3300049824 Ga0501045_0014038 Ga0501045_0014038_87_707 206
968 3300049824 Ga0501045_0094602 Ga0501045_0094602_1125_1784 206
969 3300049824 Ga0501045_0118557 Ga0501045_0118557_247_876 206
970 3300049824 Ga0501045_0324111 Ga0501045_0324111_392_1027 206
971 3300050507 nmdc:mga05p37_138827_c1 nmdc:mga05p37_138827_c1_1236_1856 206
972 3300050507 nmdc:mga05p37_24458_c2 nmdc:mga05p37_24458_c2_1430_2056 206
973 3300050507 nmdc:mga05p37_24982_c1 nmdc:mga05p37_24982_c1_6368_6988 206
974 3300050507 nmdc:mga05p37_284551_c1 nmdc:mga05p37_284551_c1_94_744 206
975 3300050507 nmdc:mga05p37_371760_c1 nmdc:mga05p37_371760_c1_803_1429 206
976 3300050507 nmdc:mga05p37_414393_c1 nmdc:mga05p37_414393_c1_642_1292 206
977 3300050507 nmdc:mga05p37_51636_c1 nmdc:mga05p37_51636_c1_4153_4782 206
978 3300050507 nmdc:mga05p37_561756_c1 nmdc:mga05p37_561756_c1_658_1278 206
979 3300050507 nmdc:mga05p37_75331_c1 nmdc:mga05p37_75331_c1_1360_1980 206
980 3300050508 nmdc:mga09592_125585_c1 nmdc:mga09592_125585_c1_1349_1975 206
981 3300050508 nmdc:mga09592_19135_c1 nmdc:mga09592_19135_c1_46_666 206
982 3300050508 nmdc:mga09592_3967_c1 nmdc:mga09592_3967_c1_6183_6803 206
983 3300050509 nmdc:mga0qj67_10094_c1 nmdc:mga0qj67_10094_c1_5649_6284 206
984 3300050509 nmdc:mga0qj67_255813_c1 nmdc:mga0qj67_255813_c1_109_759 206
985 3300050509 nmdc:mga0qj67_3022_c1 nmdc:mga0qj67_3022_c1_7629_8255 206
986 3300050509 nmdc:mga0qj67_41359_c1 nmdc:mga0qj67_41359_c1_1558_2184 206
987 3300050509 nmdc:mga0qj67_427435_c1 nmdc:mga0qj67_427435_c1_392_1018 206
988 3300050509 nmdc:mga0qj67_584417_c1 nmdc:mga0qj67_584417_c1_103_723 206
989 3300050510 nmdc:mga06r32_118220_c1 nmdc:mga06r32_118220_c1_464_1099 206
990 3300050510 nmdc:mga06r32_22435_c1 nmdc:mga06r32_22435_c1_2923_3549 206
991 3300050510 nmdc:mga06r32_269914_c1 nmdc:mga06r32_269914_c1_1026_1652 206
992 3300050510 nmdc:mga06r32_29277_c1 nmdc:mga06r32_29277_c1_1737_2363 206
993 3300050510 nmdc:mga06r32_339589_c1 nmdc:mga06r32_339589_c1_203_853 206
994 3300050510 nmdc:mga06r32_356899_c1 nmdc:mga06r32_356899_c1_266_892 206
995 3300050510 nmdc:mga06r32_383154_c1 nmdc:mga06r32_383154_c1_111_731 206
996 3300050510 nmdc:mga06r32_45554_c1 nmdc:mga06r32_45554_c1_3185_3805 206
997 3300050510 nmdc:mga06r32_857504_c1 nmdc:mga06r32_857504_c1_82_708 206
998 3300050511 nmdc:mga08y16_232930_c1 nmdc:mga08y16_232930_c1_913_1545 206
999 3300050511 nmdc:mga08y16_542655_c1 nmdc:mga08y16_542655_c1_488_1108 206
1000 3300050511 nmdc:mga08y16_71880_c1 nmdc:mga08y16_71880_c1_2718_3344 206
1001 3300050511 nmdc:mga08y16_9037_c1 nmdc:mga08y16_9037_c1_120_770 206
1002 3300050512 nmdc:mga0n895_1129540_c1 nmdc:mga0n895_1129540_c1_96_725 206
1003 3300050512 nmdc:mga0n895_11503_c1 nmdc:mga0n895_11503_c1_4175_4795 206
1004 3300050512 nmdc:mga0n895_13422_c1 nmdc:mga0n895_13422_c1_2782_3402 206
1005 3300050512 nmdc:mga0n895_141908_c1 nmdc:mga0n895_141908_c1_231_857 206
1006 3300050512 nmdc:mga0n895_21697_c1 nmdc:mga0n895_21697_c1_4826_5446 206
1007 3300050512 nmdc:mga0n895_3234_c1 nmdc:mga0n895_3234_c1_11406_12026 206
1008 3300050512 nmdc:mga0n895_40283_c1 nmdc:mga0n895_40283_c1_3148_3768 206
1009 3300050512 nmdc:mga0n895_532041_c1 nmdc:mga0n895_532041_c1_11_640 206
1010 3300050512 nmdc:mga0n895_603579_c1 nmdc:mga0n895_603579_c1_415_1035 206
1011 3300050512 nmdc:mga0n895_60762_c1 nmdc:mga0n895_60762_c1_1089_1709 206
1012 3300050512 nmdc:mga0n895_639749_c1 nmdc:mga0n895_639749_c1_68_688 206
1013 3300050512 nmdc:mga0n895_77744_c1 nmdc:mga0n895_77744_c1_1796_2416 206
1014 3300050513 nmdc:mga0rr50_104391_c1 nmdc:mga0rr50_104391_c1_1087_1707 206
1015 3300050513 nmdc:mga0rr50_127494_c1 nmdc:mga0rr50_127494_c1_1114_1734 206
1016 3300050513 nmdc:mga0rr50_259408_c1 nmdc:mga0rr50_259408_c1_521_1141 206
1017 3300050513 nmdc:mga0rr50_345316_c1 nmdc:mga0rr50_345316_c1_383_1003 206
1018 3300050513 nmdc:mga0rr50_51554_c1 nmdc:mga0rr50_51554_c1_347_967 206
1019 3300050513 nmdc:mga0rr50_611973_c1 nmdc:mga0rr50_611973_c1_232_852 206
1020 3300050513 nmdc:mga0rr50_7588_c1 nmdc:mga0rr50_7588_c1_3874_4494 206
1021 3300050513 nmdc:mga0rr50_79036_c1 nmdc:mga0rr50_79036_c1_1620_2240 206
1022 3300050514 nmdc:mga08x19_102252_c1 nmdc:mga08x19_102252_c1_38_658 206
1023 3300050514 nmdc:mga08x19_2813_c1 nmdc:mga08x19_2813_c1_682_1302 206
1024 3300050514 nmdc:mga08x19_28964_c1 nmdc:mga08x19_28964_c1_857_1477 206
1025 3300050514 nmdc:mga08x19_34468_c1 nmdc:mga08x19_34468_c1_888_1508 206
1026 3300050514 nmdc:mga08x19_51234_c1 nmdc:mga08x19_51234_c1_456_1076 206
1027 3300050514 nmdc:mga08x19_8445_c1 nmdc:mga08x19_8445_c1_4169_4789 206
1028 3300050515 nmdc:mga0a205_108546_c1 nmdc:mga0a205_108546_c1_128_748 206
1029 3300050515 nmdc:mga0a205_209869_c1 nmdc:mga0a205_209869_c1_388_1008 206
1030 3300050515 nmdc:mga0a205_247330_c2 nmdc:mga0a205_247330_c2_346_966 206
1031 3300050515 nmdc:mga0a205_37263_c1 nmdc:mga0a205_37263_c1_3474_4094 206
1032 3300050515 nmdc:mga0a205_784485_c1 nmdc:mga0a205_784485_c1_13_633 206
1033 3300050515 nmdc:mga0a205_80583_c1 nmdc:mga0a205_80583_c1_255_875 206
1034 3300050515 nmdc:mga0a205_823_c1 nmdc:mga0a205_823_c1_4699_5319 206
1035 3300054114 Ga0501084_0001187 Ga0501084_0001187_17930_18559 206
1036 3300054114 Ga0501084_0022610 Ga0501084_0022610_2892_3521 206
1037 3300054114 Ga0501084_0091875 Ga0501084_0091875_220_849 206
1038 3300054114 Ga0501084_0431681 Ga0501084_0431681_156_815 206
1039 3300054114 Ga0501084_0493686 Ga0501084_0493686_332_952 206
1040 3300059421 Ga0590071_011011 Ga0590071_011011_1025_1654 206
1041 3300059421 Ga0590071_017913 Ga0590071_017913_839_1465 206
1042 3300059421 Ga0590071_093083 Ga0590071_093083_91_711 206
1043 3300059423 Ga0590074_038811 Ga0590074_038811_87_716 206
1044 3300059424 Ga0590075_014608 Ga0590075_014608_1074_1715 206
1045 3300059426 Ga0590077_091099 Ga0590077_091099_50_691 206
1046 3300060353 Ga0501082_0002066 Ga0501082_0002066_171_800 206
1047 3300060353 Ga0501082_0009721 Ga0501082_0009721_6031_6663 206
1048 3300060353 Ga0501082_0055172 Ga0501082_0055172_729_1358 206
1049 3300060353 Ga0501082_0084001 Ga0501082_0084001_1509_2138 206
1050 3300060353 Ga0501082_0784771 Ga0501082_0784771_75_710 206
1051 3300061734 Ga0530510_0021297 Ga0530510_0021297_2699_3331 206
1052 3300061734 Ga0530510_0037427 Ga0530510_0037427_2834_3463 206
1053 3300061734 Ga0530510_0174044 Ga0530510_0174044_70_690 206
1054 3300061734 Ga0530510_0255175 Ga0530510_0255175_607_1227 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06971

Put_DNA-bind_N

Putative DNA-binding protein N-terminus

3

51

0.98

PF02629

CoA_binding

CoA binding domain

79

177

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wgh-assembly1.cif.gz_A crystal structure of rsp in complex with beta-nadh 0.9494 1 205
3wgh-assembly1.cif.gz_B crystal structure of rsp in complex with beta-nadh 0.9484 1 205
3wg9-assembly1.cif.gz_A crystal structure of rsp, a rex-family repressor 0.9428 1 205
3wgi-assembly1.cif.gz_A crystal structure of rsp in complex with beta-nad+ and operator dna 0.9358 1 205
3wg9-assembly2.cif.gz_D crystal structure of rsp, a rex-family repressor 0.9299 1 205
ID Description Score Start End Superfamily
1xcbB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9712 5 73 1.10.10.10
5zz6C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9676 3 72 1.10.10.10
3iktA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9662 3 73 1.10.10.10
1xcbF01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9653 4 73 1.10.10.10
1r72C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9602 5 73 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A644XMJ9-F1-model_v4 Redox-sensing transcriptional repressor Rex 0.977 80 205 GO:0003677
GO:0005737
GO:0045892
GO:0051775
AF-A0A3M1GUN8-F1-model_v4 Redox-sensing transcriptional repressor Rex 0.975 1 205 GO:0003677
GO:0003700
GO:0005737
GO:0045892
GO:0051775
AF-A0A849H2L9-F1-model_v4 Redox-sensing transcriptional repressor Rex 0.9695 4 205 GO:0003677
GO:0003700
GO:0005737
GO:0045892
GO:0051775
AF-A0A352IM06-F1-model_v4 deleted 0.9684 9 190
AF-A0A2N2B627-F1-model_v4 Redox-sensing transcriptional repressor Rex 0.9681 67 204 GO:0003677
GO:0005737
GO:0045892
GO:0051775

Feature Viewer

pLDDT pTM Quality
91.36 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map