F489107

General Info

Members Datasets Scaffolds Average Seq Length
1053 492 2106 363

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100358490|Ga0070706_1003584901
Length 423
Sequence MRAHEPVNPVGCASAHRRHAGGLGGALKRTLRLEPRPQPSRVMSVASPLLALAITVVLGVALFLLLGKDPLRGLQVFFVEPLKSGYALSELALKATPLLLIALGLALCFRSNVWNIGAEGQFIVGAIAAGGIAMLAEQGTSRLIVVAILAAGVLGGMAWAAVVAFLRDKANANEILVSLMLVYVAEMLLSHLVYGPWKDPAGYNFPQTISFLAPTQVPRLFAGLRVNIGAPIALAAVGLFWLFLFRIYAGFQLQVGGLAPAAARYAGFSSRKALWVAMLGSGGMAGLAGAIEVAGPLGQLTPHVPAGYGFAAIIVAFVGRLHPVGVVFSSVLMSMFYIGGELAQSRLGLPKALTGVFQGLLLFTLLACDTLIAYRLRWQARSSHHLQARHPGERRDPPMHATMDPGVRRDDVERGRDDGKEPA

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
98 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
135 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
142 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
147 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
148 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
216 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
222 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
223 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
227 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
228 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
229 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
230 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
231 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
232 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
233 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
234 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
235 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
236 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
237 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
240 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
241 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
242 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
243 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
244 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
245 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
246 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
247 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
248 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
249 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
257 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
258 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
259 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
260 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
261 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
277 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
278 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
279 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
280 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
281 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
282 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
283 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
284 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
285 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
286 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
287 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
288 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
289 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
290 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
291 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
292 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
293 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
294 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
295 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
296 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
297 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
298 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
301 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
302 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
306 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
307 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
308 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
313 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
316 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
317 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
318 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
319 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
320 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
329 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
330 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
331 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
334 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
335 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
336 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
337 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
358 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
359 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
372 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
373 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
374 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
375 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
376 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
377 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
378 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
379 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
382 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
383 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
384 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
385 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
386 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
387 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
388 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
389 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
390 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
391 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
392 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
393 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
394 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
395 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
396 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
397 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
398 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
399 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
400 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
401 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
402 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
403 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
404 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
405 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
406 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
407 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
408 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
409 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
410 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
411 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
412 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
413 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
414 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
415 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
416 2547132374 Acidovorax radicis N35 Isolate Unclassified
417 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
418 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
419 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
420 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
421 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
422 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
423 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
424 2643221570 Acidovorax sp. Root568 Isolate Unclassified
425 2643221591 Devosia sp. Root685 Isolate Unclassified
426 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
427 2643221596 Acidovorax sp. Root70 Isolate Unclassified
428 2643221609 Acidovorax sp. Root217 Isolate Unclassified
429 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
430 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
431 2643221629 Devosia sp. Root105 Isolate Unclassified
432 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
433 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
434 2643221652 Acidovorax sp. Root402 Isolate Unclassified
435 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
436 2643221658 Variovorax sp. Root411 Isolate Unclassified
437 2643221662 Devosia sp. Root413D1 Isolate Unclassified
438 2643221672 Variovorax sp. Root434 Isolate Unclassified
439 2643221683 Variovorax sp. Root473 Isolate Unclassified
440 2643221717 Acidovorax sp. Root267 Isolate Unclassified
441 2643221733 Bosea sp. Root381 Isolate Unclassified
442 2643221734 Bosea sp. Root670 Isolate Unclassified
443 2643221736 Bosea sp. Root483D1 Isolate Unclassified
444 2738541277 Variovorax sp. GV051 Isolate Unclassified
445 2738543012 Acidovorax sp. CF301 Isolate Unclassified
446 2738543019 Variovorax sp. GV040 Isolate Unclassified
447 2816332133 Acidovorax radicis 2721A Isolate Unclassified
448 2818991446 Variovorax sp. 1180 Isolate Unclassified
449 2818991467 Bosea vestrisii 3192 Isolate Unclassified
450 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
451 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
452 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
453 2841760612 Bosea sp. Tri-49 Isolate Nodule
454 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
455 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
456 2842677519 Variovorax sp. R-72495 Isolate Unclassified
457 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
458 2842733646 Variovorax sp. R-72446 Isolate Unclassified
459 2842747753 Variovorax sp. R-72060 Isolate Unclassified
460 2844104063 Bosea sp. Tri-39 Isolate Nodule
461 2851182111 Bosea sp. Tri-44 Isolate Nodule
462 2851246043 Bosea sp. Tri-54 Isolate Nodule
463 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
464 2885198086 Variovorax sp. 679 Isolate Unclassified
465 2885211737 Variovorax sp. 553 Isolate Unclassified
466 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
467 2899924645 Variovorax sp. 369 Isolate Unclassified
468 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
469 2904456579 Variovorax sp. 2002 Isolate Unclassified
470 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
471 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
472 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
473 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
474 2928037797 Variovorax sp. 1126 Isolate Unclassified
475 2928044640 Variovorax sp. 1128 Isolate Unclassified
476 2928051484 Variovorax sp. 1133 Isolate Unclassified
477 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
478 2928070936 Variovorax gossypii 1167 Isolate Unclassified
479 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
480 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
481 2929520902 Variovorax beijingensis 502 Isolate Unclassified
482 2932401849 Devosia sp. 2618 Isolate Rhizosphere
483 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
484 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
485 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
486 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
487 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
488 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
489 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
490 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
491 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
492 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.5
Metatranscriptomes 0
Isolates 7.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.66
Nodule 1.42
Rhizoplane 2.47
Rhizosphere 65.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100358490 3300005467 Bacteria 1359
2 JGI24739J22299_10024192 3300001989 Bacteria 2143
3 JGI25155J39150_1000005 3300002704 Bacteria 261712
4 JGI25156J39149_1000006 3300002705 Bacteria 261778
5 JGI25156J39149_1000042 3300002705 Bacteria 105742
6 JGI25154J39366_1000015 3300002738 Bacteria 261778
7 JGI25154J39366_1003388 3300002738 Bacteria 3372
8 JGI25157J39369_1000016 3300002741 Bacteria 192349
9 JGI25157J39369_1000033 3300002741 Bacteria 139508
10 JGI25151J46595_10000040 3300003187 Bacteria 176750
11 JGI25151J46595_10000135 3300003187 Bacteria 98528
12 JGI25151J46595_10003363 3300003187 Bacteria 8859
13 JGI25151J46595_10014930 3300003187 Bacteria 3446
14 JGI25151J46595_10047585 3300003187 Bacteria 1490
15 JGI25153J46596_10001229 3300003215 Bacteria 15448
16 JGI25153J46596_10006649 3300003215 Bacteria 5816
17 rootH1_10003125 3300003316 Bacteria 6506
18 rootH2_10009935 3300003320 Bacteria 4350
19 rootH1_10029110 3300003323 Bacteria 2143
20 rootH1_10033106 3300003323 Bacteria 4177
21 rootH1_10079201 3300003323 Bacteria 12707
22 rootH1_10231751 3300003323 Bacteria 1929
23 JGI25160J50197_1000098 3300003354 Bacteria 87307
24 JGI25161J50226_1000037 3300003374 Bacteria 133331
25 Ga0055539_1000950 3300003752 Bacteria 6420
26 Ga0055525_1000038 3300003759 Bacteria 297540
27 Ga0055535_1000181 3300003761 Bacteria 66856
28 Ga0055535_1000951 3300003761 Bacteria 19206
29 Ga0055535_1005110 3300003761 Bacteria 2972
30 Ga0055542_1000070 3300003762 Bacteria 147374
31 Ga0055529_1000805 3300003763 Bacteria 19141
32 Ga0055526_1000123 3300003771 Bacteria 68503
33 Ga0055526_1000154 3300003771 Bacteria 60968
34 Ga0055526_1006302 3300003771 Bacteria 6488
35 Ga0055526_1006801 3300003771 Bacteria 6105
36 Ga0055526_1011523 3300003771 Bacteria 3971
37 Ga0055537_1000461 3300003773 Bacteria 25584
38 Ga0055524_1000023 3300003775 Bacteria 221408
39 Ga0055524_1000052 3300003775 Bacteria 144959
40 Ga0055524_1000261 3300003775 Bacteria 53201
41 Ga0055524_1019259 3300003775 Bacteria 2339
42 Ga0055536_1001412 3300003781 Bacteria 14509
43 Ga0055536_1002347 3300003781 Bacteria 10720
44 Ga0055534_1000245 3300003784 Bacteria 38376
45 Ga0055534_1001463 3300003784 Bacteria 9402
46 Ga0055534_1015574 3300003784 Bacteria 1390
47 Ga0055528_1000723 3300003790 Bacteria 23348
48 Ga0055528_1001448 3300003790 Bacteria 14491
49 Ga0055530_10000190 3300003791 Bacteria 55126
50 Ga0055530_10009289 3300003791 Bacteria 3800
51 Ga0055530_10025779 3300003791 Bacteria 1636
52 Ga0055540_1000187 3300003792 Bacteria 59910
53 Ga0055540_1001526 3300003792 Bacteria 13633
54 Ga0055540_1004871 3300003792 Bacteria 5874
55 Ga0055540_1007513 3300003792 Bacteria 4094
56 Ga0055540_1009113 3300003792 Bacteria 3478
57 Ga0055540_1012167 3300003792 Bacteria 2721
58 Ga0055531_10001522 3300003794 Bacteria 16989
59 Ga0055531_10014851 3300003794 Bacteria 3478
60 Ga0055543_1004109 3300004625 Bacteria 4061
61 Ga0065165_1000248 3300005262 Bacteria 93216
62 Ga0065165_1000362 3300005262 Bacteria 74503
63 Ga0065165_1004149 3300005262 Bacteria 9290
64 Ga0065165_1015845 3300005262 Bacteria 2855
65 Ga0065165_1020157 3300005262 Bacteria 2356
66 Ga0065165_1035830 3300005262 Bacteria 1519
67 Ga0065704_10114840 3300005289 Bacteria 1883
68 Ga0070658_10002918 3300005327 Bacteria 14176
69 Ga0070658_10011840 3300005327 Bacteria 7002
70 Ga0070658_10032631 3300005327 Bacteria 4187
71 Ga0070658_10095240 3300005327 Bacteria 2457
72 Ga0070676_10004616 3300005328 Bacteria 7271
73 Ga0070676_10014222 3300005328 Bacteria 4372
74 Ga0070676_10072791 3300005328 Bacteria 2067
75 Ga0070683_100014657 3300005329 Bacteria 6865
76 Ga0070683_100104478 3300005329 Bacteria 2670
77 Ga0070690_100022114 3300005330 Bacteria 3888
78 Ga0070690_100028720 3300005330 Bacteria 3446
79 Ga0070670_100001811 3300005331 Bacteria 17414
80 Ga0070670_100002276 3300005331 Bacteria 15804
81 Ga0070670_100023499 3300005331 Bacteria 5306
82 Ga0070670_100045262 3300005331 Bacteria 3782
83 Ga0070670_100133389 3300005331 Bacteria 2145
84 Ga0070670_100184143 3300005331 Bacteria 1813
85 Ga0068869_100007662 3300005334 Bacteria 6914
86 Ga0068869_100022888 3300005334 Bacteria 4310
87 Ga0068869_100110803 3300005334 Bacteria 2088
88 Ga0070666_10026552 3300005335 Bacteria 3785
89 Ga0070666_10144348 3300005335 Bacteria 1658
90 Ga0070682_100000796 3300005337 Bacteria 18493
91 Ga0070682_100006730 3300005337 Bacteria 6448
92 Ga0070682_100043720 3300005337 Bacteria 2771
93 Ga0068868_100004439 3300005338 Bacteria 9839
94 Ga0068868_100065444 3300005338 Bacteria 2888
95 Ga0068868_100123841 3300005338 Bacteria 2110
96 Ga0068868_100163746 3300005338 Bacteria 1838
97 Ga0068868_100199660 3300005338 Bacteria 1667
98 Ga0070660_100051160 3300005339 Bacteria 3180
99 Ga0070660_100102348 3300005339 Bacteria 2270
100 Ga0070660_100102668 3300005339 Bacteria 2267
101 Ga0070660_100214625 3300005339 Bacteria 1563
102 Ga0070689_100004600 3300005340 Bacteria 9346
103 Ga0070689_100027527 3300005340 Bacteria 4287
104 Ga0070687_100116366 3300005343 Bacteria 1522
105 Ga0070661_100008298 3300005344 Bacteria 7173
106 Ga0070661_100037283 3300005344 Bacteria 3536
107 Ga0070661_100074154 3300005344 Bacteria 2505
108 Ga0070661_100291520 3300005344 Bacteria 1268
109 Ga0070692_10146858 3300005345 Bacteria 1340
110 Ga0070668_100002401 3300005347 Bacteria 13779
111 Ga0070668_100147057 3300005347 Bacteria 1903
112 Ga0070669_100003159 3300005353 Bacteria 11847
113 Ga0070669_100020429 3300005353 Bacteria 4730
114 Ga0070669_100056450 3300005353 Bacteria 2879
115 Ga0070675_100003826 3300005354 Bacteria 11423
116 Ga0070675_100005498 3300005354 Bacteria 9701
117 Ga0070675_100027924 3300005354 Bacteria 4537
118 Ga0070675_100055517 3300005354 Bacteria 3260
119 Ga0070675_100075601 3300005354 Bacteria 2800
120 Ga0070671_100007846 3300005355 Bacteria 8531
121 Ga0070671_100120540 3300005355 Bacteria 2207
122 Ga0070671_100130954 3300005355 Bacteria 2113
123 Ga0070671_100166175 3300005355 Bacteria 1866
124 Ga0070674_100011837 3300005356 Bacteria 5328
125 Ga0070673_100025297 3300005364 Bacteria 4367
126 Ga0070673_100067351 3300005364 Bacteria 2863
127 Ga0070673_100078081 3300005364 Bacteria 2677
128 Ga0070659_100009325 3300005366 Bacteria 7208
129 Ga0070659_100093064 3300005366 Bacteria 2418
130 Ga0070667_100002157 3300005367 Bacteria 17328
131 Ga0070667_100043014 3300005367 Bacteria 3790
132 Ga0070667_100073422 3300005367 Bacteria 2917
133 Ga0070701_10048444 3300005438 Bacteria 2193
134 Ga0070701_10052507 3300005438 Bacteria 2118
135 Ga0070663_100001508 3300005455 Bacteria 12800
136 Ga0070663_100164863 3300005455 Bacteria 1708
137 Ga0070663_100289878 3300005455 Bacteria 1307
138 Ga0070678_100042361 3300005456 Bacteria 3235
139 Ga0070678_100239075 3300005456 Bacteria 1518
140 Ga0070662_100139537 3300005457 Bacteria 1877
141 Ga0068867_100000075 3300005459 Bacteria 60780
142 Ga0068867_100004516 3300005459 Bacteria 9782
143 Ga0068867_100052915 3300005459 Bacteria 2997
144 Ga0070685_10033319 3300005466 Bacteria 2893
145 Ga0070699_100081980 3300005518 Bacteria 2811
146 Ga0070679_100004815 3300005530 Bacteria 12449
147 Ga0068853_100001060 3300005539 Bacteria 19412
148 Ga0068853_100049008 3300005539 Bacteria 3628
149 Ga0068853_100073836 3300005539 Bacteria 2975
150 Ga0068853_100077413 3300005539 Bacteria 2905
151 Ga0068853_100116555 3300005539 Bacteria 2378
152 Ga0068853_100262304 3300005539 Bacteria 1589
153 Ga0070672_100001641 3300005543 Bacteria 13922
154 Ga0070672_100003671 3300005543 Bacteria 9971
155 Ga0070672_100004734 3300005543 Bacteria 8930
156 Ga0070672_100005245 3300005543 Bacteria 8576
157 Ga0070672_100074130 3300005543 Bacteria 2714
158 Ga0070672_100084253 3300005543 Bacteria 2552
159 Ga0070686_100024242 3300005544 Bacteria 3635
160 Ga0070693_100070910 3300005547 Bacteria 2051
161 Ga0070693_100157860 3300005547 Bacteria 1442
162 Ga0070665_100005152 3300005548 Bacteria 13528
163 Ga0068855_100000053 3300005563 Bacteria 139838
164 Ga0068855_100034008 3300005563 Bacteria 6080
165 Ga0068855_100061077 3300005563 Bacteria 4404
166 Ga0068855_100105499 3300005563 Bacteria 3240
167 Ga0068855_100110454 3300005563 Bacteria 3157
168 Ga0068855_100157746 3300005563 Bacteria 2577
169 Ga0068855_100245099 3300005563 Bacteria 2000
170 Ga0068857_100006699 3300005577 Bacteria 9905
171 Ga0068857_100025689 3300005577 Bacteria 5186
172 Ga0068857_100029106 3300005577 Bacteria 4874
173 Ga0068857_100059251 3300005577 Bacteria 3401
174 Ga0068857_100063359 3300005577 Bacteria 3286
175 Ga0068857_100256555 3300005577 Bacteria 1604
176 Ga0068854_100024277 3300005578 Bacteria 4148
177 Ga0068854_100194321 3300005578 Bacteria 1592
178 Ga0068856_100004596 3300005614 Bacteria 13731
179 Ga0068856_100009244 3300005614 Bacteria 9581
180 Ga0068856_100019140 3300005614 Bacteria 6646
181 Ga0068856_100152922 3300005614 Bacteria 2317
182 Ga0068852_100009046 3300005616 Bacteria 7373
183 Ga0068852_100013706 3300005616 Bacteria 6212
184 Ga0068852_100029640 3300005616 Bacteria 4498
185 Ga0068852_100062333 3300005616 Bacteria 3243
186 Ga0068852_100080389 3300005616 Bacteria 2890
187 Ga0068852_100126287 3300005616 Bacteria 2350
188 Ga0068852_100341027 3300005616 Bacteria 1460
189 Ga0068852_100390619 3300005616 Bacteria 1367
190 Ga0068852_100413811 3300005616 Bacteria 1329
191 Ga0068859_100030448 3300005617 Bacteria 5416
192 Ga0068859_100036141 3300005617 Bacteria 4958
193 Ga0068864_100005872 3300005618 Bacteria 10058
194 Ga0068864_100038650 3300005618 Bacteria 4076
195 Ga0068864_100039936 3300005618 Bacteria 4012
196 Ga0068864_100070497 3300005618 Bacteria 3041
197 Ga0068861_100006393 3300005719 Bacteria 8026
198 Ga0068861_100069629 3300005719 Bacteria 2722
199 Ga0068851_10000798 3300005834 Bacteria 13610
200 Ga0068851_10012368 3300005834 Bacteria 4022
201 Ga0068851_10027814 3300005834 Bacteria 2789
202 Ga0068870_10075073 3300005840 Bacteria 1854
203 Ga0068863_100031259 3300005841 Bacteria 5082
204 Ga0068863_100120962 3300005841 Bacteria 2496
205 Ga0068863_100399695 3300005841 Bacteria 1344
206 Ga0068858_100015518 3300005842 Bacteria 7163
207 Ga0068858_100028086 3300005842 Bacteria 5228
208 Ga0068858_100154651 3300005842 Bacteria 2158
209 Ga0068860_100004889 3300005843 Bacteria 13658
210 Ga0068860_100131535 3300005843 Bacteria 2402
211 Ga0068862_100031328 3300005844 Bacteria 4488
212 Ga0068862_100048416 3300005844 Bacteria 3628
213 Ga0068862_100113320 3300005844 Bacteria 2382
214 Ga0070717_10109168 3300006028 Bacteria 2358
215 Ga0075365_10000391 3300006038 Bacteria 16028
216 Ga0075365_10217231 3300006038 Bacteria 1341
217 Ga0075368_10092899 3300006042 Bacteria 1235
218 Ga0075363_100005949 3300006048 Bacteria 5498
219 Ga0075363_100062755 3300006048 Bacteria 2004
220 Ga0075364_10031732 3300006051 Bacteria 3394
221 Ga0075432_10012491 3300006058 Bacteria 2884
222 Ga0070716_100193136 3300006173 Bacteria 1347
223 Ga0075362_10004042 3300006177 Bacteria 5223
224 Ga0075362_10021972 3300006177 Bacteria 2684
225 Ga0075362_10040615 3300006177 Bacteria 2049
226 Ga0075362_10052264 3300006177 Bacteria 1830
227 Ga0075362_10093321 3300006177 Bacteria 1399
228 Ga0075367_10020571 3300006178 Bacteria 3678
229 Ga0075367_10031443 3300006178 Bacteria 3048
230 Ga0075367_10046027 3300006178 Bacteria 2562
231 Ga0075366_10004396 3300006195 Bacteria 7562
232 Ga0075366_10008531 3300006195 Bacteria 5701
233 Ga0075366_10043503 3300006195 Bacteria 2660
234 Ga0075366_10092749 3300006195 Bacteria 1810
235 Ga0097621_100031589 3300006237 Bacteria 4203
236 Ga0097621_100045454 3300006237 Bacteria 3547
237 Ga0075370_10001340 3300006353 Bacteria 10598
238 Ga0075370_10011101 3300006353 Bacteria 4723
239 Ga0068871_100069049 3300006358 Bacteria 2901
240 Ga0068871_100240107 3300006358 Bacteria 1575
241 Ga0075430_100263023 3300006846 Bacteria 1429
242 Ga0075429_100093307 3300006880 Bacteria 2625
243 Ga0068865_100004329 3300006881 Bacteria 8571
244 Ga0068865_100150344 3300006881 Bacteria 1766
245 Ga0068865_100174457 3300006881 Bacteria 1651
246 Ga0097620_100030449 3300006931 Bacteria 5416
247 Ga0097620_100036140 3300006931 Bacteria 4958
248 Ga0079104_1000003 3300006946 Bacteria 468966
249 Ga0079104_1000206 3300006946 Bacteria 82424
250 Ga0099826_10010052 3300006948 Bacteria 7078
251 Ga0105244_10014909 3300009036 Bacteria 4476
252 Ga0105250_10011778 3300009092 Bacteria 3624
253 Ga0105240_10000322 3300009093 Bacteria 90516
254 Ga0105240_10045295 3300009093 Bacteria 5582
255 Ga0105240_10089762 3300009093 Bacteria 3758
256 Ga0105240_10365953 3300009093 Bacteria 1632
257 Ga0105245_10117967 3300009098 Bacteria 2476
258 Ga0105247_10024198 3300009101 Bacteria 3658
259 Ga0105243_10000345 3300009148 Bacteria 49891
260 Ga0105243_10001128 3300009148 Bacteria 24226
261 Ga0105243_10001582 3300009148 Bacteria 19867
262 Ga0105243_10021799 3300009148 Bacteria 4865
263 Ga0105243_10219486 3300009148 Bacteria 1680
264 Ga0105241_10078966 3300009174 Bacteria 2572
265 Ga0105241_10237777 3300009174 Bacteria 1538
266 Ga0105248_10007460 3300009177 Bacteria 12000
267 Ga0105248_10112453 3300009177 Bacteria 3071
268 Ga0105248_10147445 3300009177 Bacteria 2655
269 Ga0105237_10001642 3300009545 Bacteria 29033
270 Ga0105237_10045032 3300009545 Bacteria 4442
271 Ga0105237_10063195 3300009545 Bacteria 3700
272 Ga0105237_10239786 3300009545 Bacteria 1814
273 Ga0105238_10017874 3300009551 Bacteria 7209
274 Ga0105238_10023025 3300009551 Bacteria 6351
275 Ga0105238_10077560 3300009551 Bacteria 3313
276 Ga0105238_10086017 3300009551 Bacteria 3131
277 Ga0105238_10091865 3300009551 Bacteria 3023
278 Ga0105238_10125303 3300009551 Bacteria 2548
279 Ga0105238_10228663 3300009551 Bacteria 1837
280 Ga0105239_10002917 3300010375 Bacteria 21363
281 Ga0105239_10035589 3300010375 Bacteria 5467
282 Ga0105239_10038176 3300010375 Bacteria 5263
283 Ga0105239_10162644 3300010375 Bacteria 2494
284 Ga0105246_10115303 3300011119 Bacteria 1981
285 Ga0157373_10009159 3300013100 Bacteria 7320
286 Ga0157373_10074167 3300013100 Bacteria 2400
287 Ga0157373_10102530 3300013100 Bacteria 2013
288 Ga0157371_10008934 3300013102 Bacteria 7933
289 Ga0157370_10017196 3300013104 Bacteria 7299
290 Ga0157370_10022666 3300013104 Bacteria 6249
291 Ga0157370_10194899 3300013104 Bacteria 1880
292 Ga0157369_10034649 3300013105 Bacteria 5538
293 Ga0157369_10048523 3300013105 Bacteria 4607
294 Ga0157369_10051168 3300013105 Bacteria 4470
295 Ga0171462_1026 3300013250 Bacteria 114045
296 Ga0157374_10187187 3300013296 Bacteria 2024
297 Ga0157374_10277895 3300013296 Bacteria 1653
298 Ga0163162_10012682 3300013306 Bacteria 8226
299 Ga0163162_10041220 3300013306 Bacteria 4619
300 Ga0163162_10081708 3300013306 Bacteria 3302
301 Ga0163162_10192958 3300013306 Bacteria 2165
302 Ga0157372_10016841 3300013307 Bacteria 7847
303 Ga0157372_10069543 3300013307 Bacteria 3959
304 Ga0157372_10072226 3300013307 Bacteria 3888
305 Ga0157372_10118949 3300013307 Bacteria 3032
306 Ga0157372_10358924 3300013307 Bacteria 1698
307 Ga0157375_10189844 3300013308 Bacteria 2209
308 Ga0157375_10217643 3300013308 Bacteria 2068
309 Ga0163163_10180340 3300014325 Bacteria 2159
310 Ga0163163_10248157 3300014325 Bacteria 1830
311 Ga0157380_10005359 3300014326 Bacteria 8964
312 Ga0157380_10033824 3300014326 Bacteria 3939
313 Ga0182008_10012396 3300014497 Bacteria 4500
314 Ga0182008_10016669 3300014497 Bacteria 3816
315 Ga0182008_10033465 3300014497 Bacteria 2578
316 Ga0182008_10034007 3300014497 Bacteria 2556
317 Ga0157377_10000743 3300014745 Bacteria 13483
318 Ga0157377_10061840 3300014745 Bacteria 2141
319 Ga0157379_10005615 3300014968 Bacteria 10780
320 Ga0157379_10168169 3300014968 Bacteria 1979
321 Ga0157379_10200451 3300014968 Bacteria 1805
322 Ga0157376_10047551 3300014969 Bacteria 3542
323 Ga0157376_10207333 3300014969 Bacteria 1807
324 Ga0157376_10301329 3300014969 Bacteria 1517
325 Ga0182006_1035323 3300015261 Bacteria 1994
326 Ga0182006_1048888 3300015261 Bacteria 1634
327 Ga0182007_10004007 3300015262 Bacteria 6794
328 Ga0182005_1011304 3300015265 Bacteria 2548
329 Ga0183362_10001 3300015683 Bacteria 2046624
330 Ga0163161_10003871 3300017792 Bacteria 10495
331 Ga0163161_10060364 3300017792 Bacteria 2760
332 Ga0163161_10083086 3300017792 Bacteria 2361
333 Ga0213872_10001975 3300021361 Bacteria 12491
334 Ga0213876_10041117 3300021384 Bacteria 2443
335 Ga0213875_10112838 3300021388 Bacteria 1269
336 Ga0209435_100010 3300025206 Bacteria 475373
337 Ga0209436_103411 3300025208 Bacteria 4238
338 Ga0209672_101934 3300025228 Bacteria 5874
339 Ga0209147_100874 3300025229 Bacteria 13857
340 Ga0209563_100005 3300025230 Bacteria 1774893
341 Ga0207427_101542 3300025231 Bacteria 8051
342 Ga0209258_100018 3300025242 Bacteria 567561
343 Ga0209258_100171 3300025242 Bacteria 145035
344 Ga0209258_100621 3300025242 Bacteria 28085
345 Ga0207425_1000195 3300025245 Bacteria 48597
346 Ga0207425_1003463 3300025245 Bacteria 5043
347 Ga0209646_1000001 3300025246 Bacteria 3092932
348 Ga0209646_1000089 3300025246 Bacteria 189974
349 Ga0209026_1000001 3300025250 Bacteria 1228671
350 Ga0209026_1000028 3300025250 Bacteria 341399
351 Ga0209677_100066 3300025253 Bacteria 149370
352 Ga0209148_1000030 3300025254 Bacteria 567582
353 Ga0209759_1000001 3300025256 Bacteria 2799452
354 Ga0209759_1000021 3300025256 Bacteria 341399
355 Ga0209759_1002216 3300025256 Bacteria 8874
356 Ga0209129_1000043 3300025258 Bacteria 298978
357 Ga0209129_1000427 3300025258 Bacteria 31797
358 Ga0209565_1000088 3300025263 Bacteria 151644
359 Ga0209565_1000102 3300025263 Bacteria 127545
360 Ga0209455_1000148 3300025272 Bacteria 131958
361 Ga0209673_1000064 3300025273 Bacteria 254712
362 Ga0209673_1000189 3300025273 Bacteria 123470
363 Ga0209673_1008134 3300025273 Bacteria 4713
364 Ga0209673_1010544 3300025273 Bacteria 3887
365 Ga0209673_1032068 3300025273 Bacteria 1624
366 Ga0209130_1000141 3300025284 Bacteria 115378
367 Ga0209130_1000226 3300025284 Bacteria 73970
368 Ga0209130_1001229 3300025284 Bacteria 18011
369 Ga0209130_1001786 3300025284 Bacteria 12651
370 Ga0209675_1000036 3300025291 Bacteria 254712
371 Ga0209675_1000288 3300025291 Bacteria 47740
372 Ga0209675_1001448 3300025291 Bacteria 13708
373 Ga0209675_1003322 3300025291 Bacteria 7728
374 Ga0209675_1015231 3300025291 Bacteria 2296
375 Ga0209676_1000069 3300025292 Bacteria 312462
376 Ga0209676_1000302 3300025292 Bacteria 99000
377 Ga0209676_1000538 3300025292 Bacteria 58756
378 Ga0209676_1004738 3300025292 Bacteria 7438
379 Ga0209676_1017930 3300025292 Bacteria 2485
380 Ga0209025_1000016 3300025294 Bacteria 770739
381 Ga0209025_1000238 3300025294 Bacteria 128478
382 Ga0209025_1000343 3300025294 Bacteria 101870
383 Ga0209025_1005774 3300025294 Bacteria 9926
384 Ga0209025_1006771 3300025294 Bacteria 8789
385 Ga0209025_1026317 3300025294 Bacteria 2925
386 Ga0209025_1030521 3300025294 Bacteria 2579
387 Ga0209025_1047038 3300025294 Bacteria 1767
388 Ga0209025_1051210 3300025294 Bacteria 1643
389 Ga0209564_1000014 3300025295 Bacteria 621501
390 Ga0209564_1000075 3300025295 Bacteria 285760
391 Ga0209564_1000076 3300025295 Bacteria 283602
392 Ga0209564_1000415 3300025295 Bacteria 75119
393 Ga0209564_1000575 3300025295 Bacteria 58260
394 Ga0209758_1000093 3300025297 Bacteria 241169
395 Ga0209758_1000126 3300025297 Bacteria 189761
396 Ga0209758_1000402 3300025297 Bacteria 74399
397 Ga0209758_1025438 3300025297 Bacteria 2598
398 Ga0209050_1000023 3300025298 Bacteria 537172
399 Ga0209050_1000851 3300025298 Bacteria 41579
400 Ga0209050_1003418 3300025298 Bacteria 11746
401 Ga0209050_1005580 3300025298 Bacteria 7822
402 Ga0209050_1008334 3300025298 Bacteria 5566
403 Ga0209256_1000003 3300025299 Bacteria 1661127
404 Ga0209256_1000036 3300025299 Bacteria 386664
405 Ga0209256_1000083 3300025299 Bacteria 221460
406 Ga0209256_1001241 3300025299 Bacteria 28284
407 Ga0207426_1000145 3300025302 Bacteria 191065
408 Ga0207426_1002446 3300025302 Bacteria 11856
409 Ga0209051_1000017 3300025303 Bacteria 537172
410 Ga0209051_1000101 3300025303 Bacteria 163793
411 Ga0209051_1000173 3300025303 Bacteria 117170
412 Ga0209051_1000242 3300025303 Bacteria 91755
413 Ga0209051_1000820 3300025303 Bacteria 32203
414 Ga0209051_1004138 3300025303 Bacteria 9077
415 Ga0209257_1000041 3300025304 Bacteria 537172
416 Ga0209257_1000096 3300025304 Bacteria 259390
417 Ga0209257_1000149 3300025304 Bacteria 192835
418 Ga0209257_1007739 3300025304 Bacteria 6398
419 Ga0209257_1020139 3300025304 Bacteria 2479
420 Ga0207697_10056993 3300025315 Bacteria 1622
421 Ga0207656_10002344 3300025321 Bacteria 6358
422 Ga0207656_10003086 3300025321 Bacteria 5699
423 Ga0207656_10038605 3300025321 Bacteria 2016
424 Ga0207682_10043507 3300025893 Bacteria 1838
425 Ga0207642_10050674 3300025899 Bacteria 1874
426 Ga0207710_10014263 3300025900 Bacteria 3348
427 Ga0207688_10052395 3300025901 Bacteria 2286
428 Ga0207688_10102116 3300025901 Bacteria 1657
429 Ga0207680_10044927 3300025903 Bacteria 2601
430 Ga0207680_10061617 3300025903 Bacteria 2289
431 Ga0207699_10040840 3300025906 Bacteria 2676
432 Ga0207645_10037609 3300025907 Bacteria 3105
433 Ga0207645_10050869 3300025907 Bacteria 2646
434 Ga0207705_10069044 3300025909 Bacteria 2559
435 Ga0207684_10002973 3300025910 Bacteria 16792
436 Ga0207695_10004077 3300025913 Bacteria 20085
437 Ga0207695_10015442 3300025913 Bacteria 8990
438 Ga0207695_10042012 3300025913 Bacteria 4888
439 Ga0207671_10000168 3300025914 Bacteria 100117
440 Ga0207671_10133479 3300025914 Bacteria 1907
441 Ga0207671_10160866 3300025914 Bacteria 1739
442 Ga0207662_10012394 3300025918 Bacteria 4746
443 Ga0207662_10100047 3300025918 Bacteria 1795
444 Ga0207662_10113367 3300025918 Bacteria 1693
445 Ga0207657_10034044 3300025919 Bacteria 4586
446 Ga0207657_10054750 3300025919 Bacteria 3448
447 Ga0207657_10131964 3300025919 Bacteria 2047
448 Ga0207649_10001238 3300025920 Bacteria 15279
449 Ga0207649_10014631 3300025920 Bacteria 4397
450 Ga0207649_10016297 3300025920 Bacteria 4187
451 Ga0207649_10053615 3300025920 Bacteria 2507
452 Ga0207649_10076378 3300025920 Bacteria 2155
453 Ga0207681_10001781 3300025923 Bacteria 13828
454 Ga0207681_10023829 3300025923 Bacteria 3920
455 Ga0207681_10252894 3300025923 Bacteria 1376
456 Ga0207694_10031500 3300025924 Bacteria 4052
457 Ga0207694_10093249 3300025924 Bacteria 2378
458 Ga0207650_10010289 3300025925 Bacteria 6413
459 Ga0207650_10014168 3300025925 Bacteria 5538
460 Ga0207650_10027615 3300025925 Bacteria 4064
461 Ga0207659_10010026 3300025926 Bacteria 5933
462 Ga0207659_10025707 3300025926 Bacteria 3961
463 Ga0207659_10058000 3300025926 Bacteria 2778
464 Ga0207659_10060715 3300025926 Bacteria 2722
465 Ga0207687_10050002 3300025927 Bacteria 2909
466 Ga0207644_10004445 3300025931 Bacteria 9104
467 Ga0207644_10036765 3300025931 Bacteria 3439
468 Ga0207644_10090387 3300025931 Bacteria 2281
469 Ga0207644_10096075 3300025931 Bacteria 2217
470 Ga0207644_10191658 3300025931 Bacteria 1607
471 Ga0207690_10073175 3300025932 Bacteria 2369
472 Ga0207690_10096992 3300025932 Bacteria 2097
473 Ga0207690_10302826 3300025932 Bacteria 1251
474 Ga0207706_10002128 3300025933 Bacteria 19389
475 Ga0207706_10015279 3300025933 Bacteria 6944
476 Ga0207706_10121557 3300025933 Bacteria 2296
477 Ga0207686_10045156 3300025934 Bacteria 2710
478 Ga0207709_10000032 3300025935 Bacteria 324478
479 Ga0207709_10000094 3300025935 Bacteria 137959
480 Ga0207709_10000784 3300025935 Bacteria 24867
481 Ga0207709_10003063 3300025935 Bacteria 10106
482 Ga0207709_10003619 3300025935 Bacteria 9131
483 Ga0207670_10001093 3300025936 Bacteria 14291
484 Ga0207670_10024696 3300025936 Bacteria 3760
485 Ga0207669_10043462 3300025937 Bacteria 2632
486 Ga0207669_10060909 3300025937 Bacteria 2316
487 Ga0207704_10002831 3300025938 Bacteria 7827
488 Ga0207704_10067883 3300025938 Bacteria 2246
489 Ga0207704_10076032 3300025938 Bacteria 2150
490 Ga0207691_10001442 3300025940 Bacteria 23711
491 Ga0207691_10002041 3300025940 Bacteria 19750
492 Ga0207691_10004983 3300025940 Bacteria 12809
493 Ga0207691_10009965 3300025940 Bacteria 9126
494 Ga0207691_10018437 3300025940 Bacteria 6615
495 Ga0207691_10077884 3300025940 Bacteria 2985
496 Ga0207691_10082574 3300025940 Bacteria 2886
497 Ga0207691_10232322 3300025940 Bacteria 1597
498 Ga0207711_10011487 3300025941 Bacteria 7362
499 Ga0207711_10018674 3300025941 Bacteria 5765
500 Ga0207711_10024119 3300025941 Bacteria 5091
501 Ga0207711_10038494 3300025941 Bacteria 4067
502 Ga0207711_10092517 3300025941 Bacteria 2661
503 Ga0207711_10142903 3300025941 Bacteria 2154
504 Ga0207689_10014447 3300025942 Bacteria 6716
505 Ga0207689_10022136 3300025942 Bacteria 5345
506 Ga0207689_10030620 3300025942 Bacteria 4484
507 Ga0207661_10070932 3300025944 Bacteria 2845
508 Ga0207661_10079969 3300025944 Bacteria 2696
509 Ga0207679_10003824 3300025945 Bacteria 9330
510 Ga0207667_10000698 3300025949 Bacteria 43531
511 Ga0207667_10001661 3300025949 Bacteria 28046
512 Ga0207667_10002223 3300025949 Bacteria 24360
513 Ga0207667_10086692 3300025949 Bacteria 3240
514 Ga0207667_10092740 3300025949 Bacteria 3119
515 Ga0207651_10007547 3300025960 Bacteria 5802
516 Ga0207651_10017350 3300025960 Bacteria 4251
517 Ga0207712_10022271 3300025961 Bacteria 4170
518 Ga0207712_10022799 3300025961 Bacteria 4126
519 Ga0207712_10106287 3300025961 Bacteria 2096
520 Ga0207668_10003415 3300025972 Bacteria 9315
521 Ga0207668_10168538 3300025972 Bacteria 1715
522 Ga0207640_10033012 3300025981 Bacteria 3215
523 Ga0207640_10053241 3300025981 Bacteria 2641
524 Ga0207640_10073416 3300025981 Bacteria 2312
525 Ga0207658_10001577 3300025986 Bacteria 17634
526 Ga0207658_10004517 3300025986 Bacteria 9669
527 Ga0207658_10283328 3300025986 Bacteria 1421
528 Ga0207677_10022572 3300026023 Bacteria 3871
529 Ga0207677_10033296 3300026023 Bacteria 3323
530 Ga0207703_10001878 3300026035 Bacteria 18670
531 Ga0207703_10035246 3300026035 Bacteria 3976
532 Ga0207639_10106692 3300026041 Bacteria 2274
533 Ga0207639_10122952 3300026041 Bacteria 2135
534 Ga0207678_10004159 3300026067 Bacteria 12993
535 Ga0207678_10017786 3300026067 Bacteria 6242
536 Ga0207678_10081702 3300026067 Bacteria 2766
537 Ga0207678_10124242 3300026067 Bacteria 2202
538 Ga0207678_10213366 3300026067 Bacteria 1652
539 Ga0207708_10028301 3300026075 Bacteria 4245
540 Ga0207702_10000877 3300026078 Bacteria 31301
541 Ga0207702_10034976 3300026078 Bacteria 4201
542 Ga0207702_10068520 3300026078 Bacteria 3048
543 Ga0207641_10002805 3300026088 Bacteria 15850
544 Ga0207641_10021538 3300026088 Bacteria 5297
545 Ga0207641_10127974 3300026088 Bacteria 2276
546 Ga0207648_10001842 3300026089 Bacteria 23196
547 Ga0207648_10028775 3300026089 Bacteria 4926
548 Ga0207648_10059188 3300026089 Bacteria 3341
549 Ga0207648_10122431 3300026089 Bacteria 2287
550 Ga0207648_10417211 3300026089 Bacteria 1218
551 Ga0207676_10002802 3300026095 Bacteria 12393
552 Ga0207676_10003791 3300026095 Bacteria 10690
553 Ga0207676_10072578 3300026095 Bacteria 2767
554 Ga0207674_10018453 3300026116 Bacteria 7581
555 Ga0207674_10168100 3300026116 Bacteria 2146
556 Ga0207674_10465021 3300026116 Bacteria 1222
557 Ga0207675_100000428 3300026118 Bacteria 40700
558 Ga0207675_100003768 3300026118 Bacteria 14772
559 Ga0207675_100374214 3300026118 Bacteria 1400
560 Ga0207683_10015545 3300026121 Bacteria 6481
561 Ga0207683_10050837 3300026121 Bacteria 3631
562 Ga0207683_10123727 3300026121 Bacteria 2323
563 Ga0207683_10283276 3300026121 Bacteria 1515
564 Ga0207698_10006186 3300026142 Bacteria 7452
565 Ga0207698_10026324 3300026142 Bacteria 4113
566 Ga0207698_10044256 3300026142 Bacteria 3343
567 Ga0207698_10058171 3300026142 Bacteria 2995
568 Ga0207698_10120262 3300026142 Bacteria 2221
569 Ga0209281_1000002 3300027111 Bacteria 1924012
570 Ga0209281_1000259 3300027111 Bacteria 101905
571 Ga0209968_1008498 3300027526 Bacteria 1565
572 Ga0209282_1000253 3300027666 Bacteria 26889
573 Ga0268266_10000691 3300028379 Bacteria 45474
574 Ga0268265_10060503 3300028380 Bacteria 2903
575 Ga0268265_10082447 3300028380 Bacteria 2543
576 Ga0268264_10004642 3300028381 Bacteria 11672
577 Ga0268264_10005729 3300028381 Bacteria 10529
578 Ga0268264_10174207 3300028381 Bacteria 1948
579 Ga0265334_10005111 3300028573 Bacteria 5747
580 Ga0265336_10000028 3300028666 Bacteria 179201
581 Ga0265336_10024599 3300028666 Bacteria 1900
582 Ga0307517_10051884 3300028786 Bacteria 4126
583 Ga0307517_10142783 3300028786 Bacteria 1674
584 Ga0307515_10000160 3300028794 Bacteria 164789
585 Ga0307515_10000184 3300028794 Bacteria 153952
586 Ga0307515_10006930 3300028794 Bacteria 22516
587 Ga0307515_10049623 3300028794 Bacteria 6306
588 Ga0307515_10091314 3300028794 Bacteria 3806
589 Ga0307515_10098849 3300028794 Bacteria 3549
590 Ga0265338_10008192 3300028800 Bacteria 12738
591 Ga0265324_10001001 3300029957 Bacteria 17367
592 Ga0307511_10078378 3300030521 Bacteria 2344
593 Ga0307512_10003982 3300030522 Bacteria 16512
594 Ga0265330_10001213 3300031235 Bacteria 15203
595 Ga0265330_10007925 3300031235 Bacteria 5147
596 Ga0265332_10000005 3300031238 Bacteria 377525
597 Ga0265332_10000011 3300031238 Bacteria 284299
598 Ga0265332_10000107 3300031238 Bacteria 70652
599 Ga0265332_10006627 3300031238 Bacteria 5247
600 Ga0265328_10000266 3300031239 Bacteria 24085
601 Ga0265320_10004067 3300031240 Bacteria 9611
602 Ga0265320_10005009 3300031240 Bacteria 8584
603 Ga0265325_10001526 3300031241 Bacteria 16238
604 Ga0265325_10004976 3300031241 Bacteria 8280
605 Ga0265325_10072892 3300031241 Bacteria 1720
606 Ga0265329_10000288 3300031242 Bacteria 26582
607 Ga0265339_10002899 3300031249 Bacteria 12141
608 Ga0265339_10020302 3300031249 Bacteria 3883
609 Ga0265339_10035027 3300031249 Bacteria 2819
610 Ga0265331_10002501 3300031250 Bacteria 12411
611 Ga0265331_10003107 3300031250 Bacteria 10866
612 Ga0265331_10039049 3300031250 Bacteria 2317
613 Ga0265327_10000083 3300031251 Bacteria 204923
614 Ga0265327_10000572 3300031251 Bacteria 62611
615 Ga0265327_10037034 3300031251 Bacteria 2675
616 Ga0265316_10000233 3300031344 Bacteria 64109
617 Ga0265316_10040621 3300031344 Bacteria 3728
618 Ga0307513_10000004 3300031456 Bacteria 558931
619 Ga0307513_10000015 3300031456 Bacteria 296183
620 Ga0307509_10004068 3300031507 Bacteria 21447
621 Ga0307509_10135853 3300031507 Bacteria 2405
622 Ga0307408_100017758 3300031548 Bacteria 4767
623 Ga0307408_100042107 3300031548 Bacteria 3241
624 Ga0307408_100061447 3300031548 Bacteria 2743
625 Ga0307408_100083595 3300031548 Bacteria 2392
626 Ga0307408_100172818 3300031548 Bacteria 1727
627 Ga0307408_100293704 3300031548 Bacteria 1358
628 Ga0265313_10000107 3300031595 Bacteria 83816
629 Ga0265313_10004965 3300031595 Bacteria 9954
630 Ga0265313_10057166 3300031595 Bacteria 1842
631 Ga0265313_10057731 3300031595 Bacteria 1830
632 Ga0307508_10030221 3300031616 Bacteria 4896
633 Ga0307508_10069430 3300031616 Bacteria 3095
634 Ga0307514_10011139 3300031649 Bacteria 7485
635 Ga0265314_10000026 3300031711 Bacteria 284299
636 Ga0265314_10000677 3300031711 Bacteria 41527
637 Ga0265314_10002021 3300031711 Bacteria 21531
638 Ga0265314_10004697 3300031711 Bacteria 12543
639 Ga0265314_10009030 3300031711 Bacteria 8473
640 Ga0265314_10022612 3300031711 Bacteria 4815
641 Ga0265342_10000862 3300031712 Bacteria 30245
642 Ga0265342_10001343 3300031712 Bacteria 23075
643 Ga0265342_10005935 3300031712 Bacteria 9195
644 Ga0265342_10090259 3300031712 Bacteria 1757
645 Ga0265342_10099371 3300031712 Bacteria 1660
646 Ga0307516_10000283 3300031730 Bacteria 65833
647 Ga0307516_10000460 3300031730 Bacteria 53821
648 Ga0307516_10001460 3300031730 Bacteria 32683
649 Ga0307516_10014862 3300031730 Bacteria 8218
650 Ga0307516_10049562 3300031730 Bacteria 4126
651 Ga0307516_10058753 3300031730 Bacteria 3742
652 Ga0307516_10094383 3300031730 Bacteria 2816
653 Ga0307516_10257922 3300031730 Bacteria 1435
654 Ga0307405_10007945 3300031731 Bacteria 5348
655 Ga0307405_10045380 3300031731 Bacteria 2692
656 Ga0307405_10054409 3300031731 Bacteria 2498
657 Ga0307410_10048747 3300031852 Bacteria 2839
658 Ga0307406_10012802 3300031901 Bacteria 4789
659 Ga0307406_10038475 3300031901 Bacteria 2961
660 Ga0307412_10007984 3300031911 Bacteria 6033
661 Ga0307412_10022011 3300031911 Bacteria 3901
662 Ga0307412_10080308 3300031911 Bacteria 2252
663 Ga0307412_10252181 3300031911 Bacteria 1371
664 Ga0307409_100003565 3300031995 Bacteria 8492
665 Ga0307409_100163369 3300031995 Bacteria 1951
666 Ga0307416_100006952 3300032002 Bacteria 7134
667 Ga0307416_100011019 3300032002 Bacteria 6005
668 Ga0307414_10098932 3300032004 Bacteria 2190
669 Ga0307414_10134686 3300032004 Bacteria 1924
670 Ga0307414_10275483 3300032004 Bacteria 1411
671 Ga0307411_10036214 3300032005 Bacteria 3089
672 Ga0307411_10042402 3300032005 Bacteria 2903
673 Ga0307411_10159457 3300032005 Bacteria 1687
674 Ga0307415_100015925 3300032126 Bacteria 4465
675 Ga0307507_10082017 3300033179 Bacteria 2831
676 Ga0307510_10087595 3300033180 Bacteria 2978
677 Ga0373934_0034716 3300035086 Bacteria 1982
678 Ga0373956_0024775 3300035119 Bacteria 2589
679 Ga0373956_0104117 3300035119 Bacteria 1318
680 Ga0373957_0006535 3300035120 Bacteria 3676
681 Ga0373955_0002467 3300035172 Bacteria 8083
682 Ga0373961_0000090 3300035241 Bacteria 49242
683 Ga0373931_0019318 3300035691 Bacteria 3401
684 Ga0373935_0034573 3300035692 Bacteria 3151
685 Ga0373935_0188446 3300035692 Bacteria 1420
686 Ga0373935_0220091 3300035692 Bacteria 1318
687 Ga0373933_0013190 3300035724 Bacteria 4577
688 Ga0373937_0033494 3300036401 Bacteria 4666
689 Ga0373937_0138556 3300036401 Bacteria 2275
690 Ga0373925_0003169 3300037068 Bacteria 12875
691 Ga0373925_0033870 3300037068 Bacteria 3764
692 Ga0395899_0014940 3300037312 Bacteria 5921
693 Ga0395899_0016191 3300037312 Bacteria 5683
694 Ga0395899_0017939 3300037312 Bacteria 5385
695 Ga0395899_0126367 3300037312 Bacteria 1828
696 Ga0395900_0014879 3300037418 Bacteria 7927
697 Ga0395900_0029863 3300037418 Bacteria 5595
698 Ga0395900_0071458 3300037418 Bacteria 3567
699 Ga0395900_0289727 3300037418 Bacteria 1626
700 Ga0395898_0024397 3300037466 Bacteria 6098
701 Ga0395898_0064013 3300037466 Bacteria 3567
702 Ga0395898_0093693 3300037466 Bacteria 2886
703 Ga0395898_0325328 3300037466 Bacteria 1466
704 Ga0395905_0000025 3300037471 Bacteria 317571
705 Ga0395905_0007656 3300037471 Bacteria 10722
706 Ga0395905_0027223 3300037471 Bacteria 5391
707 Ga0395905_0051557 3300037471 Bacteria 3854
708 Ga0395905_0114538 3300037471 Bacteria 2533
709 Ga0395905_0213236 3300037471 Bacteria 1809
710 Ga0395905_0311935 3300037471 Bacteria 1461
711 Ga0436364_0268395 3300037853 Bacteria 3994
712 Ga0395901_0015016 3300038443 Bacteria 7873
713 Ga0395901_0047183 3300038443 Bacteria 4472
714 Ga0395901_0063804 3300038443 Bacteria 3834
715 Ga0395901_0077770 3300038443 Bacteria 3463
716 Ga0395901_0265053 3300038443 Bacteria 1787
717 Ga0436365_0431674 3300039437 Bacteria 3115
718 Ga0436361_1170859 3300039447 Bacteria 26091
719 Ga0436363_0015497 3300039450 Bacteria 1693
720 Ga0436363_1073622 3300039450 Bacteria 13302
721 Ga0439465_0011137 3300041413 Bacteria 2823
722 Ga0439465_0024201 3300041413 Bacteria 1914
723 Ga0439433_0002359 3300041999 Bacteria 4001
724 Ga0439432_007426 3300042006 Bacteria 3885
725 Ga0439432_018979 3300042006 Bacteria 2294
726 Ga0439449_0000714 3300042007 Bacteria 12712
727 Ga0439449_0000777 3300042007 Bacteria 12288
728 Ga0439449_0052701 3300042007 Bacteria 1504
729 Ga0439457_010176 3300042014 Bacteria 2169
730 Ga0450923_003039 3300042125 Bacteria 2486
731 Ga0450923_011882 3300042125 Bacteria 1576
732 Ga0439446_0008693 3300042156 Bacteria 2704
733 Ga0439434_0016742 3300042435 Bacteria 2191
734 Ga0439434_0033373 3300042435 Bacteria 1568
735 Ga0450918_000716 3300042531 Bacteria 7029
736 Ga0450918_001165 3300042531 Bacteria 5394
737 Ga0451577_0000419 3300042876 Bacteria 76708
738 Ga0451577_0034859 3300042876 Bacteria 4535
739 Ga0451577_0255491 3300042876 Bacteria 1586
740 Ga0439440_0044678 3300042993 Bacteria 1090
741 Ga0453683_0002969 3300044673 Bacteria 12730
742 Ga0466965_0043520 3300044683 Bacteria 2217
743 Ga0453684_0000475 3300044712 Bacteria 159174
744 Ga0453684_0008658 3300044712 Bacteria 18114
745 Ga0453684_0109098 3300044712 Bacteria 3367
746 Ga0453684_0136832 3300044712 Bacteria 2931
747 Ga0453684_0241678 3300044712 Bacteria 2078
748 Ga0466957_0062018 3300044842 Bacteria 2296
749 Ga0466957_0104831 3300044842 Bacteria 1786
750 Ga0466959_0032626 3300045049 Bacteria 3854
751 Ga0451576_0004269 3300045051 Bacteria 18733
752 Ga0451576_0006268 3300045051 Bacteria 14636
753 Ga0451576_0017617 3300045051 Bacteria 7850
754 Ga0451576_0041353 3300045051 Bacteria 4874
755 Ga0451576_0188376 3300045051 Bacteria 2154
756 Ga0451576_0242410 3300045051 Bacteria 1883
757 Ga0495592_0000427 3300046454 Bacteria 31839
758 Ga0495629_0052419 3300046459 Bacteria 2855
759 Ga0495638_0105043 3300046460 Bacteria 1684
760 Ga0495638_0109902 3300046460 Bacteria 1638
761 Ga0495650_0013525 3300046471 Bacteria 4309
762 Ga0495650_0029722 3300046471 Bacteria 2487
763 Ga0495580_0163083 3300046472 Bacteria 1542
764 Ga0495608_0080071 3300046511 Bacteria 2124
765 Ga0495610_0043351 3300046512 Bacteria 2242
766 Ga0495616_0005153 3300046513 Bacteria 8106
767 Ga0495618_0284723 3300046514 Bacteria 1030
768 Ga0495628_0082921 3300046516 Bacteria 2490
769 Ga0495631_0003589 3300046518 Bacteria 8459
770 Ga0495632_0005676 3300046519 Bacteria 8201
771 Ga0495609_0055994 3300046538 Bacteria 1748
772 Ga0495621_0022002 3300046539 Bacteria 2108
773 Ga0495633_0000499 3300046558 Bacteria 39590
774 Ga0495656_0000974 3300046615 Bacteria 9264
775 Ga0495625_0000116 3300046660 Bacteria 122740
776 Ga0495625_0106167 3300046660 Bacteria 1923
777 Ga0495647_0028409 3300046681 Bacteria 2062
778 Ga0495671_0023540 3300046692 Bacteria 3217
779 Ga0495676_0038995 3300047321 Bacteria 3940
780 Ga0495684_0285827 3300047471 Bacteria 1188
781 Ga0495686_0076358 3300047472 Bacteria 2053
782 Ga0495614_0027494 3300048089 Bacteria 2452
783 Ga0495615_0013138 3300048090 Bacteria 1724
784 Ga0495615_0017546 3300048090 Bacteria 1561
785 Ga0496100_0087961 3300048903 Bacteria 2114
786 Ga0496100_0150055 3300048903 Bacteria 1661
787 Ga0496101_0149882 3300048904 Bacteria 1783
788 Ga0496102_0261304 3300048905 Bacteria 1632
789 Ga0496103_0036091 3300048906 Bacteria 3027
790 Ga0496103_0079809 3300048906 Bacteria 2057
791 Ga0496104_0030814 3300048907 Bacteria 4987
792 Ga0496105_0129529 3300048908 Bacteria 2081
793 Ga0496106_0007537 3300048909 Bacteria 8050
794 Ga0496107_0040451 3300048910 Bacteria 3346
795 Ga0496108_0089223 3300048911 Bacteria 2620
796 Ga0496108_0151075 3300048911 Bacteria 2004
797 Ga0496110_0125259 3300048913 Bacteria 2318
798 Ga0496110_0169641 3300048913 Bacteria 1980
799 Ga0496110_0181775 3300048913 Bacteria 1909
800 Ga0496111_0011763 3300048914 Bacteria 5908
801 Ga0496111_0096795 3300048914 Bacteria 2166
802 Ga0496112_0007641 3300048915 Bacteria 9614
803 Ga0496112_0296716 3300048915 Bacteria 1562
804 Ga0496113_0162806 3300048916 Bacteria 1764
805 Ga0496114_0010850 3300048917 Bacteria 7254
806 Ga0496114_0011767 3300048917 Bacteria 7001
807 Ga0496115_0055645 3300048918 Bacteria 3178
808 Ga0496117_0032387 3300048920 Bacteria 3972
809 Ga0496117_0066002 3300048920 Bacteria 2457
810 Ga0496117_0071590 3300048920 Bacteria 2322
811 Ga0496121_0003381 3300048924 Bacteria 22854
812 Ga0496121_0048164 3300048924 Bacteria 3629
813 Ga0496121_0058857 3300048924 Bacteria 3172
814 Ga0496121_0080775 3300048924 Bacteria 2576
815 Ga0496122_0000199 3300048925 Bacteria 133898
816 Ga0496122_0091952 3300048925 Bacteria 2064
817 Ga0496122_0129012 3300048925 Bacteria 1612
818 Ga0496123_0000102 3300048926 Bacteria 169327
819 Ga0496123_0034202 3300048926 Bacteria 3645
820 Ga0496123_0058893 3300048926 Bacteria 2487
821 Ga0496124_0236700 3300048927 Bacteria 1361
822 Ga0496125_0000191 3300048928 Bacteria 131220
823 Ga0496125_0033962 3300048928 Bacteria 4504
824 Ga0496125_0054502 3300048928 Bacteria 3267
825 Ga0496126_0069392 3300048929 Bacteria 3144
826 Ga0501031_0001000 3300049568 Bacteria 17145
827 Ga0501031_0037108 3300049568 Bacteria 3179
828 Ga0501032_0011856 3300049569 Bacteria 6244
829 Ga0501032_0064379 3300049569 Bacteria 2454
830 Ga0501032_0092787 3300049569 Bacteria 2003
831 Ga0501033_0000118 3300049570 Bacteria 75690
832 Ga0501033_0001653 3300049570 Bacteria 19522
833 Ga0501033_0061988 3300049570 Bacteria 2754
834 Ga0501034_0006372 3300049571 Bacteria 12709
835 Ga0501034_0027612 3300049571 Bacteria 5772
836 Ga0501034_0058631 3300049571 Bacteria 3869
837 Ga0501034_0100073 3300049571 Bacteria 2893
838 Ga0501034_0110207 3300049571 Bacteria 2744
839 Ga0501034_0153478 3300049571 Bacteria 2278
840 Ga0501034_0158686 3300049571 Bacteria 2234
841 Ga0501034_0184881 3300049571 Bacteria 2048
842 Ga0501034_0221481 3300049571 Bacteria 1844
843 Ga0501034_0273341 3300049571 Bacteria 1630
844 Ga0501036_0009013 3300049572 Bacteria 8206
845 Ga0501036_0065490 3300049572 Bacteria 3075
846 Ga0501037_0032625 3300049573 Bacteria 3846
847 Ga0501037_0058309 3300049573 Bacteria 2818
848 Ga0501037_0166206 3300049573 Bacteria 1571
849 Ga0501037_0198866 3300049573 Bacteria 1417
850 Ga0501037_0238476 3300049573 Bacteria 1275
851 Ga0501038_0004201 3300049574 Bacteria 13375
852 Ga0501038_0040981 3300049574 Bacteria 4041
853 Ga0501038_0043927 3300049574 Bacteria 3884
854 Ga0501038_0202412 3300049574 Bacteria 1593
855 Ga0501039_0016917 3300049575 Bacteria 5590
856 Ga0501043_0000020 3300049579 Bacteria 155270
857 Ga0501043_0013069 3300049579 Bacteria 6490
858 Ga0501043_0225461 3300049579 Bacteria 1449
859 Ga0501046_0000039 3300049580 Bacteria 155237
860 Ga0501046_0024570 3300049580 Bacteria 4941
861 Ga0501046_0066538 3300049580 Bacteria 2808
862 Ga0501047_0000028 3300049581 Bacteria 220279
863 Ga0501047_0060747 3300049581 Bacteria 3646
864 Ga0501047_0073931 3300049581 Bacteria 3281
865 Ga0501047_0118126 3300049581 Bacteria 2533
866 Ga0501048_0013028 3300049582 Bacteria 6176
867 Ga0501048_0122017 3300049582 Bacteria 1841
868 Ga0501067_0001921 3300049583 Bacteria 11417
869 Ga0501068_0024687 3300049584 Bacteria 3531
870 Ga0501068_0033029 3300049584 Bacteria 3080
871 Ga0501068_0084659 3300049584 Bacteria 1950
872 Ga0501069_0000996 3300049585 Bacteria 13514
873 Ga0501070_0000091 3300049586 Bacteria 77270
874 Ga0501070_0007631 3300049586 Bacteria 9184
875 Ga0501070_0017398 3300049586 Bacteria 6035
876 Ga0501070_0068110 3300049586 Bacteria 2947
877 Ga0501070_0112556 3300049586 Bacteria 2249
878 Ga0501073_0000442 3300049589 Bacteria 28617
879 Ga0501073_0002814 3300049589 Bacteria 13022
880 Ga0501073_0021924 3300049589 Bacteria 4602
881 Ga0501198_000014 3300049649 Bacteria 106940
882 Ga0501222_000008 3300049662 Bacteria 120904
883 Ga0501080_0005715 3300049742 Bacteria 11126
884 Ga0501080_0007030 3300049742 Bacteria 10162
885 Ga0501080_0007562 3300049742 Bacteria 9823
886 Ga0501080_0035269 3300049742 Bacteria 4669
887 Ga0501080_0041922 3300049742 Bacteria 4264
888 Ga0501083_0003873 3300049744 Bacteria 10513
889 Ga0501083_0014743 3300049744 Bacteria 5465
890 Ga0501083_0039734 3300049744 Bacteria 3195
891 Ga0501265_002203 3300049762 Bacteria 2214
892 Ga0501035_0025411 3300049822 Bacteria 5430
893 Ga0501035_0039460 3300049822 Bacteria 4273
894 Ga0501035_0097077 3300049822 Bacteria 2588
895 Ga0501035_0125810 3300049822 Bacteria 2237
896 Ga0501035_0211314 3300049822 Bacteria 1660
897 Ga0501035_0266217 3300049822 Bacteria 1452
898 Ga0501044_0038555 3300049823 Bacteria 4989
899 Ga0501044_0056426 3300049823 Bacteria 4033
900 Ga0501044_0110475 3300049823 Bacteria 2758
901 Ga0501044_0259481 3300049823 Bacteria 1676
902 Ga0501045_0032103 3300049824 Bacteria 3804
903 nmdc:mga03683_23140_c1 3300050489 Bacteria 2417
904 nmdc:mga03n38_28314_c1 3300050490 Bacteria 2334
905 nmdc:mga03n38_34365_c1 3300050490 Bacteria 2165
906 nmdc:mga00v17_33528_c1 3300050491 Bacteria 3043
907 nmdc:mga0yw44_207857_c1 3300050492 Bacteria 1294
908 nmdc:mga0k408_134308_c1 3300050493 Bacteria 1470
909 nmdc:mga0k408_2458_c1 3300050493 Bacteria 9851
910 nmdc:mga0k408_6485_c1 3300050493 Bacteria 6236
911 nmdc:mga0k408_88724_c1 3300050493 Bacteria 1816
912 nmdc:mga06z11_46506_c1 3300050494 Bacteria 2199
913 nmdc:mga07m45_11158_c1 3300050496 Bacteria 4715
914 nmdc:mga07m45_24573_c1 3300050496 Bacteria 3303
915 nmdc:mga07m45_96238_c1 3300050496 Bacteria 1699
916 nmdc:mga09592_373938_c1 3300050508 Bacteria 1232
917 nmdc:mga09592_99406_c1 3300050508 Bacteria 2491
918 nmdc:mga0qj67_218414_c1 3300050509 Bacteria 1547
919 nmdc:mga0qj67_223933_c1 3300050509 Bacteria 1527
920 nmdc:mga0rr50_90162_c1 3300050513 Bacteria 2385
921 nmdc:mga0sz30_82214_c1 3300050516 Bacteria 1394
922 Ga0495612_0022924 3300053078 Bacteria 2503
923 Ga0500610_0063222 3300053079 Bacteria 1930
924 Ga0500635_0000114 3300053080 Bacteria 48114
925 Ga0495595_0027045 3300053084 Bacteria 2553
926 Ga0500578_0001658 3300053086 Bacteria 21440
927 Ga0500578_0056581 3300053086 Bacteria 2508
928 Ga0500578_0093078 3300053086 Bacteria 1912
929 Ga0500644_0009222 3300053088 Bacteria 2633
930 Ga0500646_0007852 3300053090 Bacteria 2727
931 Ga0500651_0001525 3300053093 Bacteria 11715
932 Ga0500651_0019791 3300053093 Bacteria 4187
933 Ga0500566_0049189 3300053094 Bacteria 2415
934 Ga0500566_0053255 3300053094 Bacteria 2310
935 Ga0500640_022510 3300053095 Bacteria 2725
936 Ga0500554_000402 3300053102 Bacteria 9186
937 Ga0500555_001398 3300053103 Bacteria 7450
938 Ga0500571_000343 3300053110 Bacteria 18323
939 Ga0500572_007428 3300053111 Bacteria 2537
940 Ga0500593_018896 3300053117 Bacteria 3010
941 Ga0500594_0003416 3300053118 Bacteria 3484
942 Ga0500595_000585 3300053119 Bacteria 21749
943 Ga0500607_000320 3300053121 Bacteria 45511
944 Ga0500607_098164 3300053121 Bacteria 1460
945 Ga0500628_001917 3300053129 Bacteria 3502
946 Ga0500642_0051369 3300053130 Bacteria 1821
947 Ga0500652_001532 3300053131 Bacteria 7082
948 Ga0500655_008233 3300053133 Bacteria 1876
949 Ga0500658_0005316 3300053134 Bacteria 4787
950 Ga0500559_0000666 3300053136 Bacteria 22968
951 Ga0500559_0010271 3300053136 Bacteria 4024
952 Ga0500559_0123005 3300053136 Bacteria 1207
953 Ga0500564_102132 3300053138 Bacteria 1266
954 Ga0500568_0010736 3300053139 Bacteria 4275
955 Ga0500568_0034123 3300053139 Bacteria 2083
956 Ga0500568_0067474 3300053139 Bacteria 1374
957 Ga0500585_058425 3300053144 Bacteria 1385
958 Ga0500603_014618 3300053150 Bacteria 1836
959 Ga0500604_0001217 3300053151 Bacteria 7170
960 Ga0500616_0046009 3300053153 Bacteria 2321
961 Ga0500616_0074266 3300053153 Bacteria 1724
962 Ga0500622_0000858 3300053156 Bacteria 25968
963 Ga0500622_0003925 3300053156 Bacteria 9619
964 Ga0500622_0076479 3300053156 Bacteria 1683
965 Ga0500634_0000002 3300053161 Bacteria 252372
966 Ga0500634_0024020 3300053161 Bacteria 3315
967 Ga0500638_062434 3300053162 Bacteria 1789
968 Ga0500636_0027915 3300053177 Bacteria 3334
969 Ga0501084_0126873 3300054114 Bacteria 2147
970 Ga0501084_0223768 3300054114 Bacteria 1588
971 Ga0501082_0012702 3300060353 Bacteria 7237
972 Ga0501082_0064532 3300060353 Bacteria 3153
973 Ga0501082_0074598 3300060353 Bacteria 2922
974 Ga0466962_0051578 3300061719 Bacteria 1967
975 2511245842 2511231002 Bacteria 5042903
976 2513231717 2513020051 Bacteria 6053213
977 2548498844 2547132374 Bacteria 5530232
978 2587728503 2585428057 Bacteria 6737412
979 2587735239 2585428058 Bacteria 6853932
980 2588290776 2588253510 Bacteria 6901809
981 2599625161 2599185214 Bacteria 8209958
982 2599673387 2599185226 Bacteria 8233575
983 2599683057 2599185227 Bacteria 8246414
984 2599694995 2599185229 Bacteria 8216126
985 2643867949 2643221570 Bacteria 5103772
986 2643964624 2643221591 Bacteria 4397626
987 2643971261 2643221592 Bacteria 6608788
988 2643991814 2643221596 Bacteria 5006805
989 2644058936 2643221609 Bacteria 6756331
990 2644139437 2643221625 Bacteria 6512927
991 2644158718 2643221628 Bacteria 5745828
992 2644167229 2643221629 Bacteria 5850260
993 2644248136 2643221644 Bacteria 6865017
994 2644272251 2643221648 Bacteria 6521465
995 2644293557 2643221652 Bacteria 5140275
996 2644302802 2643221654 Bacteria 5273570
997 2644328396 2643221658 Bacteria 6064537
998 2644349745 2643221662 Bacteria 5851492
999 2644397491 2643221672 Bacteria 6322190
1000 2644465451 2643221683 Bacteria 5749203
1001 2644648304 2643221717 Bacteria 5676132
1002 2644727740 2643221733 Bacteria 5690728
1003 2644733548 2643221734 Bacteria 5365412
1004 2644744544 2643221736 Bacteria 6608466
1005 2738722471 2738541277 Bacteria 7458140
1006 2739246193 2738543012 Bacteria 7115078
1007 2739283042 2738543019 Bacteria 7459457
1008 2816471428 2816332133 Bacteria 7249298
1009 2819600750 2818991446 Bacteria 7757362
1010 2819717192 2818991467 Bacteria 5893227
1011 2831267333 2831265667 Bacteria 7184833
1012 2837682501 2837678835 Bacteria 5252418
1013 2838060310 2838054893 Bacteria 7451788
1014 2841763244 2841760612 Bacteria 6454112
1015 2841917173 2841911363 Bacteria 6173697
1016 2841922794 2841917233 Bacteria 6173500
1017 2842677802 2842677519 Bacteria 5615038
1018 2842721234 2842718218 Bacteria 4560148
1019 2842739025 2842733646 Bacteria 5716726
1020 2842748714 2842747753 Bacteria 5578255
1021 2844108886 2844104063 Bacteria 6440972
1022 2851182490 2851182111 Bacteria 6047226
1023 2851250993 2851246043 Bacteria 6439203
1024 2885195296 2885192300 Bacteria 5882526
1025 2885198385 2885198086 Bacteria 7212419
1026 2885212235 2885211737 Bacteria 7212420
1027 2894024597 2894023352 Bacteria 5167372
1028 2899931698 2899924645 Bacteria 7487985
1029 2904452056 2904449895 Bacteria 6927402
1030 2904458798 2904456579 Bacteria 6819253
1031 2904482951 2904479285 Bacteria 5073931
1032 2904547541 2904541872 Bacteria 8915136
1033 2917701321 2917699015 Bacteria 7043791
1034 2919467662 2919462493 Bacteria 5817112
1035 2928043080 2928037797 Bacteria 7273642
1036 2928050261 2928044640 Bacteria 7271509
1037 2928056712 2928051484 Bacteria 7773759
1038 2928068828 2928064002 Bacteria 7419480
1039 2928075752 2928070936 Bacteria 8062541
1040 2928090300 2928084124 Bacteria 7159212
1041 2929164955 2929160207 Bacteria 9075316
1042 2929523401 2929520902 Bacteria 6765052
1043 2932402370 2932401849 Bacteria 4262978
1044 2932425304 2932422444 Bacteria 4678430
1045 2939636195 2939631187 Bacteria 6118131
1046 2945910410 2945909444 Bacteria 7065066
1047 2945946379 2945945610 Bacteria 5951079
1048 2945975972 2945972063 Bacteria 6086495
1049 2945987541 2945984333 Bacteria 7358892
1050 2954771133 2954767861 Bacteria 5535784
1051 2974324217 2974320154 Bacteria 4571377
1052 2990713683 2990710928 Bacteria 5002431
1053 8057534834 8057529695 Bacteria 6306553
1054 Ga0070706_100358490
1055 JGI24739J22299_10024192
1056 JGI25155J39150_1000005
1057 JGI25156J39149_1000006
1058 JGI25156J39149_1000042
1059 JGI25154J39366_1000015
1060 JGI25154J39366_1003388
1061 JGI25157J39369_1000016
1062 JGI25157J39369_1000033
1063 JGI25151J46595_10000040
1064 JGI25151J46595_10000135
1065 JGI25151J46595_10003363
1066 JGI25151J46595_10014930
1067 JGI25151J46595_10047585
1068 JGI25153J46596_10001229
1069 JGI25153J46596_10006649
1070 rootH1_10003125
1071 rootH2_10009935
1072 rootH1_10029110
1073 rootH1_10033106
1074 rootH1_10079201
1075 rootH1_10231751
1076 JGI25160J50197_1000098
1077 JGI25161J50226_1000037
1078 Ga0055539_1000950
1079 Ga0055525_1000038
1080 Ga0055535_1000181
1081 Ga0055535_1000951
1082 Ga0055535_1005110
1083 Ga0055542_1000070
1084 Ga0055529_1000805
1085 Ga0055526_1000123
1086 Ga0055526_1000154
1087 Ga0055526_1006302
1088 Ga0055526_1006801
1089 Ga0055526_1011523
1090 Ga0055537_1000461
1091 Ga0055524_1000023
1092 Ga0055524_1000052
1093 Ga0055524_1000261
1094 Ga0055524_1019259
1095 Ga0055536_1001412
1096 Ga0055536_1002347
1097 Ga0055534_1000245
1098 Ga0055534_1001463
1099 Ga0055534_1015574
1100 Ga0055528_1000723
1101 Ga0055528_1001448
1102 Ga0055530_10000190
1103 Ga0055530_10009289
1104 Ga0055530_10025779
1105 Ga0055540_1000187
1106 Ga0055540_1001526
1107 Ga0055540_1004871
1108 Ga0055540_1007513
1109 Ga0055540_1009113
1110 Ga0055540_1012167
1111 Ga0055531_10001522
1112 Ga0055531_10014851
1113 Ga0055543_1004109
1114 Ga0065165_1000248
1115 Ga0065165_1000362
1116 Ga0065165_1004149
1117 Ga0065165_1015845
1118 Ga0065165_1020157
1119 Ga0065165_1035830
1120 Ga0065704_10114840
1121 Ga0070658_10002918
1122 Ga0070658_10011840
1123 Ga0070658_10032631
1124 Ga0070658_10095240
1125 Ga0070676_10004616
1126 Ga0070676_10014222
1127 Ga0070676_10072791
1128 Ga0070683_100014657
1129 Ga0070683_100104478
1130 Ga0070690_100022114
1131 Ga0070690_100028720
1132 Ga0070670_100001811
1133 Ga0070670_100002276
1134 Ga0070670_100023499
1135 Ga0070670_100045262
1136 Ga0070670_100133389
1137 Ga0070670_100184143
1138 Ga0068869_100007662
1139 Ga0068869_100022888
1140 Ga0068869_100110803
1141 Ga0070666_10026552
1142 Ga0070666_10144348
1143 Ga0070682_100000796
1144 Ga0070682_100006730
1145 Ga0070682_100043720
1146 Ga0068868_100004439
1147 Ga0068868_100065444
1148 Ga0068868_100123841
1149 Ga0068868_100163746
1150 Ga0068868_100199660
1151 Ga0070660_100051160
1152 Ga0070660_100102348
1153 Ga0070660_100102668
1154 Ga0070660_100214625
1155 Ga0070689_100004600
1156 Ga0070689_100027527
1157 Ga0070687_100116366
1158 Ga0070661_100008298
1159 Ga0070661_100037283
1160 Ga0070661_100074154
1161 Ga0070661_100291520
1162 Ga0070692_10146858
1163 Ga0070668_100002401
1164 Ga0070668_100147057
1165 Ga0070669_100003159
1166 Ga0070669_100020429
1167 Ga0070669_100056450
1168 Ga0070675_100003826
1169 Ga0070675_100005498
1170 Ga0070675_100027924
1171 Ga0070675_100055517
1172 Ga0070675_100075601
1173 Ga0070671_100007846
1174 Ga0070671_100120540
1175 Ga0070671_100130954
1176 Ga0070671_100166175
1177 Ga0070674_100011837
1178 Ga0070673_100025297
1179 Ga0070673_100067351
1180 Ga0070673_100078081
1181 Ga0070659_100009325
1182 Ga0070659_100093064
1183 Ga0070667_100002157
1184 Ga0070667_100043014
1185 Ga0070667_100073422
1186 Ga0070701_10048444
1187 Ga0070701_10052507
1188 Ga0070663_100001508
1189 Ga0070663_100164863
1190 Ga0070663_100289878
1191 Ga0070678_100042361
1192 Ga0070678_100239075
1193 Ga0070662_100139537
1194 Ga0068867_100000075
1195 Ga0068867_100004516
1196 Ga0068867_100052915
1197 Ga0070685_10033319
1198 Ga0070699_100081980
1199 Ga0070679_100004815
1200 Ga0068853_100001060
1201 Ga0068853_100049008
1202 Ga0068853_100073836
1203 Ga0068853_100077413
1204 Ga0068853_100116555
1205 Ga0068853_100262304
1206 Ga0070672_100001641
1207 Ga0070672_100003671
1208 Ga0070672_100004734
1209 Ga0070672_100005245
1210 Ga0070672_100074130
1211 Ga0070672_100084253
1212 Ga0070686_100024242
1213 Ga0070693_100070910
1214 Ga0070693_100157860
1215 Ga0070665_100005152
1216 Ga0068855_100000053
1217 Ga0068855_100034008
1218 Ga0068855_100061077
1219 Ga0068855_100105499
1220 Ga0068855_100110454
1221 Ga0068855_100157746
1222 Ga0068855_100245099
1223 Ga0068857_100006699
1224 Ga0068857_100025689
1225 Ga0068857_100029106
1226 Ga0068857_100059251
1227 Ga0068857_100063359
1228 Ga0068857_100256555
1229 Ga0068854_100024277
1230 Ga0068854_100194321
1231 Ga0068856_100004596
1232 Ga0068856_100009244
1233 Ga0068856_100019140
1234 Ga0068856_100152922
1235 Ga0068852_100009046
1236 Ga0068852_100013706
1237 Ga0068852_100029640
1238 Ga0068852_100062333
1239 Ga0068852_100080389
1240 Ga0068852_100126287
1241 Ga0068852_100341027
1242 Ga0068852_100390619
1243 Ga0068852_100413811
1244 Ga0068859_100030448
1245 Ga0068859_100036141
1246 Ga0068864_100005872
1247 Ga0068864_100038650
1248 Ga0068864_100039936
1249 Ga0068864_100070497
1250 Ga0068861_100006393
1251 Ga0068861_100069629
1252 Ga0068851_10000798
1253 Ga0068851_10012368
1254 Ga0068851_10027814
1255 Ga0068870_10075073
1256 Ga0068863_100031259
1257 Ga0068863_100120962
1258 Ga0068863_100399695
1259 Ga0068858_100015518
1260 Ga0068858_100028086
1261 Ga0068858_100154651
1262 Ga0068860_100004889
1263 Ga0068860_100131535
1264 Ga0068862_100031328
1265 Ga0068862_100048416
1266 Ga0068862_100113320
1267 Ga0070717_10109168
1268 Ga0075365_10000391
1269 Ga0075365_10217231
1270 Ga0075368_10092899
1271 Ga0075363_100005949
1272 Ga0075363_100062755
1273 Ga0075364_10031732
1274 Ga0075432_10012491
1275 Ga0070716_100193136
1276 Ga0075362_10004042
1277 Ga0075362_10021972
1278 Ga0075362_10040615
1279 Ga0075362_10052264
1280 Ga0075362_10093321
1281 Ga0075367_10020571
1282 Ga0075367_10031443
1283 Ga0075367_10046027
1284 Ga0075366_10004396
1285 Ga0075366_10008531
1286 Ga0075366_10043503
1287 Ga0075366_10092749
1288 Ga0097621_100031589
1289 Ga0097621_100045454
1290 Ga0075370_10001340
1291 Ga0075370_10011101
1292 Ga0068871_100069049
1293 Ga0068871_100240107
1294 Ga0075430_100263023
1295 Ga0075429_100093307
1296 Ga0068865_100004329
1297 Ga0068865_100150344
1298 Ga0068865_100174457
1299 Ga0097620_100030449
1300 Ga0097620_100036140
1301 Ga0079104_1000003
1302 Ga0079104_1000206
1303 Ga0099826_10010052
1304 Ga0105244_10014909
1305 Ga0105250_10011778
1306 Ga0105240_10000322
1307 Ga0105240_10045295
1308 Ga0105240_10089762
1309 Ga0105240_10365953
1310 Ga0105245_10117967
1311 Ga0105247_10024198
1312 Ga0105243_10000345
1313 Ga0105243_10001128
1314 Ga0105243_10001582
1315 Ga0105243_10021799
1316 Ga0105243_10219486
1317 Ga0105241_10078966
1318 Ga0105241_10237777
1319 Ga0105248_10007460
1320 Ga0105248_10112453
1321 Ga0105248_10147445
1322 Ga0105237_10001642
1323 Ga0105237_10045032
1324 Ga0105237_10063195
1325 Ga0105237_10239786
1326 Ga0105238_10017874
1327 Ga0105238_10023025
1328 Ga0105238_10077560
1329 Ga0105238_10086017
1330 Ga0105238_10091865
1331 Ga0105238_10125303
1332 Ga0105238_10228663
1333 Ga0105239_10002917
1334 Ga0105239_10035589
1335 Ga0105239_10038176
1336 Ga0105239_10162644
1337 Ga0105246_10115303
1338 Ga0157373_10009159
1339 Ga0157373_10074167
1340 Ga0157373_10102530
1341 Ga0157371_10008934
1342 Ga0157370_10017196
1343 Ga0157370_10022666
1344 Ga0157370_10194899
1345 Ga0157369_10034649
1346 Ga0157369_10048523
1347 Ga0157369_10051168
1348 Ga0171462_1026
1349 Ga0157374_10187187
1350 Ga0157374_10277895
1351 Ga0163162_10012682
1352 Ga0163162_10041220
1353 Ga0163162_10081708
1354 Ga0163162_10192958
1355 Ga0157372_10016841
1356 Ga0157372_10069543
1357 Ga0157372_10072226
1358 Ga0157372_10118949
1359 Ga0157372_10358924
1360 Ga0157375_10189844
1361 Ga0157375_10217643
1362 Ga0163163_10180340
1363 Ga0163163_10248157
1364 Ga0157380_10005359
1365 Ga0157380_10033824
1366 Ga0182008_10012396
1367 Ga0182008_10016669
1368 Ga0182008_10033465
1369 Ga0182008_10034007
1370 Ga0157377_10000743
1371 Ga0157377_10061840
1372 Ga0157379_10005615
1373 Ga0157379_10168169
1374 Ga0157379_10200451
1375 Ga0157376_10047551
1376 Ga0157376_10207333
1377 Ga0157376_10301329
1378 Ga0182006_1035323
1379 Ga0182006_1048888
1380 Ga0182007_10004007
1381 Ga0182005_1011304
1382 Ga0183362_10001
1383 Ga0163161_10003871
1384 Ga0163161_10060364
1385 Ga0163161_10083086
1386 Ga0213872_10001975
1387 Ga0213876_10041117
1388 Ga0213875_10112838
1389 Ga0209435_100010
1390 Ga0209436_103411
1391 Ga0209672_101934
1392 Ga0209147_100874
1393 Ga0209563_100005
1394 Ga0207427_101542
1395 Ga0209258_100018
1396 Ga0209258_100171
1397 Ga0209258_100621
1398 Ga0207425_1000195
1399 Ga0207425_1003463
1400 Ga0209646_1000001
1401 Ga0209646_1000089
1402 Ga0209026_1000001
1403 Ga0209026_1000028
1404 Ga0209677_100066
1405 Ga0209148_1000030
1406 Ga0209759_1000001
1407 Ga0209759_1000021
1408 Ga0209759_1002216
1409 Ga0209129_1000043
1410 Ga0209129_1000427
1411 Ga0209565_1000088
1412 Ga0209565_1000102
1413 Ga0209455_1000148
1414 Ga0209673_1000064
1415 Ga0209673_1000189
1416 Ga0209673_1008134
1417 Ga0209673_1010544
1418 Ga0209673_1032068
1419 Ga0209130_1000141
1420 Ga0209130_1000226
1421 Ga0209130_1001229
1422 Ga0209130_1001786
1423 Ga0209675_1000036
1424 Ga0209675_1000288
1425 Ga0209675_1001448
1426 Ga0209675_1003322
1427 Ga0209675_1015231
1428 Ga0209676_1000069
1429 Ga0209676_1000302
1430 Ga0209676_1000538
1431 Ga0209676_1004738
1432 Ga0209676_1017930
1433 Ga0209025_1000016
1434 Ga0209025_1000238
1435 Ga0209025_1000343
1436 Ga0209025_1005774
1437 Ga0209025_1006771
1438 Ga0209025_1026317
1439 Ga0209025_1030521
1440 Ga0209025_1047038
1441 Ga0209025_1051210
1442 Ga0209564_1000014
1443 Ga0209564_1000075
1444 Ga0209564_1000076
1445 Ga0209564_1000415
1446 Ga0209564_1000575
1447 Ga0209758_1000093
1448 Ga0209758_1000126
1449 Ga0209758_1000402
1450 Ga0209758_1025438
1451 Ga0209050_1000023
1452 Ga0209050_1000851
1453 Ga0209050_1003418
1454 Ga0209050_1005580
1455 Ga0209050_1008334
1456 Ga0209256_1000003
1457 Ga0209256_1000036
1458 Ga0209256_1000083
1459 Ga0209256_1001241
1460 Ga0207426_1000145
1461 Ga0207426_1002446
1462 Ga0209051_1000017
1463 Ga0209051_1000101
1464 Ga0209051_1000173
1465 Ga0209051_1000242
1466 Ga0209051_1000820
1467 Ga0209051_1004138
1468 Ga0209257_1000041
1469 Ga0209257_1000096
1470 Ga0209257_1000149
1471 Ga0209257_1007739
1472 Ga0209257_1020139
1473 Ga0207697_10056993
1474 Ga0207656_10002344
1475 Ga0207656_10003086
1476 Ga0207656_10038605
1477 Ga0207682_10043507
1478 Ga0207642_10050674
1479 Ga0207710_10014263
1480 Ga0207688_10052395
1481 Ga0207688_10102116
1482 Ga0207680_10044927
1483 Ga0207680_10061617
1484 Ga0207699_10040840
1485 Ga0207645_10037609
1486 Ga0207645_10050869
1487 Ga0207705_10069044
1488 Ga0207684_10002973
1489 Ga0207695_10004077
1490 Ga0207695_10015442
1491 Ga0207695_10042012
1492 Ga0207671_10000168
1493 Ga0207671_10133479
1494 Ga0207671_10160866
1495 Ga0207662_10012394
1496 Ga0207662_10100047
1497 Ga0207662_10113367
1498 Ga0207657_10034044
1499 Ga0207657_10054750
1500 Ga0207657_10131964
1501 Ga0207649_10001238
1502 Ga0207649_10014631
1503 Ga0207649_10016297
1504 Ga0207649_10053615
1505 Ga0207649_10076378
1506 Ga0207681_10001781
1507 Ga0207681_10023829
1508 Ga0207681_10252894
1509 Ga0207694_10031500
1510 Ga0207694_10093249
1511 Ga0207650_10010289
1512 Ga0207650_10014168
1513 Ga0207650_10027615
1514 Ga0207659_10010026
1515 Ga0207659_10025707
1516 Ga0207659_10058000
1517 Ga0207659_10060715
1518 Ga0207687_10050002
1519 Ga0207644_10004445
1520 Ga0207644_10036765
1521 Ga0207644_10090387
1522 Ga0207644_10096075
1523 Ga0207644_10191658
1524 Ga0207690_10073175
1525 Ga0207690_10096992
1526 Ga0207690_10302826
1527 Ga0207706_10002128
1528 Ga0207706_10015279
1529 Ga0207706_10121557
1530 Ga0207686_10045156
1531 Ga0207709_10000032
1532 Ga0207709_10000094
1533 Ga0207709_10000784
1534 Ga0207709_10003063
1535 Ga0207709_10003619
1536 Ga0207670_10001093
1537 Ga0207670_10024696
1538 Ga0207669_10043462
1539 Ga0207669_10060909
1540 Ga0207704_10002831
1541 Ga0207704_10067883
1542 Ga0207704_10076032
1543 Ga0207691_10001442
1544 Ga0207691_10002041
1545 Ga0207691_10004983
1546 Ga0207691_10009965
1547 Ga0207691_10018437
1548 Ga0207691_10077884
1549 Ga0207691_10082574
1550 Ga0207691_10232322
1551 Ga0207711_10011487
1552 Ga0207711_10018674
1553 Ga0207711_10024119
1554 Ga0207711_10038494
1555 Ga0207711_10092517
1556 Ga0207711_10142903
1557 Ga0207689_10014447
1558 Ga0207689_10022136
1559 Ga0207689_10030620
1560 Ga0207661_10070932
1561 Ga0207661_10079969
1562 Ga0207679_10003824
1563 Ga0207667_10000698
1564 Ga0207667_10001661
1565 Ga0207667_10002223
1566 Ga0207667_10086692
1567 Ga0207667_10092740
1568 Ga0207651_10007547
1569 Ga0207651_10017350
1570 Ga0207712_10022271
1571 Ga0207712_10022799
1572 Ga0207712_10106287
1573 Ga0207668_10003415
1574 Ga0207668_10168538
1575 Ga0207640_10033012
1576 Ga0207640_10053241
1577 Ga0207640_10073416
1578 Ga0207658_10001577
1579 Ga0207658_10004517
1580 Ga0207658_10283328
1581 Ga0207677_10022572
1582 Ga0207677_10033296
1583 Ga0207703_10001878
1584 Ga0207703_10035246
1585 Ga0207639_10106692
1586 Ga0207639_10122952
1587 Ga0207678_10004159
1588 Ga0207678_10017786
1589 Ga0207678_10081702
1590 Ga0207678_10124242
1591 Ga0207678_10213366
1592 Ga0207708_10028301
1593 Ga0207702_10000877
1594 Ga0207702_10034976
1595 Ga0207702_10068520
1596 Ga0207641_10002805
1597 Ga0207641_10021538
1598 Ga0207641_10127974
1599 Ga0207648_10001842
1600 Ga0207648_10028775
1601 Ga0207648_10059188
1602 Ga0207648_10122431
1603 Ga0207648_10417211
1604 Ga0207676_10002802
1605 Ga0207676_10003791
1606 Ga0207676_10072578
1607 Ga0207674_10018453
1608 Ga0207674_10168100
1609 Ga0207674_10465021
1610 Ga0207675_100000428
1611 Ga0207675_100003768
1612 Ga0207675_100374214
1613 Ga0207683_10015545
1614 Ga0207683_10050837
1615 Ga0207683_10123727
1616 Ga0207683_10283276
1617 Ga0207698_10006186
1618 Ga0207698_10026324
1619 Ga0207698_10044256
1620 Ga0207698_10058171
1621 Ga0207698_10120262
1622 Ga0209281_1000002
1623 Ga0209281_1000259
1624 Ga0209968_1008498
1625 Ga0209282_1000253
1626 Ga0268266_10000691
1627 Ga0268265_10060503
1628 Ga0268265_10082447
1629 Ga0268264_10004642
1630 Ga0268264_10005729
1631 Ga0268264_10174207
1632 Ga0265334_10005111
1633 Ga0265336_10000028
1634 Ga0265336_10024599
1635 Ga0307517_10051884
1636 Ga0307517_10142783
1637 Ga0307515_10000160
1638 Ga0307515_10000184
1639 Ga0307515_10006930
1640 Ga0307515_10049623
1641 Ga0307515_10091314
1642 Ga0307515_10098849
1643 Ga0265338_10008192
1644 Ga0265324_10001001
1645 Ga0307511_10078378
1646 Ga0307512_10003982
1647 Ga0265330_10001213
1648 Ga0265330_10007925
1649 Ga0265332_10000005
1650 Ga0265332_10000011
1651 Ga0265332_10000107
1652 Ga0265332_10006627
1653 Ga0265328_10000266
1654 Ga0265320_10004067
1655 Ga0265320_10005009
1656 Ga0265325_10001526
1657 Ga0265325_10004976
1658 Ga0265325_10072892
1659 Ga0265329_10000288
1660 Ga0265339_10002899
1661 Ga0265339_10020302
1662 Ga0265339_10035027
1663 Ga0265331_10002501
1664 Ga0265331_10003107
1665 Ga0265331_10039049
1666 Ga0265327_10000083
1667 Ga0265327_10000572
1668 Ga0265327_10037034
1669 Ga0265316_10000233
1670 Ga0265316_10040621
1671 Ga0307513_10000004
1672 Ga0307513_10000015
1673 Ga0307509_10004068
1674 Ga0307509_10135853
1675 Ga0307408_100017758
1676 Ga0307408_100042107
1677 Ga0307408_100061447
1678 Ga0307408_100083595
1679 Ga0307408_100172818
1680 Ga0307408_100293704
1681 Ga0265313_10000107
1682 Ga0265313_10004965
1683 Ga0265313_10057166
1684 Ga0265313_10057731
1685 Ga0307508_10030221
1686 Ga0307508_10069430
1687 Ga0307514_10011139
1688 Ga0265314_10000026
1689 Ga0265314_10000677
1690 Ga0265314_10002021
1691 Ga0265314_10004697
1692 Ga0265314_10009030
1693 Ga0265314_10022612
1694 Ga0265342_10000862
1695 Ga0265342_10001343
1696 Ga0265342_10005935
1697 Ga0265342_10090259
1698 Ga0265342_10099371
1699 Ga0307516_10000283
1700 Ga0307516_10000460
1701 Ga0307516_10001460
1702 Ga0307516_10014862
1703 Ga0307516_10049562
1704 Ga0307516_10058753
1705 Ga0307516_10094383
1706 Ga0307516_10257922
1707 Ga0307405_10007945
1708 Ga0307405_10045380
1709 Ga0307405_10054409
1710 Ga0307410_10048747
1711 Ga0307406_10012802
1712 Ga0307406_10038475
1713 Ga0307412_10007984
1714 Ga0307412_10022011
1715 Ga0307412_10080308
1716 Ga0307412_10252181
1717 Ga0307409_100003565
1718 Ga0307409_100163369
1719 Ga0307416_100006952
1720 Ga0307416_100011019
1721 Ga0307414_10098932
1722 Ga0307414_10134686
1723 Ga0307414_10275483
1724 Ga0307411_10036214
1725 Ga0307411_10042402
1726 Ga0307411_10159457
1727 Ga0307415_100015925
1728 Ga0307507_10082017
1729 Ga0307510_10087595
1730 Ga0373934_0034716
1731 Ga0373956_0024775
1732 Ga0373956_0104117
1733 Ga0373957_0006535
1734 Ga0373955_0002467
1735 Ga0373961_0000090
1736 Ga0373931_0019318
1737 Ga0373935_0034573
1738 Ga0373935_0188446
1739 Ga0373935_0220091
1740 Ga0373933_0013190
1741 Ga0373937_0033494
1742 Ga0373937_0138556
1743 Ga0373925_0003169
1744 Ga0373925_0033870
1745 Ga0395899_0014940
1746 Ga0395899_0016191
1747 Ga0395899_0017939
1748 Ga0395899_0126367
1749 Ga0395900_0014879
1750 Ga0395900_0029863
1751 Ga0395900_0071458
1752 Ga0395900_0289727
1753 Ga0395898_0024397
1754 Ga0395898_0064013
1755 Ga0395898_0093693
1756 Ga0395898_0325328
1757 Ga0395905_0000025
1758 Ga0395905_0007656
1759 Ga0395905_0027223
1760 Ga0395905_0051557
1761 Ga0395905_0114538
1762 Ga0395905_0213236
1763 Ga0395905_0311935
1764 Ga0436364_0268395
1765 Ga0395901_0015016
1766 Ga0395901_0047183
1767 Ga0395901_0063804
1768 Ga0395901_0077770
1769 Ga0395901_0265053
1770 Ga0436365_0431674
1771 Ga0436361_1170859
1772 Ga0436363_0015497
1773 Ga0436363_1073622
1774 Ga0439465_0011137
1775 Ga0439465_0024201
1776 Ga0439433_0002359
1777 Ga0439432_007426
1778 Ga0439432_018979
1779 Ga0439449_0000714
1780 Ga0439449_0000777
1781 Ga0439449_0052701
1782 Ga0439457_010176
1783 Ga0450923_003039
1784 Ga0450923_011882
1785 Ga0439446_0008693
1786 Ga0439434_0016742
1787 Ga0439434_0033373
1788 Ga0450918_000716
1789 Ga0450918_001165
1790 Ga0451577_0000419
1791 Ga0451577_0034859
1792 Ga0451577_0255491
1793 Ga0439440_0044678
1794 Ga0453683_0002969
1795 Ga0466965_0043520
1796 Ga0453684_0000475
1797 Ga0453684_0008658
1798 Ga0453684_0109098
1799 Ga0453684_0136832
1800 Ga0453684_0241678
1801 Ga0466957_0062018
1802 Ga0466957_0104831
1803 Ga0466959_0032626
1804 Ga0451576_0004269
1805 Ga0451576_0006268
1806 Ga0451576_0017617
1807 Ga0451576_0041353
1808 Ga0451576_0188376
1809 Ga0451576_0242410
1810 Ga0495592_0000427
1811 Ga0495629_0052419
1812 Ga0495638_0105043
1813 Ga0495638_0109902
1814 Ga0495650_0013525
1815 Ga0495650_0029722
1816 Ga0495580_0163083
1817 Ga0495608_0080071
1818 Ga0495610_0043351
1819 Ga0495616_0005153
1820 Ga0495618_0284723
1821 Ga0495628_0082921
1822 Ga0495631_0003589
1823 Ga0495632_0005676
1824 Ga0495609_0055994
1825 Ga0495621_0022002
1826 Ga0495633_0000499
1827 Ga0495656_0000974
1828 Ga0495625_0000116
1829 Ga0495625_0106167
1830 Ga0495647_0028409
1831 Ga0495671_0023540
1832 Ga0495676_0038995
1833 Ga0495684_0285827
1834 Ga0495686_0076358
1835 Ga0495614_0027494
1836 Ga0495615_0013138
1837 Ga0495615_0017546
1838 Ga0496100_0087961
1839 Ga0496100_0150055
1840 Ga0496101_0149882
1841 Ga0496102_0261304
1842 Ga0496103_0036091
1843 Ga0496103_0079809
1844 Ga0496104_0030814
1845 Ga0496105_0129529
1846 Ga0496106_0007537
1847 Ga0496107_0040451
1848 Ga0496108_0089223
1849 Ga0496108_0151075
1850 Ga0496110_0125259
1851 Ga0496110_0169641
1852 Ga0496110_0181775
1853 Ga0496111_0011763
1854 Ga0496111_0096795
1855 Ga0496112_0007641
1856 Ga0496112_0296716
1857 Ga0496113_0162806
1858 Ga0496114_0010850
1859 Ga0496114_0011767
1860 Ga0496115_0055645
1861 Ga0496117_0032387
1862 Ga0496117_0066002
1863 Ga0496117_0071590
1864 Ga0496121_0003381
1865 Ga0496121_0048164
1866 Ga0496121_0058857
1867 Ga0496121_0080775
1868 Ga0496122_0000199
1869 Ga0496122_0091952
1870 Ga0496122_0129012
1871 Ga0496123_0000102
1872 Ga0496123_0034202
1873 Ga0496123_0058893
1874 Ga0496124_0236700
1875 Ga0496125_0000191
1876 Ga0496125_0033962
1877 Ga0496125_0054502
1878 Ga0496126_0069392
1879 Ga0501031_0001000
1880 Ga0501031_0037108
1881 Ga0501032_0011856
1882 Ga0501032_0064379
1883 Ga0501032_0092787
1884 Ga0501033_0000118
1885 Ga0501033_0001653
1886 Ga0501033_0061988
1887 Ga0501034_0006372
1888 Ga0501034_0027612
1889 Ga0501034_0058631
1890 Ga0501034_0100073
1891 Ga0501034_0110207
1892 Ga0501034_0153478
1893 Ga0501034_0158686
1894 Ga0501034_0184881
1895 Ga0501034_0221481
1896 Ga0501034_0273341
1897 Ga0501036_0009013
1898 Ga0501036_0065490
1899 Ga0501037_0032625
1900 Ga0501037_0058309
1901 Ga0501037_0166206
1902 Ga0501037_0198866
1903 Ga0501037_0238476
1904 Ga0501038_0004201
1905 Ga0501038_0040981
1906 Ga0501038_0043927
1907 Ga0501038_0202412
1908 Ga0501039_0016917
1909 Ga0501043_0000020
1910 Ga0501043_0013069
1911 Ga0501043_0225461
1912 Ga0501046_0000039
1913 Ga0501046_0024570
1914 Ga0501046_0066538
1915 Ga0501047_0000028
1916 Ga0501047_0060747
1917 Ga0501047_0073931
1918 Ga0501047_0118126
1919 Ga0501048_0013028
1920 Ga0501048_0122017
1921 Ga0501067_0001921
1922 Ga0501068_0024687
1923 Ga0501068_0033029
1924 Ga0501068_0084659
1925 Ga0501069_0000996
1926 Ga0501070_0000091
1927 Ga0501070_0007631
1928 Ga0501070_0017398
1929 Ga0501070_0068110
1930 Ga0501070_0112556
1931 Ga0501073_0000442
1932 Ga0501073_0002814
1933 Ga0501073_0021924
1934 Ga0501198_000014
1935 Ga0501222_000008
1936 Ga0501080_0005715
1937 Ga0501080_0007030
1938 Ga0501080_0007562
1939 Ga0501080_0035269
1940 Ga0501080_0041922
1941 Ga0501083_0003873
1942 Ga0501083_0014743
1943 Ga0501083_0039734
1944 Ga0501265_002203
1945 Ga0501035_0025411
1946 Ga0501035_0039460
1947 Ga0501035_0097077
1948 Ga0501035_0125810
1949 Ga0501035_0211314
1950 Ga0501035_0266217
1951 Ga0501044_0038555
1952 Ga0501044_0056426
1953 Ga0501044_0110475
1954 Ga0501044_0259481
1955 Ga0501045_0032103
1956 nmdc:mga03683_23140_c1
1957 nmdc:mga03n38_28314_c1
1958 nmdc:mga03n38_34365_c1
1959 nmdc:mga00v17_33528_c1
1960 nmdc:mga0yw44_207857_c1
1961 nmdc:mga0k408_134308_c1
1962 nmdc:mga0k408_2458_c1
1963 nmdc:mga0k408_6485_c1
1964 nmdc:mga0k408_88724_c1
1965 nmdc:mga06z11_46506_c1
1966 nmdc:mga07m45_11158_c1
1967 nmdc:mga07m45_24573_c1
1968 nmdc:mga07m45_96238_c1
1969 nmdc:mga09592_373938_c1
1970 nmdc:mga09592_99406_c1
1971 nmdc:mga0qj67_218414_c1
1972 nmdc:mga0qj67_223933_c1
1973 nmdc:mga0rr50_90162_c1
1974 nmdc:mga0sz30_82214_c1
1975 Ga0495612_0022924
1976 Ga0500610_0063222
1977 Ga0500635_0000114
1978 Ga0495595_0027045
1979 Ga0500578_0001658
1980 Ga0500578_0056581
1981 Ga0500578_0093078
1982 Ga0500644_0009222
1983 Ga0500646_0007852
1984 Ga0500651_0001525
1985 Ga0500651_0019791
1986 Ga0500566_0049189
1987 Ga0500566_0053255
1988 Ga0500640_022510
1989 Ga0500554_000402
1990 Ga0500555_001398
1991 Ga0500571_000343
1992 Ga0500572_007428
1993 Ga0500593_018896
1994 Ga0500594_0003416
1995 Ga0500595_000585
1996 Ga0500607_000320
1997 Ga0500607_098164
1998 Ga0500628_001917
1999 Ga0500642_0051369
2000 Ga0500652_001532
2001 Ga0500655_008233
2002 Ga0500658_0005316
2003 Ga0500559_0000666
2004 Ga0500559_0010271
2005 Ga0500559_0123005
2006 Ga0500564_102132
2007 Ga0500568_0010736
2008 Ga0500568_0034123
2009 Ga0500568_0067474
2010 Ga0500585_058425
2011 Ga0500603_014618
2012 Ga0500604_0001217
2013 Ga0500616_0046009
2014 Ga0500616_0074266
2015 Ga0500622_0000858
2016 Ga0500622_0003925
2017 Ga0500622_0076479
2018 Ga0500634_0000002
2019 Ga0500634_0024020
2020 Ga0500638_062434
2021 Ga0500636_0027915
2022 Ga0501084_0126873
2023 Ga0501084_0223768
2024 Ga0501082_0012702
2025 Ga0501082_0064532
2026 Ga0501082_0074598
2027 Ga0466962_0051578
2028 2511245842
2029 2513231717
2030 2548498844
2031 2587728503
2032 2587735239
2033 2588290776
2034 2599625161
2035 2599673387
2036 2599683057
2037 2599694995
2038 2643867949
2039 2643964624
2040 2643971261
2041 2643991814
2042 2644058936
2043 2644139437
2044 2644158718
2045 2644167229
2046 2644248136
2047 2644272251
2048 2644293557
2049 2644302802
2050 2644328396
2051 2644349745
2052 2644397491
2053 2644465451
2054 2644648304
2055 2644727740
2056 2644733548
2057 2644744544
2058 2738722471
2059 2739246193
2060 2739283042
2061 2816471428
2062 2819600750
2063 2819717192
2064 2831267333
2065 2837682501
2066 2838060310
2067 2841763244
2068 2841917173
2069 2841922794
2070 2842677802
2071 2842721234
2072 2842739025
2073 2842748714
2074 2844108886
2075 2851182490
2076 2851250993
2077 2885195296
2078 2885198385
2079 2885212235
2080 2894024597
2081 2899931698
2082 2904452056
2083 2904458798
2084 2904482951
2085 2904547541
2086 2917701321
2087 2919467662
2088 2928043080
2089 2928050261
2090 2928056712
2091 2928068828
2092 2928075752
2093 2928090300
2094 2929164955
2095 2929523401
2096 2932402370
2097 2932425304
2098 2939636195
2099 2945910410
2100 2945946379
2101 2945975972
2102 2945987541
2103 2954771133
2104 2974324217
2105 2990713683
2106 8057534834

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

87

366

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4898 48 317
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.4736 16 316
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.4679 16 316
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.4675 57 321
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4647 48 317
ID Description Score Start End Superfamily
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7608 59 314 1.10.3470.10
af_P77315_52_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7486 61 314 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7413 60 314 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7346 59 314 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7324 59 314 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A519G8P5-F1-model_v4 deleted 0.9743 1 327
AF-A0A528XS58-F1-model_v4 ABC transporter permease 0.9576 7 308 GO:0005886
GO:0022857
AF-A0A7W6CQF3-F1-model_v4 Simple sugar transport system permease protein 0.9504 1 334 GO:0005886
GO:0022857
AF-A0A3B8RM30-F1-model_v4 Sugar ABC transporter permease 0.9501 1 338 GO:0005886
GO:0022857
AF-A0A1F3BA63-F1-model_v4 ABC transporter permease 0.95 20 320 GO:0005886
GO:0022857

Map