F489107
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1053 | 492 | 2106 | 363 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100358490|Ga0070706_1003584901 |
| Length | 423 |
| Sequence | MRAHEPVNPVGCASAHRRHAGGLGGALKRTLRLEPRPQPSRVMSVASPLLALAITVVLGVALFLLLGKDPLRGLQVFFVEPLKSGYALSELALKATPLLLIALGLALCFRSNVWNIGAEGQFIVGAIAAGGIAMLAEQGTSRLIVVAILAAGVLGGMAWAAVVAFLRDKANANEILVSLMLVYVAEMLLSHLVYGPWKDPAGYNFPQTISFLAPTQVPRLFAGLRVNIGAPIALAAVGLFWLFLFRIYAGFQLQVGGLAPAAARYAGFSSRKALWVAMLGSGGMAGLAGAIEVAGPLGQLTPHVPAGYGFAAIIVAFVGRLHPVGVVFSSVLMSMFYIGGELAQSRLGLPKALTGVFQGLLLFTLLACDTLIAYRLRWQARSSHHLQARHPGERRDPPMHATMDPGVRRDDVERGRDDGKEPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 98 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 99 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 134 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 224 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 228 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 229 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 232 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 234 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 240 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 241 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 242 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 244 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 245 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 248 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 250 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 251 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 253 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 254 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 255 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 256 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 257 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 258 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 259 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 273 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 274 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 275 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 276 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 277 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 278 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 279 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 280 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 281 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 282 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 283 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 284 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 285 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 286 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 287 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 288 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 289 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 290 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 291 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 292 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 293 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 294 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 295 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 322 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 323 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 324 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 329 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 330 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 331 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 332 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 333 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 334 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 335 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 336 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 337 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 338 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 339 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 359 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 371 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 372 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 379 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 380 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 382 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 384 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 385 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 387 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 388 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 391 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 392 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 393 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 394 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 395 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 396 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 397 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 398 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 399 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 401 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 403 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 404 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 405 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 406 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 408 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 409 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 410 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 411 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 414 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 415 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 416 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 417 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 418 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 419 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 420 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 421 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 422 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 423 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 424 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 425 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 426 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 427 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 428 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 429 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 430 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 431 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 432 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 433 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 434 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 435 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 436 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 437 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 438 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 439 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 440 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 441 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 442 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 443 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 444 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 445 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 446 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 447 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 448 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 449 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 450 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 451 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 452 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 453 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 454 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 455 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 456 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 457 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 458 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 459 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 460 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 461 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 462 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 463 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 464 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 465 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 466 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 467 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 468 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 469 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 470 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 471 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 472 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 473 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 474 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 475 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 476 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 477 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 478 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 479 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 480 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 481 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 482 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 483 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 484 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 485 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 486 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 487 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 488 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 489 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 490 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 491 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 492 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.5 |
| Metatranscriptomes | 0 |
| Isolates | 7.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.66 |
| Nodule | 1.42 |
| Rhizoplane | 2.47 |
| Rhizosphere | 65.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070706_100358490 | 3300005467 | Bacteria | 1359 |
| 2 | JGI24739J22299_10024192 | 3300001989 | Bacteria | 2143 |
| 3 | JGI25155J39150_1000005 | 3300002704 | Bacteria | 261712 |
| 4 | JGI25156J39149_1000006 | 3300002705 | Bacteria | 261778 |
| 5 | JGI25156J39149_1000042 | 3300002705 | Bacteria | 105742 |
| 6 | JGI25154J39366_1000015 | 3300002738 | Bacteria | 261778 |
| 7 | JGI25154J39366_1003388 | 3300002738 | Bacteria | 3372 |
| 8 | JGI25157J39369_1000016 | 3300002741 | Bacteria | 192349 |
| 9 | JGI25157J39369_1000033 | 3300002741 | Bacteria | 139508 |
| 10 | JGI25151J46595_10000040 | 3300003187 | Bacteria | 176750 |
| 11 | JGI25151J46595_10000135 | 3300003187 | Bacteria | 98528 |
| 12 | JGI25151J46595_10003363 | 3300003187 | Bacteria | 8859 |
| 13 | JGI25151J46595_10014930 | 3300003187 | Bacteria | 3446 |
| 14 | JGI25151J46595_10047585 | 3300003187 | Bacteria | 1490 |
| 15 | JGI25153J46596_10001229 | 3300003215 | Bacteria | 15448 |
| 16 | JGI25153J46596_10006649 | 3300003215 | Bacteria | 5816 |
| 17 | rootH1_10003125 | 3300003316 | Bacteria | 6506 |
| 18 | rootH2_10009935 | 3300003320 | Bacteria | 4350 |
| 19 | rootH1_10029110 | 3300003323 | Bacteria | 2143 |
| 20 | rootH1_10033106 | 3300003323 | Bacteria | 4177 |
| 21 | rootH1_10079201 | 3300003323 | Bacteria | 12707 |
| 22 | rootH1_10231751 | 3300003323 | Bacteria | 1929 |
| 23 | JGI25160J50197_1000098 | 3300003354 | Bacteria | 87307 |
| 24 | JGI25161J50226_1000037 | 3300003374 | Bacteria | 133331 |
| 25 | Ga0055539_1000950 | 3300003752 | Bacteria | 6420 |
| 26 | Ga0055525_1000038 | 3300003759 | Bacteria | 297540 |
| 27 | Ga0055535_1000181 | 3300003761 | Bacteria | 66856 |
| 28 | Ga0055535_1000951 | 3300003761 | Bacteria | 19206 |
| 29 | Ga0055535_1005110 | 3300003761 | Bacteria | 2972 |
| 30 | Ga0055542_1000070 | 3300003762 | Bacteria | 147374 |
| 31 | Ga0055529_1000805 | 3300003763 | Bacteria | 19141 |
| 32 | Ga0055526_1000123 | 3300003771 | Bacteria | 68503 |
| 33 | Ga0055526_1000154 | 3300003771 | Bacteria | 60968 |
| 34 | Ga0055526_1006302 | 3300003771 | Bacteria | 6488 |
| 35 | Ga0055526_1006801 | 3300003771 | Bacteria | 6105 |
| 36 | Ga0055526_1011523 | 3300003771 | Bacteria | 3971 |
| 37 | Ga0055537_1000461 | 3300003773 | Bacteria | 25584 |
| 38 | Ga0055524_1000023 | 3300003775 | Bacteria | 221408 |
| 39 | Ga0055524_1000052 | 3300003775 | Bacteria | 144959 |
| 40 | Ga0055524_1000261 | 3300003775 | Bacteria | 53201 |
| 41 | Ga0055524_1019259 | 3300003775 | Bacteria | 2339 |
| 42 | Ga0055536_1001412 | 3300003781 | Bacteria | 14509 |
| 43 | Ga0055536_1002347 | 3300003781 | Bacteria | 10720 |
| 44 | Ga0055534_1000245 | 3300003784 | Bacteria | 38376 |
| 45 | Ga0055534_1001463 | 3300003784 | Bacteria | 9402 |
| 46 | Ga0055534_1015574 | 3300003784 | Bacteria | 1390 |
| 47 | Ga0055528_1000723 | 3300003790 | Bacteria | 23348 |
| 48 | Ga0055528_1001448 | 3300003790 | Bacteria | 14491 |
| 49 | Ga0055530_10000190 | 3300003791 | Bacteria | 55126 |
| 50 | Ga0055530_10009289 | 3300003791 | Bacteria | 3800 |
| 51 | Ga0055530_10025779 | 3300003791 | Bacteria | 1636 |
| 52 | Ga0055540_1000187 | 3300003792 | Bacteria | 59910 |
| 53 | Ga0055540_1001526 | 3300003792 | Bacteria | 13633 |
| 54 | Ga0055540_1004871 | 3300003792 | Bacteria | 5874 |
| 55 | Ga0055540_1007513 | 3300003792 | Bacteria | 4094 |
| 56 | Ga0055540_1009113 | 3300003792 | Bacteria | 3478 |
| 57 | Ga0055540_1012167 | 3300003792 | Bacteria | 2721 |
| 58 | Ga0055531_10001522 | 3300003794 | Bacteria | 16989 |
| 59 | Ga0055531_10014851 | 3300003794 | Bacteria | 3478 |
| 60 | Ga0055543_1004109 | 3300004625 | Bacteria | 4061 |
| 61 | Ga0065165_1000248 | 3300005262 | Bacteria | 93216 |
| 62 | Ga0065165_1000362 | 3300005262 | Bacteria | 74503 |
| 63 | Ga0065165_1004149 | 3300005262 | Bacteria | 9290 |
| 64 | Ga0065165_1015845 | 3300005262 | Bacteria | 2855 |
| 65 | Ga0065165_1020157 | 3300005262 | Bacteria | 2356 |
| 66 | Ga0065165_1035830 | 3300005262 | Bacteria | 1519 |
| 67 | Ga0065704_10114840 | 3300005289 | Bacteria | 1883 |
| 68 | Ga0070658_10002918 | 3300005327 | Bacteria | 14176 |
| 69 | Ga0070658_10011840 | 3300005327 | Bacteria | 7002 |
| 70 | Ga0070658_10032631 | 3300005327 | Bacteria | 4187 |
| 71 | Ga0070658_10095240 | 3300005327 | Bacteria | 2457 |
| 72 | Ga0070676_10004616 | 3300005328 | Bacteria | 7271 |
| 73 | Ga0070676_10014222 | 3300005328 | Bacteria | 4372 |
| 74 | Ga0070676_10072791 | 3300005328 | Bacteria | 2067 |
| 75 | Ga0070683_100014657 | 3300005329 | Bacteria | 6865 |
| 76 | Ga0070683_100104478 | 3300005329 | Bacteria | 2670 |
| 77 | Ga0070690_100022114 | 3300005330 | Bacteria | 3888 |
| 78 | Ga0070690_100028720 | 3300005330 | Bacteria | 3446 |
| 79 | Ga0070670_100001811 | 3300005331 | Bacteria | 17414 |
| 80 | Ga0070670_100002276 | 3300005331 | Bacteria | 15804 |
| 81 | Ga0070670_100023499 | 3300005331 | Bacteria | 5306 |
| 82 | Ga0070670_100045262 | 3300005331 | Bacteria | 3782 |
| 83 | Ga0070670_100133389 | 3300005331 | Bacteria | 2145 |
| 84 | Ga0070670_100184143 | 3300005331 | Bacteria | 1813 |
| 85 | Ga0068869_100007662 | 3300005334 | Bacteria | 6914 |
| 86 | Ga0068869_100022888 | 3300005334 | Bacteria | 4310 |
| 87 | Ga0068869_100110803 | 3300005334 | Bacteria | 2088 |
| 88 | Ga0070666_10026552 | 3300005335 | Bacteria | 3785 |
| 89 | Ga0070666_10144348 | 3300005335 | Bacteria | 1658 |
| 90 | Ga0070682_100000796 | 3300005337 | Bacteria | 18493 |
| 91 | Ga0070682_100006730 | 3300005337 | Bacteria | 6448 |
| 92 | Ga0070682_100043720 | 3300005337 | Bacteria | 2771 |
| 93 | Ga0068868_100004439 | 3300005338 | Bacteria | 9839 |
| 94 | Ga0068868_100065444 | 3300005338 | Bacteria | 2888 |
| 95 | Ga0068868_100123841 | 3300005338 | Bacteria | 2110 |
| 96 | Ga0068868_100163746 | 3300005338 | Bacteria | 1838 |
| 97 | Ga0068868_100199660 | 3300005338 | Bacteria | 1667 |
| 98 | Ga0070660_100051160 | 3300005339 | Bacteria | 3180 |
| 99 | Ga0070660_100102348 | 3300005339 | Bacteria | 2270 |
| 100 | Ga0070660_100102668 | 3300005339 | Bacteria | 2267 |
| 101 | Ga0070660_100214625 | 3300005339 | Bacteria | 1563 |
| 102 | Ga0070689_100004600 | 3300005340 | Bacteria | 9346 |
| 103 | Ga0070689_100027527 | 3300005340 | Bacteria | 4287 |
| 104 | Ga0070687_100116366 | 3300005343 | Bacteria | 1522 |
| 105 | Ga0070661_100008298 | 3300005344 | Bacteria | 7173 |
| 106 | Ga0070661_100037283 | 3300005344 | Bacteria | 3536 |
| 107 | Ga0070661_100074154 | 3300005344 | Bacteria | 2505 |
| 108 | Ga0070661_100291520 | 3300005344 | Bacteria | 1268 |
| 109 | Ga0070692_10146858 | 3300005345 | Bacteria | 1340 |
| 110 | Ga0070668_100002401 | 3300005347 | Bacteria | 13779 |
| 111 | Ga0070668_100147057 | 3300005347 | Bacteria | 1903 |
| 112 | Ga0070669_100003159 | 3300005353 | Bacteria | 11847 |
| 113 | Ga0070669_100020429 | 3300005353 | Bacteria | 4730 |
| 114 | Ga0070669_100056450 | 3300005353 | Bacteria | 2879 |
| 115 | Ga0070675_100003826 | 3300005354 | Bacteria | 11423 |
| 116 | Ga0070675_100005498 | 3300005354 | Bacteria | 9701 |
| 117 | Ga0070675_100027924 | 3300005354 | Bacteria | 4537 |
| 118 | Ga0070675_100055517 | 3300005354 | Bacteria | 3260 |
| 119 | Ga0070675_100075601 | 3300005354 | Bacteria | 2800 |
| 120 | Ga0070671_100007846 | 3300005355 | Bacteria | 8531 |
| 121 | Ga0070671_100120540 | 3300005355 | Bacteria | 2207 |
| 122 | Ga0070671_100130954 | 3300005355 | Bacteria | 2113 |
| 123 | Ga0070671_100166175 | 3300005355 | Bacteria | 1866 |
| 124 | Ga0070674_100011837 | 3300005356 | Bacteria | 5328 |
| 125 | Ga0070673_100025297 | 3300005364 | Bacteria | 4367 |
| 126 | Ga0070673_100067351 | 3300005364 | Bacteria | 2863 |
| 127 | Ga0070673_100078081 | 3300005364 | Bacteria | 2677 |
| 128 | Ga0070659_100009325 | 3300005366 | Bacteria | 7208 |
| 129 | Ga0070659_100093064 | 3300005366 | Bacteria | 2418 |
| 130 | Ga0070667_100002157 | 3300005367 | Bacteria | 17328 |
| 131 | Ga0070667_100043014 | 3300005367 | Bacteria | 3790 |
| 132 | Ga0070667_100073422 | 3300005367 | Bacteria | 2917 |
| 133 | Ga0070701_10048444 | 3300005438 | Bacteria | 2193 |
| 134 | Ga0070701_10052507 | 3300005438 | Bacteria | 2118 |
| 135 | Ga0070663_100001508 | 3300005455 | Bacteria | 12800 |
| 136 | Ga0070663_100164863 | 3300005455 | Bacteria | 1708 |
| 137 | Ga0070663_100289878 | 3300005455 | Bacteria | 1307 |
| 138 | Ga0070678_100042361 | 3300005456 | Bacteria | 3235 |
| 139 | Ga0070678_100239075 | 3300005456 | Bacteria | 1518 |
| 140 | Ga0070662_100139537 | 3300005457 | Bacteria | 1877 |
| 141 | Ga0068867_100000075 | 3300005459 | Bacteria | 60780 |
| 142 | Ga0068867_100004516 | 3300005459 | Bacteria | 9782 |
| 143 | Ga0068867_100052915 | 3300005459 | Bacteria | 2997 |
| 144 | Ga0070685_10033319 | 3300005466 | Bacteria | 2893 |
| 145 | Ga0070699_100081980 | 3300005518 | Bacteria | 2811 |
| 146 | Ga0070679_100004815 | 3300005530 | Bacteria | 12449 |
| 147 | Ga0068853_100001060 | 3300005539 | Bacteria | 19412 |
| 148 | Ga0068853_100049008 | 3300005539 | Bacteria | 3628 |
| 149 | Ga0068853_100073836 | 3300005539 | Bacteria | 2975 |
| 150 | Ga0068853_100077413 | 3300005539 | Bacteria | 2905 |
| 151 | Ga0068853_100116555 | 3300005539 | Bacteria | 2378 |
| 152 | Ga0068853_100262304 | 3300005539 | Bacteria | 1589 |
| 153 | Ga0070672_100001641 | 3300005543 | Bacteria | 13922 |
| 154 | Ga0070672_100003671 | 3300005543 | Bacteria | 9971 |
| 155 | Ga0070672_100004734 | 3300005543 | Bacteria | 8930 |
| 156 | Ga0070672_100005245 | 3300005543 | Bacteria | 8576 |
| 157 | Ga0070672_100074130 | 3300005543 | Bacteria | 2714 |
| 158 | Ga0070672_100084253 | 3300005543 | Bacteria | 2552 |
| 159 | Ga0070686_100024242 | 3300005544 | Bacteria | 3635 |
| 160 | Ga0070693_100070910 | 3300005547 | Bacteria | 2051 |
| 161 | Ga0070693_100157860 | 3300005547 | Bacteria | 1442 |
| 162 | Ga0070665_100005152 | 3300005548 | Bacteria | 13528 |
| 163 | Ga0068855_100000053 | 3300005563 | Bacteria | 139838 |
| 164 | Ga0068855_100034008 | 3300005563 | Bacteria | 6080 |
| 165 | Ga0068855_100061077 | 3300005563 | Bacteria | 4404 |
| 166 | Ga0068855_100105499 | 3300005563 | Bacteria | 3240 |
| 167 | Ga0068855_100110454 | 3300005563 | Bacteria | 3157 |
| 168 | Ga0068855_100157746 | 3300005563 | Bacteria | 2577 |
| 169 | Ga0068855_100245099 | 3300005563 | Bacteria | 2000 |
| 170 | Ga0068857_100006699 | 3300005577 | Bacteria | 9905 |
| 171 | Ga0068857_100025689 | 3300005577 | Bacteria | 5186 |
| 172 | Ga0068857_100029106 | 3300005577 | Bacteria | 4874 |
| 173 | Ga0068857_100059251 | 3300005577 | Bacteria | 3401 |
| 174 | Ga0068857_100063359 | 3300005577 | Bacteria | 3286 |
| 175 | Ga0068857_100256555 | 3300005577 | Bacteria | 1604 |
| 176 | Ga0068854_100024277 | 3300005578 | Bacteria | 4148 |
| 177 | Ga0068854_100194321 | 3300005578 | Bacteria | 1592 |
| 178 | Ga0068856_100004596 | 3300005614 | Bacteria | 13731 |
| 179 | Ga0068856_100009244 | 3300005614 | Bacteria | 9581 |
| 180 | Ga0068856_100019140 | 3300005614 | Bacteria | 6646 |
| 181 | Ga0068856_100152922 | 3300005614 | Bacteria | 2317 |
| 182 | Ga0068852_100009046 | 3300005616 | Bacteria | 7373 |
| 183 | Ga0068852_100013706 | 3300005616 | Bacteria | 6212 |
| 184 | Ga0068852_100029640 | 3300005616 | Bacteria | 4498 |
| 185 | Ga0068852_100062333 | 3300005616 | Bacteria | 3243 |
| 186 | Ga0068852_100080389 | 3300005616 | Bacteria | 2890 |
| 187 | Ga0068852_100126287 | 3300005616 | Bacteria | 2350 |
| 188 | Ga0068852_100341027 | 3300005616 | Bacteria | 1460 |
| 189 | Ga0068852_100390619 | 3300005616 | Bacteria | 1367 |
| 190 | Ga0068852_100413811 | 3300005616 | Bacteria | 1329 |
| 191 | Ga0068859_100030448 | 3300005617 | Bacteria | 5416 |
| 192 | Ga0068859_100036141 | 3300005617 | Bacteria | 4958 |
| 193 | Ga0068864_100005872 | 3300005618 | Bacteria | 10058 |
| 194 | Ga0068864_100038650 | 3300005618 | Bacteria | 4076 |
| 195 | Ga0068864_100039936 | 3300005618 | Bacteria | 4012 |
| 196 | Ga0068864_100070497 | 3300005618 | Bacteria | 3041 |
| 197 | Ga0068861_100006393 | 3300005719 | Bacteria | 8026 |
| 198 | Ga0068861_100069629 | 3300005719 | Bacteria | 2722 |
| 199 | Ga0068851_10000798 | 3300005834 | Bacteria | 13610 |
| 200 | Ga0068851_10012368 | 3300005834 | Bacteria | 4022 |
| 201 | Ga0068851_10027814 | 3300005834 | Bacteria | 2789 |
| 202 | Ga0068870_10075073 | 3300005840 | Bacteria | 1854 |
| 203 | Ga0068863_100031259 | 3300005841 | Bacteria | 5082 |
| 204 | Ga0068863_100120962 | 3300005841 | Bacteria | 2496 |
| 205 | Ga0068863_100399695 | 3300005841 | Bacteria | 1344 |
| 206 | Ga0068858_100015518 | 3300005842 | Bacteria | 7163 |
| 207 | Ga0068858_100028086 | 3300005842 | Bacteria | 5228 |
| 208 | Ga0068858_100154651 | 3300005842 | Bacteria | 2158 |
| 209 | Ga0068860_100004889 | 3300005843 | Bacteria | 13658 |
| 210 | Ga0068860_100131535 | 3300005843 | Bacteria | 2402 |
| 211 | Ga0068862_100031328 | 3300005844 | Bacteria | 4488 |
| 212 | Ga0068862_100048416 | 3300005844 | Bacteria | 3628 |
| 213 | Ga0068862_100113320 | 3300005844 | Bacteria | 2382 |
| 214 | Ga0070717_10109168 | 3300006028 | Bacteria | 2358 |
| 215 | Ga0075365_10000391 | 3300006038 | Bacteria | 16028 |
| 216 | Ga0075365_10217231 | 3300006038 | Bacteria | 1341 |
| 217 | Ga0075368_10092899 | 3300006042 | Bacteria | 1235 |
| 218 | Ga0075363_100005949 | 3300006048 | Bacteria | 5498 |
| 219 | Ga0075363_100062755 | 3300006048 | Bacteria | 2004 |
| 220 | Ga0075364_10031732 | 3300006051 | Bacteria | 3394 |
| 221 | Ga0075432_10012491 | 3300006058 | Bacteria | 2884 |
| 222 | Ga0070716_100193136 | 3300006173 | Bacteria | 1347 |
| 223 | Ga0075362_10004042 | 3300006177 | Bacteria | 5223 |
| 224 | Ga0075362_10021972 | 3300006177 | Bacteria | 2684 |
| 225 | Ga0075362_10040615 | 3300006177 | Bacteria | 2049 |
| 226 | Ga0075362_10052264 | 3300006177 | Bacteria | 1830 |
| 227 | Ga0075362_10093321 | 3300006177 | Bacteria | 1399 |
| 228 | Ga0075367_10020571 | 3300006178 | Bacteria | 3678 |
| 229 | Ga0075367_10031443 | 3300006178 | Bacteria | 3048 |
| 230 | Ga0075367_10046027 | 3300006178 | Bacteria | 2562 |
| 231 | Ga0075366_10004396 | 3300006195 | Bacteria | 7562 |
| 232 | Ga0075366_10008531 | 3300006195 | Bacteria | 5701 |
| 233 | Ga0075366_10043503 | 3300006195 | Bacteria | 2660 |
| 234 | Ga0075366_10092749 | 3300006195 | Bacteria | 1810 |
| 235 | Ga0097621_100031589 | 3300006237 | Bacteria | 4203 |
| 236 | Ga0097621_100045454 | 3300006237 | Bacteria | 3547 |
| 237 | Ga0075370_10001340 | 3300006353 | Bacteria | 10598 |
| 238 | Ga0075370_10011101 | 3300006353 | Bacteria | 4723 |
| 239 | Ga0068871_100069049 | 3300006358 | Bacteria | 2901 |
| 240 | Ga0068871_100240107 | 3300006358 | Bacteria | 1575 |
| 241 | Ga0075430_100263023 | 3300006846 | Bacteria | 1429 |
| 242 | Ga0075429_100093307 | 3300006880 | Bacteria | 2625 |
| 243 | Ga0068865_100004329 | 3300006881 | Bacteria | 8571 |
| 244 | Ga0068865_100150344 | 3300006881 | Bacteria | 1766 |
| 245 | Ga0068865_100174457 | 3300006881 | Bacteria | 1651 |
| 246 | Ga0097620_100030449 | 3300006931 | Bacteria | 5416 |
| 247 | Ga0097620_100036140 | 3300006931 | Bacteria | 4958 |
| 248 | Ga0079104_1000003 | 3300006946 | Bacteria | 468966 |
| 249 | Ga0079104_1000206 | 3300006946 | Bacteria | 82424 |
| 250 | Ga0099826_10010052 | 3300006948 | Bacteria | 7078 |
| 251 | Ga0105244_10014909 | 3300009036 | Bacteria | 4476 |
| 252 | Ga0105250_10011778 | 3300009092 | Bacteria | 3624 |
| 253 | Ga0105240_10000322 | 3300009093 | Bacteria | 90516 |
| 254 | Ga0105240_10045295 | 3300009093 | Bacteria | 5582 |
| 255 | Ga0105240_10089762 | 3300009093 | Bacteria | 3758 |
| 256 | Ga0105240_10365953 | 3300009093 | Bacteria | 1632 |
| 257 | Ga0105245_10117967 | 3300009098 | Bacteria | 2476 |
| 258 | Ga0105247_10024198 | 3300009101 | Bacteria | 3658 |
| 259 | Ga0105243_10000345 | 3300009148 | Bacteria | 49891 |
| 260 | Ga0105243_10001128 | 3300009148 | Bacteria | 24226 |
| 261 | Ga0105243_10001582 | 3300009148 | Bacteria | 19867 |
| 262 | Ga0105243_10021799 | 3300009148 | Bacteria | 4865 |
| 263 | Ga0105243_10219486 | 3300009148 | Bacteria | 1680 |
| 264 | Ga0105241_10078966 | 3300009174 | Bacteria | 2572 |
| 265 | Ga0105241_10237777 | 3300009174 | Bacteria | 1538 |
| 266 | Ga0105248_10007460 | 3300009177 | Bacteria | 12000 |
| 267 | Ga0105248_10112453 | 3300009177 | Bacteria | 3071 |
| 268 | Ga0105248_10147445 | 3300009177 | Bacteria | 2655 |
| 269 | Ga0105237_10001642 | 3300009545 | Bacteria | 29033 |
| 270 | Ga0105237_10045032 | 3300009545 | Bacteria | 4442 |
| 271 | Ga0105237_10063195 | 3300009545 | Bacteria | 3700 |
| 272 | Ga0105237_10239786 | 3300009545 | Bacteria | 1814 |
| 273 | Ga0105238_10017874 | 3300009551 | Bacteria | 7209 |
| 274 | Ga0105238_10023025 | 3300009551 | Bacteria | 6351 |
| 275 | Ga0105238_10077560 | 3300009551 | Bacteria | 3313 |
| 276 | Ga0105238_10086017 | 3300009551 | Bacteria | 3131 |
| 277 | Ga0105238_10091865 | 3300009551 | Bacteria | 3023 |
| 278 | Ga0105238_10125303 | 3300009551 | Bacteria | 2548 |
| 279 | Ga0105238_10228663 | 3300009551 | Bacteria | 1837 |
| 280 | Ga0105239_10002917 | 3300010375 | Bacteria | 21363 |
| 281 | Ga0105239_10035589 | 3300010375 | Bacteria | 5467 |
| 282 | Ga0105239_10038176 | 3300010375 | Bacteria | 5263 |
| 283 | Ga0105239_10162644 | 3300010375 | Bacteria | 2494 |
| 284 | Ga0105246_10115303 | 3300011119 | Bacteria | 1981 |
| 285 | Ga0157373_10009159 | 3300013100 | Bacteria | 7320 |
| 286 | Ga0157373_10074167 | 3300013100 | Bacteria | 2400 |
| 287 | Ga0157373_10102530 | 3300013100 | Bacteria | 2013 |
| 288 | Ga0157371_10008934 | 3300013102 | Bacteria | 7933 |
| 289 | Ga0157370_10017196 | 3300013104 | Bacteria | 7299 |
| 290 | Ga0157370_10022666 | 3300013104 | Bacteria | 6249 |
| 291 | Ga0157370_10194899 | 3300013104 | Bacteria | 1880 |
| 292 | Ga0157369_10034649 | 3300013105 | Bacteria | 5538 |
| 293 | Ga0157369_10048523 | 3300013105 | Bacteria | 4607 |
| 294 | Ga0157369_10051168 | 3300013105 | Bacteria | 4470 |
| 295 | Ga0171462_1026 | 3300013250 | Bacteria | 114045 |
| 296 | Ga0157374_10187187 | 3300013296 | Bacteria | 2024 |
| 297 | Ga0157374_10277895 | 3300013296 | Bacteria | 1653 |
| 298 | Ga0163162_10012682 | 3300013306 | Bacteria | 8226 |
| 299 | Ga0163162_10041220 | 3300013306 | Bacteria | 4619 |
| 300 | Ga0163162_10081708 | 3300013306 | Bacteria | 3302 |
| 301 | Ga0163162_10192958 | 3300013306 | Bacteria | 2165 |
| 302 | Ga0157372_10016841 | 3300013307 | Bacteria | 7847 |
| 303 | Ga0157372_10069543 | 3300013307 | Bacteria | 3959 |
| 304 | Ga0157372_10072226 | 3300013307 | Bacteria | 3888 |
| 305 | Ga0157372_10118949 | 3300013307 | Bacteria | 3032 |
| 306 | Ga0157372_10358924 | 3300013307 | Bacteria | 1698 |
| 307 | Ga0157375_10189844 | 3300013308 | Bacteria | 2209 |
| 308 | Ga0157375_10217643 | 3300013308 | Bacteria | 2068 |
| 309 | Ga0163163_10180340 | 3300014325 | Bacteria | 2159 |
| 310 | Ga0163163_10248157 | 3300014325 | Bacteria | 1830 |
| 311 | Ga0157380_10005359 | 3300014326 | Bacteria | 8964 |
| 312 | Ga0157380_10033824 | 3300014326 | Bacteria | 3939 |
| 313 | Ga0182008_10012396 | 3300014497 | Bacteria | 4500 |
| 314 | Ga0182008_10016669 | 3300014497 | Bacteria | 3816 |
| 315 | Ga0182008_10033465 | 3300014497 | Bacteria | 2578 |
| 316 | Ga0182008_10034007 | 3300014497 | Bacteria | 2556 |
| 317 | Ga0157377_10000743 | 3300014745 | Bacteria | 13483 |
| 318 | Ga0157377_10061840 | 3300014745 | Bacteria | 2141 |
| 319 | Ga0157379_10005615 | 3300014968 | Bacteria | 10780 |
| 320 | Ga0157379_10168169 | 3300014968 | Bacteria | 1979 |
| 321 | Ga0157379_10200451 | 3300014968 | Bacteria | 1805 |
| 322 | Ga0157376_10047551 | 3300014969 | Bacteria | 3542 |
| 323 | Ga0157376_10207333 | 3300014969 | Bacteria | 1807 |
| 324 | Ga0157376_10301329 | 3300014969 | Bacteria | 1517 |
| 325 | Ga0182006_1035323 | 3300015261 | Bacteria | 1994 |
| 326 | Ga0182006_1048888 | 3300015261 | Bacteria | 1634 |
| 327 | Ga0182007_10004007 | 3300015262 | Bacteria | 6794 |
| 328 | Ga0182005_1011304 | 3300015265 | Bacteria | 2548 |
| 329 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 330 | Ga0163161_10003871 | 3300017792 | Bacteria | 10495 |
| 331 | Ga0163161_10060364 | 3300017792 | Bacteria | 2760 |
| 332 | Ga0163161_10083086 | 3300017792 | Bacteria | 2361 |
| 333 | Ga0213872_10001975 | 3300021361 | Bacteria | 12491 |
| 334 | Ga0213876_10041117 | 3300021384 | Bacteria | 2443 |
| 335 | Ga0213875_10112838 | 3300021388 | Bacteria | 1269 |
| 336 | Ga0209435_100010 | 3300025206 | Bacteria | 475373 |
| 337 | Ga0209436_103411 | 3300025208 | Bacteria | 4238 |
| 338 | Ga0209672_101934 | 3300025228 | Bacteria | 5874 |
| 339 | Ga0209147_100874 | 3300025229 | Bacteria | 13857 |
| 340 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 341 | Ga0207427_101542 | 3300025231 | Bacteria | 8051 |
| 342 | Ga0209258_100018 | 3300025242 | Bacteria | 567561 |
| 343 | Ga0209258_100171 | 3300025242 | Bacteria | 145035 |
| 344 | Ga0209258_100621 | 3300025242 | Bacteria | 28085 |
| 345 | Ga0207425_1000195 | 3300025245 | Bacteria | 48597 |
| 346 | Ga0207425_1003463 | 3300025245 | Bacteria | 5043 |
| 347 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 348 | Ga0209646_1000089 | 3300025246 | Bacteria | 189974 |
| 349 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 350 | Ga0209026_1000028 | 3300025250 | Bacteria | 341399 |
| 351 | Ga0209677_100066 | 3300025253 | Bacteria | 149370 |
| 352 | Ga0209148_1000030 | 3300025254 | Bacteria | 567582 |
| 353 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 354 | Ga0209759_1000021 | 3300025256 | Bacteria | 341399 |
| 355 | Ga0209759_1002216 | 3300025256 | Bacteria | 8874 |
| 356 | Ga0209129_1000043 | 3300025258 | Bacteria | 298978 |
| 357 | Ga0209129_1000427 | 3300025258 | Bacteria | 31797 |
| 358 | Ga0209565_1000088 | 3300025263 | Bacteria | 151644 |
| 359 | Ga0209565_1000102 | 3300025263 | Bacteria | 127545 |
| 360 | Ga0209455_1000148 | 3300025272 | Bacteria | 131958 |
| 361 | Ga0209673_1000064 | 3300025273 | Bacteria | 254712 |
| 362 | Ga0209673_1000189 | 3300025273 | Bacteria | 123470 |
| 363 | Ga0209673_1008134 | 3300025273 | Bacteria | 4713 |
| 364 | Ga0209673_1010544 | 3300025273 | Bacteria | 3887 |
| 365 | Ga0209673_1032068 | 3300025273 | Bacteria | 1624 |
| 366 | Ga0209130_1000141 | 3300025284 | Bacteria | 115378 |
| 367 | Ga0209130_1000226 | 3300025284 | Bacteria | 73970 |
| 368 | Ga0209130_1001229 | 3300025284 | Bacteria | 18011 |
| 369 | Ga0209130_1001786 | 3300025284 | Bacteria | 12651 |
| 370 | Ga0209675_1000036 | 3300025291 | Bacteria | 254712 |
| 371 | Ga0209675_1000288 | 3300025291 | Bacteria | 47740 |
| 372 | Ga0209675_1001448 | 3300025291 | Bacteria | 13708 |
| 373 | Ga0209675_1003322 | 3300025291 | Bacteria | 7728 |
| 374 | Ga0209675_1015231 | 3300025291 | Bacteria | 2296 |
| 375 | Ga0209676_1000069 | 3300025292 | Bacteria | 312462 |
| 376 | Ga0209676_1000302 | 3300025292 | Bacteria | 99000 |
| 377 | Ga0209676_1000538 | 3300025292 | Bacteria | 58756 |
| 378 | Ga0209676_1004738 | 3300025292 | Bacteria | 7438 |
| 379 | Ga0209676_1017930 | 3300025292 | Bacteria | 2485 |
| 380 | Ga0209025_1000016 | 3300025294 | Bacteria | 770739 |
| 381 | Ga0209025_1000238 | 3300025294 | Bacteria | 128478 |
| 382 | Ga0209025_1000343 | 3300025294 | Bacteria | 101870 |
| 383 | Ga0209025_1005774 | 3300025294 | Bacteria | 9926 |
| 384 | Ga0209025_1006771 | 3300025294 | Bacteria | 8789 |
| 385 | Ga0209025_1026317 | 3300025294 | Bacteria | 2925 |
| 386 | Ga0209025_1030521 | 3300025294 | Bacteria | 2579 |
| 387 | Ga0209025_1047038 | 3300025294 | Bacteria | 1767 |
| 388 | Ga0209025_1051210 | 3300025294 | Bacteria | 1643 |
| 389 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 390 | Ga0209564_1000075 | 3300025295 | Bacteria | 285760 |
| 391 | Ga0209564_1000076 | 3300025295 | Bacteria | 283602 |
| 392 | Ga0209564_1000415 | 3300025295 | Bacteria | 75119 |
| 393 | Ga0209564_1000575 | 3300025295 | Bacteria | 58260 |
| 394 | Ga0209758_1000093 | 3300025297 | Bacteria | 241169 |
| 395 | Ga0209758_1000126 | 3300025297 | Bacteria | 189761 |
| 396 | Ga0209758_1000402 | 3300025297 | Bacteria | 74399 |
| 397 | Ga0209758_1025438 | 3300025297 | Bacteria | 2598 |
| 398 | Ga0209050_1000023 | 3300025298 | Bacteria | 537172 |
| 399 | Ga0209050_1000851 | 3300025298 | Bacteria | 41579 |
| 400 | Ga0209050_1003418 | 3300025298 | Bacteria | 11746 |
| 401 | Ga0209050_1005580 | 3300025298 | Bacteria | 7822 |
| 402 | Ga0209050_1008334 | 3300025298 | Bacteria | 5566 |
| 403 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 404 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 405 | Ga0209256_1000083 | 3300025299 | Bacteria | 221460 |
| 406 | Ga0209256_1001241 | 3300025299 | Bacteria | 28284 |
| 407 | Ga0207426_1000145 | 3300025302 | Bacteria | 191065 |
| 408 | Ga0207426_1002446 | 3300025302 | Bacteria | 11856 |
| 409 | Ga0209051_1000017 | 3300025303 | Bacteria | 537172 |
| 410 | Ga0209051_1000101 | 3300025303 | Bacteria | 163793 |
| 411 | Ga0209051_1000173 | 3300025303 | Bacteria | 117170 |
| 412 | Ga0209051_1000242 | 3300025303 | Bacteria | 91755 |
| 413 | Ga0209051_1000820 | 3300025303 | Bacteria | 32203 |
| 414 | Ga0209051_1004138 | 3300025303 | Bacteria | 9077 |
| 415 | Ga0209257_1000041 | 3300025304 | Bacteria | 537172 |
| 416 | Ga0209257_1000096 | 3300025304 | Bacteria | 259390 |
| 417 | Ga0209257_1000149 | 3300025304 | Bacteria | 192835 |
| 418 | Ga0209257_1007739 | 3300025304 | Bacteria | 6398 |
| 419 | Ga0209257_1020139 | 3300025304 | Bacteria | 2479 |
| 420 | Ga0207697_10056993 | 3300025315 | Bacteria | 1622 |
| 421 | Ga0207656_10002344 | 3300025321 | Bacteria | 6358 |
| 422 | Ga0207656_10003086 | 3300025321 | Bacteria | 5699 |
| 423 | Ga0207656_10038605 | 3300025321 | Bacteria | 2016 |
| 424 | Ga0207682_10043507 | 3300025893 | Bacteria | 1838 |
| 425 | Ga0207642_10050674 | 3300025899 | Bacteria | 1874 |
| 426 | Ga0207710_10014263 | 3300025900 | Bacteria | 3348 |
| 427 | Ga0207688_10052395 | 3300025901 | Bacteria | 2286 |
| 428 | Ga0207688_10102116 | 3300025901 | Bacteria | 1657 |
| 429 | Ga0207680_10044927 | 3300025903 | Bacteria | 2601 |
| 430 | Ga0207680_10061617 | 3300025903 | Bacteria | 2289 |
| 431 | Ga0207699_10040840 | 3300025906 | Bacteria | 2676 |
| 432 | Ga0207645_10037609 | 3300025907 | Bacteria | 3105 |
| 433 | Ga0207645_10050869 | 3300025907 | Bacteria | 2646 |
| 434 | Ga0207705_10069044 | 3300025909 | Bacteria | 2559 |
| 435 | Ga0207684_10002973 | 3300025910 | Bacteria | 16792 |
| 436 | Ga0207695_10004077 | 3300025913 | Bacteria | 20085 |
| 437 | Ga0207695_10015442 | 3300025913 | Bacteria | 8990 |
| 438 | Ga0207695_10042012 | 3300025913 | Bacteria | 4888 |
| 439 | Ga0207671_10000168 | 3300025914 | Bacteria | 100117 |
| 440 | Ga0207671_10133479 | 3300025914 | Bacteria | 1907 |
| 441 | Ga0207671_10160866 | 3300025914 | Bacteria | 1739 |
| 442 | Ga0207662_10012394 | 3300025918 | Bacteria | 4746 |
| 443 | Ga0207662_10100047 | 3300025918 | Bacteria | 1795 |
| 444 | Ga0207662_10113367 | 3300025918 | Bacteria | 1693 |
| 445 | Ga0207657_10034044 | 3300025919 | Bacteria | 4586 |
| 446 | Ga0207657_10054750 | 3300025919 | Bacteria | 3448 |
| 447 | Ga0207657_10131964 | 3300025919 | Bacteria | 2047 |
| 448 | Ga0207649_10001238 | 3300025920 | Bacteria | 15279 |
| 449 | Ga0207649_10014631 | 3300025920 | Bacteria | 4397 |
| 450 | Ga0207649_10016297 | 3300025920 | Bacteria | 4187 |
| 451 | Ga0207649_10053615 | 3300025920 | Bacteria | 2507 |
| 452 | Ga0207649_10076378 | 3300025920 | Bacteria | 2155 |
| 453 | Ga0207681_10001781 | 3300025923 | Bacteria | 13828 |
| 454 | Ga0207681_10023829 | 3300025923 | Bacteria | 3920 |
| 455 | Ga0207681_10252894 | 3300025923 | Bacteria | 1376 |
| 456 | Ga0207694_10031500 | 3300025924 | Bacteria | 4052 |
| 457 | Ga0207694_10093249 | 3300025924 | Bacteria | 2378 |
| 458 | Ga0207650_10010289 | 3300025925 | Bacteria | 6413 |
| 459 | Ga0207650_10014168 | 3300025925 | Bacteria | 5538 |
| 460 | Ga0207650_10027615 | 3300025925 | Bacteria | 4064 |
| 461 | Ga0207659_10010026 | 3300025926 | Bacteria | 5933 |
| 462 | Ga0207659_10025707 | 3300025926 | Bacteria | 3961 |
| 463 | Ga0207659_10058000 | 3300025926 | Bacteria | 2778 |
| 464 | Ga0207659_10060715 | 3300025926 | Bacteria | 2722 |
| 465 | Ga0207687_10050002 | 3300025927 | Bacteria | 2909 |
| 466 | Ga0207644_10004445 | 3300025931 | Bacteria | 9104 |
| 467 | Ga0207644_10036765 | 3300025931 | Bacteria | 3439 |
| 468 | Ga0207644_10090387 | 3300025931 | Bacteria | 2281 |
| 469 | Ga0207644_10096075 | 3300025931 | Bacteria | 2217 |
| 470 | Ga0207644_10191658 | 3300025931 | Bacteria | 1607 |
| 471 | Ga0207690_10073175 | 3300025932 | Bacteria | 2369 |
| 472 | Ga0207690_10096992 | 3300025932 | Bacteria | 2097 |
| 473 | Ga0207690_10302826 | 3300025932 | Bacteria | 1251 |
| 474 | Ga0207706_10002128 | 3300025933 | Bacteria | 19389 |
| 475 | Ga0207706_10015279 | 3300025933 | Bacteria | 6944 |
| 476 | Ga0207706_10121557 | 3300025933 | Bacteria | 2296 |
| 477 | Ga0207686_10045156 | 3300025934 | Bacteria | 2710 |
| 478 | Ga0207709_10000032 | 3300025935 | Bacteria | 324478 |
| 479 | Ga0207709_10000094 | 3300025935 | Bacteria | 137959 |
| 480 | Ga0207709_10000784 | 3300025935 | Bacteria | 24867 |
| 481 | Ga0207709_10003063 | 3300025935 | Bacteria | 10106 |
| 482 | Ga0207709_10003619 | 3300025935 | Bacteria | 9131 |
| 483 | Ga0207670_10001093 | 3300025936 | Bacteria | 14291 |
| 484 | Ga0207670_10024696 | 3300025936 | Bacteria | 3760 |
| 485 | Ga0207669_10043462 | 3300025937 | Bacteria | 2632 |
| 486 | Ga0207669_10060909 | 3300025937 | Bacteria | 2316 |
| 487 | Ga0207704_10002831 | 3300025938 | Bacteria | 7827 |
| 488 | Ga0207704_10067883 | 3300025938 | Bacteria | 2246 |
| 489 | Ga0207704_10076032 | 3300025938 | Bacteria | 2150 |
| 490 | Ga0207691_10001442 | 3300025940 | Bacteria | 23711 |
| 491 | Ga0207691_10002041 | 3300025940 | Bacteria | 19750 |
| 492 | Ga0207691_10004983 | 3300025940 | Bacteria | 12809 |
| 493 | Ga0207691_10009965 | 3300025940 | Bacteria | 9126 |
| 494 | Ga0207691_10018437 | 3300025940 | Bacteria | 6615 |
| 495 | Ga0207691_10077884 | 3300025940 | Bacteria | 2985 |
| 496 | Ga0207691_10082574 | 3300025940 | Bacteria | 2886 |
| 497 | Ga0207691_10232322 | 3300025940 | Bacteria | 1597 |
| 498 | Ga0207711_10011487 | 3300025941 | Bacteria | 7362 |
| 499 | Ga0207711_10018674 | 3300025941 | Bacteria | 5765 |
| 500 | Ga0207711_10024119 | 3300025941 | Bacteria | 5091 |
| 501 | Ga0207711_10038494 | 3300025941 | Bacteria | 4067 |
| 502 | Ga0207711_10092517 | 3300025941 | Bacteria | 2661 |
| 503 | Ga0207711_10142903 | 3300025941 | Bacteria | 2154 |
| 504 | Ga0207689_10014447 | 3300025942 | Bacteria | 6716 |
| 505 | Ga0207689_10022136 | 3300025942 | Bacteria | 5345 |
| 506 | Ga0207689_10030620 | 3300025942 | Bacteria | 4484 |
| 507 | Ga0207661_10070932 | 3300025944 | Bacteria | 2845 |
| 508 | Ga0207661_10079969 | 3300025944 | Bacteria | 2696 |
| 509 | Ga0207679_10003824 | 3300025945 | Bacteria | 9330 |
| 510 | Ga0207667_10000698 | 3300025949 | Bacteria | 43531 |
| 511 | Ga0207667_10001661 | 3300025949 | Bacteria | 28046 |
| 512 | Ga0207667_10002223 | 3300025949 | Bacteria | 24360 |
| 513 | Ga0207667_10086692 | 3300025949 | Bacteria | 3240 |
| 514 | Ga0207667_10092740 | 3300025949 | Bacteria | 3119 |
| 515 | Ga0207651_10007547 | 3300025960 | Bacteria | 5802 |
| 516 | Ga0207651_10017350 | 3300025960 | Bacteria | 4251 |
| 517 | Ga0207712_10022271 | 3300025961 | Bacteria | 4170 |
| 518 | Ga0207712_10022799 | 3300025961 | Bacteria | 4126 |
| 519 | Ga0207712_10106287 | 3300025961 | Bacteria | 2096 |
| 520 | Ga0207668_10003415 | 3300025972 | Bacteria | 9315 |
| 521 | Ga0207668_10168538 | 3300025972 | Bacteria | 1715 |
| 522 | Ga0207640_10033012 | 3300025981 | Bacteria | 3215 |
| 523 | Ga0207640_10053241 | 3300025981 | Bacteria | 2641 |
| 524 | Ga0207640_10073416 | 3300025981 | Bacteria | 2312 |
| 525 | Ga0207658_10001577 | 3300025986 | Bacteria | 17634 |
| 526 | Ga0207658_10004517 | 3300025986 | Bacteria | 9669 |
| 527 | Ga0207658_10283328 | 3300025986 | Bacteria | 1421 |
| 528 | Ga0207677_10022572 | 3300026023 | Bacteria | 3871 |
| 529 | Ga0207677_10033296 | 3300026023 | Bacteria | 3323 |
| 530 | Ga0207703_10001878 | 3300026035 | Bacteria | 18670 |
| 531 | Ga0207703_10035246 | 3300026035 | Bacteria | 3976 |
| 532 | Ga0207639_10106692 | 3300026041 | Bacteria | 2274 |
| 533 | Ga0207639_10122952 | 3300026041 | Bacteria | 2135 |
| 534 | Ga0207678_10004159 | 3300026067 | Bacteria | 12993 |
| 535 | Ga0207678_10017786 | 3300026067 | Bacteria | 6242 |
| 536 | Ga0207678_10081702 | 3300026067 | Bacteria | 2766 |
| 537 | Ga0207678_10124242 | 3300026067 | Bacteria | 2202 |
| 538 | Ga0207678_10213366 | 3300026067 | Bacteria | 1652 |
| 539 | Ga0207708_10028301 | 3300026075 | Bacteria | 4245 |
| 540 | Ga0207702_10000877 | 3300026078 | Bacteria | 31301 |
| 541 | Ga0207702_10034976 | 3300026078 | Bacteria | 4201 |
| 542 | Ga0207702_10068520 | 3300026078 | Bacteria | 3048 |
| 543 | Ga0207641_10002805 | 3300026088 | Bacteria | 15850 |
| 544 | Ga0207641_10021538 | 3300026088 | Bacteria | 5297 |
| 545 | Ga0207641_10127974 | 3300026088 | Bacteria | 2276 |
| 546 | Ga0207648_10001842 | 3300026089 | Bacteria | 23196 |
| 547 | Ga0207648_10028775 | 3300026089 | Bacteria | 4926 |
| 548 | Ga0207648_10059188 | 3300026089 | Bacteria | 3341 |
| 549 | Ga0207648_10122431 | 3300026089 | Bacteria | 2287 |
| 550 | Ga0207648_10417211 | 3300026089 | Bacteria | 1218 |
| 551 | Ga0207676_10002802 | 3300026095 | Bacteria | 12393 |
| 552 | Ga0207676_10003791 | 3300026095 | Bacteria | 10690 |
| 553 | Ga0207676_10072578 | 3300026095 | Bacteria | 2767 |
| 554 | Ga0207674_10018453 | 3300026116 | Bacteria | 7581 |
| 555 | Ga0207674_10168100 | 3300026116 | Bacteria | 2146 |
| 556 | Ga0207674_10465021 | 3300026116 | Bacteria | 1222 |
| 557 | Ga0207675_100000428 | 3300026118 | Bacteria | 40700 |
| 558 | Ga0207675_100003768 | 3300026118 | Bacteria | 14772 |
| 559 | Ga0207675_100374214 | 3300026118 | Bacteria | 1400 |
| 560 | Ga0207683_10015545 | 3300026121 | Bacteria | 6481 |
| 561 | Ga0207683_10050837 | 3300026121 | Bacteria | 3631 |
| 562 | Ga0207683_10123727 | 3300026121 | Bacteria | 2323 |
| 563 | Ga0207683_10283276 | 3300026121 | Bacteria | 1515 |
| 564 | Ga0207698_10006186 | 3300026142 | Bacteria | 7452 |
| 565 | Ga0207698_10026324 | 3300026142 | Bacteria | 4113 |
| 566 | Ga0207698_10044256 | 3300026142 | Bacteria | 3343 |
| 567 | Ga0207698_10058171 | 3300026142 | Bacteria | 2995 |
| 568 | Ga0207698_10120262 | 3300026142 | Bacteria | 2221 |
| 569 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 570 | Ga0209281_1000259 | 3300027111 | Bacteria | 101905 |
| 571 | Ga0209968_1008498 | 3300027526 | Bacteria | 1565 |
| 572 | Ga0209282_1000253 | 3300027666 | Bacteria | 26889 |
| 573 | Ga0268266_10000691 | 3300028379 | Bacteria | 45474 |
| 574 | Ga0268265_10060503 | 3300028380 | Bacteria | 2903 |
| 575 | Ga0268265_10082447 | 3300028380 | Bacteria | 2543 |
| 576 | Ga0268264_10004642 | 3300028381 | Bacteria | 11672 |
| 577 | Ga0268264_10005729 | 3300028381 | Bacteria | 10529 |
| 578 | Ga0268264_10174207 | 3300028381 | Bacteria | 1948 |
| 579 | Ga0265334_10005111 | 3300028573 | Bacteria | 5747 |
| 580 | Ga0265336_10000028 | 3300028666 | Bacteria | 179201 |
| 581 | Ga0265336_10024599 | 3300028666 | Bacteria | 1900 |
| 582 | Ga0307517_10051884 | 3300028786 | Bacteria | 4126 |
| 583 | Ga0307517_10142783 | 3300028786 | Bacteria | 1674 |
| 584 | Ga0307515_10000160 | 3300028794 | Bacteria | 164789 |
| 585 | Ga0307515_10000184 | 3300028794 | Bacteria | 153952 |
| 586 | Ga0307515_10006930 | 3300028794 | Bacteria | 22516 |
| 587 | Ga0307515_10049623 | 3300028794 | Bacteria | 6306 |
| 588 | Ga0307515_10091314 | 3300028794 | Bacteria | 3806 |
| 589 | Ga0307515_10098849 | 3300028794 | Bacteria | 3549 |
| 590 | Ga0265338_10008192 | 3300028800 | Bacteria | 12738 |
| 591 | Ga0265324_10001001 | 3300029957 | Bacteria | 17367 |
| 592 | Ga0307511_10078378 | 3300030521 | Bacteria | 2344 |
| 593 | Ga0307512_10003982 | 3300030522 | Bacteria | 16512 |
| 594 | Ga0265330_10001213 | 3300031235 | Bacteria | 15203 |
| 595 | Ga0265330_10007925 | 3300031235 | Bacteria | 5147 |
| 596 | Ga0265332_10000005 | 3300031238 | Bacteria | 377525 |
| 597 | Ga0265332_10000011 | 3300031238 | Bacteria | 284299 |
| 598 | Ga0265332_10000107 | 3300031238 | Bacteria | 70652 |
| 599 | Ga0265332_10006627 | 3300031238 | Bacteria | 5247 |
| 600 | Ga0265328_10000266 | 3300031239 | Bacteria | 24085 |
| 601 | Ga0265320_10004067 | 3300031240 | Bacteria | 9611 |
| 602 | Ga0265320_10005009 | 3300031240 | Bacteria | 8584 |
| 603 | Ga0265325_10001526 | 3300031241 | Bacteria | 16238 |
| 604 | Ga0265325_10004976 | 3300031241 | Bacteria | 8280 |
| 605 | Ga0265325_10072892 | 3300031241 | Bacteria | 1720 |
| 606 | Ga0265329_10000288 | 3300031242 | Bacteria | 26582 |
| 607 | Ga0265339_10002899 | 3300031249 | Bacteria | 12141 |
| 608 | Ga0265339_10020302 | 3300031249 | Bacteria | 3883 |
| 609 | Ga0265339_10035027 | 3300031249 | Bacteria | 2819 |
| 610 | Ga0265331_10002501 | 3300031250 | Bacteria | 12411 |
| 611 | Ga0265331_10003107 | 3300031250 | Bacteria | 10866 |
| 612 | Ga0265331_10039049 | 3300031250 | Bacteria | 2317 |
| 613 | Ga0265327_10000083 | 3300031251 | Bacteria | 204923 |
| 614 | Ga0265327_10000572 | 3300031251 | Bacteria | 62611 |
| 615 | Ga0265327_10037034 | 3300031251 | Bacteria | 2675 |
| 616 | Ga0265316_10000233 | 3300031344 | Bacteria | 64109 |
| 617 | Ga0265316_10040621 | 3300031344 | Bacteria | 3728 |
| 618 | Ga0307513_10000004 | 3300031456 | Bacteria | 558931 |
| 619 | Ga0307513_10000015 | 3300031456 | Bacteria | 296183 |
| 620 | Ga0307509_10004068 | 3300031507 | Bacteria | 21447 |
| 621 | Ga0307509_10135853 | 3300031507 | Bacteria | 2405 |
| 622 | Ga0307408_100017758 | 3300031548 | Bacteria | 4767 |
| 623 | Ga0307408_100042107 | 3300031548 | Bacteria | 3241 |
| 624 | Ga0307408_100061447 | 3300031548 | Bacteria | 2743 |
| 625 | Ga0307408_100083595 | 3300031548 | Bacteria | 2392 |
| 626 | Ga0307408_100172818 | 3300031548 | Bacteria | 1727 |
| 627 | Ga0307408_100293704 | 3300031548 | Bacteria | 1358 |
| 628 | Ga0265313_10000107 | 3300031595 | Bacteria | 83816 |
| 629 | Ga0265313_10004965 | 3300031595 | Bacteria | 9954 |
| 630 | Ga0265313_10057166 | 3300031595 | Bacteria | 1842 |
| 631 | Ga0265313_10057731 | 3300031595 | Bacteria | 1830 |
| 632 | Ga0307508_10030221 | 3300031616 | Bacteria | 4896 |
| 633 | Ga0307508_10069430 | 3300031616 | Bacteria | 3095 |
| 634 | Ga0307514_10011139 | 3300031649 | Bacteria | 7485 |
| 635 | Ga0265314_10000026 | 3300031711 | Bacteria | 284299 |
| 636 | Ga0265314_10000677 | 3300031711 | Bacteria | 41527 |
| 637 | Ga0265314_10002021 | 3300031711 | Bacteria | 21531 |
| 638 | Ga0265314_10004697 | 3300031711 | Bacteria | 12543 |
| 639 | Ga0265314_10009030 | 3300031711 | Bacteria | 8473 |
| 640 | Ga0265314_10022612 | 3300031711 | Bacteria | 4815 |
| 641 | Ga0265342_10000862 | 3300031712 | Bacteria | 30245 |
| 642 | Ga0265342_10001343 | 3300031712 | Bacteria | 23075 |
| 643 | Ga0265342_10005935 | 3300031712 | Bacteria | 9195 |
| 644 | Ga0265342_10090259 | 3300031712 | Bacteria | 1757 |
| 645 | Ga0265342_10099371 | 3300031712 | Bacteria | 1660 |
| 646 | Ga0307516_10000283 | 3300031730 | Bacteria | 65833 |
| 647 | Ga0307516_10000460 | 3300031730 | Bacteria | 53821 |
| 648 | Ga0307516_10001460 | 3300031730 | Bacteria | 32683 |
| 649 | Ga0307516_10014862 | 3300031730 | Bacteria | 8218 |
| 650 | Ga0307516_10049562 | 3300031730 | Bacteria | 4126 |
| 651 | Ga0307516_10058753 | 3300031730 | Bacteria | 3742 |
| 652 | Ga0307516_10094383 | 3300031730 | Bacteria | 2816 |
| 653 | Ga0307516_10257922 | 3300031730 | Bacteria | 1435 |
| 654 | Ga0307405_10007945 | 3300031731 | Bacteria | 5348 |
| 655 | Ga0307405_10045380 | 3300031731 | Bacteria | 2692 |
| 656 | Ga0307405_10054409 | 3300031731 | Bacteria | 2498 |
| 657 | Ga0307410_10048747 | 3300031852 | Bacteria | 2839 |
| 658 | Ga0307406_10012802 | 3300031901 | Bacteria | 4789 |
| 659 | Ga0307406_10038475 | 3300031901 | Bacteria | 2961 |
| 660 | Ga0307412_10007984 | 3300031911 | Bacteria | 6033 |
| 661 | Ga0307412_10022011 | 3300031911 | Bacteria | 3901 |
| 662 | Ga0307412_10080308 | 3300031911 | Bacteria | 2252 |
| 663 | Ga0307412_10252181 | 3300031911 | Bacteria | 1371 |
| 664 | Ga0307409_100003565 | 3300031995 | Bacteria | 8492 |
| 665 | Ga0307409_100163369 | 3300031995 | Bacteria | 1951 |
| 666 | Ga0307416_100006952 | 3300032002 | Bacteria | 7134 |
| 667 | Ga0307416_100011019 | 3300032002 | Bacteria | 6005 |
| 668 | Ga0307414_10098932 | 3300032004 | Bacteria | 2190 |
| 669 | Ga0307414_10134686 | 3300032004 | Bacteria | 1924 |
| 670 | Ga0307414_10275483 | 3300032004 | Bacteria | 1411 |
| 671 | Ga0307411_10036214 | 3300032005 | Bacteria | 3089 |
| 672 | Ga0307411_10042402 | 3300032005 | Bacteria | 2903 |
| 673 | Ga0307411_10159457 | 3300032005 | Bacteria | 1687 |
| 674 | Ga0307415_100015925 | 3300032126 | Bacteria | 4465 |
| 675 | Ga0307507_10082017 | 3300033179 | Bacteria | 2831 |
| 676 | Ga0307510_10087595 | 3300033180 | Bacteria | 2978 |
| 677 | Ga0373934_0034716 | 3300035086 | Bacteria | 1982 |
| 678 | Ga0373956_0024775 | 3300035119 | Bacteria | 2589 |
| 679 | Ga0373956_0104117 | 3300035119 | Bacteria | 1318 |
| 680 | Ga0373957_0006535 | 3300035120 | Bacteria | 3676 |
| 681 | Ga0373955_0002467 | 3300035172 | Bacteria | 8083 |
| 682 | Ga0373961_0000090 | 3300035241 | Bacteria | 49242 |
| 683 | Ga0373931_0019318 | 3300035691 | Bacteria | 3401 |
| 684 | Ga0373935_0034573 | 3300035692 | Bacteria | 3151 |
| 685 | Ga0373935_0188446 | 3300035692 | Bacteria | 1420 |
| 686 | Ga0373935_0220091 | 3300035692 | Bacteria | 1318 |
| 687 | Ga0373933_0013190 | 3300035724 | Bacteria | 4577 |
| 688 | Ga0373937_0033494 | 3300036401 | Bacteria | 4666 |
| 689 | Ga0373937_0138556 | 3300036401 | Bacteria | 2275 |
| 690 | Ga0373925_0003169 | 3300037068 | Bacteria | 12875 |
| 691 | Ga0373925_0033870 | 3300037068 | Bacteria | 3764 |
| 692 | Ga0395899_0014940 | 3300037312 | Bacteria | 5921 |
| 693 | Ga0395899_0016191 | 3300037312 | Bacteria | 5683 |
| 694 | Ga0395899_0017939 | 3300037312 | Bacteria | 5385 |
| 695 | Ga0395899_0126367 | 3300037312 | Bacteria | 1828 |
| 696 | Ga0395900_0014879 | 3300037418 | Bacteria | 7927 |
| 697 | Ga0395900_0029863 | 3300037418 | Bacteria | 5595 |
| 698 | Ga0395900_0071458 | 3300037418 | Bacteria | 3567 |
| 699 | Ga0395900_0289727 | 3300037418 | Bacteria | 1626 |
| 700 | Ga0395898_0024397 | 3300037466 | Bacteria | 6098 |
| 701 | Ga0395898_0064013 | 3300037466 | Bacteria | 3567 |
| 702 | Ga0395898_0093693 | 3300037466 | Bacteria | 2886 |
| 703 | Ga0395898_0325328 | 3300037466 | Bacteria | 1466 |
| 704 | Ga0395905_0000025 | 3300037471 | Bacteria | 317571 |
| 705 | Ga0395905_0007656 | 3300037471 | Bacteria | 10722 |
| 706 | Ga0395905_0027223 | 3300037471 | Bacteria | 5391 |
| 707 | Ga0395905_0051557 | 3300037471 | Bacteria | 3854 |
| 708 | Ga0395905_0114538 | 3300037471 | Bacteria | 2533 |
| 709 | Ga0395905_0213236 | 3300037471 | Bacteria | 1809 |
| 710 | Ga0395905_0311935 | 3300037471 | Bacteria | 1461 |
| 711 | Ga0436364_0268395 | 3300037853 | Bacteria | 3994 |
| 712 | Ga0395901_0015016 | 3300038443 | Bacteria | 7873 |
| 713 | Ga0395901_0047183 | 3300038443 | Bacteria | 4472 |
| 714 | Ga0395901_0063804 | 3300038443 | Bacteria | 3834 |
| 715 | Ga0395901_0077770 | 3300038443 | Bacteria | 3463 |
| 716 | Ga0395901_0265053 | 3300038443 | Bacteria | 1787 |
| 717 | Ga0436365_0431674 | 3300039437 | Bacteria | 3115 |
| 718 | Ga0436361_1170859 | 3300039447 | Bacteria | 26091 |
| 719 | Ga0436363_0015497 | 3300039450 | Bacteria | 1693 |
| 720 | Ga0436363_1073622 | 3300039450 | Bacteria | 13302 |
| 721 | Ga0439465_0011137 | 3300041413 | Bacteria | 2823 |
| 722 | Ga0439465_0024201 | 3300041413 | Bacteria | 1914 |
| 723 | Ga0439433_0002359 | 3300041999 | Bacteria | 4001 |
| 724 | Ga0439432_007426 | 3300042006 | Bacteria | 3885 |
| 725 | Ga0439432_018979 | 3300042006 | Bacteria | 2294 |
| 726 | Ga0439449_0000714 | 3300042007 | Bacteria | 12712 |
| 727 | Ga0439449_0000777 | 3300042007 | Bacteria | 12288 |
| 728 | Ga0439449_0052701 | 3300042007 | Bacteria | 1504 |
| 729 | Ga0439457_010176 | 3300042014 | Bacteria | 2169 |
| 730 | Ga0450923_003039 | 3300042125 | Bacteria | 2486 |
| 731 | Ga0450923_011882 | 3300042125 | Bacteria | 1576 |
| 732 | Ga0439446_0008693 | 3300042156 | Bacteria | 2704 |
| 733 | Ga0439434_0016742 | 3300042435 | Bacteria | 2191 |
| 734 | Ga0439434_0033373 | 3300042435 | Bacteria | 1568 |
| 735 | Ga0450918_000716 | 3300042531 | Bacteria | 7029 |
| 736 | Ga0450918_001165 | 3300042531 | Bacteria | 5394 |
| 737 | Ga0451577_0000419 | 3300042876 | Bacteria | 76708 |
| 738 | Ga0451577_0034859 | 3300042876 | Bacteria | 4535 |
| 739 | Ga0451577_0255491 | 3300042876 | Bacteria | 1586 |
| 740 | Ga0439440_0044678 | 3300042993 | Bacteria | 1090 |
| 741 | Ga0453683_0002969 | 3300044673 | Bacteria | 12730 |
| 742 | Ga0466965_0043520 | 3300044683 | Bacteria | 2217 |
| 743 | Ga0453684_0000475 | 3300044712 | Bacteria | 159174 |
| 744 | Ga0453684_0008658 | 3300044712 | Bacteria | 18114 |
| 745 | Ga0453684_0109098 | 3300044712 | Bacteria | 3367 |
| 746 | Ga0453684_0136832 | 3300044712 | Bacteria | 2931 |
| 747 | Ga0453684_0241678 | 3300044712 | Bacteria | 2078 |
| 748 | Ga0466957_0062018 | 3300044842 | Bacteria | 2296 |
| 749 | Ga0466957_0104831 | 3300044842 | Bacteria | 1786 |
| 750 | Ga0466959_0032626 | 3300045049 | Bacteria | 3854 |
| 751 | Ga0451576_0004269 | 3300045051 | Bacteria | 18733 |
| 752 | Ga0451576_0006268 | 3300045051 | Bacteria | 14636 |
| 753 | Ga0451576_0017617 | 3300045051 | Bacteria | 7850 |
| 754 | Ga0451576_0041353 | 3300045051 | Bacteria | 4874 |
| 755 | Ga0451576_0188376 | 3300045051 | Bacteria | 2154 |
| 756 | Ga0451576_0242410 | 3300045051 | Bacteria | 1883 |
| 757 | Ga0495592_0000427 | 3300046454 | Bacteria | 31839 |
| 758 | Ga0495629_0052419 | 3300046459 | Bacteria | 2855 |
| 759 | Ga0495638_0105043 | 3300046460 | Bacteria | 1684 |
| 760 | Ga0495638_0109902 | 3300046460 | Bacteria | 1638 |
| 761 | Ga0495650_0013525 | 3300046471 | Bacteria | 4309 |
| 762 | Ga0495650_0029722 | 3300046471 | Bacteria | 2487 |
| 763 | Ga0495580_0163083 | 3300046472 | Bacteria | 1542 |
| 764 | Ga0495608_0080071 | 3300046511 | Bacteria | 2124 |
| 765 | Ga0495610_0043351 | 3300046512 | Bacteria | 2242 |
| 766 | Ga0495616_0005153 | 3300046513 | Bacteria | 8106 |
| 767 | Ga0495618_0284723 | 3300046514 | Bacteria | 1030 |
| 768 | Ga0495628_0082921 | 3300046516 | Bacteria | 2490 |
| 769 | Ga0495631_0003589 | 3300046518 | Bacteria | 8459 |
| 770 | Ga0495632_0005676 | 3300046519 | Bacteria | 8201 |
| 771 | Ga0495609_0055994 | 3300046538 | Bacteria | 1748 |
| 772 | Ga0495621_0022002 | 3300046539 | Bacteria | 2108 |
| 773 | Ga0495633_0000499 | 3300046558 | Bacteria | 39590 |
| 774 | Ga0495656_0000974 | 3300046615 | Bacteria | 9264 |
| 775 | Ga0495625_0000116 | 3300046660 | Bacteria | 122740 |
| 776 | Ga0495625_0106167 | 3300046660 | Bacteria | 1923 |
| 777 | Ga0495647_0028409 | 3300046681 | Bacteria | 2062 |
| 778 | Ga0495671_0023540 | 3300046692 | Bacteria | 3217 |
| 779 | Ga0495676_0038995 | 3300047321 | Bacteria | 3940 |
| 780 | Ga0495684_0285827 | 3300047471 | Bacteria | 1188 |
| 781 | Ga0495686_0076358 | 3300047472 | Bacteria | 2053 |
| 782 | Ga0495614_0027494 | 3300048089 | Bacteria | 2452 |
| 783 | Ga0495615_0013138 | 3300048090 | Bacteria | 1724 |
| 784 | Ga0495615_0017546 | 3300048090 | Bacteria | 1561 |
| 785 | Ga0496100_0087961 | 3300048903 | Bacteria | 2114 |
| 786 | Ga0496100_0150055 | 3300048903 | Bacteria | 1661 |
| 787 | Ga0496101_0149882 | 3300048904 | Bacteria | 1783 |
| 788 | Ga0496102_0261304 | 3300048905 | Bacteria | 1632 |
| 789 | Ga0496103_0036091 | 3300048906 | Bacteria | 3027 |
| 790 | Ga0496103_0079809 | 3300048906 | Bacteria | 2057 |
| 791 | Ga0496104_0030814 | 3300048907 | Bacteria | 4987 |
| 792 | Ga0496105_0129529 | 3300048908 | Bacteria | 2081 |
| 793 | Ga0496106_0007537 | 3300048909 | Bacteria | 8050 |
| 794 | Ga0496107_0040451 | 3300048910 | Bacteria | 3346 |
| 795 | Ga0496108_0089223 | 3300048911 | Bacteria | 2620 |
| 796 | Ga0496108_0151075 | 3300048911 | Bacteria | 2004 |
| 797 | Ga0496110_0125259 | 3300048913 | Bacteria | 2318 |
| 798 | Ga0496110_0169641 | 3300048913 | Bacteria | 1980 |
| 799 | Ga0496110_0181775 | 3300048913 | Bacteria | 1909 |
| 800 | Ga0496111_0011763 | 3300048914 | Bacteria | 5908 |
| 801 | Ga0496111_0096795 | 3300048914 | Bacteria | 2166 |
| 802 | Ga0496112_0007641 | 3300048915 | Bacteria | 9614 |
| 803 | Ga0496112_0296716 | 3300048915 | Bacteria | 1562 |
| 804 | Ga0496113_0162806 | 3300048916 | Bacteria | 1764 |
| 805 | Ga0496114_0010850 | 3300048917 | Bacteria | 7254 |
| 806 | Ga0496114_0011767 | 3300048917 | Bacteria | 7001 |
| 807 | Ga0496115_0055645 | 3300048918 | Bacteria | 3178 |
| 808 | Ga0496117_0032387 | 3300048920 | Bacteria | 3972 |
| 809 | Ga0496117_0066002 | 3300048920 | Bacteria | 2457 |
| 810 | Ga0496117_0071590 | 3300048920 | Bacteria | 2322 |
| 811 | Ga0496121_0003381 | 3300048924 | Bacteria | 22854 |
| 812 | Ga0496121_0048164 | 3300048924 | Bacteria | 3629 |
| 813 | Ga0496121_0058857 | 3300048924 | Bacteria | 3172 |
| 814 | Ga0496121_0080775 | 3300048924 | Bacteria | 2576 |
| 815 | Ga0496122_0000199 | 3300048925 | Bacteria | 133898 |
| 816 | Ga0496122_0091952 | 3300048925 | Bacteria | 2064 |
| 817 | Ga0496122_0129012 | 3300048925 | Bacteria | 1612 |
| 818 | Ga0496123_0000102 | 3300048926 | Bacteria | 169327 |
| 819 | Ga0496123_0034202 | 3300048926 | Bacteria | 3645 |
| 820 | Ga0496123_0058893 | 3300048926 | Bacteria | 2487 |
| 821 | Ga0496124_0236700 | 3300048927 | Bacteria | 1361 |
| 822 | Ga0496125_0000191 | 3300048928 | Bacteria | 131220 |
| 823 | Ga0496125_0033962 | 3300048928 | Bacteria | 4504 |
| 824 | Ga0496125_0054502 | 3300048928 | Bacteria | 3267 |
| 825 | Ga0496126_0069392 | 3300048929 | Bacteria | 3144 |
| 826 | Ga0501031_0001000 | 3300049568 | Bacteria | 17145 |
| 827 | Ga0501031_0037108 | 3300049568 | Bacteria | 3179 |
| 828 | Ga0501032_0011856 | 3300049569 | Bacteria | 6244 |
| 829 | Ga0501032_0064379 | 3300049569 | Bacteria | 2454 |
| 830 | Ga0501032_0092787 | 3300049569 | Bacteria | 2003 |
| 831 | Ga0501033_0000118 | 3300049570 | Bacteria | 75690 |
| 832 | Ga0501033_0001653 | 3300049570 | Bacteria | 19522 |
| 833 | Ga0501033_0061988 | 3300049570 | Bacteria | 2754 |
| 834 | Ga0501034_0006372 | 3300049571 | Bacteria | 12709 |
| 835 | Ga0501034_0027612 | 3300049571 | Bacteria | 5772 |
| 836 | Ga0501034_0058631 | 3300049571 | Bacteria | 3869 |
| 837 | Ga0501034_0100073 | 3300049571 | Bacteria | 2893 |
| 838 | Ga0501034_0110207 | 3300049571 | Bacteria | 2744 |
| 839 | Ga0501034_0153478 | 3300049571 | Bacteria | 2278 |
| 840 | Ga0501034_0158686 | 3300049571 | Bacteria | 2234 |
| 841 | Ga0501034_0184881 | 3300049571 | Bacteria | 2048 |
| 842 | Ga0501034_0221481 | 3300049571 | Bacteria | 1844 |
| 843 | Ga0501034_0273341 | 3300049571 | Bacteria | 1630 |
| 844 | Ga0501036_0009013 | 3300049572 | Bacteria | 8206 |
| 845 | Ga0501036_0065490 | 3300049572 | Bacteria | 3075 |
| 846 | Ga0501037_0032625 | 3300049573 | Bacteria | 3846 |
| 847 | Ga0501037_0058309 | 3300049573 | Bacteria | 2818 |
| 848 | Ga0501037_0166206 | 3300049573 | Bacteria | 1571 |
| 849 | Ga0501037_0198866 | 3300049573 | Bacteria | 1417 |
| 850 | Ga0501037_0238476 | 3300049573 | Bacteria | 1275 |
| 851 | Ga0501038_0004201 | 3300049574 | Bacteria | 13375 |
| 852 | Ga0501038_0040981 | 3300049574 | Bacteria | 4041 |
| 853 | Ga0501038_0043927 | 3300049574 | Bacteria | 3884 |
| 854 | Ga0501038_0202412 | 3300049574 | Bacteria | 1593 |
| 855 | Ga0501039_0016917 | 3300049575 | Bacteria | 5590 |
| 856 | Ga0501043_0000020 | 3300049579 | Bacteria | 155270 |
| 857 | Ga0501043_0013069 | 3300049579 | Bacteria | 6490 |
| 858 | Ga0501043_0225461 | 3300049579 | Bacteria | 1449 |
| 859 | Ga0501046_0000039 | 3300049580 | Bacteria | 155237 |
| 860 | Ga0501046_0024570 | 3300049580 | Bacteria | 4941 |
| 861 | Ga0501046_0066538 | 3300049580 | Bacteria | 2808 |
| 862 | Ga0501047_0000028 | 3300049581 | Bacteria | 220279 |
| 863 | Ga0501047_0060747 | 3300049581 | Bacteria | 3646 |
| 864 | Ga0501047_0073931 | 3300049581 | Bacteria | 3281 |
| 865 | Ga0501047_0118126 | 3300049581 | Bacteria | 2533 |
| 866 | Ga0501048_0013028 | 3300049582 | Bacteria | 6176 |
| 867 | Ga0501048_0122017 | 3300049582 | Bacteria | 1841 |
| 868 | Ga0501067_0001921 | 3300049583 | Bacteria | 11417 |
| 869 | Ga0501068_0024687 | 3300049584 | Bacteria | 3531 |
| 870 | Ga0501068_0033029 | 3300049584 | Bacteria | 3080 |
| 871 | Ga0501068_0084659 | 3300049584 | Bacteria | 1950 |
| 872 | Ga0501069_0000996 | 3300049585 | Bacteria | 13514 |
| 873 | Ga0501070_0000091 | 3300049586 | Bacteria | 77270 |
| 874 | Ga0501070_0007631 | 3300049586 | Bacteria | 9184 |
| 875 | Ga0501070_0017398 | 3300049586 | Bacteria | 6035 |
| 876 | Ga0501070_0068110 | 3300049586 | Bacteria | 2947 |
| 877 | Ga0501070_0112556 | 3300049586 | Bacteria | 2249 |
| 878 | Ga0501073_0000442 | 3300049589 | Bacteria | 28617 |
| 879 | Ga0501073_0002814 | 3300049589 | Bacteria | 13022 |
| 880 | Ga0501073_0021924 | 3300049589 | Bacteria | 4602 |
| 881 | Ga0501198_000014 | 3300049649 | Bacteria | 106940 |
| 882 | Ga0501222_000008 | 3300049662 | Bacteria | 120904 |
| 883 | Ga0501080_0005715 | 3300049742 | Bacteria | 11126 |
| 884 | Ga0501080_0007030 | 3300049742 | Bacteria | 10162 |
| 885 | Ga0501080_0007562 | 3300049742 | Bacteria | 9823 |
| 886 | Ga0501080_0035269 | 3300049742 | Bacteria | 4669 |
| 887 | Ga0501080_0041922 | 3300049742 | Bacteria | 4264 |
| 888 | Ga0501083_0003873 | 3300049744 | Bacteria | 10513 |
| 889 | Ga0501083_0014743 | 3300049744 | Bacteria | 5465 |
| 890 | Ga0501083_0039734 | 3300049744 | Bacteria | 3195 |
| 891 | Ga0501265_002203 | 3300049762 | Bacteria | 2214 |
| 892 | Ga0501035_0025411 | 3300049822 | Bacteria | 5430 |
| 893 | Ga0501035_0039460 | 3300049822 | Bacteria | 4273 |
| 894 | Ga0501035_0097077 | 3300049822 | Bacteria | 2588 |
| 895 | Ga0501035_0125810 | 3300049822 | Bacteria | 2237 |
| 896 | Ga0501035_0211314 | 3300049822 | Bacteria | 1660 |
| 897 | Ga0501035_0266217 | 3300049822 | Bacteria | 1452 |
| 898 | Ga0501044_0038555 | 3300049823 | Bacteria | 4989 |
| 899 | Ga0501044_0056426 | 3300049823 | Bacteria | 4033 |
| 900 | Ga0501044_0110475 | 3300049823 | Bacteria | 2758 |
| 901 | Ga0501044_0259481 | 3300049823 | Bacteria | 1676 |
| 902 | Ga0501045_0032103 | 3300049824 | Bacteria | 3804 |
| 903 | nmdc:mga03683_23140_c1 | 3300050489 | Bacteria | 2417 |
| 904 | nmdc:mga03n38_28314_c1 | 3300050490 | Bacteria | 2334 |
| 905 | nmdc:mga03n38_34365_c1 | 3300050490 | Bacteria | 2165 |
| 906 | nmdc:mga00v17_33528_c1 | 3300050491 | Bacteria | 3043 |
| 907 | nmdc:mga0yw44_207857_c1 | 3300050492 | Bacteria | 1294 |
| 908 | nmdc:mga0k408_134308_c1 | 3300050493 | Bacteria | 1470 |
| 909 | nmdc:mga0k408_2458_c1 | 3300050493 | Bacteria | 9851 |
| 910 | nmdc:mga0k408_6485_c1 | 3300050493 | Bacteria | 6236 |
| 911 | nmdc:mga0k408_88724_c1 | 3300050493 | Bacteria | 1816 |
| 912 | nmdc:mga06z11_46506_c1 | 3300050494 | Bacteria | 2199 |
| 913 | nmdc:mga07m45_11158_c1 | 3300050496 | Bacteria | 4715 |
| 914 | nmdc:mga07m45_24573_c1 | 3300050496 | Bacteria | 3303 |
| 915 | nmdc:mga07m45_96238_c1 | 3300050496 | Bacteria | 1699 |
| 916 | nmdc:mga09592_373938_c1 | 3300050508 | Bacteria | 1232 |
| 917 | nmdc:mga09592_99406_c1 | 3300050508 | Bacteria | 2491 |
| 918 | nmdc:mga0qj67_218414_c1 | 3300050509 | Bacteria | 1547 |
| 919 | nmdc:mga0qj67_223933_c1 | 3300050509 | Bacteria | 1527 |
| 920 | nmdc:mga0rr50_90162_c1 | 3300050513 | Bacteria | 2385 |
| 921 | nmdc:mga0sz30_82214_c1 | 3300050516 | Bacteria | 1394 |
| 922 | Ga0495612_0022924 | 3300053078 | Bacteria | 2503 |
| 923 | Ga0500610_0063222 | 3300053079 | Bacteria | 1930 |
| 924 | Ga0500635_0000114 | 3300053080 | Bacteria | 48114 |
| 925 | Ga0495595_0027045 | 3300053084 | Bacteria | 2553 |
| 926 | Ga0500578_0001658 | 3300053086 | Bacteria | 21440 |
| 927 | Ga0500578_0056581 | 3300053086 | Bacteria | 2508 |
| 928 | Ga0500578_0093078 | 3300053086 | Bacteria | 1912 |
| 929 | Ga0500644_0009222 | 3300053088 | Bacteria | 2633 |
| 930 | Ga0500646_0007852 | 3300053090 | Bacteria | 2727 |
| 931 | Ga0500651_0001525 | 3300053093 | Bacteria | 11715 |
| 932 | Ga0500651_0019791 | 3300053093 | Bacteria | 4187 |
| 933 | Ga0500566_0049189 | 3300053094 | Bacteria | 2415 |
| 934 | Ga0500566_0053255 | 3300053094 | Bacteria | 2310 |
| 935 | Ga0500640_022510 | 3300053095 | Bacteria | 2725 |
| 936 | Ga0500554_000402 | 3300053102 | Bacteria | 9186 |
| 937 | Ga0500555_001398 | 3300053103 | Bacteria | 7450 |
| 938 | Ga0500571_000343 | 3300053110 | Bacteria | 18323 |
| 939 | Ga0500572_007428 | 3300053111 | Bacteria | 2537 |
| 940 | Ga0500593_018896 | 3300053117 | Bacteria | 3010 |
| 941 | Ga0500594_0003416 | 3300053118 | Bacteria | 3484 |
| 942 | Ga0500595_000585 | 3300053119 | Bacteria | 21749 |
| 943 | Ga0500607_000320 | 3300053121 | Bacteria | 45511 |
| 944 | Ga0500607_098164 | 3300053121 | Bacteria | 1460 |
| 945 | Ga0500628_001917 | 3300053129 | Bacteria | 3502 |
| 946 | Ga0500642_0051369 | 3300053130 | Bacteria | 1821 |
| 947 | Ga0500652_001532 | 3300053131 | Bacteria | 7082 |
| 948 | Ga0500655_008233 | 3300053133 | Bacteria | 1876 |
| 949 | Ga0500658_0005316 | 3300053134 | Bacteria | 4787 |
| 950 | Ga0500559_0000666 | 3300053136 | Bacteria | 22968 |
| 951 | Ga0500559_0010271 | 3300053136 | Bacteria | 4024 |
| 952 | Ga0500559_0123005 | 3300053136 | Bacteria | 1207 |
| 953 | Ga0500564_102132 | 3300053138 | Bacteria | 1266 |
| 954 | Ga0500568_0010736 | 3300053139 | Bacteria | 4275 |
| 955 | Ga0500568_0034123 | 3300053139 | Bacteria | 2083 |
| 956 | Ga0500568_0067474 | 3300053139 | Bacteria | 1374 |
| 957 | Ga0500585_058425 | 3300053144 | Bacteria | 1385 |
| 958 | Ga0500603_014618 | 3300053150 | Bacteria | 1836 |
| 959 | Ga0500604_0001217 | 3300053151 | Bacteria | 7170 |
| 960 | Ga0500616_0046009 | 3300053153 | Bacteria | 2321 |
| 961 | Ga0500616_0074266 | 3300053153 | Bacteria | 1724 |
| 962 | Ga0500622_0000858 | 3300053156 | Bacteria | 25968 |
| 963 | Ga0500622_0003925 | 3300053156 | Bacteria | 9619 |
| 964 | Ga0500622_0076479 | 3300053156 | Bacteria | 1683 |
| 965 | Ga0500634_0000002 | 3300053161 | Bacteria | 252372 |
| 966 | Ga0500634_0024020 | 3300053161 | Bacteria | 3315 |
| 967 | Ga0500638_062434 | 3300053162 | Bacteria | 1789 |
| 968 | Ga0500636_0027915 | 3300053177 | Bacteria | 3334 |
| 969 | Ga0501084_0126873 | 3300054114 | Bacteria | 2147 |
| 970 | Ga0501084_0223768 | 3300054114 | Bacteria | 1588 |
| 971 | Ga0501082_0012702 | 3300060353 | Bacteria | 7237 |
| 972 | Ga0501082_0064532 | 3300060353 | Bacteria | 3153 |
| 973 | Ga0501082_0074598 | 3300060353 | Bacteria | 2922 |
| 974 | Ga0466962_0051578 | 3300061719 | Bacteria | 1967 |
| 975 | 2511245842 | 2511231002 | Bacteria | 5042903 |
| 976 | 2513231717 | 2513020051 | Bacteria | 6053213 |
| 977 | 2548498844 | 2547132374 | Bacteria | 5530232 |
| 978 | 2587728503 | 2585428057 | Bacteria | 6737412 |
| 979 | 2587735239 | 2585428058 | Bacteria | 6853932 |
| 980 | 2588290776 | 2588253510 | Bacteria | 6901809 |
| 981 | 2599625161 | 2599185214 | Bacteria | 8209958 |
| 982 | 2599673387 | 2599185226 | Bacteria | 8233575 |
| 983 | 2599683057 | 2599185227 | Bacteria | 8246414 |
| 984 | 2599694995 | 2599185229 | Bacteria | 8216126 |
| 985 | 2643867949 | 2643221570 | Bacteria | 5103772 |
| 986 | 2643964624 | 2643221591 | Bacteria | 4397626 |
| 987 | 2643971261 | 2643221592 | Bacteria | 6608788 |
| 988 | 2643991814 | 2643221596 | Bacteria | 5006805 |
| 989 | 2644058936 | 2643221609 | Bacteria | 6756331 |
| 990 | 2644139437 | 2643221625 | Bacteria | 6512927 |
| 991 | 2644158718 | 2643221628 | Bacteria | 5745828 |
| 992 | 2644167229 | 2643221629 | Bacteria | 5850260 |
| 993 | 2644248136 | 2643221644 | Bacteria | 6865017 |
| 994 | 2644272251 | 2643221648 | Bacteria | 6521465 |
| 995 | 2644293557 | 2643221652 | Bacteria | 5140275 |
| 996 | 2644302802 | 2643221654 | Bacteria | 5273570 |
| 997 | 2644328396 | 2643221658 | Bacteria | 6064537 |
| 998 | 2644349745 | 2643221662 | Bacteria | 5851492 |
| 999 | 2644397491 | 2643221672 | Bacteria | 6322190 |
| 1000 | 2644465451 | 2643221683 | Bacteria | 5749203 |
| 1001 | 2644648304 | 2643221717 | Bacteria | 5676132 |
| 1002 | 2644727740 | 2643221733 | Bacteria | 5690728 |
| 1003 | 2644733548 | 2643221734 | Bacteria | 5365412 |
| 1004 | 2644744544 | 2643221736 | Bacteria | 6608466 |
| 1005 | 2738722471 | 2738541277 | Bacteria | 7458140 |
| 1006 | 2739246193 | 2738543012 | Bacteria | 7115078 |
| 1007 | 2739283042 | 2738543019 | Bacteria | 7459457 |
| 1008 | 2816471428 | 2816332133 | Bacteria | 7249298 |
| 1009 | 2819600750 | 2818991446 | Bacteria | 7757362 |
| 1010 | 2819717192 | 2818991467 | Bacteria | 5893227 |
| 1011 | 2831267333 | 2831265667 | Bacteria | 7184833 |
| 1012 | 2837682501 | 2837678835 | Bacteria | 5252418 |
| 1013 | 2838060310 | 2838054893 | Bacteria | 7451788 |
| 1014 | 2841763244 | 2841760612 | Bacteria | 6454112 |
| 1015 | 2841917173 | 2841911363 | Bacteria | 6173697 |
| 1016 | 2841922794 | 2841917233 | Bacteria | 6173500 |
| 1017 | 2842677802 | 2842677519 | Bacteria | 5615038 |
| 1018 | 2842721234 | 2842718218 | Bacteria | 4560148 |
| 1019 | 2842739025 | 2842733646 | Bacteria | 5716726 |
| 1020 | 2842748714 | 2842747753 | Bacteria | 5578255 |
| 1021 | 2844108886 | 2844104063 | Bacteria | 6440972 |
| 1022 | 2851182490 | 2851182111 | Bacteria | 6047226 |
| 1023 | 2851250993 | 2851246043 | Bacteria | 6439203 |
| 1024 | 2885195296 | 2885192300 | Bacteria | 5882526 |
| 1025 | 2885198385 | 2885198086 | Bacteria | 7212419 |
| 1026 | 2885212235 | 2885211737 | Bacteria | 7212420 |
| 1027 | 2894024597 | 2894023352 | Bacteria | 5167372 |
| 1028 | 2899931698 | 2899924645 | Bacteria | 7487985 |
| 1029 | 2904452056 | 2904449895 | Bacteria | 6927402 |
| 1030 | 2904458798 | 2904456579 | Bacteria | 6819253 |
| 1031 | 2904482951 | 2904479285 | Bacteria | 5073931 |
| 1032 | 2904547541 | 2904541872 | Bacteria | 8915136 |
| 1033 | 2917701321 | 2917699015 | Bacteria | 7043791 |
| 1034 | 2919467662 | 2919462493 | Bacteria | 5817112 |
| 1035 | 2928043080 | 2928037797 | Bacteria | 7273642 |
| 1036 | 2928050261 | 2928044640 | Bacteria | 7271509 |
| 1037 | 2928056712 | 2928051484 | Bacteria | 7773759 |
| 1038 | 2928068828 | 2928064002 | Bacteria | 7419480 |
| 1039 | 2928075752 | 2928070936 | Bacteria | 8062541 |
| 1040 | 2928090300 | 2928084124 | Bacteria | 7159212 |
| 1041 | 2929164955 | 2929160207 | Bacteria | 9075316 |
| 1042 | 2929523401 | 2929520902 | Bacteria | 6765052 |
| 1043 | 2932402370 | 2932401849 | Bacteria | 4262978 |
| 1044 | 2932425304 | 2932422444 | Bacteria | 4678430 |
| 1045 | 2939636195 | 2939631187 | Bacteria | 6118131 |
| 1046 | 2945910410 | 2945909444 | Bacteria | 7065066 |
| 1047 | 2945946379 | 2945945610 | Bacteria | 5951079 |
| 1048 | 2945975972 | 2945972063 | Bacteria | 6086495 |
| 1049 | 2945987541 | 2945984333 | Bacteria | 7358892 |
| 1050 | 2954771133 | 2954767861 | Bacteria | 5535784 |
| 1051 | 2974324217 | 2974320154 | Bacteria | 4571377 |
| 1052 | 2990713683 | 2990710928 | Bacteria | 5002431 |
| 1053 | 8057534834 | 8057529695 | Bacteria | 6306553 |
| 1054 | Ga0070706_100358490 | |||
| 1055 | JGI24739J22299_10024192 | |||
| 1056 | JGI25155J39150_1000005 | |||
| 1057 | JGI25156J39149_1000006 | |||
| 1058 | JGI25156J39149_1000042 | |||
| 1059 | JGI25154J39366_1000015 | |||
| 1060 | JGI25154J39366_1003388 | |||
| 1061 | JGI25157J39369_1000016 | |||
| 1062 | JGI25157J39369_1000033 | |||
| 1063 | JGI25151J46595_10000040 | |||
| 1064 | JGI25151J46595_10000135 | |||
| 1065 | JGI25151J46595_10003363 | |||
| 1066 | JGI25151J46595_10014930 | |||
| 1067 | JGI25151J46595_10047585 | |||
| 1068 | JGI25153J46596_10001229 | |||
| 1069 | JGI25153J46596_10006649 | |||
| 1070 | rootH1_10003125 | |||
| 1071 | rootH2_10009935 | |||
| 1072 | rootH1_10029110 | |||
| 1073 | rootH1_10033106 | |||
| 1074 | rootH1_10079201 | |||
| 1075 | rootH1_10231751 | |||
| 1076 | JGI25160J50197_1000098 | |||
| 1077 | JGI25161J50226_1000037 | |||
| 1078 | Ga0055539_1000950 | |||
| 1079 | Ga0055525_1000038 | |||
| 1080 | Ga0055535_1000181 | |||
| 1081 | Ga0055535_1000951 | |||
| 1082 | Ga0055535_1005110 | |||
| 1083 | Ga0055542_1000070 | |||
| 1084 | Ga0055529_1000805 | |||
| 1085 | Ga0055526_1000123 | |||
| 1086 | Ga0055526_1000154 | |||
| 1087 | Ga0055526_1006302 | |||
| 1088 | Ga0055526_1006801 | |||
| 1089 | Ga0055526_1011523 | |||
| 1090 | Ga0055537_1000461 | |||
| 1091 | Ga0055524_1000023 | |||
| 1092 | Ga0055524_1000052 | |||
| 1093 | Ga0055524_1000261 | |||
| 1094 | Ga0055524_1019259 | |||
| 1095 | Ga0055536_1001412 | |||
| 1096 | Ga0055536_1002347 | |||
| 1097 | Ga0055534_1000245 | |||
| 1098 | Ga0055534_1001463 | |||
| 1099 | Ga0055534_1015574 | |||
| 1100 | Ga0055528_1000723 | |||
| 1101 | Ga0055528_1001448 | |||
| 1102 | Ga0055530_10000190 | |||
| 1103 | Ga0055530_10009289 | |||
| 1104 | Ga0055530_10025779 | |||
| 1105 | Ga0055540_1000187 | |||
| 1106 | Ga0055540_1001526 | |||
| 1107 | Ga0055540_1004871 | |||
| 1108 | Ga0055540_1007513 | |||
| 1109 | Ga0055540_1009113 | |||
| 1110 | Ga0055540_1012167 | |||
| 1111 | Ga0055531_10001522 | |||
| 1112 | Ga0055531_10014851 | |||
| 1113 | Ga0055543_1004109 | |||
| 1114 | Ga0065165_1000248 | |||
| 1115 | Ga0065165_1000362 | |||
| 1116 | Ga0065165_1004149 | |||
| 1117 | Ga0065165_1015845 | |||
| 1118 | Ga0065165_1020157 | |||
| 1119 | Ga0065165_1035830 | |||
| 1120 | Ga0065704_10114840 | |||
| 1121 | Ga0070658_10002918 | |||
| 1122 | Ga0070658_10011840 | |||
| 1123 | Ga0070658_10032631 | |||
| 1124 | Ga0070658_10095240 | |||
| 1125 | Ga0070676_10004616 | |||
| 1126 | Ga0070676_10014222 | |||
| 1127 | Ga0070676_10072791 | |||
| 1128 | Ga0070683_100014657 | |||
| 1129 | Ga0070683_100104478 | |||
| 1130 | Ga0070690_100022114 | |||
| 1131 | Ga0070690_100028720 | |||
| 1132 | Ga0070670_100001811 | |||
| 1133 | Ga0070670_100002276 | |||
| 1134 | Ga0070670_100023499 | |||
| 1135 | Ga0070670_100045262 | |||
| 1136 | Ga0070670_100133389 | |||
| 1137 | Ga0070670_100184143 | |||
| 1138 | Ga0068869_100007662 | |||
| 1139 | Ga0068869_100022888 | |||
| 1140 | Ga0068869_100110803 | |||
| 1141 | Ga0070666_10026552 | |||
| 1142 | Ga0070666_10144348 | |||
| 1143 | Ga0070682_100000796 | |||
| 1144 | Ga0070682_100006730 | |||
| 1145 | Ga0070682_100043720 | |||
| 1146 | Ga0068868_100004439 | |||
| 1147 | Ga0068868_100065444 | |||
| 1148 | Ga0068868_100123841 | |||
| 1149 | Ga0068868_100163746 | |||
| 1150 | Ga0068868_100199660 | |||
| 1151 | Ga0070660_100051160 | |||
| 1152 | Ga0070660_100102348 | |||
| 1153 | Ga0070660_100102668 | |||
| 1154 | Ga0070660_100214625 | |||
| 1155 | Ga0070689_100004600 | |||
| 1156 | Ga0070689_100027527 | |||
| 1157 | Ga0070687_100116366 | |||
| 1158 | Ga0070661_100008298 | |||
| 1159 | Ga0070661_100037283 | |||
| 1160 | Ga0070661_100074154 | |||
| 1161 | Ga0070661_100291520 | |||
| 1162 | Ga0070692_10146858 | |||
| 1163 | Ga0070668_100002401 | |||
| 1164 | Ga0070668_100147057 | |||
| 1165 | Ga0070669_100003159 | |||
| 1166 | Ga0070669_100020429 | |||
| 1167 | Ga0070669_100056450 | |||
| 1168 | Ga0070675_100003826 | |||
| 1169 | Ga0070675_100005498 | |||
| 1170 | Ga0070675_100027924 | |||
| 1171 | Ga0070675_100055517 | |||
| 1172 | Ga0070675_100075601 | |||
| 1173 | Ga0070671_100007846 | |||
| 1174 | Ga0070671_100120540 | |||
| 1175 | Ga0070671_100130954 | |||
| 1176 | Ga0070671_100166175 | |||
| 1177 | Ga0070674_100011837 | |||
| 1178 | Ga0070673_100025297 | |||
| 1179 | Ga0070673_100067351 | |||
| 1180 | Ga0070673_100078081 | |||
| 1181 | Ga0070659_100009325 | |||
| 1182 | Ga0070659_100093064 | |||
| 1183 | Ga0070667_100002157 | |||
| 1184 | Ga0070667_100043014 | |||
| 1185 | Ga0070667_100073422 | |||
| 1186 | Ga0070701_10048444 | |||
| 1187 | Ga0070701_10052507 | |||
| 1188 | Ga0070663_100001508 | |||
| 1189 | Ga0070663_100164863 | |||
| 1190 | Ga0070663_100289878 | |||
| 1191 | Ga0070678_100042361 | |||
| 1192 | Ga0070678_100239075 | |||
| 1193 | Ga0070662_100139537 | |||
| 1194 | Ga0068867_100000075 | |||
| 1195 | Ga0068867_100004516 | |||
| 1196 | Ga0068867_100052915 | |||
| 1197 | Ga0070685_10033319 | |||
| 1198 | Ga0070699_100081980 | |||
| 1199 | Ga0070679_100004815 | |||
| 1200 | Ga0068853_100001060 | |||
| 1201 | Ga0068853_100049008 | |||
| 1202 | Ga0068853_100073836 | |||
| 1203 | Ga0068853_100077413 | |||
| 1204 | Ga0068853_100116555 | |||
| 1205 | Ga0068853_100262304 | |||
| 1206 | Ga0070672_100001641 | |||
| 1207 | Ga0070672_100003671 | |||
| 1208 | Ga0070672_100004734 | |||
| 1209 | Ga0070672_100005245 | |||
| 1210 | Ga0070672_100074130 | |||
| 1211 | Ga0070672_100084253 | |||
| 1212 | Ga0070686_100024242 | |||
| 1213 | Ga0070693_100070910 | |||
| 1214 | Ga0070693_100157860 | |||
| 1215 | Ga0070665_100005152 | |||
| 1216 | Ga0068855_100000053 | |||
| 1217 | Ga0068855_100034008 | |||
| 1218 | Ga0068855_100061077 | |||
| 1219 | Ga0068855_100105499 | |||
| 1220 | Ga0068855_100110454 | |||
| 1221 | Ga0068855_100157746 | |||
| 1222 | Ga0068855_100245099 | |||
| 1223 | Ga0068857_100006699 | |||
| 1224 | Ga0068857_100025689 | |||
| 1225 | Ga0068857_100029106 | |||
| 1226 | Ga0068857_100059251 | |||
| 1227 | Ga0068857_100063359 | |||
| 1228 | Ga0068857_100256555 | |||
| 1229 | Ga0068854_100024277 | |||
| 1230 | Ga0068854_100194321 | |||
| 1231 | Ga0068856_100004596 | |||
| 1232 | Ga0068856_100009244 | |||
| 1233 | Ga0068856_100019140 | |||
| 1234 | Ga0068856_100152922 | |||
| 1235 | Ga0068852_100009046 | |||
| 1236 | Ga0068852_100013706 | |||
| 1237 | Ga0068852_100029640 | |||
| 1238 | Ga0068852_100062333 | |||
| 1239 | Ga0068852_100080389 | |||
| 1240 | Ga0068852_100126287 | |||
| 1241 | Ga0068852_100341027 | |||
| 1242 | Ga0068852_100390619 | |||
| 1243 | Ga0068852_100413811 | |||
| 1244 | Ga0068859_100030448 | |||
| 1245 | Ga0068859_100036141 | |||
| 1246 | Ga0068864_100005872 | |||
| 1247 | Ga0068864_100038650 | |||
| 1248 | Ga0068864_100039936 | |||
| 1249 | Ga0068864_100070497 | |||
| 1250 | Ga0068861_100006393 | |||
| 1251 | Ga0068861_100069629 | |||
| 1252 | Ga0068851_10000798 | |||
| 1253 | Ga0068851_10012368 | |||
| 1254 | Ga0068851_10027814 | |||
| 1255 | Ga0068870_10075073 | |||
| 1256 | Ga0068863_100031259 | |||
| 1257 | Ga0068863_100120962 | |||
| 1258 | Ga0068863_100399695 | |||
| 1259 | Ga0068858_100015518 | |||
| 1260 | Ga0068858_100028086 | |||
| 1261 | Ga0068858_100154651 | |||
| 1262 | Ga0068860_100004889 | |||
| 1263 | Ga0068860_100131535 | |||
| 1264 | Ga0068862_100031328 | |||
| 1265 | Ga0068862_100048416 | |||
| 1266 | Ga0068862_100113320 | |||
| 1267 | Ga0070717_10109168 | |||
| 1268 | Ga0075365_10000391 | |||
| 1269 | Ga0075365_10217231 | |||
| 1270 | Ga0075368_10092899 | |||
| 1271 | Ga0075363_100005949 | |||
| 1272 | Ga0075363_100062755 | |||
| 1273 | Ga0075364_10031732 | |||
| 1274 | Ga0075432_10012491 | |||
| 1275 | Ga0070716_100193136 | |||
| 1276 | Ga0075362_10004042 | |||
| 1277 | Ga0075362_10021972 | |||
| 1278 | Ga0075362_10040615 | |||
| 1279 | Ga0075362_10052264 | |||
| 1280 | Ga0075362_10093321 | |||
| 1281 | Ga0075367_10020571 | |||
| 1282 | Ga0075367_10031443 | |||
| 1283 | Ga0075367_10046027 | |||
| 1284 | Ga0075366_10004396 | |||
| 1285 | Ga0075366_10008531 | |||
| 1286 | Ga0075366_10043503 | |||
| 1287 | Ga0075366_10092749 | |||
| 1288 | Ga0097621_100031589 | |||
| 1289 | Ga0097621_100045454 | |||
| 1290 | Ga0075370_10001340 | |||
| 1291 | Ga0075370_10011101 | |||
| 1292 | Ga0068871_100069049 | |||
| 1293 | Ga0068871_100240107 | |||
| 1294 | Ga0075430_100263023 | |||
| 1295 | Ga0075429_100093307 | |||
| 1296 | Ga0068865_100004329 | |||
| 1297 | Ga0068865_100150344 | |||
| 1298 | Ga0068865_100174457 | |||
| 1299 | Ga0097620_100030449 | |||
| 1300 | Ga0097620_100036140 | |||
| 1301 | Ga0079104_1000003 | |||
| 1302 | Ga0079104_1000206 | |||
| 1303 | Ga0099826_10010052 | |||
| 1304 | Ga0105244_10014909 | |||
| 1305 | Ga0105250_10011778 | |||
| 1306 | Ga0105240_10000322 | |||
| 1307 | Ga0105240_10045295 | |||
| 1308 | Ga0105240_10089762 | |||
| 1309 | Ga0105240_10365953 | |||
| 1310 | Ga0105245_10117967 | |||
| 1311 | Ga0105247_10024198 | |||
| 1312 | Ga0105243_10000345 | |||
| 1313 | Ga0105243_10001128 | |||
| 1314 | Ga0105243_10001582 | |||
| 1315 | Ga0105243_10021799 | |||
| 1316 | Ga0105243_10219486 | |||
| 1317 | Ga0105241_10078966 | |||
| 1318 | Ga0105241_10237777 | |||
| 1319 | Ga0105248_10007460 | |||
| 1320 | Ga0105248_10112453 | |||
| 1321 | Ga0105248_10147445 | |||
| 1322 | Ga0105237_10001642 | |||
| 1323 | Ga0105237_10045032 | |||
| 1324 | Ga0105237_10063195 | |||
| 1325 | Ga0105237_10239786 | |||
| 1326 | Ga0105238_10017874 | |||
| 1327 | Ga0105238_10023025 | |||
| 1328 | Ga0105238_10077560 | |||
| 1329 | Ga0105238_10086017 | |||
| 1330 | Ga0105238_10091865 | |||
| 1331 | Ga0105238_10125303 | |||
| 1332 | Ga0105238_10228663 | |||
| 1333 | Ga0105239_10002917 | |||
| 1334 | Ga0105239_10035589 | |||
| 1335 | Ga0105239_10038176 | |||
| 1336 | Ga0105239_10162644 | |||
| 1337 | Ga0105246_10115303 | |||
| 1338 | Ga0157373_10009159 | |||
| 1339 | Ga0157373_10074167 | |||
| 1340 | Ga0157373_10102530 | |||
| 1341 | Ga0157371_10008934 | |||
| 1342 | Ga0157370_10017196 | |||
| 1343 | Ga0157370_10022666 | |||
| 1344 | Ga0157370_10194899 | |||
| 1345 | Ga0157369_10034649 | |||
| 1346 | Ga0157369_10048523 | |||
| 1347 | Ga0157369_10051168 | |||
| 1348 | Ga0171462_1026 | |||
| 1349 | Ga0157374_10187187 | |||
| 1350 | Ga0157374_10277895 | |||
| 1351 | Ga0163162_10012682 | |||
| 1352 | Ga0163162_10041220 | |||
| 1353 | Ga0163162_10081708 | |||
| 1354 | Ga0163162_10192958 | |||
| 1355 | Ga0157372_10016841 | |||
| 1356 | Ga0157372_10069543 | |||
| 1357 | Ga0157372_10072226 | |||
| 1358 | Ga0157372_10118949 | |||
| 1359 | Ga0157372_10358924 | |||
| 1360 | Ga0157375_10189844 | |||
| 1361 | Ga0157375_10217643 | |||
| 1362 | Ga0163163_10180340 | |||
| 1363 | Ga0163163_10248157 | |||
| 1364 | Ga0157380_10005359 | |||
| 1365 | Ga0157380_10033824 | |||
| 1366 | Ga0182008_10012396 | |||
| 1367 | Ga0182008_10016669 | |||
| 1368 | Ga0182008_10033465 | |||
| 1369 | Ga0182008_10034007 | |||
| 1370 | Ga0157377_10000743 | |||
| 1371 | Ga0157377_10061840 | |||
| 1372 | Ga0157379_10005615 | |||
| 1373 | Ga0157379_10168169 | |||
| 1374 | Ga0157379_10200451 | |||
| 1375 | Ga0157376_10047551 | |||
| 1376 | Ga0157376_10207333 | |||
| 1377 | Ga0157376_10301329 | |||
| 1378 | Ga0182006_1035323 | |||
| 1379 | Ga0182006_1048888 | |||
| 1380 | Ga0182007_10004007 | |||
| 1381 | Ga0182005_1011304 | |||
| 1382 | Ga0183362_10001 | |||
| 1383 | Ga0163161_10003871 | |||
| 1384 | Ga0163161_10060364 | |||
| 1385 | Ga0163161_10083086 | |||
| 1386 | Ga0213872_10001975 | |||
| 1387 | Ga0213876_10041117 | |||
| 1388 | Ga0213875_10112838 | |||
| 1389 | Ga0209435_100010 | |||
| 1390 | Ga0209436_103411 | |||
| 1391 | Ga0209672_101934 | |||
| 1392 | Ga0209147_100874 | |||
| 1393 | Ga0209563_100005 | |||
| 1394 | Ga0207427_101542 | |||
| 1395 | Ga0209258_100018 | |||
| 1396 | Ga0209258_100171 | |||
| 1397 | Ga0209258_100621 | |||
| 1398 | Ga0207425_1000195 | |||
| 1399 | Ga0207425_1003463 | |||
| 1400 | Ga0209646_1000001 | |||
| 1401 | Ga0209646_1000089 | |||
| 1402 | Ga0209026_1000001 | |||
| 1403 | Ga0209026_1000028 | |||
| 1404 | Ga0209677_100066 | |||
| 1405 | Ga0209148_1000030 | |||
| 1406 | Ga0209759_1000001 | |||
| 1407 | Ga0209759_1000021 | |||
| 1408 | Ga0209759_1002216 | |||
| 1409 | Ga0209129_1000043 | |||
| 1410 | Ga0209129_1000427 | |||
| 1411 | Ga0209565_1000088 | |||
| 1412 | Ga0209565_1000102 | |||
| 1413 | Ga0209455_1000148 | |||
| 1414 | Ga0209673_1000064 | |||
| 1415 | Ga0209673_1000189 | |||
| 1416 | Ga0209673_1008134 | |||
| 1417 | Ga0209673_1010544 | |||
| 1418 | Ga0209673_1032068 | |||
| 1419 | Ga0209130_1000141 | |||
| 1420 | Ga0209130_1000226 | |||
| 1421 | Ga0209130_1001229 | |||
| 1422 | Ga0209130_1001786 | |||
| 1423 | Ga0209675_1000036 | |||
| 1424 | Ga0209675_1000288 | |||
| 1425 | Ga0209675_1001448 | |||
| 1426 | Ga0209675_1003322 | |||
| 1427 | Ga0209675_1015231 | |||
| 1428 | Ga0209676_1000069 | |||
| 1429 | Ga0209676_1000302 | |||
| 1430 | Ga0209676_1000538 | |||
| 1431 | Ga0209676_1004738 | |||
| 1432 | Ga0209676_1017930 | |||
| 1433 | Ga0209025_1000016 | |||
| 1434 | Ga0209025_1000238 | |||
| 1435 | Ga0209025_1000343 | |||
| 1436 | Ga0209025_1005774 | |||
| 1437 | Ga0209025_1006771 | |||
| 1438 | Ga0209025_1026317 | |||
| 1439 | Ga0209025_1030521 | |||
| 1440 | Ga0209025_1047038 | |||
| 1441 | Ga0209025_1051210 | |||
| 1442 | Ga0209564_1000014 | |||
| 1443 | Ga0209564_1000075 | |||
| 1444 | Ga0209564_1000076 | |||
| 1445 | Ga0209564_1000415 | |||
| 1446 | Ga0209564_1000575 | |||
| 1447 | Ga0209758_1000093 | |||
| 1448 | Ga0209758_1000126 | |||
| 1449 | Ga0209758_1000402 | |||
| 1450 | Ga0209758_1025438 | |||
| 1451 | Ga0209050_1000023 | |||
| 1452 | Ga0209050_1000851 | |||
| 1453 | Ga0209050_1003418 | |||
| 1454 | Ga0209050_1005580 | |||
| 1455 | Ga0209050_1008334 | |||
| 1456 | Ga0209256_1000003 | |||
| 1457 | Ga0209256_1000036 | |||
| 1458 | Ga0209256_1000083 | |||
| 1459 | Ga0209256_1001241 | |||
| 1460 | Ga0207426_1000145 | |||
| 1461 | Ga0207426_1002446 | |||
| 1462 | Ga0209051_1000017 | |||
| 1463 | Ga0209051_1000101 | |||
| 1464 | Ga0209051_1000173 | |||
| 1465 | Ga0209051_1000242 | |||
| 1466 | Ga0209051_1000820 | |||
| 1467 | Ga0209051_1004138 | |||
| 1468 | Ga0209257_1000041 | |||
| 1469 | Ga0209257_1000096 | |||
| 1470 | Ga0209257_1000149 | |||
| 1471 | Ga0209257_1007739 | |||
| 1472 | Ga0209257_1020139 | |||
| 1473 | Ga0207697_10056993 | |||
| 1474 | Ga0207656_10002344 | |||
| 1475 | Ga0207656_10003086 | |||
| 1476 | Ga0207656_10038605 | |||
| 1477 | Ga0207682_10043507 | |||
| 1478 | Ga0207642_10050674 | |||
| 1479 | Ga0207710_10014263 | |||
| 1480 | Ga0207688_10052395 | |||
| 1481 | Ga0207688_10102116 | |||
| 1482 | Ga0207680_10044927 | |||
| 1483 | Ga0207680_10061617 | |||
| 1484 | Ga0207699_10040840 | |||
| 1485 | Ga0207645_10037609 | |||
| 1486 | Ga0207645_10050869 | |||
| 1487 | Ga0207705_10069044 | |||
| 1488 | Ga0207684_10002973 | |||
| 1489 | Ga0207695_10004077 | |||
| 1490 | Ga0207695_10015442 | |||
| 1491 | Ga0207695_10042012 | |||
| 1492 | Ga0207671_10000168 | |||
| 1493 | Ga0207671_10133479 | |||
| 1494 | Ga0207671_10160866 | |||
| 1495 | Ga0207662_10012394 | |||
| 1496 | Ga0207662_10100047 | |||
| 1497 | Ga0207662_10113367 | |||
| 1498 | Ga0207657_10034044 | |||
| 1499 | Ga0207657_10054750 | |||
| 1500 | Ga0207657_10131964 | |||
| 1501 | Ga0207649_10001238 | |||
| 1502 | Ga0207649_10014631 | |||
| 1503 | Ga0207649_10016297 | |||
| 1504 | Ga0207649_10053615 | |||
| 1505 | Ga0207649_10076378 | |||
| 1506 | Ga0207681_10001781 | |||
| 1507 | Ga0207681_10023829 | |||
| 1508 | Ga0207681_10252894 | |||
| 1509 | Ga0207694_10031500 | |||
| 1510 | Ga0207694_10093249 | |||
| 1511 | Ga0207650_10010289 | |||
| 1512 | Ga0207650_10014168 | |||
| 1513 | Ga0207650_10027615 | |||
| 1514 | Ga0207659_10010026 | |||
| 1515 | Ga0207659_10025707 | |||
| 1516 | Ga0207659_10058000 | |||
| 1517 | Ga0207659_10060715 | |||
| 1518 | Ga0207687_10050002 | |||
| 1519 | Ga0207644_10004445 | |||
| 1520 | Ga0207644_10036765 | |||
| 1521 | Ga0207644_10090387 | |||
| 1522 | Ga0207644_10096075 | |||
| 1523 | Ga0207644_10191658 | |||
| 1524 | Ga0207690_10073175 | |||
| 1525 | Ga0207690_10096992 | |||
| 1526 | Ga0207690_10302826 | |||
| 1527 | Ga0207706_10002128 | |||
| 1528 | Ga0207706_10015279 | |||
| 1529 | Ga0207706_10121557 | |||
| 1530 | Ga0207686_10045156 | |||
| 1531 | Ga0207709_10000032 | |||
| 1532 | Ga0207709_10000094 | |||
| 1533 | Ga0207709_10000784 | |||
| 1534 | Ga0207709_10003063 | |||
| 1535 | Ga0207709_10003619 | |||
| 1536 | Ga0207670_10001093 | |||
| 1537 | Ga0207670_10024696 | |||
| 1538 | Ga0207669_10043462 | |||
| 1539 | Ga0207669_10060909 | |||
| 1540 | Ga0207704_10002831 | |||
| 1541 | Ga0207704_10067883 | |||
| 1542 | Ga0207704_10076032 | |||
| 1543 | Ga0207691_10001442 | |||
| 1544 | Ga0207691_10002041 | |||
| 1545 | Ga0207691_10004983 | |||
| 1546 | Ga0207691_10009965 | |||
| 1547 | Ga0207691_10018437 | |||
| 1548 | Ga0207691_10077884 | |||
| 1549 | Ga0207691_10082574 | |||
| 1550 | Ga0207691_10232322 | |||
| 1551 | Ga0207711_10011487 | |||
| 1552 | Ga0207711_10018674 | |||
| 1553 | Ga0207711_10024119 | |||
| 1554 | Ga0207711_10038494 | |||
| 1555 | Ga0207711_10092517 | |||
| 1556 | Ga0207711_10142903 | |||
| 1557 | Ga0207689_10014447 | |||
| 1558 | Ga0207689_10022136 | |||
| 1559 | Ga0207689_10030620 | |||
| 1560 | Ga0207661_10070932 | |||
| 1561 | Ga0207661_10079969 | |||
| 1562 | Ga0207679_10003824 | |||
| 1563 | Ga0207667_10000698 | |||
| 1564 | Ga0207667_10001661 | |||
| 1565 | Ga0207667_10002223 | |||
| 1566 | Ga0207667_10086692 | |||
| 1567 | Ga0207667_10092740 | |||
| 1568 | Ga0207651_10007547 | |||
| 1569 | Ga0207651_10017350 | |||
| 1570 | Ga0207712_10022271 | |||
| 1571 | Ga0207712_10022799 | |||
| 1572 | Ga0207712_10106287 | |||
| 1573 | Ga0207668_10003415 | |||
| 1574 | Ga0207668_10168538 | |||
| 1575 | Ga0207640_10033012 | |||
| 1576 | Ga0207640_10053241 | |||
| 1577 | Ga0207640_10073416 | |||
| 1578 | Ga0207658_10001577 | |||
| 1579 | Ga0207658_10004517 | |||
| 1580 | Ga0207658_10283328 | |||
| 1581 | Ga0207677_10022572 | |||
| 1582 | Ga0207677_10033296 | |||
| 1583 | Ga0207703_10001878 | |||
| 1584 | Ga0207703_10035246 | |||
| 1585 | Ga0207639_10106692 | |||
| 1586 | Ga0207639_10122952 | |||
| 1587 | Ga0207678_10004159 | |||
| 1588 | Ga0207678_10017786 | |||
| 1589 | Ga0207678_10081702 | |||
| 1590 | Ga0207678_10124242 | |||
| 1591 | Ga0207678_10213366 | |||
| 1592 | Ga0207708_10028301 | |||
| 1593 | Ga0207702_10000877 | |||
| 1594 | Ga0207702_10034976 | |||
| 1595 | Ga0207702_10068520 | |||
| 1596 | Ga0207641_10002805 | |||
| 1597 | Ga0207641_10021538 | |||
| 1598 | Ga0207641_10127974 | |||
| 1599 | Ga0207648_10001842 | |||
| 1600 | Ga0207648_10028775 | |||
| 1601 | Ga0207648_10059188 | |||
| 1602 | Ga0207648_10122431 | |||
| 1603 | Ga0207648_10417211 | |||
| 1604 | Ga0207676_10002802 | |||
| 1605 | Ga0207676_10003791 | |||
| 1606 | Ga0207676_10072578 | |||
| 1607 | Ga0207674_10018453 | |||
| 1608 | Ga0207674_10168100 | |||
| 1609 | Ga0207674_10465021 | |||
| 1610 | Ga0207675_100000428 | |||
| 1611 | Ga0207675_100003768 | |||
| 1612 | Ga0207675_100374214 | |||
| 1613 | Ga0207683_10015545 | |||
| 1614 | Ga0207683_10050837 | |||
| 1615 | Ga0207683_10123727 | |||
| 1616 | Ga0207683_10283276 | |||
| 1617 | Ga0207698_10006186 | |||
| 1618 | Ga0207698_10026324 | |||
| 1619 | Ga0207698_10044256 | |||
| 1620 | Ga0207698_10058171 | |||
| 1621 | Ga0207698_10120262 | |||
| 1622 | Ga0209281_1000002 | |||
| 1623 | Ga0209281_1000259 | |||
| 1624 | Ga0209968_1008498 | |||
| 1625 | Ga0209282_1000253 | |||
| 1626 | Ga0268266_10000691 | |||
| 1627 | Ga0268265_10060503 | |||
| 1628 | Ga0268265_10082447 | |||
| 1629 | Ga0268264_10004642 | |||
| 1630 | Ga0268264_10005729 | |||
| 1631 | Ga0268264_10174207 | |||
| 1632 | Ga0265334_10005111 | |||
| 1633 | Ga0265336_10000028 | |||
| 1634 | Ga0265336_10024599 | |||
| 1635 | Ga0307517_10051884 | |||
| 1636 | Ga0307517_10142783 | |||
| 1637 | Ga0307515_10000160 | |||
| 1638 | Ga0307515_10000184 | |||
| 1639 | Ga0307515_10006930 | |||
| 1640 | Ga0307515_10049623 | |||
| 1641 | Ga0307515_10091314 | |||
| 1642 | Ga0307515_10098849 | |||
| 1643 | Ga0265338_10008192 | |||
| 1644 | Ga0265324_10001001 | |||
| 1645 | Ga0307511_10078378 | |||
| 1646 | Ga0307512_10003982 | |||
| 1647 | Ga0265330_10001213 | |||
| 1648 | Ga0265330_10007925 | |||
| 1649 | Ga0265332_10000005 | |||
| 1650 | Ga0265332_10000011 | |||
| 1651 | Ga0265332_10000107 | |||
| 1652 | Ga0265332_10006627 | |||
| 1653 | Ga0265328_10000266 | |||
| 1654 | Ga0265320_10004067 | |||
| 1655 | Ga0265320_10005009 | |||
| 1656 | Ga0265325_10001526 | |||
| 1657 | Ga0265325_10004976 | |||
| 1658 | Ga0265325_10072892 | |||
| 1659 | Ga0265329_10000288 | |||
| 1660 | Ga0265339_10002899 | |||
| 1661 | Ga0265339_10020302 | |||
| 1662 | Ga0265339_10035027 | |||
| 1663 | Ga0265331_10002501 | |||
| 1664 | Ga0265331_10003107 | |||
| 1665 | Ga0265331_10039049 | |||
| 1666 | Ga0265327_10000083 | |||
| 1667 | Ga0265327_10000572 | |||
| 1668 | Ga0265327_10037034 | |||
| 1669 | Ga0265316_10000233 | |||
| 1670 | Ga0265316_10040621 | |||
| 1671 | Ga0307513_10000004 | |||
| 1672 | Ga0307513_10000015 | |||
| 1673 | Ga0307509_10004068 | |||
| 1674 | Ga0307509_10135853 | |||
| 1675 | Ga0307408_100017758 | |||
| 1676 | Ga0307408_100042107 | |||
| 1677 | Ga0307408_100061447 | |||
| 1678 | Ga0307408_100083595 | |||
| 1679 | Ga0307408_100172818 | |||
| 1680 | Ga0307408_100293704 | |||
| 1681 | Ga0265313_10000107 | |||
| 1682 | Ga0265313_10004965 | |||
| 1683 | Ga0265313_10057166 | |||
| 1684 | Ga0265313_10057731 | |||
| 1685 | Ga0307508_10030221 | |||
| 1686 | Ga0307508_10069430 | |||
| 1687 | Ga0307514_10011139 | |||
| 1688 | Ga0265314_10000026 | |||
| 1689 | Ga0265314_10000677 | |||
| 1690 | Ga0265314_10002021 | |||
| 1691 | Ga0265314_10004697 | |||
| 1692 | Ga0265314_10009030 | |||
| 1693 | Ga0265314_10022612 | |||
| 1694 | Ga0265342_10000862 | |||
| 1695 | Ga0265342_10001343 | |||
| 1696 | Ga0265342_10005935 | |||
| 1697 | Ga0265342_10090259 | |||
| 1698 | Ga0265342_10099371 | |||
| 1699 | Ga0307516_10000283 | |||
| 1700 | Ga0307516_10000460 | |||
| 1701 | Ga0307516_10001460 | |||
| 1702 | Ga0307516_10014862 | |||
| 1703 | Ga0307516_10049562 | |||
| 1704 | Ga0307516_10058753 | |||
| 1705 | Ga0307516_10094383 | |||
| 1706 | Ga0307516_10257922 | |||
| 1707 | Ga0307405_10007945 | |||
| 1708 | Ga0307405_10045380 | |||
| 1709 | Ga0307405_10054409 | |||
| 1710 | Ga0307410_10048747 | |||
| 1711 | Ga0307406_10012802 | |||
| 1712 | Ga0307406_10038475 | |||
| 1713 | Ga0307412_10007984 | |||
| 1714 | Ga0307412_10022011 | |||
| 1715 | Ga0307412_10080308 | |||
| 1716 | Ga0307412_10252181 | |||
| 1717 | Ga0307409_100003565 | |||
| 1718 | Ga0307409_100163369 | |||
| 1719 | Ga0307416_100006952 | |||
| 1720 | Ga0307416_100011019 | |||
| 1721 | Ga0307414_10098932 | |||
| 1722 | Ga0307414_10134686 | |||
| 1723 | Ga0307414_10275483 | |||
| 1724 | Ga0307411_10036214 | |||
| 1725 | Ga0307411_10042402 | |||
| 1726 | Ga0307411_10159457 | |||
| 1727 | Ga0307415_100015925 | |||
| 1728 | Ga0307507_10082017 | |||
| 1729 | Ga0307510_10087595 | |||
| 1730 | Ga0373934_0034716 | |||
| 1731 | Ga0373956_0024775 | |||
| 1732 | Ga0373956_0104117 | |||
| 1733 | Ga0373957_0006535 | |||
| 1734 | Ga0373955_0002467 | |||
| 1735 | Ga0373961_0000090 | |||
| 1736 | Ga0373931_0019318 | |||
| 1737 | Ga0373935_0034573 | |||
| 1738 | Ga0373935_0188446 | |||
| 1739 | Ga0373935_0220091 | |||
| 1740 | Ga0373933_0013190 | |||
| 1741 | Ga0373937_0033494 | |||
| 1742 | Ga0373937_0138556 | |||
| 1743 | Ga0373925_0003169 | |||
| 1744 | Ga0373925_0033870 | |||
| 1745 | Ga0395899_0014940 | |||
| 1746 | Ga0395899_0016191 | |||
| 1747 | Ga0395899_0017939 | |||
| 1748 | Ga0395899_0126367 | |||
| 1749 | Ga0395900_0014879 | |||
| 1750 | Ga0395900_0029863 | |||
| 1751 | Ga0395900_0071458 | |||
| 1752 | Ga0395900_0289727 | |||
| 1753 | Ga0395898_0024397 | |||
| 1754 | Ga0395898_0064013 | |||
| 1755 | Ga0395898_0093693 | |||
| 1756 | Ga0395898_0325328 | |||
| 1757 | Ga0395905_0000025 | |||
| 1758 | Ga0395905_0007656 | |||
| 1759 | Ga0395905_0027223 | |||
| 1760 | Ga0395905_0051557 | |||
| 1761 | Ga0395905_0114538 | |||
| 1762 | Ga0395905_0213236 | |||
| 1763 | Ga0395905_0311935 | |||
| 1764 | Ga0436364_0268395 | |||
| 1765 | Ga0395901_0015016 | |||
| 1766 | Ga0395901_0047183 | |||
| 1767 | Ga0395901_0063804 | |||
| 1768 | Ga0395901_0077770 | |||
| 1769 | Ga0395901_0265053 | |||
| 1770 | Ga0436365_0431674 | |||
| 1771 | Ga0436361_1170859 | |||
| 1772 | Ga0436363_0015497 | |||
| 1773 | Ga0436363_1073622 | |||
| 1774 | Ga0439465_0011137 | |||
| 1775 | Ga0439465_0024201 | |||
| 1776 | Ga0439433_0002359 | |||
| 1777 | Ga0439432_007426 | |||
| 1778 | Ga0439432_018979 | |||
| 1779 | Ga0439449_0000714 | |||
| 1780 | Ga0439449_0000777 | |||
| 1781 | Ga0439449_0052701 | |||
| 1782 | Ga0439457_010176 | |||
| 1783 | Ga0450923_003039 | |||
| 1784 | Ga0450923_011882 | |||
| 1785 | Ga0439446_0008693 | |||
| 1786 | Ga0439434_0016742 | |||
| 1787 | Ga0439434_0033373 | |||
| 1788 | Ga0450918_000716 | |||
| 1789 | Ga0450918_001165 | |||
| 1790 | Ga0451577_0000419 | |||
| 1791 | Ga0451577_0034859 | |||
| 1792 | Ga0451577_0255491 | |||
| 1793 | Ga0439440_0044678 | |||
| 1794 | Ga0453683_0002969 | |||
| 1795 | Ga0466965_0043520 | |||
| 1796 | Ga0453684_0000475 | |||
| 1797 | Ga0453684_0008658 | |||
| 1798 | Ga0453684_0109098 | |||
| 1799 | Ga0453684_0136832 | |||
| 1800 | Ga0453684_0241678 | |||
| 1801 | Ga0466957_0062018 | |||
| 1802 | Ga0466957_0104831 | |||
| 1803 | Ga0466959_0032626 | |||
| 1804 | Ga0451576_0004269 | |||
| 1805 | Ga0451576_0006268 | |||
| 1806 | Ga0451576_0017617 | |||
| 1807 | Ga0451576_0041353 | |||
| 1808 | Ga0451576_0188376 | |||
| 1809 | Ga0451576_0242410 | |||
| 1810 | Ga0495592_0000427 | |||
| 1811 | Ga0495629_0052419 | |||
| 1812 | Ga0495638_0105043 | |||
| 1813 | Ga0495638_0109902 | |||
| 1814 | Ga0495650_0013525 | |||
| 1815 | Ga0495650_0029722 | |||
| 1816 | Ga0495580_0163083 | |||
| 1817 | Ga0495608_0080071 | |||
| 1818 | Ga0495610_0043351 | |||
| 1819 | Ga0495616_0005153 | |||
| 1820 | Ga0495618_0284723 | |||
| 1821 | Ga0495628_0082921 | |||
| 1822 | Ga0495631_0003589 | |||
| 1823 | Ga0495632_0005676 | |||
| 1824 | Ga0495609_0055994 | |||
| 1825 | Ga0495621_0022002 | |||
| 1826 | Ga0495633_0000499 | |||
| 1827 | Ga0495656_0000974 | |||
| 1828 | Ga0495625_0000116 | |||
| 1829 | Ga0495625_0106167 | |||
| 1830 | Ga0495647_0028409 | |||
| 1831 | Ga0495671_0023540 | |||
| 1832 | Ga0495676_0038995 | |||
| 1833 | Ga0495684_0285827 | |||
| 1834 | Ga0495686_0076358 | |||
| 1835 | Ga0495614_0027494 | |||
| 1836 | Ga0495615_0013138 | |||
| 1837 | Ga0495615_0017546 | |||
| 1838 | Ga0496100_0087961 | |||
| 1839 | Ga0496100_0150055 | |||
| 1840 | Ga0496101_0149882 | |||
| 1841 | Ga0496102_0261304 | |||
| 1842 | Ga0496103_0036091 | |||
| 1843 | Ga0496103_0079809 | |||
| 1844 | Ga0496104_0030814 | |||
| 1845 | Ga0496105_0129529 | |||
| 1846 | Ga0496106_0007537 | |||
| 1847 | Ga0496107_0040451 | |||
| 1848 | Ga0496108_0089223 | |||
| 1849 | Ga0496108_0151075 | |||
| 1850 | Ga0496110_0125259 | |||
| 1851 | Ga0496110_0169641 | |||
| 1852 | Ga0496110_0181775 | |||
| 1853 | Ga0496111_0011763 | |||
| 1854 | Ga0496111_0096795 | |||
| 1855 | Ga0496112_0007641 | |||
| 1856 | Ga0496112_0296716 | |||
| 1857 | Ga0496113_0162806 | |||
| 1858 | Ga0496114_0010850 | |||
| 1859 | Ga0496114_0011767 | |||
| 1860 | Ga0496115_0055645 | |||
| 1861 | Ga0496117_0032387 | |||
| 1862 | Ga0496117_0066002 | |||
| 1863 | Ga0496117_0071590 | |||
| 1864 | Ga0496121_0003381 | |||
| 1865 | Ga0496121_0048164 | |||
| 1866 | Ga0496121_0058857 | |||
| 1867 | Ga0496121_0080775 | |||
| 1868 | Ga0496122_0000199 | |||
| 1869 | Ga0496122_0091952 | |||
| 1870 | Ga0496122_0129012 | |||
| 1871 | Ga0496123_0000102 | |||
| 1872 | Ga0496123_0034202 | |||
| 1873 | Ga0496123_0058893 | |||
| 1874 | Ga0496124_0236700 | |||
| 1875 | Ga0496125_0000191 | |||
| 1876 | Ga0496125_0033962 | |||
| 1877 | Ga0496125_0054502 | |||
| 1878 | Ga0496126_0069392 | |||
| 1879 | Ga0501031_0001000 | |||
| 1880 | Ga0501031_0037108 | |||
| 1881 | Ga0501032_0011856 | |||
| 1882 | Ga0501032_0064379 | |||
| 1883 | Ga0501032_0092787 | |||
| 1884 | Ga0501033_0000118 | |||
| 1885 | Ga0501033_0001653 | |||
| 1886 | Ga0501033_0061988 | |||
| 1887 | Ga0501034_0006372 | |||
| 1888 | Ga0501034_0027612 | |||
| 1889 | Ga0501034_0058631 | |||
| 1890 | Ga0501034_0100073 | |||
| 1891 | Ga0501034_0110207 | |||
| 1892 | Ga0501034_0153478 | |||
| 1893 | Ga0501034_0158686 | |||
| 1894 | Ga0501034_0184881 | |||
| 1895 | Ga0501034_0221481 | |||
| 1896 | Ga0501034_0273341 | |||
| 1897 | Ga0501036_0009013 | |||
| 1898 | Ga0501036_0065490 | |||
| 1899 | Ga0501037_0032625 | |||
| 1900 | Ga0501037_0058309 | |||
| 1901 | Ga0501037_0166206 | |||
| 1902 | Ga0501037_0198866 | |||
| 1903 | Ga0501037_0238476 | |||
| 1904 | Ga0501038_0004201 | |||
| 1905 | Ga0501038_0040981 | |||
| 1906 | Ga0501038_0043927 | |||
| 1907 | Ga0501038_0202412 | |||
| 1908 | Ga0501039_0016917 | |||
| 1909 | Ga0501043_0000020 | |||
| 1910 | Ga0501043_0013069 | |||
| 1911 | Ga0501043_0225461 | |||
| 1912 | Ga0501046_0000039 | |||
| 1913 | Ga0501046_0024570 | |||
| 1914 | Ga0501046_0066538 | |||
| 1915 | Ga0501047_0000028 | |||
| 1916 | Ga0501047_0060747 | |||
| 1917 | Ga0501047_0073931 | |||
| 1918 | Ga0501047_0118126 | |||
| 1919 | Ga0501048_0013028 | |||
| 1920 | Ga0501048_0122017 | |||
| 1921 | Ga0501067_0001921 | |||
| 1922 | Ga0501068_0024687 | |||
| 1923 | Ga0501068_0033029 | |||
| 1924 | Ga0501068_0084659 | |||
| 1925 | Ga0501069_0000996 | |||
| 1926 | Ga0501070_0000091 | |||
| 1927 | Ga0501070_0007631 | |||
| 1928 | Ga0501070_0017398 | |||
| 1929 | Ga0501070_0068110 | |||
| 1930 | Ga0501070_0112556 | |||
| 1931 | Ga0501073_0000442 | |||
| 1932 | Ga0501073_0002814 | |||
| 1933 | Ga0501073_0021924 | |||
| 1934 | Ga0501198_000014 | |||
| 1935 | Ga0501222_000008 | |||
| 1936 | Ga0501080_0005715 | |||
| 1937 | Ga0501080_0007030 | |||
| 1938 | Ga0501080_0007562 | |||
| 1939 | Ga0501080_0035269 | |||
| 1940 | Ga0501080_0041922 | |||
| 1941 | Ga0501083_0003873 | |||
| 1942 | Ga0501083_0014743 | |||
| 1943 | Ga0501083_0039734 | |||
| 1944 | Ga0501265_002203 | |||
| 1945 | Ga0501035_0025411 | |||
| 1946 | Ga0501035_0039460 | |||
| 1947 | Ga0501035_0097077 | |||
| 1948 | Ga0501035_0125810 | |||
| 1949 | Ga0501035_0211314 | |||
| 1950 | Ga0501035_0266217 | |||
| 1951 | Ga0501044_0038555 | |||
| 1952 | Ga0501044_0056426 | |||
| 1953 | Ga0501044_0110475 | |||
| 1954 | Ga0501044_0259481 | |||
| 1955 | Ga0501045_0032103 | |||
| 1956 | nmdc:mga03683_23140_c1 | |||
| 1957 | nmdc:mga03n38_28314_c1 | |||
| 1958 | nmdc:mga03n38_34365_c1 | |||
| 1959 | nmdc:mga00v17_33528_c1 | |||
| 1960 | nmdc:mga0yw44_207857_c1 | |||
| 1961 | nmdc:mga0k408_134308_c1 | |||
| 1962 | nmdc:mga0k408_2458_c1 | |||
| 1963 | nmdc:mga0k408_6485_c1 | |||
| 1964 | nmdc:mga0k408_88724_c1 | |||
| 1965 | nmdc:mga06z11_46506_c1 | |||
| 1966 | nmdc:mga07m45_11158_c1 | |||
| 1967 | nmdc:mga07m45_24573_c1 | |||
| 1968 | nmdc:mga07m45_96238_c1 | |||
| 1969 | nmdc:mga09592_373938_c1 | |||
| 1970 | nmdc:mga09592_99406_c1 | |||
| 1971 | nmdc:mga0qj67_218414_c1 | |||
| 1972 | nmdc:mga0qj67_223933_c1 | |||
| 1973 | nmdc:mga0rr50_90162_c1 | |||
| 1974 | nmdc:mga0sz30_82214_c1 | |||
| 1975 | Ga0495612_0022924 | |||
| 1976 | Ga0500610_0063222 | |||
| 1977 | Ga0500635_0000114 | |||
| 1978 | Ga0495595_0027045 | |||
| 1979 | Ga0500578_0001658 | |||
| 1980 | Ga0500578_0056581 | |||
| 1981 | Ga0500578_0093078 | |||
| 1982 | Ga0500644_0009222 | |||
| 1983 | Ga0500646_0007852 | |||
| 1984 | Ga0500651_0001525 | |||
| 1985 | Ga0500651_0019791 | |||
| 1986 | Ga0500566_0049189 | |||
| 1987 | Ga0500566_0053255 | |||
| 1988 | Ga0500640_022510 | |||
| 1989 | Ga0500554_000402 | |||
| 1990 | Ga0500555_001398 | |||
| 1991 | Ga0500571_000343 | |||
| 1992 | Ga0500572_007428 | |||
| 1993 | Ga0500593_018896 | |||
| 1994 | Ga0500594_0003416 | |||
| 1995 | Ga0500595_000585 | |||
| 1996 | Ga0500607_000320 | |||
| 1997 | Ga0500607_098164 | |||
| 1998 | Ga0500628_001917 | |||
| 1999 | Ga0500642_0051369 | |||
| 2000 | Ga0500652_001532 | |||
| 2001 | Ga0500655_008233 | |||
| 2002 | Ga0500658_0005316 | |||
| 2003 | Ga0500559_0000666 | |||
| 2004 | Ga0500559_0010271 | |||
| 2005 | Ga0500559_0123005 | |||
| 2006 | Ga0500564_102132 | |||
| 2007 | Ga0500568_0010736 | |||
| 2008 | Ga0500568_0034123 | |||
| 2009 | Ga0500568_0067474 | |||
| 2010 | Ga0500585_058425 | |||
| 2011 | Ga0500603_014618 | |||
| 2012 | Ga0500604_0001217 | |||
| 2013 | Ga0500616_0046009 | |||
| 2014 | Ga0500616_0074266 | |||
| 2015 | Ga0500622_0000858 | |||
| 2016 | Ga0500622_0003925 | |||
| 2017 | Ga0500622_0076479 | |||
| 2018 | Ga0500634_0000002 | |||
| 2019 | Ga0500634_0024020 | |||
| 2020 | Ga0500638_062434 | |||
| 2021 | Ga0500636_0027915 | |||
| 2022 | Ga0501084_0126873 | |||
| 2023 | Ga0501084_0223768 | |||
| 2024 | Ga0501082_0012702 | |||
| 2025 | Ga0501082_0064532 | |||
| 2026 | Ga0501082_0074598 | |||
| 2027 | Ga0466962_0051578 | |||
| 2028 | 2511245842 | |||
| 2029 | 2513231717 | |||
| 2030 | 2548498844 | |||
| 2031 | 2587728503 | |||
| 2032 | 2587735239 | |||
| 2033 | 2588290776 | |||
| 2034 | 2599625161 | |||
| 2035 | 2599673387 | |||
| 2036 | 2599683057 | |||
| 2037 | 2599694995 | |||
| 2038 | 2643867949 | |||
| 2039 | 2643964624 | |||
| 2040 | 2643971261 | |||
| 2041 | 2643991814 | |||
| 2042 | 2644058936 | |||
| 2043 | 2644139437 | |||
| 2044 | 2644158718 | |||
| 2045 | 2644167229 | |||
| 2046 | 2644248136 | |||
| 2047 | 2644272251 | |||
| 2048 | 2644293557 | |||
| 2049 | 2644302802 | |||
| 2050 | 2644328396 | |||
| 2051 | 2644349745 | |||
| 2052 | 2644397491 | |||
| 2053 | 2644465451 | |||
| 2054 | 2644648304 | |||
| 2055 | 2644727740 | |||
| 2056 | 2644733548 | |||
| 2057 | 2644744544 | |||
| 2058 | 2738722471 | |||
| 2059 | 2739246193 | |||
| 2060 | 2739283042 | |||
| 2061 | 2816471428 | |||
| 2062 | 2819600750 | |||
| 2063 | 2819717192 | |||
| 2064 | 2831267333 | |||
| 2065 | 2837682501 | |||
| 2066 | 2838060310 | |||
| 2067 | 2841763244 | |||
| 2068 | 2841917173 | |||
| 2069 | 2841922794 | |||
| 2070 | 2842677802 | |||
| 2071 | 2842721234 | |||
| 2072 | 2842739025 | |||
| 2073 | 2842748714 | |||
| 2074 | 2844108886 | |||
| 2075 | 2851182490 | |||
| 2076 | 2851250993 | |||
| 2077 | 2885195296 | |||
| 2078 | 2885198385 | |||
| 2079 | 2885212235 | |||
| 2080 | 2894024597 | |||
| 2081 | 2899931698 | |||
| 2082 | 2904452056 | |||
| 2083 | 2904458798 | |||
| 2084 | 2904482951 | |||
| 2085 | 2904547541 | |||
| 2086 | 2917701321 | |||
| 2087 | 2919467662 | |||
| 2088 | 2928043080 | |||
| 2089 | 2928050261 | |||
| 2090 | 2928056712 | |||
| 2091 | 2928068828 | |||
| 2092 | 2928075752 | |||
| 2093 | 2928090300 | |||
| 2094 | 2929164955 | |||
| 2095 | 2929523401 | |||
| 2096 | 2932402370 | |||
| 2097 | 2932425304 | |||
| 2098 | 2939636195 | |||
| 2099 | 2945910410 | |||
| 2100 | 2945946379 | |||
| 2101 | 2945975972 | |||
| 2102 | 2945987541 | |||
| 2103 | 2954771133 | |||
| 2104 | 2974324217 | |||
| 2105 | 2990713683 | |||
| 2106 | 8057534834 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.4898 | 48 | 317 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.4736 | 16 | 316 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.4679 | 16 | 316 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.4675 | 57 | 321 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.4647 | 48 | 317 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77672_36_301_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7608 | 59 | 314 | 1.10.3470.10 |
| af_P77315_52_317_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7486 | 61 | 314 | 1.10.3470.10 |
| af_P39328_55_321_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7413 | 60 | 314 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7346 | 59 | 314 | 1.10.3470.10 |
| af_P77672_36_301_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7324 | 59 | 314 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519G8P5-F1-model_v4 | deleted | 0.9743 | 1 | 327 |
|
| AF-A0A528XS58-F1-model_v4 | ABC transporter permease | 0.9576 | 7 | 308 |
GO:0005886
GO:0022857 |
| AF-A0A7W6CQF3-F1-model_v4 | Simple sugar transport system permease protein | 0.9504 | 1 | 334 |
GO:0005886
GO:0022857 |
| AF-A0A3B8RM30-F1-model_v4 | Sugar ABC transporter permease | 0.9501 | 1 | 338 |
GO:0005886
GO:0022857 |
| AF-A0A1F3BA63-F1-model_v4 | ABC transporter permease | 0.95 | 20 | 320 |
GO:0005886
GO:0022857 |