F488966

General Info

Members Datasets Scaffolds Average Seq Length
1046 490 1016 276

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0134961|Ga0451576_0134961_1554_2555
Length 333
Sequence LETLSKSFAARASGCGRIAALQMLAMVRPWLCFAPCAASLIRARPLAQNLLSISADYDFRPMPELPEVEVTRRSFASAIQGARVTGLRLGKPLRWPLGTDPETLLGSRVGAVQRRGKYLWLPLEGSGGLLMHLGMSGSLAFLGGTPAAGVHDHFDLHTDRGLLRLTDPRRFGAVVWAPALDAEPVSTLLGGLGLEPFDERFDGPHLHAGLSGRRVPVKQALLAGDIVVGAGNIYACEALFLAGIDPRLPAGKLSRPRAARLAEAVRTVLAQALKAGGTTLRDFRDAHGVAGSFQMQAQVYGREGEACRRCGTAIRRIVQGQRSTFYCPSCQKR

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
6 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
7 2643221585 Pelomonas sp. Root662 Isolate Unclassified
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
12 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
13 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
14 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
15 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
16 2643221656 Pelomonas sp. Root405 Isolate Unclassified
17 2721755523 Delftia sp. HK171 Isolate Unclassified
18 2738541337 Pelomonas sp. BT06 Isolate Unclassified
19 2738543012 Acidovorax sp. CF301 Isolate Unclassified
20 2816332133 Acidovorax radicis 2721A Isolate Unclassified
21 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
22 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
23 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
24 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
25 2885266251 Ralstonia sp. SET104 Isolate Nodule
26 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
27 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
28 2928058823 Ralstonia sp. 1138 Isolate Unclassified
29 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
30 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
31 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
32 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
33 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
40 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
41 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
42 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
43 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
44 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
45 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
46 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
47 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
48 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
49 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
50 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
71 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
72 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
75 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
76 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
77 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
84 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
85 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
96 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
97 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
98 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
99 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
104 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
105 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
106 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
112 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
113 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
114 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
117 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
118 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
119 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
120 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
121 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
122 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
128 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
129 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
130 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
131 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
132 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
133 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
136 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
137 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
138 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
139 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
140 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
141 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
143 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
152 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
153 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
157 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
160 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
161 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
164 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
165 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
166 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
167 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
168 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
173 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
174 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
183 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
184 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
185 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
187 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
188 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
192 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
248 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
255 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
260 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
261 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
262 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
263 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
264 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
265 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
266 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
267 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
268 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
269 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
270 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
271 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
272 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
273 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
274 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
275 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
276 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
277 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
278 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
279 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
280 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
281 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
282 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
283 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
284 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
285 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
286 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
287 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
288 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
289 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
290 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
291 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
292 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
294 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
295 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
296 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
297 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
298 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
299 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
300 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
301 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
302 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
303 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
304 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
305 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
306 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
307 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
308 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
309 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
310 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
311 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
312 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
313 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
314 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
315 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
316 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
317 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
318 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
319 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
320 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
321 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
322 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
323 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
324 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
325 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
326 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
327 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
328 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
329 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
330 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
331 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
332 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
333 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
334 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
335 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
336 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
337 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
338 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
339 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
340 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
341 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
342 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
343 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
344 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
345 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
346 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
347 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
348 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
349 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
350 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
351 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
352 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
353 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
354 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
355 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
356 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
357 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
358 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
359 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
360 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
361 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
362 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
363 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
364 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
365 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
366 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
367 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
368 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
369 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
370 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
371 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
372 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
373 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
374 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
375 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
376 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
377 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
378 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
379 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
380 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
381 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
382 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
383 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
384 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
385 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
386 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
387 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
388 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
391 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
392 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
393 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
394 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
395 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
396 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
397 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
398 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
399 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
400 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
401 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
402 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
403 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
404 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
405 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
406 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
407 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
408 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
409 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
424 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
425 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
426 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
427 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
428 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
429 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
430 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
431 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
432 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
433 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
434 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
435 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
436 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
437 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
438 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
439 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
440 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
441 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
442 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
443 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
444 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
445 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
448 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
449 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
450 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
451 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
452 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
453 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
454 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
455 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
456 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
457 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
458 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
459 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
460 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
461 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
462 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
463 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
464 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
465 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
466 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
467 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
468 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
469 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
470 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
471 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
472 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
473 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
474 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
475 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
476 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
477 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
478 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
479 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
480 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
481 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
482 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
483 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
484 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
485 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
486 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
487 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
488 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
489 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
490 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 0.19
Isolates 2.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.83
Nodule 0.48
Rhizoplane 0.96
Rhizosphere 70.36
Stem 0
Stem Tuber 0
Unclassified 9.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004293 3300001979 Bacteria 6143
2 JGI24740J21852_10019851 3300001979 Bacteria 2359
3 JGI24744J21845_10009944 3300002077 Bacteria 1951
4 JGI25156J39149_1000474 3300002705 Bacteria 24235
5 JGI25157J39369_1000008 3300002741 Bacteria 211083
6 JGI25153J46596_10007844 3300003215 Bacteria 5184
7 rootH1_10046143 3300003316 Bacteria 4758
8 rootH2_10057619 3300003320 Bacteria 7538
9 rootL2_10068954 3300003322 Bacteria 5150
10 rootL2_10105231 3300003322 Bacteria 2770
11 rootH1_10099221 3300003323 Bacteria 5338
12 rootH1_10111419 3300003323 Bacteria 2399
13 Ga0055539_1000425 3300003752 Bacteria 15373
14 Ga0055539_1000547 3300003752 Bacteria 10979
15 Ga0055539_1000697 3300003752 Bacteria 8639
16 Ga0055533_1000040 3300003756 Bacteria 242927
17 Ga0055525_1000177 3300003759 Bacteria 79402
18 Ga0055525_1000566 3300003759 Bacteria 16650
19 Ga0055527_1002546 3300003760 Bacteria 3029
20 Ga0055535_1000004 3300003761 Bacteria 451244
21 Ga0055535_1000052 3300003761 Bacteria 132513
22 Ga0055529_1000022 3300003763 Bacteria 320108
23 Ga0055529_1000053 3300003763 Bacteria 198996
24 Ga0055524_1000247 3300003775 Bacteria 56379
25 Ga0055540_1000260 3300003792 Bacteria 47714
26 Ga0055531_10005151 3300003794 Bacteria 7709
27 Ga0055541_1012321 3300003841 Bacteria 1230
28 Ga0065165_1001775 3300005262 Bacteria 21338
29 Ga0065704_10083986 3300005289 Bacteria 3391
30 Ga0065704_10122127 3300005289 Bacteria 1754
31 Ga0070658_10002808 3300005327 Bacteria 14470
32 Ga0070658_10048068 3300005327 Bacteria 3453
33 Ga0070658_10193722 3300005327 Bacteria 1714
34 Ga0070658_10256045 3300005327 Bacteria 1485
35 Ga0070676_10002205 3300005328 Bacteria 9935
36 Ga0070683_100034664 3300005329 Bacteria 4612
37 Ga0070690_100018751 3300005330 Bacteria 4185
38 Ga0070690_100250778 3300005330 Bacteria 1252
39 Ga0070670_100003795 3300005331 Bacteria 12583
40 Ga0070670_100105517 3300005331 Bacteria 2428
41 Ga0070677_10042789 3300005333 Bacteria 1796
42 Ga0068869_100002877 3300005334 Bacteria 10453
43 Ga0068869_100057158 3300005334 Bacteria 2847
44 Ga0068869_100116753 3300005334 Bacteria 2036
45 Ga0070666_10140391 3300005335 Bacteria 1683
46 Ga0070680_100008477 3300005336 Bacteria 7871
47 Ga0070680_100290611 3300005336 Bacteria 1385
48 Ga0070680_100363684 3300005336 Bacteria 1231
49 Ga0070682_100043594 3300005337 Bacteria 2775
50 Ga0068868_100005532 3300005338 Bacteria 8885
51 Ga0068868_100061412 3300005338 Bacteria 2977
52 Ga0068868_100206684 3300005338 Bacteria 1639
53 Ga0070660_100024054 3300005339 Bacteria 4518
54 Ga0070689_100010914 3300005340 Bacteria 6491
55 Ga0070689_100303737 3300005340 Bacteria 1329
56 Ga0070661_100000012 3300005344 Bacteria 167998
57 Ga0070661_100000641 3300005344 Bacteria 25944
58 Ga0070669_100015088 3300005353 Bacteria 5505
59 Ga0070669_100189807 3300005353 Bacteria 1611
60 Ga0070675_100001810 3300005354 Bacteria 15812
61 Ga0070675_100004319 3300005354 Bacteria 10835
62 Ga0070675_100026872 3300005354 Bacteria 4621
63 Ga0070675_100132024 3300005354 Bacteria 2129
64 Ga0070675_100394270 3300005354 Bacteria 1234
65 Ga0070671_100019262 3300005355 Bacteria 5552
66 Ga0070674_100108635 3300005356 Bacteria 2033
67 Ga0070673_100007444 3300005364 Bacteria 7220
68 Ga0070673_100008102 3300005364 Bacteria 6970
69 Ga0070688_100088113 3300005365 Bacteria 2023
70 Ga0070688_100322378 3300005365 Bacteria 1123
71 Ga0070659_100002940 3300005366 Bacteria 12145
72 Ga0070659_100163683 3300005366 Bacteria 1820
73 Ga0070667_100002153 3300005367 Bacteria 17348
74 Ga0070667_100015286 3300005367 Bacteria 6344
75 Ga0070667_100038770 3300005367 Bacteria 3995
76 Ga0070667_100178857 3300005367 Bacteria 1875
77 Ga0070667_100243970 3300005367 Bacteria 1605
78 Ga0070713_100019399 3300005436 Bacteria 5190
79 Ga0070705_100126710 3300005440 Bacteria 1659
80 Ga0070700_100015534 3300005441 Bacteria 4320
81 Ga0070700_100057858 3300005441 Bacteria 2434
82 Ga0070694_100001590 3300005444 Bacteria 13368
83 Ga0070694_100112910 3300005444 Bacteria 1938
84 Ga0070694_100147173 3300005444 Bacteria 1717
85 Ga0070694_100251484 3300005444 Bacteria 1337
86 Ga0070694_100623131 3300005444 Bacteria 871
87 Ga0070708_100291361 3300005445 Bacteria 1537
88 Ga0070708_100617770 3300005445 Bacteria 1022
89 Ga0070663_100000003 3300005455 Bacteria 260492
90 Ga0070663_100055129 3300005455 Bacteria 2844
91 Ga0070678_100036527 3300005456 Bacteria 3440
92 Ga0070678_100081246 3300005456 Bacteria 2457
93 Ga0070678_100302711 3300005456 Bacteria 1359
94 Ga0070678_100414386 3300005456 Bacteria 1173
95 Ga0070678_100494243 3300005456 Bacteria 1078
96 Ga0070662_100001973 3300005457 Bacteria 12604
97 Ga0070662_100054350 3300005457 Bacteria 2902
98 Ga0070662_100111253 3300005457 Bacteria 2086
99 Ga0070681_10018158 3300005458 Bacteria 7031
100 Ga0068867_100000361 3300005459 Bacteria 30295
101 Ga0068867_100040595 3300005459 Bacteria 3397
102 Ga0068867_100154649 3300005459 Bacteria 1804
103 Ga0070685_10115977 3300005466 Bacteria 1657
104 Ga0070706_100000700 3300005467 Bacteria 37931
105 Ga0070706_100124278 3300005467 Bacteria 2406
106 Ga0070706_100394299 3300005467 Bacteria 1288
107 Ga0070707_100168390 3300005468 Bacteria 2135
108 Ga0070698_100003213 3300005471 Bacteria 18005
109 Ga0070698_100021426 3300005471 Bacteria 6770
110 Ga0070699_100094302 3300005518 Bacteria 2620
111 Ga0070699_100287994 3300005518 Bacteria 1472
112 Ga0070679_100003097 3300005530 Bacteria 15194
113 Ga0070684_100024883 3300005535 Bacteria 5025
114 Ga0070684_100033679 3300005535 Bacteria 4376
115 Ga0068853_100240125 3300005539 Bacteria 1660
116 Ga0070672_100039742 3300005543 Bacteria 3605
117 Ga0070672_100045822 3300005543 Bacteria 3385
118 Ga0070672_100184205 3300005543 Bacteria 1741
119 Ga0070672_100254964 3300005543 Bacteria 1478
120 Ga0070672_100466918 3300005543 Bacteria 1089
121 Ga0070686_100124691 3300005544 Bacteria 1773
122 Ga0070686_100200796 3300005544 Bacteria 1429
123 Ga0070686_100373077 3300005544 Bacteria 1078
124 Ga0070695_100004255 3300005545 Bacteria 8374
125 Ga0070695_100132662 3300005545 Bacteria 1718
126 Ga0070665_100018865 3300005548 Bacteria 6916
127 Ga0070665_100023087 3300005548 Bacteria 6266
128 Ga0070665_100083744 3300005548 Bacteria 3194
129 Ga0070665_100288758 3300005548 Bacteria 1643
130 Ga0070665_100297310 3300005548 Bacteria 1617
131 Ga0070665_100323715 3300005548 Bacteria 1546
132 Ga0070665_100372521 3300005548 Bacteria 1435
133 Ga0070704_100011971 3300005549 Bacteria 5344
134 Ga0070704_100015068 3300005549 Bacteria 4846
135 Ga0070704_100179843 3300005549 Bacteria 1690
136 Ga0070704_100268615 3300005549 Bacteria 1408
137 Ga0068855_100020041 3300005563 Bacteria 8030
138 Ga0068855_100029384 3300005563 Bacteria 6572
139 Ga0068855_100245298 3300005563 Bacteria 1999
140 Ga0068855_100461598 3300005563 Bacteria 1385
141 Ga0070664_100000003 3300005564 Bacteria 325604
142 Ga0070664_100001233 3300005564 Bacteria 20476
143 Ga0070664_100104792 3300005564 Bacteria 2463
144 Ga0070664_100204848 3300005564 Bacteria 1761
145 Ga0068857_100005237 3300005577 Bacteria 11044
146 Ga0068857_100074071 3300005577 Bacteria 3035
147 Ga0068857_100091846 3300005577 Bacteria 2718
148 Ga0068854_100000020 3300005578 Bacteria 132163
149 Ga0068854_100002868 3300005578 Bacteria 10722
150 Ga0068856_100001987 3300005614 Bacteria 21317
151 Ga0068856_100034640 3300005614 Bacteria 4945
152 Ga0068852_100042700 3300005616 Bacteria 3840
153 Ga0068852_100043187 3300005616 Bacteria 3822
154 Ga0068852_100099690 3300005616 Bacteria 2619
155 Ga0068852_100149454 3300005616 Bacteria 2171
156 Ga0068852_100173328 3300005616 Bacteria 2024
157 Ga0068852_100235020 3300005616 Bacteria 1749
158 Ga0068852_100237412 3300005616 Bacteria 1740
159 Ga0068859_100062296 3300005617 Bacteria 3760
160 Ga0068859_100069882 3300005617 Bacteria 3547
161 Ga0068864_100001083 3300005618 Bacteria 22791
162 Ga0068864_100011312 3300005618 Bacteria 7373
163 Ga0068864_100022017 3300005618 Bacteria 5342
164 Ga0068866_10119507 3300005718 Bacteria 1483
165 Ga0068861_100000432 3300005719 Bacteria 24368
166 Ga0068870_10020755 3300005840 Bacteria 3204
167 Ga0068870_10033348 3300005840 Bacteria 2627
168 Ga0068863_100010775 3300005841 Bacteria 8869
169 Ga0068863_100020774 3300005841 Bacteria 6271
170 Ga0068863_100504205 3300005841 Unclassified 1192
171 Ga0068858_100081732 3300005842 Bacteria 3003
172 Ga0068860_100001815 3300005843 Bacteria 22723
173 Ga0068860_100060541 3300005843 Bacteria 3598
174 Ga0068860_100823767 3300005843 Bacteria 942
175 Ga0068862_100002346 3300005844 Bacteria 16855
176 Ga0068862_100005522 3300005844 Bacteria 10563
177 Ga0068862_100011728 3300005844 Bacteria 7234
178 Ga0068862_100021433 3300005844 Bacteria 5399
179 Ga0068862_100131676 3300005844 Bacteria 2212
180 Ga0081455_10001851 3300005937 Bacteria 25467
181 Ga0081455_10002478 3300005937 Bacteria 21945
182 Ga0081455_10007317 3300005937 Bacteria 11641
183 Ga0081455_10104159 3300005937 Bacteria 2270
184 Ga0081539_10001293 3300005985 Bacteria 43956
185 Ga0081539_10007008 3300005985 Bacteria 10455
186 Ga0075365_10003502 3300006038 Bacteria 8111
187 Ga0075365_10073341 3300006038 Bacteria 2307
188 Ga0075365_10139894 3300006038 Bacteria 1680
189 Ga0075368_10001377 3300006042 Bacteria 7744
190 Ga0075368_10048412 3300006042 Bacteria 1685
191 Ga0075368_10061110 3300006042 Bacteria 1508
192 Ga0075363_100004369 3300006048 Bacteria 6170
193 Ga0075363_100009854 3300006048 Bacteria 4507
194 Ga0075364_10000618 3300006051 Bacteria 18341
195 Ga0075364_10003245 3300006051 Bacteria 9211
196 Ga0075364_10105816 3300006051 Bacteria 1875
197 Ga0075364_10207427 3300006051 Bacteria 1329
198 Ga0075364_10280762 3300006051 Bacteria 1133
199 Ga0070715_10101356 3300006163 Bacteria 1343
200 Ga0070712_100121184 3300006175 Bacteria 1968
201 Ga0075362_10010353 3300006177 Bacteria 3639
202 Ga0075362_10010485 3300006177 Bacteria 3619
203 Ga0075362_10052153 3300006177 Bacteria 1832
204 Ga0075362_10052751 3300006177 Bacteria 1823
205 Ga0075362_10087148 3300006177 Bacteria 1445
206 Ga0075362_10131051 3300006177 Bacteria 1193
207 Ga0075362_10203717 3300006177 Bacteria 964
208 Ga0075362_10229604 3300006177 Bacteria 909
209 Ga0075367_10005203 3300006178 Bacteria 6431
210 Ga0075367_10015184 3300006178 Bacteria 4180
211 Ga0075367_10024789 3300006178 Bacteria 3384
212 Ga0075367_10035949 3300006178 Bacteria 2870
213 Ga0075367_10039066 3300006178 Bacteria 2766
214 Ga0075367_10114561 3300006178 Bacteria 1657
215 Ga0075369_10007032 3300006186 Bacteria 4275
216 Ga0075369_10049913 3300006186 Bacteria 1808
217 Ga0075369_10098265 3300006186 Bacteria 1312
218 Ga0075369_10135117 3300006186 Bacteria 1122
219 Ga0075366_10001135 3300006195 Bacteria 13140
220 Ga0075366_10001971 3300006195 Bacteria 10385
221 Ga0075366_10010718 3300006195 Bacteria 5153
222 Ga0075366_10018528 3300006195 Bacteria 4020
223 Ga0075366_10021594 3300006195 Bacteria 3742
224 Ga0075366_10031292 3300006195 Bacteria 3131
225 Ga0075366_10036943 3300006195 Bacteria 2881
226 Ga0075366_10079348 3300006195 Bacteria 1959
227 Ga0075366_10086781 3300006195 Bacteria 1872
228 Ga0075366_10094058 3300006195 Bacteria 1797
229 Ga0075366_10106828 3300006195 Bacteria 1683
230 Ga0075366_10147127 3300006195 Bacteria 1426
231 Ga0075366_10155520 3300006195 Bacteria 1385
232 Ga0075366_10345988 3300006195 Bacteria 912
233 Ga0097621_100018679 3300006237 Bacteria 5304
234 Ga0097621_100161788 3300006237 Bacteria 1925
235 Ga0097621_100181689 3300006237 Bacteria 1818
236 Ga0097621_100402153 3300006237 Bacteria 1226
237 Ga0097621_100560588 3300006237 Bacteria 1041
238 Ga0075370_10000282 3300006353 Bacteria 18351
239 Ga0075370_10001386 3300006353 Bacteria 10451
240 Ga0075370_10002451 3300006353 Bacteria 8607
241 Ga0075370_10005682 3300006353 Bacteria 6223
242 Ga0075370_10007999 3300006353 Bacteria 5420
243 Ga0075370_10010161 3300006353 Bacteria 4907
244 Ga0075370_10011111 3300006353 Bacteria 4721
245 Ga0075370_10018775 3300006353 Bacteria 3755
246 Ga0075370_10026524 3300006353 Bacteria 3210
247 Ga0075370_10045856 3300006353 Bacteria 2473
248 Ga0075370_10077033 3300006353 Bacteria 1913
249 Ga0068871_100010307 3300006358 Bacteria 6813
250 Ga0075428_100005985 3300006844 Bacteria 13511
251 Ga0075428_100055238 3300006844 Bacteria 4351
252 Ga0075428_100143532 3300006844 Bacteria 2595
253 Ga0075428_100236770 3300006844 Bacteria 1970
254 Ga0075430_100085601 3300006846 Bacteria 2639
255 Ga0075430_100122047 3300006846 Bacteria 2172
256 Ga0075430_100230009 3300006846 Bacteria 1537
257 Ga0075430_100369170 3300006846 Bacteria 1185
258 Ga0075430_100404034 3300006846 Bacteria 1127
259 Ga0075431_100007163 3300006847 Bacteria 11088
260 Ga0075431_100048259 3300006847 Bacteria 4391
261 Ga0075431_100068636 3300006847 Bacteria 3658
262 Ga0075431_100096050 3300006847 Bacteria 3060
263 Ga0075433_10005939 3300006852 Bacteria 9614
264 Ga0075434_100387249 3300006871 Bacteria 1419
265 Ga0075429_100002595 3300006880 Bacteria 15231
266 Ga0075429_100025560 3300006880 Bacteria 5125
267 Ga0075429_100097514 3300006880 Bacteria 2564
268 Ga0068865_100015222 3300006881 Bacteria 4902
269 Ga0068865_100051354 3300006881 Bacteria 2853
270 Ga0075436_100228896 3300006914 Bacteria 1320
271 Ga0097620_100062296 3300006931 Bacteria 3760
272 Ga0097620_100069882 3300006931 Bacteria 3547
273 Ga0079104_1000055 3300006946 Bacteria 166522
274 Ga0079104_1000714 3300006946 Bacteria 30116
275 Ga0075435_100034464 3300007076 Bacteria 4012
276 Ga0075435_100103511 3300007076 Bacteria 2361
277 Ga0075435_100115469 3300007076 Bacteria 2235
278 Ga0099794_10043244 3300007265 Bacteria 2150
279 Ga0099794_10086157 3300007265 Bacteria 1555
280 Ga0105251_10028894 3300009011 Bacteria 2798
281 Ga0105250_10000934 3300009092 Bacteria 17188
282 Ga0105250_10028986 3300009092 Bacteria 2228
283 Ga0105240_10010321 3300009093 Bacteria 13142
284 Ga0105240_10011702 3300009093 Bacteria 12192
285 Ga0105240_10047257 3300009093 Bacteria 5447
286 Ga0105240_10056122 3300009093 Bacteria 4928
287 Ga0105240_10116664 3300009093 Bacteria 3220
288 Ga0111539_10395255 3300009094 Bacteria 1610
289 Ga0111539_10671687 3300009094 Bacteria 1206
290 Ga0105245_10017446 3300009098 Bacteria 6262
291 Ga0105245_10373181 3300009098 Bacteria 1419
292 Ga0105245_10539905 3300009098 Bacteria 1187
293 Ga0114129_10088714 3300009147 Bacteria 4287
294 Ga0114129_10114832 3300009147 Bacteria 3712
295 Ga0114129_10121865 3300009147 Bacteria 3588
296 Ga0105243_10008363 3300009148 Bacteria 7943
297 Ga0105243_10010416 3300009148 Bacteria 7060
298 Ga0105243_10131940 3300009148 Bacteria 2120
299 Ga0105243_10166684 3300009148 Bacteria 1904
300 Ga0105243_10224520 3300009148 Bacteria 1662
301 Ga0105243_10342764 3300009148 Bacteria 1369
302 Ga0105242_10002298 3300009176 Bacteria 15099
303 Ga0105242_10008113 3300009176 Bacteria 8078
304 Ga0105242_10195169 3300009176 Bacteria 1795
305 Ga0105242_10285201 3300009176 Bacteria 1501
306 Ga0105242_10389265 3300009176 Bacteria 1298
307 Ga0105248_10062998 3300009177 Bacteria 4162
308 Ga0105248_10322965 3300009177 Bacteria 1738
309 Ga0105248_10447694 3300009177 Bacteria 1455
310 Ga0105237_10001363 3300009545 Bacteria 32325
311 Ga0105237_10005313 3300009545 Bacteria 14566
312 Ga0105237_10570635 3300009545 Bacteria 1138
313 Ga0105238_10002436 3300009551 Bacteria 18670
314 Ga0105238_10036475 3300009551 Bacteria 4998
315 Ga0105238_10326761 3300009551 Bacteria 1520
316 Ga0105249_10025991 3300009553 Bacteria 5273
317 Ga0105249_10091843 3300009553 Bacteria 2841
318 Ga0105239_10000954 3300010375 Bacteria 40769
319 Ga0105239_10032384 3300010375 Bacteria 5745
320 Ga0157319_1000003 3300012497 Bacteria 397199
321 Ga0157319_1000452 3300012497 Bacteria 1872
322 Ga0157373_10007631 3300013100 Bacteria 8034
323 Ga0157371_10000567 3300013102 Bacteria 43827
324 Ga0157371_10029522 3300013102 Bacteria 3963
325 Ga0157370_10000633 3300013104 Bacteria 43884
326 Ga0157369_10010717 3300013105 Bacteria 10432
327 Ga0157369_10024567 3300013105 Bacteria 6699
328 Ga0157369_10304604 3300013105 Bacteria 1657
329 Ga0157374_10214251 3300013296 Bacteria 1889
330 Ga0157374_10365774 3300013296 Bacteria 1435
331 Ga0157374_10422996 3300013296 Bacteria 1331
332 Ga0157378_10002482 3300013297 Bacteria 16403
333 Ga0157378_10162573 3300013297 Bacteria 2089
334 Ga0157378_10643519 3300013297 Bacteria 1075
335 Ga0163162_10001152 3300013306 Bacteria 24673
336 Ga0163162_10030246 3300013306 Bacteria 5366
337 Ga0157372_10003682 3300013307 Bacteria 16477
338 Ga0157372_10384819 3300013307 Bacteria 1634
339 Ga0157375_10010232 3300013308 Bacteria 8251
340 Ga0157375_10011836 3300013308 Bacteria 7714
341 Ga0157375_10024377 3300013308 Bacteria 5598
342 Ga0157375_10026053 3300013308 Bacteria 5444
343 Ga0157375_10027684 3300013308 Bacteria 5302
344 Ga0157375_10326293 3300013308 Bacteria 1700
345 Ga0163163_10037755 3300014325 Bacteria 4701
346 Ga0163163_10096037 3300014325 Bacteria 2984
347 Ga0157380_10201644 3300014326 Bacteria 1765
348 Ga0182008_10034166 3300014497 Bacteria 2550
349 Ga0182008_10038919 3300014497 Bacteria 2377
350 Ga0157377_10189368 3300014745 Bacteria 1299
351 Ga0157379_10040265 3300014968 Bacteria 4170
352 Ga0157379_10080208 3300014968 Bacteria 2923
353 Ga0157379_10122780 3300014968 Bacteria 2337
354 Ga0157379_10127214 3300014968 Bacteria 2293
355 Ga0157379_10150722 3300014968 Bacteria 2097
356 Ga0157376_10076251 3300014969 Bacteria 2864
357 Ga0157376_10420785 3300014969 Bacteria 1296
358 Ga0182006_1001900 3300015261 Bacteria 11909
359 Ga0182006_1012562 3300015261 Bacteria 3702
360 Ga0182007_10006742 3300015262 Bacteria 4902
361 Ga0163161_10525912 3300017792 Bacteria 966
362 Ga0206356_11584573 3300020070 Bacteria 1662
363 Ga0154015_1561949 3300020610 Bacteria 17677
364 Ga0213872_10000006 3300021361 Bacteria 249845
365 Ga0213872_10000175 3300021361 Bacteria 57086
366 Ga0213872_10000735 3300021361 Bacteria 24387
367 Ga0213872_10103969 3300021361 Bacteria 1264
368 Ga0213871_10001196 3300021441 Bacteria 4187
369 Ga0209784_100006 3300025224 Bacteria 930704
370 Ga0209566_100002 3300025225 Bacteria 2614868
371 Ga0209674_100010 3300025226 Bacteria 1038638
372 Ga0209674_100050 3300025226 Bacteria 341738
373 Ga0209674_100066 3300025226 Bacteria 256739
374 Ga0209672_100111 3300025228 Bacteria 94440
375 Ga0209672_106766 3300025228 Bacteria 1831
376 Ga0209147_100015 3300025229 Bacteria 565073
377 Ga0209563_100004 3300025230 Bacteria 1814108
378 Ga0209563_100107 3300025230 Bacteria 143807
379 Ga0207427_100848 3300025231 Bacteria 13647
380 Ga0209258_100021 3300025242 Bacteria 565073
381 Ga0209258_100074 3300025242 Bacteria 271062
382 Ga0209258_101083 3300025242 Bacteria 11674
383 Ga0207425_1000545 3300025245 Bacteria 22453
384 Ga0209646_1000039 3300025246 Bacteria 349637
385 Ga0209026_1000006 3300025250 Bacteria 677225
386 Ga0209677_100007 3300025253 Bacteria 1021332
387 Ga0209677_100052 3300025253 Bacteria 167826
388 Ga0209677_100131 3300025253 Bacteria 72722
389 Ga0209677_102745 3300025253 Bacteria 6292
390 Ga0209759_1000020 3300025256 Bacteria 344904
391 Ga0209759_1001101 3300025256 Bacteria 17455
392 Ga0209759_1001776 3300025256 Bacteria 10977
393 Ga0209759_1001943 3300025256 Bacteria 10044
394 Ga0209129_1000294 3300025258 Bacteria 47351
395 Ga0209455_1000028 3300025272 Bacteria 565073
396 Ga0209455_1000066 3300025272 Bacteria 316811
397 Ga0209673_1007230 3300025273 Bacteria 5170
398 Ga0209564_1000003 3300025295 Bacteria 1585848
399 Ga0209564_1000300 3300025295 Bacteria 98386
400 Ga0209758_1000453 3300025297 Bacteria 68482
401 Ga0209758_1000605 3300025297 Bacteria 55552
402 Ga0209050_1001043 3300025298 Bacteria 34245
403 Ga0209050_1001662 3300025298 Bacteria 22481
404 Ga0209050_1016584 3300025298 Bacteria 3002
405 Ga0209256_1000049 3300025299 Bacteria 310696
406 Ga0209256_1000150 3300025299 Bacteria 146086
407 Ga0209051_1000247 3300025303 Bacteria 91122
408 Ga0209051_1001846 3300025303 Bacteria 16707
409 Ga0209051_1011161 3300025303 Bacteria 4462
410 Ga0209051_1054828 3300025303 Bacteria 1298
411 Ga0209257_1000141 3300025304 Bacteria 201130
412 Ga0209257_1000318 3300025304 Bacteria 101186
413 Ga0207696_1002314 3300025711 Bacteria 9448
414 Ga0207696_1030321 3300025711 Bacteria 1644
415 Ga0207682_10037579 3300025893 Bacteria 1962
416 Ga0207682_10044355 3300025893 Bacteria 1823
417 Ga0207688_10130383 3300025901 Bacteria 1474
418 Ga0207647_10138345 3300025904 Bacteria 1428
419 Ga0207685_10057319 3300025905 Bacteria 1528
420 Ga0207645_10000239 3300025907 Bacteria 45441
421 Ga0207645_10002245 3300025907 Bacteria 15384
422 Ga0207643_10021888 3300025908 Bacteria 3517
423 Ga0207643_10088422 3300025908 Bacteria 1803
424 Ga0207705_10007165 3300025909 Bacteria 8214
425 Ga0207705_10051903 3300025909 Bacteria 2951
426 Ga0207705_10061679 3300025909 Bacteria 2708
427 Ga0207705_10152132 3300025909 Bacteria 1734
428 Ga0207684_10020637 3300025910 Bacteria 5629
429 Ga0207684_10184701 3300025910 Bacteria 1798
430 Ga0207684_10265702 3300025910 Bacteria 1480
431 Ga0207707_10003527 3300025912 Bacteria 13853
432 Ga0207695_10000762 3300025913 Bacteria 61636
433 Ga0207695_10006803 3300025913 Bacteria 14738
434 Ga0207695_10016461 3300025913 Bacteria 8650
435 Ga0207695_10168773 3300025913 Bacteria 2115
436 Ga0207671_10006342 3300025914 Bacteria 10552
437 Ga0207671_10029236 3300025914 Bacteria 4116
438 Ga0207663_10426562 3300025916 Bacteria 1019
439 Ga0207657_10026018 3300025919 Bacteria 5386
440 Ga0207657_10155305 3300025919 Bacteria 1861
441 Ga0207657_10393855 3300025919 Bacteria 1090
442 Ga0207649_10000181 3300025920 Bacteria 51550
443 Ga0207649_10000335 3300025920 Bacteria 35710
444 Ga0207652_10009517 3300025921 Bacteria 7814
445 Ga0207646_10522289 3300025922 Bacteria 1069
446 Ga0207646_10532955 3300025922 Unclassified 1057
447 Ga0207681_10461679 3300025923 Bacteria 1034
448 Ga0207694_10032788 3300025924 Bacteria 3977
449 Ga0207694_10137473 3300025924 Bacteria 1963
450 Ga0207650_10002178 3300025925 Bacteria 13682
451 Ga0207650_10017432 3300025925 Bacteria 5030
452 Ga0207650_10095254 3300025925 Bacteria 2282
453 Ga0207659_10119494 3300025926 Bacteria 2018
454 Ga0207659_10191058 3300025926 Bacteria 1630
455 Ga0207659_10192642 3300025926 Bacteria 1623
456 Ga0207659_10286481 3300025926 Bacteria 1348
457 Ga0207687_10006568 3300025927 Bacteria 7673
458 Ga0207687_10273821 3300025927 Bacteria 1350
459 Ga0207700_10012529 3300025928 Bacteria 5474
460 Ga0207644_10016858 3300025931 Bacteria 4922
461 Ga0207690_10000176 3300025932 Bacteria 49560
462 Ga0207690_10093091 3300025932 Bacteria 2135
463 Ga0207690_10117344 3300025932 Bacteria 1927
464 Ga0207706_10000269 3300025933 Bacteria 56605
465 Ga0207706_10005101 3300025933 Bacteria 12262
466 Ga0207706_10203160 3300025933 Bacteria 1738
467 Ga0207706_10204919 3300025933 Bacteria 1729
468 Ga0207686_10014921 3300025934 Bacteria 4337
469 Ga0207686_10105189 3300025934 Bacteria 1892
470 Ga0207709_10000728 3300025935 Bacteria 26361
471 Ga0207709_10012031 3300025935 Bacteria 4772
472 Ga0207709_10099526 3300025935 Bacteria 1919
473 Ga0207709_10579633 3300025935 Bacteria 886
474 Ga0207670_10020673 3300025936 Bacteria 4049
475 Ga0207669_10027794 3300025937 Bacteria 3103
476 Ga0207669_10059288 3300025937 Bacteria 2341
477 Ga0207691_10007606 3300025940 Bacteria 10427
478 Ga0207691_10027019 3300025940 Bacteria 5385
479 Ga0207691_10103118 3300025940 Bacteria 2544
480 Ga0207691_10169098 3300025940 Bacteria 1915
481 Ga0207691_10605176 3300025940 Bacteria 928
482 Ga0207711_10007438 3300025941 Bacteria 9168
483 Ga0207711_10257008 3300025941 Bacteria 1605
484 Ga0207689_10007794 3300025942 Bacteria 9369
485 Ga0207689_10011133 3300025942 Bacteria 7721
486 Ga0207689_10113104 3300025942 Bacteria 2231
487 Ga0207679_10000007 3300025945 Bacteria 460140
488 Ga0207679_10000168 3300025945 Bacteria 54187
489 Ga0207679_10006048 3300025945 Bacteria 7628
490 Ga0207679_10118750 3300025945 Bacteria 2101
491 Ga0207667_10002821 3300025949 Bacteria 21552
492 Ga0207667_10008762 3300025949 Bacteria 11983
493 Ga0207667_10027793 3300025949 Bacteria 6152
494 Ga0207651_10004284 3300025960 Bacteria 7162
495 Ga0207651_10015741 3300025960 Bacteria 4406
496 Ga0207640_10000087 3300025981 Bacteria 72872
497 Ga0207640_10004871 3300025981 Bacteria 7292
498 Ga0207640_10126666 3300025981 Bacteria 1840
499 Ga0207658_10001079 3300025986 Bacteria 22086
500 Ga0207658_10091760 3300025986 Bacteria 2357
501 Ga0207658_10119301 3300025986 Bacteria 2100
502 Ga0207677_10041675 3300026023 Bacteria 3038
503 Ga0207677_10144971 3300026023 Bacteria 1824
504 Ga0207677_10370976 3300026023 Bacteria 1205
505 Ga0207703_10140367 3300026035 Bacteria 2096
506 Ga0207703_10381503 3300026035 Bacteria 1304
507 Ga0207639_10149577 3300026041 Bacteria 1954
508 Ga0207639_10502004 3300026041 Bacteria 1108
509 Ga0207678_10000011 3300026067 Bacteria 147685
510 Ga0207678_10031607 3300026067 Bacteria 4617
511 Ga0207678_10034740 3300026067 Bacteria 4391
512 Ga0207708_10044187 3300026075 Bacteria 3395
513 Ga0207702_10000018 3300026078 Bacteria 212617
514 Ga0207702_10000310 3300026078 Bacteria 55596
515 Ga0207702_10023845 3300026078 Bacteria 5075
516 Ga0207641_10009800 3300026088 Bacteria 7888
517 Ga0207641_10040044 3300026088 Bacteria 3920
518 Ga0207641_10323502 3300026088 Bacteria 1463
519 Ga0207648_10000393 3300026089 Bacteria 48485
520 Ga0207648_10006738 3300026089 Bacteria 11394
521 Ga0207648_10048470 3300026089 Bacteria 3719
522 Ga0207648_10189848 3300026089 Bacteria 1820
523 Ga0207648_10234015 3300026089 Bacteria 1635
524 Ga0207648_10293309 3300026089 Bacteria 1457
525 Ga0207676_10014656 3300026095 Bacteria 5645
526 Ga0207676_10051117 3300026095 Bacteria 3225
527 Ga0207674_10005933 3300026116 Bacteria 14445
528 Ga0207674_10008702 3300026116 Bacteria 11684
529 Ga0207674_10019532 3300026116 Bacteria 7338
530 Ga0207674_10070363 3300026116 Bacteria 3518
531 Ga0207675_100000241 3300026118 Bacteria 52027
532 Ga0207675_100001788 3300026118 Bacteria 21504
533 Ga0207675_100009646 3300026118 Bacteria 9034
534 Ga0207683_10026363 3300026121 Bacteria 5016
535 Ga0207683_10056923 3300026121 Bacteria 3431
536 Ga0207683_10190003 3300026121 Bacteria 1864
537 Ga0207683_10211874 3300026121 Bacteria 1764
538 Ga0207698_10230812 3300026142 Bacteria 1680
539 Ga0207698_10304799 3300026142 Bacteria 1484
540 Ga0207698_10409876 3300026142 Bacteria 1298
541 Ga0207698_10542380 3300026142 Bacteria 1139
542 Ga0209281_1000007 3300027111 Bacteria 938265
543 Ga0209281_1001190 3300027111 Bacteria 17791
544 Ga0209968_1001023 3300027526 Bacteria 4300
545 Ga0209970_1000068 3300027614 Bacteria 14109
546 Ga0209970_1004215 3300027614 Bacteria 2395
547 Ga0209983_1001464 3300027665 Bacteria 5249
548 Ga0209983_1001937 3300027665 Bacteria 4590
549 Ga0209971_1002797 3300027682 Bacteria 4169
550 Ga0209966_1000035 3300027695 Bacteria 56067
551 Ga0209998_10000299 3300027717 Bacteria 15058
552 Ga0209813_10002804 3300027866 Bacteria 4028
553 Ga0209974_10001503 3300027876 Bacteria 8474
554 Ga0209974_10018896 3300027876 Bacteria 2286
555 Ga0268266_10004061 3300028379 Bacteria 14147
556 Ga0268266_10016016 3300028379 Bacteria 6412
557 Ga0268266_10039802 3300028379 Bacteria 4004
558 Ga0268266_10121161 3300028379 Bacteria 2328
559 Ga0268266_10297747 3300028379 Bacteria 1504
560 Ga0268265_10021206 3300028380 Bacteria 4547
561 Ga0268265_10042503 3300028380 Bacteria 3373
562 Ga0268265_10043519 3300028380 Bacteria 3339
563 Ga0268265_10442268 3300028380 Bacteria 1212
564 Ga0268264_10009229 3300028381 Bacteria 8172
565 Ga0265334_10006563 3300028573 Bacteria 5007
566 Ga0265336_10000024 3300028666 Bacteria 188787
567 Ga0307517_10063967 3300028786 Bacteria 3428
568 Ga0307517_10157710 3300028786 Bacteria 1534
569 Ga0307515_10000477 3300028794 Bacteria 95378
570 Ga0307515_10001774 3300028794 Bacteria 48109
571 Ga0307515_10001873 3300028794 Bacteria 46808
572 Ga0307515_10018010 3300028794 Bacteria 12820
573 Ga0307515_10033140 3300028794 Bacteria 8518
574 Ga0307515_10052957 3300028794 Bacteria 6003
575 Ga0307515_10071375 3300028794 Bacteria 4707
576 Ga0307515_10216759 3300028794 Bacteria 1743
577 Ga0307515_10231694 3300028794 Bacteria 1638
578 Ga0265324_10000651 3300029957 Bacteria 23540
579 Ga0307512_10023350 3300030522 Bacteria 5524
580 Ga0307512_10062748 3300030522 Bacteria 2847
581 Ga0307512_10112528 3300030522 Bacteria 1786
582 Ga0265330_10000046 3300031235 Bacteria 108853
583 Ga0265332_10000028 3300031238 Bacteria 184029
584 Ga0265328_10026430 3300031239 Bacteria 2181
585 Ga0265340_10040751 3300031247 Bacteria 2286
586 Ga0265331_10012894 3300031250 Bacteria 4508
587 Ga0265327_10000042 3300031251 Bacteria 287487
588 Ga0265327_10000419 3300031251 Bacteria 77672
589 Ga0265316_10000332 3300031344 Bacteria 52832
590 Ga0265316_10214578 3300031344 Bacteria 1422
591 Ga0307513_10011506 3300031456 Bacteria 10991
592 Ga0307513_10022921 3300031456 Bacteria 7317
593 Ga0307513_10423420 3300031456 Bacteria 1061
594 Ga0307509_10000063 3300031507 Bacteria 143708
595 Ga0307509_10005231 3300031507 Bacteria 18184
596 Ga0307509_10018876 3300031507 Bacteria 7890
597 Ga0307509_10050207 3300031507 Bacteria 4468
598 Ga0307509_10097488 3300031507 Bacteria 2988
599 Ga0307408_100000029 3300031548 Bacteria 227806
600 Ga0307408_100039098 3300031548 Bacteria 3351
601 Ga0307408_100101113 3300031548 Bacteria 2197
602 Ga0307408_100105449 3300031548 Bacteria 2155
603 Ga0307508_10000053 3300031616 Bacteria 128020
604 Ga0307508_10000109 3300031616 Bacteria 97316
605 Ga0307508_10037138 3300031616 Bacteria 4383
606 Ga0307508_10129989 3300031616 Bacteria 2121
607 Ga0307508_10230618 3300031616 Bacteria 1450
608 Ga0307514_10003555 3300031649 Bacteria 14852
609 Ga0316575_10003572 3300031665 Bacteria 5379
610 Ga0316579_10001228 3300031691 Bacteria 9188
611 Ga0265314_10000054 3300031711 Bacteria 184029
612 Ga0316578_10007343 3300031728 Bacteria 5518
613 Ga0307516_10000290 3300031730 Bacteria 65231
614 Ga0307516_10000676 3300031730 Bacteria 46208
615 Ga0307516_10003323 3300031730 Bacteria 20804
616 Ga0307516_10042443 3300031730 Bacteria 4512
617 Ga0307516_10205000 3300031730 Bacteria 1689
618 Ga0307412_10091723 3300031911 Bacteria 2127
619 Ga0307412_10416480 3300031911 Bacteria 1098
620 Ga0307414_10125240 3300032004 Bacteria 1984
621 Ga0307411_10000099 3300032005 Bacteria 26770
622 Ga0316583_10000892 3300032133 Bacteria 9552
623 Ga0316583_10003087 3300032133 Bacteria 5855
624 Ga0307507_10166349 3300033179 Bacteria 1615
625 Ga0307507_10194813 3300033179 Bacteria 1416
626 Ga0307510_10006488 3300033180 Bacteria 13955
627 Ga0307510_10081052 3300033180 Bacteria 3150
628 Ga0307510_10098226 3300033180 Bacteria 2733
629 Ga0307510_10126918 3300033180 Bacteria 2237
630 Ga0307510_10136225 3300033180 Bacteria 2112
631 Ga0373959_0006759 3300034820 Bacteria 1913
632 Ga0373934_0015566 3300035086 Bacteria 2887
633 Ga0373951_0016550 3300035091 Bacteria 1664
634 Ga0373952_0001055 3300035092 Bacteria 5034
635 Ga0373936_0052765 3300035113 Bacteria 1648
636 Ga0373939_0000012 3300035114 Bacteria 67223
637 Ga0373953_0110954 3300035117 Bacteria 1160
638 Ga0373954_0000014 3300035118 Bacteria 71012
639 Ga0373956_0033580 3300035119 Bacteria 2257
640 Ga0373960_0008082 3300035121 Bacteria 2511
641 Ga0373955_0071786 3300035172 Bacteria 1938
642 Ga0373942_0104615 3300035207 Bacteria 869
643 Ga0316574_0118606 3300035398 Bacteria 1698
644 Ga0373931_0000235 3300035691 Bacteria 23527
645 Ga0373931_0001846 3300035691 Bacteria 9220
646 Ga0373931_0005977 3300035691 Bacteria 5659
647 Ga0373931_0043878 3300035691 Bacteria 2357
648 Ga0373931_0047326 3300035691 Bacteria 2276
649 Ga0373931_0081180 3300035691 Bacteria 1790
650 Ga0373933_0012021 3300035724 Bacteria 4780
651 Ga0373933_0099713 3300035724 Bacteria 1801
652 Ga0373937_0000218 3300036401 Bacteria 55605
653 Ga0373937_0039513 3300036401 Bacteria 4300
654 Ga0373937_0243575 3300036401 Bacteria 1694
655 Ga0316582_0001739 3300036647 Bacteria 9792
656 Ga0316582_0098172 3300036647 Bacteria 1937
657 Ga0316584_0066683 3300036712 Bacteria 2697
658 Ga0373925_0218977 3300037068 Bacteria 1519
659 Ga0373925_0317765 3300037068 Bacteria 1260
660 Ga0395899_0008576 3300037312 Bacteria 7870
661 Ga0395899_0047209 3300037312 Bacteria 3207
662 Ga0395900_0000183 3300037418 Bacteria 100749
663 Ga0395900_0035720 3300037418 Bacteria 5120
664 Ga0395900_0046371 3300037418 Bacteria 4475
665 Ga0395900_0074822 3300037418 Bacteria 3481
666 Ga0395900_0352392 3300037418 Bacteria 1445
667 Ga0395898_0002107 3300037466 Bacteria 24665
668 Ga0395898_0021926 3300037466 Bacteria 6470
669 Ga0395898_0108462 3300037466 Bacteria 2662
670 Ga0395898_0156177 3300037466 Bacteria 2182
671 Ga0395898_0324776 3300037466 Bacteria 1468
672 Ga0395905_0000805 3300037471 Bacteria 41184
673 Ga0395905_0004023 3300037471 Bacteria 15426
674 Ga0395905_0004208 3300037471 Bacteria 15056
675 Ga0395905_0011566 3300037471 Bacteria 8525
676 Ga0395905_0046448 3300037471 Bacteria 4072
677 Ga0316581_0008060 3300037588 Bacteria 2850
678 Ga0395901_0007074 3300038443 Bacteria 11341
679 Ga0395901_0015701 3300038443 Bacteria 7714
680 Ga0395901_0068369 3300038443 Bacteria 3700
681 Ga0395901_0178882 3300038443 Bacteria 2224
682 Ga0436365_0086324 3300039437 Bacteria 1303
683 Ga0436365_1817572 3300039437 Bacteria 1085
684 Ga0436360_1076911 3300039438 Bacteria 12198
685 Ga0436361_0027820 3300039447 Bacteria 4959
686 Ga0436361_0105405 3300039447 Bacteria 5290
687 Ga0436361_0169339 3300039447 Bacteria 26126
688 Ga0436361_0438458 3300039447 Bacteria 1639
689 Ga0436361_0491913 3300039447 Bacteria 14451
690 Ga0436361_1221151 3300039447 Bacteria 2512
691 Ga0436363_0146039 3300039450 Bacteria 1328
692 Ga0439453_0028120 3300041408 Bacteria 1051
693 Ga0439461_0031344 3300041410 Bacteria 1110
694 Ga0451847_0578485 3300041503 Unclassified 1221
695 Ga0439431_0001954 3300041997 Bacteria 4573
696 Ga0439445_0014021 3300042004 Bacteria 1947
697 Ga0439448_0115196 3300042005 Bacteria 920
698 Ga0450911_000351 3300042115 Bacteria 15672
699 Ga0450915_000577 3300042119 Bacteria 1407
700 Ga0450917_000046 3300042120 Bacteria 6255
701 Ga0450919_000354 3300042121 Bacteria 5543
702 Ga0450921_000418 3300042123 Bacteria 1978
703 Ga0450888_000419 3300042126 Bacteria 4010
704 Ga0450890_000389 3300042127 Bacteria 6440
705 Ga0450890_008313 3300042127 Bacteria 1327
706 Ga0450891_000914 3300042129 Bacteria 3087
707 Ga0450903_003345 3300042138 Bacteria 2781
708 Ga0450907_015630 3300042146 Bacteria 1267
709 Ga0439458_0013278 3300042157 Bacteria 1854
710 Ga0439434_0021932 3300042435 Bacteria 1919
711 Ga0439434_0033674 3300042435 Bacteria 1563
712 Ga0439435_0010927 3300042436 Bacteria 2168
713 Ga0439459_0031306 3300042438 Bacteria 1084
714 Ga0450916_000613 3300042530 Bacteria 3200
715 Ga0450918_000406 3300042531 Bacteria 9338
716 Ga0451577_0003091 3300042876 Bacteria 18789
717 Ga0451577_0005873 3300042876 Bacteria 12410
718 Ga0451577_0011731 3300042876 Bacteria 8271
719 Ga0451577_0167433 3300042876 Bacteria 1980
720 Ga0466986_0015166 3300044650 Bacteria 4923
721 Ga0466969_0000020 3300044656 Bacteria 101861
722 Ga0466969_0019679 3300044656 Bacteria 3505
723 Ga0466969_0022256 3300044656 Bacteria 3272
724 Ga0466972_0012887 3300044658 Bacteria 4198
725 Ga0466972_0017534 3300044658 Bacteria 3584
726 Ga0466978_0036798 3300044671 Bacteria 3014
727 Ga0466982_0068387 3300044672 Bacteria 2191
728 Ga0453683_0098685 3300044673 Bacteria 1834
729 Ga0466965_0006671 3300044683 Bacteria 5260
730 Ga0466965_0008128 3300044683 Bacteria 4845
731 Ga0466965_0057642 3300044683 Bacteria 1936
732 Ga0466965_0070808 3300044683 Bacteria 1753
733 Ga0466965_0285624 3300044683 Bacteria 892
734 Ga0466966_0003281 3300044684 Bacteria 10664
735 Ga0466966_0008789 3300044684 Bacteria 6687
736 Ga0466966_0027606 3300044684 Bacteria 3700
737 Ga0466961_0002611 3300044693 Bacteria 11188
738 Ga0466961_0019410 3300044693 Bacteria 4371
739 Ga0466961_0037440 3300044693 Bacteria 3111
740 Ga0466961_0135237 3300044693 Bacteria 1544
741 Ga0466963_0141651 3300044694 Bacteria 1666
742 Ga0466964_0003293 3300044706 Bacteria 5881
743 Ga0466964_0004560 3300044706 Bacteria 5123
744 Ga0466964_0043434 3300044706 Bacteria 1823
745 Ga0466964_0056995 3300044706 Bacteria 1616
746 Ga0453684_0046865 3300044712 Bacteria 5742
747 Ga0466971_0033639 3300044719 Bacteria 2296
748 Ga0466971_0047363 3300044719 Bacteria 1932
749 Ga0466968_0023135 3300044735 Bacteria 2529
750 Ga0466968_0031434 3300044735 Bacteria 2202
751 Ga0466970_0009727 3300044765 Bacteria 4865
752 Ga0466970_0050042 3300044765 Bacteria 2228
753 Ga0466957_0012573 3300044842 Bacteria 4900
754 Ga0466957_0019692 3300044842 Bacteria 3969
755 Ga0466960_0016831 3300044901 Bacteria 3178
756 Ga0466960_0042006 3300044901 Bacteria 2169
757 Ga0466960_0232415 3300044901 Bacteria 1018
758 Ga0466959_0000424 3300045049 Bacteria 24579
759 Ga0466959_0079880 3300045049 Bacteria 2358
760 Ga0466959_0087107 3300045049 Bacteria 2246
761 Ga0451576_0036167 3300045051 Bacteria 5236
762 Ga0451576_0078392 3300045051 Bacteria 3438
763 Ga0451576_0134961 3300045051 Bacteria 2573
764 Ga0451576_0267711 3300045051 Bacteria 1786
765 Ga0451576_0435673 3300045051 Bacteria 1375
766 Ga0466958_0262389 3300045836 Bacteria 1106
767 Ga0466967_0007150 3300045976 Bacteria 8013
768 Ga0466967_0184518 3300045976 Bacteria 1969
769 Ga0466967_0215366 3300045976 Bacteria 1823
770 Ga0466967_0598066 3300045976 Bacteria 1088
771 Ga0495590_0052281 3300046457 Bacteria 1427
772 Ga0495629_0220557 3300046459 Bacteria 1308
773 Ga0495638_0012776 3300046460 Bacteria 5738
774 Ga0495638_0214307 3300046460 Bacteria 1080
775 Ga0495650_0001952 3300046471 Bacteria 18228
776 Ga0495650_0010282 3300046471 Bacteria 5233
777 Ga0495582_0161148 3300046473 Bacteria 1276
778 Ga0495605_0002292 3300046474 Bacteria 11951
779 Ga0495605_0132957 3300046474 Bacteria 1121
780 Ga0495585_0010595 3300046492 Bacteria 5481
781 Ga0495585_0079639 3300046492 Bacteria 1777
782 Ga0495594_0040077 3300046499 Bacteria 2562
783 Ga0495607_0000044 3300046501 Bacteria 125410
784 Ga0495583_0000034 3300046506 Bacteria 246856
785 Ga0495606_0004244 3300046507 Bacteria 14497
786 Ga0495610_0054381 3300046512 Bacteria 1934
787 Ga0495631_0067422 3300046518 Bacteria 1548
788 Ga0495632_0003922 3300046519 Bacteria 10332
789 Ga0495632_0012106 3300046519 Bacteria 4991
790 Ga0495643_0051137 3300046522 Bacteria 2223
791 Ga0495666_0018480 3300046526 Bacteria 3469
792 Ga0495597_0016564 3300046542 Bacteria 3480
793 Ga0495597_0053924 3300046542 Bacteria 1767
794 Ga0495645_0011842 3300046543 Bacteria 6145
795 Ga0495622_0116063 3300046557 Bacteria 1224
796 Ga0495668_0024868 3300046616 Bacteria 3405
797 Ga0495668_0053052 3300046616 Bacteria 2243
798 Ga0495625_0001672 3300046660 Bacteria 25960
799 Ga0495625_0015803 3300046660 Bacteria 5959
800 Ga0495625_0017804 3300046660 Bacteria 5553
801 Ga0495625_0147050 3300046660 Bacteria 1586
802 Ga0495661_0000223 3300046665 Archaea 65277
803 Ga0495658_0073124 3300046683 Bacteria 1995
804 Ga0495669_0004642 3300046684 Bacteria 5694
805 Ga0495670_0142712 3300046691 Bacteria 1253
806 Ga0495671_0031717 3300046692 Bacteria 2701
807 Ga0495671_0091255 3300046692 Bacteria 1491
808 Ga0495671_0114036 3300046692 Bacteria 1320
809 Ga0495671_0156027 3300046692 Bacteria 1111
810 Ga0495649_0000324 3300046694 Bacteria 41534
811 Ga0495649_0000671 3300046694 Bacteria 27902
812 Ga0495649_0004399 3300046694 Bacteria 9214
813 Ga0495589_0098616 3300046794 Bacteria 1415
814 Ga0495589_0149981 3300046794 Bacteria 1113
815 Ga0495604_0027486 3300047317 Bacteria 4524
816 Ga0495676_0058548 3300047321 Bacteria 3031
817 Ga0495687_001419 3300047443 Bacteria 22047
818 Ga0495687_011765 3300047443 Bacteria 4678
819 Ga0495687_013134 3300047443 Bacteria 4336
820 Ga0495673_0077964 3300047469 Bacteria 1379
821 Ga0495684_0139253 3300047471 Bacteria 1820
822 Ga0495686_0000988 3300047472 Bacteria 34672
823 Ga0495626_0041866 3300048091 Bacteria 2154
824 Ga0496102_0001217 3300048905 Bacteria 23346
825 Ga0496102_0023496 3300048905 Bacteria 5477
826 Ga0496104_0076976 3300048907 Bacteria 3178
827 Ga0496107_0070361 3300048910 Bacteria 2540
828 Ga0496108_0057028 3300048911 Bacteria 3282
829 Ga0496109_0347864 3300048912 Bacteria 1400
830 Ga0496109_0404843 3300048912 Bacteria 1289
831 Ga0496110_0001725 3300048913 Bacteria 16100
832 Ga0496114_0015814 3300048917 Bacteria 6072
833 Ga0496114_0101704 3300048917 Bacteria 2454
834 Ga0496121_0012277 3300048924 Bacteria 9376
835 Ga0496121_0012411 3300048924 Bacteria 9299
836 Ga0496123_0034818 3300048926 Bacteria 3599
837 Ga0496124_0000108 3300048927 Bacteria 167473
838 Ga0496124_0019272 3300048927 Bacteria 6358
839 Ga0496124_0023176 3300048927 Bacteria 5673
840 Ga0496124_0109268 3300048927 Bacteria 2229
841 Ga0496125_0001189 3300048928 Bacteria 39370
842 Ga0496125_0006406 3300048928 Bacteria 12743
843 Ga0496125_0022269 3300048928 Bacteria 5888
844 Ga0496125_0023763 3300048928 Bacteria 5651
845 Ga0496125_0079710 3300048928 Bacteria 2510
846 Ga0496125_0096368 3300048928 Bacteria 2196
847 Ga0496126_0001477 3300048929 Bacteria 36534
848 Ga0496126_0038262 3300048929 Bacteria 4466
849 Ga0496126_0678718 3300048929 Bacteria 803
850 Ga0501294_004908 3300049517 Bacteria 1264
851 Ga0501031_0002015 3300049568 Bacteria 12792
852 Ga0501031_0074212 3300049568 Bacteria 2215
853 Ga0501031_0132915 3300049568 Bacteria 1625
854 Ga0501031_0292429 3300049568 Bacteria 1056
855 Ga0501032_0236070 3300049569 Bacteria 1188
856 Ga0501033_0056527 3300049570 Bacteria 2900
857 Ga0501034_0007498 3300049571 Bacteria 11602
858 Ga0501034_0026574 3300049571 Bacteria 5894
859 Ga0501036_0056015 3300049572 Bacteria 3340
860 Ga0501037_0090190 3300049573 Bacteria 2218
861 Ga0501037_0281425 3300049573 Bacteria 1159
862 Ga0501037_0356111 3300049573 Bacteria 1009
863 Ga0501038_0035777 3300049574 Bacteria 4359
864 Ga0501039_0018752 3300049575 Bacteria 5311
865 Ga0501040_0024046 3300049576 Bacteria 4088
866 Ga0501041_0244979 3300049577 Bacteria 1126
867 Ga0501043_0000002 3300049579 Bacteria 351081
868 Ga0501043_0122242 3300049579 Bacteria 2042
869 Ga0501046_0000008 3300049580 Bacteria 351167
870 Ga0501046_0159709 3300049580 Bacteria 1696
871 Ga0501046_0196977 3300049580 Bacteria 1500
872 Ga0501047_0000003 3300049581 Bacteria 508375
873 Ga0501048_0000983 3300049582 Bacteria 21145
874 Ga0501048_0044213 3300049582 Bacteria 3186
875 Ga0501048_0086449 3300049582 Bacteria 2212
876 Ga0501068_0215809 3300049584 Bacteria 1219
877 Ga0501070_0037789 3300049586 Bacteria 4030
878 Ga0501072_0179833 3300049588 Bacteria 1687
879 Ga0501073_0262420 3300049589 Bacteria 1192
880 Ga0501075_0184131 3300049591 Bacteria 1593
881 Ga0501077_0131892 3300049593 Bacteria 1584
882 Ga0501198_000024 3300049649 Bacteria 67171
883 Ga0501202_004215 3300049652 Bacteria 2512
884 Ga0501206_005518 3300049653 Bacteria 1628
885 Ga0501222_000020 3300049662 Bacteria 67164
886 Ga0501222_005361 3300049662 Bacteria 1732
887 Ga0501223_035016 3300049663 Bacteria 977
888 Ga0501233_014551 3300049668 Bacteria 1609
889 Ga0501235_007166 3300049669 Bacteria 2430
890 Ga0501255_001464 3300049684 Bacteria 1911
891 Ga0501221_002008 3300049704 Bacteria 3393
892 Ga0501229_000186 3300049706 Bacteria 6655
893 Ga0501079_0156374 3300049741 Bacteria 1777
894 Ga0501079_0186934 3300049741 Bacteria 1617
895 Ga0501080_0421860 3300049742 Bacteria 1198
896 Ga0501081_0031033 3300049743 Bacteria 3621
897 Ga0501265_000443 3300049762 Bacteria 4352
898 Ga0501266_000075 3300049763 Bacteria 12913
899 Ga0501273_018696 3300049770 Bacteria 924
900 Ga0501035_0353626 3300049822 Bacteria 1229
901 Ga0501035_0510410 3300049822 Bacteria 989
902 Ga0501044_0134313 3300049823 Bacteria 2466
903 Ga0501044_0140116 3300049823 Bacteria 2407
904 Ga0501045_0001581 3300049824 Bacteria 15187
905 Ga0501045_0090202 3300049824 Bacteria 2265
906 nmdc:mga03683_128920_c1 3300050489 Bacteria 1130
907 nmdc:mga03683_29418_c1 3300050489 Bacteria 2191
908 nmdc:mga03683_2990_c1 3300050489 Bacteria 4138
909 nmdc:mga03683_40775_c1 3300050489 Bacteria 1905
910 nmdc:mga03683_46636_c1 3300050489 Bacteria 1797
911 nmdc:mga03683_98275_c1 3300050489 Bacteria 1284
912 nmdc:mga00v17_121220_c1 3300050491 Bacteria 1665
913 nmdc:mga00v17_17442_c1 3300050491 Bacteria 4065
914 nmdc:mga00v17_192813_c1 3300050491 Bacteria 1316
915 nmdc:mga00v17_32530_c1 3300050491 Bacteria 3084
916 nmdc:mga00v17_6284_c1 3300050491 Bacteria 6297
917 nmdc:mga00v17_8113_c1 3300050491 Bacteria 5636
918 nmdc:mga0yw44_26115_c1 3300050492 Bacteria 3332
919 nmdc:mga0yw44_405660_c1 3300050492 Bacteria 922
920 nmdc:mga0k408_124890_c1 3300050493 Bacteria 1526
921 nmdc:mga0k408_131034_c1 3300050493 Bacteria 1489
922 nmdc:mga0k408_1570_c1 3300050493 Bacteria 12344
923 nmdc:mga0k408_1611_c1 3300050493 Bacteria 12218
924 nmdc:mga0k408_213_c1 3300050493 Bacteria 31180
925 nmdc:mga0k408_2767_c1 3300050493 Bacteria 9325
926 nmdc:mga0k408_302_c1 3300050493 Bacteria 26707
927 nmdc:mga0k408_31417_c1 3300050493 Bacteria 3032
928 nmdc:mga0k408_3792_c1 3300050493 Bacteria 8010
929 nmdc:mga0k408_8381_c1 3300050493 Bacteria 5544
930 nmdc:mga0k408_83946_c1 3300050493 Bacteria 1868
931 nmdc:mga06z11_155652_c1 3300050494 Bacteria 1303
932 nmdc:mga06z11_199777_c1 3300050494 Bacteria 1161
933 nmdc:mga06z11_27335_c1 3300050494 Bacteria 2727
934 nmdc:mga06z11_7906_c1 3300050494 Bacteria 4403
935 nmdc:mga06z11_83057_c1 3300050494 Bacteria 1723
936 nmdc:mga04h51_51263_c1 3300050495 Bacteria 1386
937 nmdc:mga07m45_106428_c1 3300050496 Bacteria 1613
938 nmdc:mga07m45_11126_c1 3300050496 Bacteria 4721
939 nmdc:mga07m45_11434_c1 3300050496 Bacteria 4663
940 nmdc:mga07m45_118303_c1 3300050496 Bacteria 1530
941 nmdc:mga07m45_1209_c1 3300050496 Bacteria 11695
942 nmdc:mga07m45_1376_c1 3300050496 Bacteria 11088
943 nmdc:mga07m45_15735_c1 3300050496 Bacteria 4042
944 nmdc:mga07m45_18652_c1 3300050496 Bacteria 3751
945 nmdc:mga07m45_2100_c1 3300050496 Bacteria 9260
946 nmdc:mga07m45_257_c1 3300050496 Bacteria 21611
947 nmdc:mga07m45_270029_c1 3300050496 Bacteria 989
948 nmdc:mga07m45_3296_c1 3300050496 Bacteria 7770
949 nmdc:mga07m45_401_c1 3300050496 Bacteria 17879
950 nmdc:mga07m45_4997_c1 3300050496 Bacteria 6549
951 nmdc:mga07m45_869_c1 3300050496 Bacteria 13176
952 nmdc:mga05p37_1554_c1 3300050507 Bacteria 26686
953 nmdc:mga09592_140995_c1 3300050508 Bacteria 2078
954 nmdc:mga09592_25627_c1 3300050508 Bacteria 4883
955 nmdc:mga09592_357_c1 3300050508 Bacteria 33391
956 nmdc:mga09592_76250_c1 3300050508 Bacteria 2851
957 nmdc:mga0qj67_118120_c1 3300050509 Bacteria 2144
958 nmdc:mga0qj67_210864_c1 3300050509 Bacteria 1578
959 nmdc:mga06r32_18169_c1 3300050510 Bacteria 6433
960 nmdc:mga06r32_270778_c1 3300050510 Bacteria 1686
961 nmdc:mga06r32_46479_c1 3300050510 Bacteria 4142
962 nmdc:mga06r32_77840_c1 3300050510 Bacteria 3222
963 nmdc:mga08y16_249543_c1 3300050511 Bacteria 1834
964 nmdc:mga0n895_209520_c1 3300050512 Bacteria 1980
965 nmdc:mga0rr50_205561_c1 3300050513 Bacteria 1620
966 nmdc:mga0rr50_37854_c1 3300050513 Bacteria 3486
967 nmdc:mga0rr50_89493_c1 3300050513 Bacteria 2393
968 nmdc:mga08x19_127169_c1 3300050514 Bacteria 1712
969 nmdc:mga08x19_24472_c1 3300050514 Bacteria 3753
970 nmdc:mga0a205_137891_c1 3300050515 Bacteria 2339
971 nmdc:mga0a205_320677_c1 3300050515 Bacteria 1420
972 nmdc:mga0a205_9263_c1 3300050515 Bacteria 8993
973 nmdc:mga0sz30_58151_c1 3300050516 Bacteria 1648
974 nmdc:mga0sz30_73041_c1 3300050516 Bacteria 1478
975 nmdc:mga0sz30_8224_c1 3300050516 Bacteria 3933
976 Ga0500635_0000008 3300053080 Bacteria 167327
977 Ga0500635_0016953 3300053080 Bacteria 2174
978 Ga0500578_0000025 3300053086 Bacteria 151485
979 Ga0500578_0014283 3300053086 Bacteria 5110
980 Ga0500578_0090581 3300053086 Bacteria 1941
981 Ga0500644_0023781 3300053088 Bacteria 1865
982 Ga0500644_0076499 3300053088 Bacteria 1220
983 Ga0500644_0136260 3300053088 Bacteria 971
984 Ga0500583_0048284 3300053092 Bacteria 1964
985 Ga0500651_0061141 3300053093 Bacteria 2353
986 Ga0500566_0130643 3300053094 Bacteria 1344
987 Ga0500641_0002690 3300053096 Bacteria 6280
988 Ga0500593_000047 3300053117 Bacteria 42992
989 Ga0500594_0000969 3300053118 Bacteria 6170
990 Ga0500642_0030457 3300053130 Bacteria 2245
991 Ga0500642_0084850 3300053130 Bacteria 1459
992 Ga0500652_000682 3300053131 Bacteria 11525
993 Ga0500655_006155 3300053133 Bacteria 2162
994 Ga0500658_0001671 3300053134 Bacteria 8812
995 Ga0500658_0021676 3300053134 Bacteria 2436
996 Ga0500658_0046838 3300053134 Bacteria 1753
997 Ga0500658_0092454 3300053134 Bacteria 1310
998 Ga0500559_0000013 3300053136 Bacteria 163436
999 Ga0500568_0001263 3300053139 Bacteria 16721
1000 Ga0500616_0010218 3300053153 Bacteria 5630
1001 Ga0500620_004765 3300053155 Bacteria 3068
1002 Ga0500622_0000087 3300053156 Bacteria 98385
1003 Ga0500622_0002441 3300053156 Bacteria 13419
1004 Ga0500622_0005795 3300053156 Bacteria 7323
1005 Ga0500633_0091737 3300053160 Bacteria 1110
1006 Ga0500636_0005063 3300053177 Bacteria 7481
1007 Ga0500636_0030670 3300053177 Bacteria 3182
1008 Ga0500645_001614 3300053730 Bacteria 11168
1009 Ga0500552_000398 3300053733 Bacteria 3990
1010 Ga0500587_000050 3300053739 Bacteria 9871
1011 Ga0500587_000704 3300053739 Bacteria 4275
1012 Ga0501082_0022351 3300060353 Bacteria 5448
1013 Ga0501082_0058818 3300060353 Bacteria 3312
1014 Ga0466962_0021520 3300061719 Bacteria 3096
1015 Ga0466962_0024752 3300061719 Bacteria 2882
1016 Ga0466962_0092207 3300061719 Bacteria 1452

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049770 Ga0501273_018696 Ga0501273_018696_176_913 213
2 3300053088 Ga0500644_0136260 Ga0500644_0136260_52_726 217
3 3300026035 Ga0207703_10381503 Ga0207703_103815032 222
4 3300050491 nmdc:mga00v17_121220_c1 nmdc:mga00v17_121220_c1_973_1653 224
5 3300050492 nmdc:mga0yw44_405660_c1 nmdc:mga0yw44_405660_c1_91_822 235
6 3300025922 Ga0207646_10522289 Ga0207646_105222891 236
7 3300009094 Ga0111539_10671687 Ga0111539_106716871 237
8 3300048929 Ga0496126_0678718 Ga0496126_0678718_23_757 237
9 3300049569 Ga0501032_0236070 Ga0501032_0236070_406_1170 237
10 3300042123 Ga0450921_000418 Ga0450921_000418_155_877 240
11 3300031548 Ga0307408_100039098 Ga0307408_1000390982 244
12 3300031911 Ga0307412_10416480 Ga0307412_104164801 244
13 3300049653 Ga0501206_005518 Ga0501206_005518_360_1178 244
14 3300049762 Ga0501265_000443 Ga0501265_000443_241_1104 244
15 3300006195 Ga0075366_10001135 Ga0075366_1000113511 245
16 3300006195 Ga0075366_10345988 Ga0075366_103459881 245
17 3300006353 Ga0075370_10005682 Ga0075370_100056823 245
18 3300050493 nmdc:mga0k408_1611_c1 nmdc:mga0k408_1611_c1_5386_6201 245
19 3300050496 nmdc:mga07m45_401_c1 nmdc:mga07m45_401_c1_3044_3859 245
20 3300025910 Ga0207684_10184701 Ga0207684_101847011 246
21 3300031730 Ga0307516_10000290 Ga0307516_1000029017 246
22 3300049568 Ga0501031_0002015 Ga0501031_0002015_9275_10090 246
23 3300033180 Ga0307510_10098226 Ga0307510_100982262 247
24 3300046543 Ga0495645_0011842 Ga0495645_0011842_1097_1912 247
25 3300031507 Ga0307509_10097488 Ga0307509_100974882 248
26 3300046459 Ga0495629_0220557 Ga0495629_0220557_238_1140 248
27 3300046473 Ga0495582_0161148 Ga0495582_0161148_293_1108 248
28 3300046557 Ga0495622_0116063 Ga0495622_0116063_254_1156 248
29 3300047321 Ga0495676_0058548 Ga0495676_0058548_341_1156 248
30 3300047472 Ga0495686_0000988 Ga0495686_0000988_4182_4997 248
31 3300006178 Ga0075367_10114561 Ga0075367_101145612 250
32 3300006048 Ga0075363_100009854 Ga0075363_1000098543 251
33 3300006353 Ga0075370_10000282 Ga0075370_100002826 251
34 3300050496 nmdc:mga07m45_11434_c1 nmdc:mga07m45_11434_c1_1149_1994 251
35 iso_pu_bacteria 2857542790 2857543007 253
36 3300005336 Ga0070680_100290611 Ga0070680_1002906112 254
37 3300005353 Ga0070669_100189807 Ga0070669_1001898072 254
38 3300005441 Ga0070700_100057858 Ga0070700_1000578582 254
39 3300005456 Ga0070678_100494243 Ga0070678_1004942432 254
40 3300005543 Ga0070672_100254964 Ga0070672_1002549643 254
41 3300005545 Ga0070695_100132662 Ga0070695_1001326622 254
42 3300005840 Ga0068870_10020755 Ga0068870_100207551 254
43 3300005844 Ga0068862_100002346 Ga0068862_10000234617 254
44 3300006844 Ga0075428_100005985 Ga0075428_10000598514 254
45 3300006844 Ga0075428_100143532 Ga0075428_1001435321 254
46 3300006846 Ga0075430_100085601 Ga0075430_1000856012 254
47 3300006846 Ga0075430_100230009 Ga0075430_1002300093 254
48 3300006846 Ga0075430_100404034 Ga0075430_1004040343 254
49 3300006847 Ga0075431_100048259 Ga0075431_1000482593 254
50 3300006847 Ga0075431_100068636 Ga0075431_1000686363 254
51 3300006880 Ga0075429_100097514 Ga0075429_1000975144 254
52 3300009094 Ga0111539_10395255 Ga0111539_103952552 254
53 3300009176 Ga0105242_10389265 Ga0105242_103892652 254
54 3300009553 Ga0105249_10091843 Ga0105249_100918432 254
55 3300017792 Ga0163161_10525912 Ga0163161_105259121 254
56 3300025907 Ga0207645_10000239 Ga0207645_1000023921 254
57 3300025908 Ga0207643_10021888 Ga0207643_100218884 254
58 3300025923 Ga0207681_10461679 Ga0207681_104616791 254
59 3300025933 Ga0207706_10000269 Ga0207706_1000026911 254
60 3300025940 Ga0207691_10027019 Ga0207691_100270194 254
61 3300026089 Ga0207648_10006738 Ga0207648_100067383 254
62 3300026118 Ga0207675_100000241 Ga0207675_1000002415 254
63 3300027665 Ga0209983_1001937 Ga0209983_10019373 254
64 3300027682 Ga0209971_1002797 Ga0209971_10027973 254
65 3300027717 Ga0209998_10000299 Ga0209998_1000029911 254
66 3300027876 Ga0209974_10001503 Ga0209974_100015037 254
67 3300028380 Ga0268265_10043519 Ga0268265_100435192 254
68 3300050508 nmdc:mga09592_140995_c1 nmdc:mga09592_140995_c1_464_1228 254
69 3300050509 nmdc:mga0qj67_118120_c1 nmdc:mga0qj67_118120_c1_334_1098 254
70 3300050509 nmdc:mga0qj67_210864_c1 nmdc:mga0qj67_210864_c1_490_1254 254
71 3300050510 nmdc:mga06r32_270778_c1 nmdc:mga06r32_270778_c1_819_1583 254
72 3300050510 nmdc:mga06r32_77840_c1 nmdc:mga06r32_77840_c1_343_1107 254
73 3300006914 Ga0075436_100228896 Ga0075436_1002288962 255
74 3300007076 Ga0075435_100115469 Ga0075435_1001154692 255
75 3300050512 nmdc:mga0n895_209520_c1 nmdc:mga0n895_209520_c1_871_1638 255
76 3300050513 nmdc:mga0rr50_37854_c1 nmdc:mga0rr50_37854_c1_1247_2014 255
77 3300050514 nmdc:mga08x19_127169_c1 nmdc:mga08x19_127169_c1_19_786 255
78 3300050515 nmdc:mga0a205_9263_c1 nmdc:mga0a205_9263_c1_4179_4946 255
79 3300003215 JGI25153J46596_10007844 JGI25153J46596_100078442 257
80 3300025297 Ga0209758_1000453 Ga0209758_100045369 257
81 3300049649 Ga0501198_000024 Ga0501198_000024_3872_4702 257
82 3300049662 Ga0501222_000020 Ga0501222_000020_62488_63318 257
83 3300049742 Ga0501080_0421860 Ga0501080_0421860_377_1162 257
84 3300025940 Ga0207691_10605176 Ga0207691_106051761 258
85 3300049579 Ga0501043_0000002 Ga0501043_0000002_192778_193608 259
86 3300049580 Ga0501046_0000008 Ga0501046_0000008_192861_193691 259
87 3300049581 Ga0501047_0000003 Ga0501047_0000003_216043_216873 259
88 3300049582 Ga0501048_0000983 Ga0501048_0000983_16435_17265 259
89 3300049823 Ga0501044_0140116 Ga0501044_0140116_986_1816 259
90 3300049824 Ga0501045_0001581 Ga0501045_0001581_12732_13562 259
91 iso_pu_bacteria 2585428062 2587758456 259
92 iso_pu_bacteria 2643221644 2644244857 259
93 3300047443 Ga0495687_011765 Ga0495687_011765_445_1275 260
94 iso_pu_bacteria 2585428057 2587725549 260
95 iso_pu_bacteria 2588253510 2588290549 260
96 iso_pu_bacteria 2643221544 2643743655 260
97 iso_pu_bacteria 2643221585 2643936581 260
98 iso_pu_bacteria 2643221592 2643970064 260
99 iso_pu_bacteria 2643221609 2644062411 260
100 iso_pu_bacteria 2643221611 2644071323 260
101 iso_pu_bacteria 2643221625 2644142962 260
102 iso_pu_bacteria 2643221639 2644222463 260
103 iso_pu_bacteria 2643221648 2644271978 260
104 iso_pu_bacteria 2643221654 2644303283 260
105 iso_pu_bacteria 2643221656 2644317937 260
106 iso_pu_bacteria 2738541337 2739058193 260
107 iso_pu_bacteria 2738543012 2739246475 260
108 iso_pu_bacteria 2816332133 2816471139 260
109 iso_pu_bacteria 2842718218 2842718781 260
110 iso_pu_bacteria 2919704043 2919704148 260
111 iso_pu_bacteria 2939631187 2939632121 260
112 3300006042 Ga0075368_10048412 Ga0075368_100484122 261
113 3300009147 Ga0114129_10121865 Ga0114129_101218654 261
114 3300006880 Ga0075429_100025560 Ga0075429_1000255605 262
115 3300009147 Ga0114129_10114832 Ga0114129_101148325 262
116 3300027614 Ga0209970_1004215 Ga0209970_10042153 262
117 3300027665 Ga0209983_1001464 Ga0209983_10014643 262
118 3300046694 Ga0495649_0004399 Ga0495649_0004399_4949_5779 262
119 3300048927 Ga0496124_0109268 Ga0496124_0109268_624_1451 262
120 3300050508 nmdc:mga09592_76250_c1 nmdc:mga09592_76250_c1_378_1187 262
121 3300050510 nmdc:mga06r32_46479_c1 nmdc:mga06r32_46479_c1_1109_1918 262
122 iso_pu_bacteria 2721755523 2722882036 262
123 iso_pu_bacteria 2839138175 2839142545 262
124 3300002705 JGI25156J39149_1000474 JGI25156J39149_10004746 263
125 3300002741 JGI25157J39369_1000008 JGI25157J39369_1000008102 263
126 3300003316 rootH1_10046143 rootH1_100461434 263
127 3300003320 rootH2_10057619 rootH2_100576196 263
128 3300003322 rootL2_10105231 rootL2_101052312 263
129 3300003323 rootH1_10099221 rootH1_100992212 263
130 3300003323 rootH1_10111419 rootH1_101114192 263
131 3300003752 Ga0055539_1000425 Ga0055539_100042511 263
132 3300003752 Ga0055539_1000697 Ga0055539_10006974 263
133 3300003756 Ga0055533_1000040 Ga0055533_1000040145 263
134 3300003759 Ga0055525_1000566 Ga0055525_10005668 263
135 3300003761 Ga0055535_1000052 Ga0055535_100005226 263
136 3300003763 Ga0055529_1000053 Ga0055529_1000053171 263
137 3300003775 Ga0055524_1000247 Ga0055524_100024738 263
138 3300003792 Ga0055540_1000260 Ga0055540_100026016 263
139 3300003794 Ga0055531_10005151 Ga0055531_100051517 263
140 3300005327 Ga0070658_10048068 Ga0070658_100480682 263
141 3300005327 Ga0070658_10193722 Ga0070658_101937222 263
142 3300005327 Ga0070658_10256045 Ga0070658_102560451 263
143 3300005330 Ga0070690_100018751 Ga0070690_1000187512 263
144 3300005333 Ga0070677_10042789 Ga0070677_100427892 263
145 3300005334 Ga0068869_100057158 Ga0068869_1000571582 263
146 3300005338 Ga0068868_100005532 Ga0068868_1000055325 263
147 3300005339 Ga0070660_100024054 Ga0070660_1000240543 263
148 3300005344 Ga0070661_100000641 Ga0070661_10000064117 263
149 3300005354 Ga0070675_100001810 Ga0070675_1000018106 263
150 3300005354 Ga0070675_100394270 Ga0070675_1003942701 263
151 3300005364 Ga0070673_100007444 Ga0070673_1000074442 263
152 3300005364 Ga0070673_100008102 Ga0070673_1000081023 263
153 3300005365 Ga0070688_100088113 Ga0070688_1000881132 263
154 3300005366 Ga0070659_100002940 Ga0070659_10000294015 263
155 3300005367 Ga0070667_100178857 Ga0070667_1001788572 263
156 3300005457 Ga0070662_100001973 Ga0070662_10000197318 263
157 3300005457 Ga0070662_100054350 Ga0070662_1000543502 263
158 3300005466 Ga0070685_10115977 Ga0070685_101159772 263
159 3300005535 Ga0070684_100024883 Ga0070684_1000248832 263
160 3300005543 Ga0070672_100466918 Ga0070672_1004669181 263
161 3300005548 Ga0070665_100323715 Ga0070665_1003237152 263
162 3300005563 Ga0068855_100029384 Ga0068855_1000293845 263
163 3300005563 Ga0068855_100245298 Ga0068855_1002452982 263
164 3300005564 Ga0070664_100001233 Ga0070664_10000123317 263
165 3300005577 Ga0068857_100005237 Ga0068857_1000052376 263
166 3300005578 Ga0068854_100002868 Ga0068854_10000286811 263
167 3300005614 Ga0068856_100001987 Ga0068856_10000198710 263
168 3300005616 Ga0068852_100043187 Ga0068852_1000431872 263
169 3300005616 Ga0068852_100099690 Ga0068852_1000996902 263
170 3300005616 Ga0068852_100149454 Ga0068852_1001494542 263
171 3300005616 Ga0068852_100237412 Ga0068852_1002374122 263
172 3300005618 Ga0068864_100001083 Ga0068864_10000108319 263
173 3300005841 Ga0068863_100020774 Ga0068863_1000207744 263
174 3300005841 Ga0068863_100504205 Ga0068863_1005042052 263
175 3300005842 Ga0068858_100081732 Ga0068858_1000817321 263
176 3300006163 Ga0070715_10101356 Ga0070715_101013561 263
177 3300006195 Ga0075366_10010718 Ga0075366_100107184 263
178 3300006195 Ga0075366_10106828 Ga0075366_101068282 263
179 3300006237 Ga0097621_100161788 Ga0097621_1001617882 263
180 3300006237 Ga0097621_100181689 Ga0097621_1001816892 263
181 3300006353 Ga0075370_10002451 Ga0075370_100024513 263
182 3300006353 Ga0075370_10077033 Ga0075370_100770332 263
183 3300006881 Ga0068865_100051354 Ga0068865_1000513542 263
184 3300006946 Ga0079104_1000714 Ga0079104_100071412 263
185 3300009093 Ga0105240_10116664 Ga0105240_101166642 263
186 3300009098 Ga0105245_10373181 Ga0105245_103731811 263
187 3300009176 Ga0105242_10195169 Ga0105242_101951691 263
188 3300009177 Ga0105248_10062998 Ga0105248_100629982 263
189 3300009177 Ga0105248_10322965 Ga0105248_103229652 263
190 3300009551 Ga0105238_10326761 Ga0105238_103267612 263
191 3300013105 Ga0157369_10024567 Ga0157369_100245672 263
192 3300013296 Ga0157374_10214251 Ga0157374_102142512 263
193 3300013297 Ga0157378_10643519 Ga0157378_106435192 263
194 3300013308 Ga0157375_10026053 Ga0157375_100260532 263
195 3300014325 Ga0163163_10037755 Ga0163163_100377552 263
196 3300014968 Ga0157379_10040265 Ga0157379_100402652 263
197 3300025226 Ga0209674_100066 Ga0209674_10006694 263
198 3300025228 Ga0209672_106766 Ga0209672_1067661 263
199 3300025230 Ga0209563_100107 Ga0209563_10010777 263
200 3300025231 Ga0207427_100848 Ga0207427_1008486 263
201 3300025242 Ga0209258_100074 Ga0209258_100074133 263
202 3300025242 Ga0209258_101083 Ga0209258_1010833 263
203 3300025246 Ga0209646_1000039 Ga0209646_1000039155 263
204 3300025250 Ga0209026_1000006 Ga0209026_1000006446 263
205 3300025253 Ga0209677_100052 Ga0209677_10005294 263
206 3300025253 Ga0209677_100131 Ga0209677_1001316 263
207 3300025253 Ga0209677_102745 Ga0209677_1027452 263
208 3300025256 Ga0209759_1000020 Ga0209759_1000020101 263
209 3300025256 Ga0209759_1001101 Ga0209759_100110112 263
210 3300025256 Ga0209759_1001776 Ga0209759_10017765 263
211 3300025272 Ga0209455_1000066 Ga0209455_1000066173 263
212 3300025298 Ga0209050_1001662 Ga0209050_10016626 263
213 3300025298 Ga0209050_1016584 Ga0209050_10165842 263
214 3300025299 Ga0209256_1000049 Ga0209256_100004936 263
215 3300025303 Ga0209051_1000247 Ga0209051_100024716 263
216 3300025303 Ga0209051_1001846 Ga0209051_10018462 263
217 3300025303 Ga0209051_1054828 Ga0209051_10548282 263
218 3300025304 Ga0209257_1000141 Ga0209257_100014116 263
219 3300025893 Ga0207682_10044355 Ga0207682_100443552 263
220 3300025905 Ga0207685_10057319 Ga0207685_100573192 263
221 3300025909 Ga0207705_10051903 Ga0207705_100519031 263
222 3300025909 Ga0207705_10061679 Ga0207705_100616792 263
223 3300025909 Ga0207705_10152132 Ga0207705_101521322 263
224 3300025913 Ga0207695_10006803 Ga0207695_100068034 263
225 3300025919 Ga0207657_10026018 Ga0207657_100260182 263
226 3300025919 Ga0207657_10155305 Ga0207657_101553052 263
227 3300025920 Ga0207649_10000335 Ga0207649_1000033536 263
228 3300025924 Ga0207694_10032788 Ga0207694_100327883 263
229 3300025932 Ga0207690_10000176 Ga0207690_1000017645 263
230 3300025932 Ga0207690_10117344 Ga0207690_101173442 263
231 3300025933 Ga0207706_10005101 Ga0207706_100051012 263
232 3300025934 Ga0207686_10105189 Ga0207686_101051892 263
233 3300025942 Ga0207689_10007794 Ga0207689_100077946 263
234 3300025945 Ga0207679_10000168 Ga0207679_1000016831 263
235 3300025949 Ga0207667_10008762 Ga0207667_100087628 263
236 3300025949 Ga0207667_10027793 Ga0207667_100277933 263
237 3300025960 Ga0207651_10015741 Ga0207651_100157412 263
238 3300025981 Ga0207640_10004871 Ga0207640_100048712 263
239 3300025986 Ga0207658_10091760 Ga0207658_100917602 263
240 3300026035 Ga0207703_10140367 Ga0207703_101403671 263
241 3300026078 Ga0207702_10000310 Ga0207702_1000031032 263
242 3300026088 Ga0207641_10040044 Ga0207641_100400442 263
243 3300026089 Ga0207648_10189848 Ga0207648_101898482 263
244 3300026089 Ga0207648_10293309 Ga0207648_102933091 263
245 3300026116 Ga0207674_10019532 Ga0207674_100195325 263
246 3300026118 Ga0207675_100009646 Ga0207675_1000096462 263
247 3300026142 Ga0207698_10304799 Ga0207698_103047991 263
248 3300026142 Ga0207698_10542380 Ga0207698_105423801 263
249 3300027111 Ga0209281_1001190 Ga0209281_100119011 263
250 3300027876 Ga0209974_10018896 Ga0209974_100188962 263
251 3300028666 Ga0265336_10000024 Ga0265336_1000002495 263
252 3300028794 Ga0307515_10000477 Ga0307515_1000047710 263
253 3300028794 Ga0307515_10001774 Ga0307515_1000177420 263
254 3300028794 Ga0307515_10001873 Ga0307515_1000187324 263
255 3300028794 Ga0307515_10231694 Ga0307515_102316942 263
256 3300029957 Ga0265324_10000651 Ga0265324_1000065110 263
257 3300030522 Ga0307512_10062748 Ga0307512_100627482 263
258 3300031456 Ga0307513_10022921 Ga0307513_100229216 263
259 3300031616 Ga0307508_10000053 Ga0307508_1000005369 263
260 3300031616 Ga0307508_10230618 Ga0307508_102306181 263
261 3300031649 Ga0307514_10003555 Ga0307514_1000355513 263
262 3300031730 Ga0307516_10000676 Ga0307516_1000067617 263
263 3300031730 Ga0307516_10003323 Ga0307516_100033234 263
264 3300033179 Ga0307507_10166349 Ga0307507_101663492 263
265 3300035086 Ga0373934_0015566 Ga0373934_0015566_1625_2512 263
266 3300035117 Ga0373953_0110954 Ga0373953_0110954_237_1052 263
267 3300037312 Ga0395899_0047209 Ga0395899_0047209_1940_2827 263
268 3300037466 Ga0395898_0108462 Ga0395898_0108462_960_1847 263
269 3300037471 Ga0395905_0004023 Ga0395905_0004023_8072_8902 263
270 3300037471 Ga0395905_0011566 Ga0395905_0011566_1785_2627 263
271 3300037471 Ga0395905_0046448 Ga0395905_0046448_2440_3303 263
272 3300038443 Ga0395901_0068369 Ga0395901_0068369_209_1096 263
273 3300041503 Ga0451847_0578485 Ga0451847_0578485_336_1151 263
274 3300042121 Ga0450919_000354 Ga0450919_000354_13_903 263
275 3300042146 Ga0450907_015630 Ga0450907_015630_52_921 263
276 3300042531 Ga0450918_000406 Ga0450918_000406_686_1501 263
277 3300044656 Ga0466969_0019679 Ga0466969_0019679_1667_2587 263
278 3300044658 Ga0466972_0012887 Ga0466972_0012887_522_1355 263
279 3300044683 Ga0466965_0006671 Ga0466965_0006671_1373_2293 263
280 3300044684 Ga0466966_0008789 Ga0466966_0008789_3920_4840 263
281 3300044693 Ga0466961_0135237 Ga0466961_0135237_12_932 263
282 3300044706 Ga0466964_0043434 Ga0466964_0043434_86_904 263
283 3300044706 Ga0466964_0056995 Ga0466964_0056995_501_1421 263
284 3300044719 Ga0466971_0047363 Ga0466971_0047363_160_1080 263
285 3300044735 Ga0466968_0031434 Ga0466968_0031434_30_863 263
286 3300044842 Ga0466957_0019692 Ga0466957_0019692_1374_2294 263
287 3300044901 Ga0466960_0042006 Ga0466960_0042006_1202_2035 263
288 3300044901 Ga0466960_0232415 Ga0466960_0232415_35_853 263
289 3300045049 Ga0466959_0079880 Ga0466959_0079880_954_1874 263
290 3300045051 Ga0451576_0435673 Ga0451576_0435673_65_901 263
291 3300045976 Ga0466967_0184518 Ga0466967_0184518_1039_1947 263
292 3300045976 Ga0466967_0598066 Ga0466967_0598066_87_1007 263
293 3300046471 Ga0495650_0010282 Ga0495650_0010282_1511_2401 263
294 3300046506 Ga0495583_0000034 Ga0495583_0000034_39156_40046 263
295 3300046507 Ga0495606_0004244 Ga0495606_0004244_13384_14274 263
296 3300046522 Ga0495643_0051137 Ga0495643_0051137_1128_1943 263
297 3300046616 Ga0495668_0024868 Ga0495668_0024868_120_1010 263
298 3300046660 Ga0495625_0001672 Ga0495625_0001672_12519_13334 263
299 3300046660 Ga0495625_0015803 Ga0495625_0015803_4930_5820 263
300 3300046684 Ga0495669_0004642 Ga0495669_0004642_4717_5607 263
301 3300046692 Ga0495671_0091255 Ga0495671_0091255_550_1365 263
302 3300046692 Ga0495671_0156027 Ga0495671_0156027_39_929 263
303 3300046694 Ga0495649_0000324 Ga0495649_0000324_8626_9516 263
304 3300046794 Ga0495589_0098616 Ga0495589_0098616_440_1330 263
305 3300048905 Ga0496102_0001217 Ga0496102_0001217_3599_4414 263
306 3300048907 Ga0496104_0076976 Ga0496104_0076976_1083_1979 263
307 3300048911 Ga0496108_0057028 Ga0496108_0057028_2256_3170 263
308 3300048912 Ga0496109_0404843 Ga0496109_0404843_116_931 263
309 3300048917 Ga0496114_0015814 Ga0496114_0015814_949_1764 263
310 3300048917 Ga0496114_0101704 Ga0496114_0101704_1055_1870 263
311 3300050493 nmdc:mga0k408_3792_c1 nmdc:mga0k408_3792_c1_3212_4099 263
312 3300050496 nmdc:mga07m45_118303_c1 nmdc:mga07m45_118303_c1_48_863 263
313 3300050496 nmdc:mga07m45_2100_c1 nmdc:mga07m45_2100_c1_7463_8305 263
314 3300050496 nmdc:mga07m45_257_c1 nmdc:mga07m45_257_c1_7260_8144 263
315 3300053080 Ga0500635_0000008 Ga0500635_0000008_96283_97164 263
316 3300053080 Ga0500635_0016953 Ga0500635_0016953_38_928 263
317 3300053117 Ga0500593_000047 Ga0500593_000047_16801_17616 263
318 3300053134 Ga0500658_0021676 Ga0500658_0021676_211_1026 263
319 3300053177 Ga0500636_0005063 Ga0500636_0005063_5734_6624 263
320 3300053739 Ga0500587_000050 Ga0500587_000050_4548_5363 263
321 3300061719 Ga0466962_0024752 Ga0466962_0024752_1110_2030 263
322 3300002077 JGI24744J21845_10009944 JGI24744J21845_100099442 264
323 3300003322 rootL2_10068954 rootL2_100689543 264
324 3300005262 Ga0065165_1001775 Ga0065165_100177514 264
325 3300005289 Ga0065704_10083986 Ga0065704_100839862 264
326 3300005328 Ga0070676_10002205 Ga0070676_100022052 264
327 3300005331 Ga0070670_100003795 Ga0070670_1000037958 264
328 3300005331 Ga0070670_100105517 Ga0070670_1001055172 264
329 3300005334 Ga0068869_100002877 Ga0068869_1000028773 264
330 3300005334 Ga0068869_100116753 Ga0068869_1001167531 264
331 3300005335 Ga0070666_10140391 Ga0070666_101403912 264
332 3300005337 Ga0070682_100043594 Ga0070682_1000435942 264
333 3300005338 Ga0068868_100061412 Ga0068868_1000614122 264
334 3300005338 Ga0068868_100206684 Ga0068868_1002066841 264
335 3300005353 Ga0070669_100015088 Ga0070669_1000150883 264
336 3300005354 Ga0070675_100004319 Ga0070675_1000043195 264
337 3300005354 Ga0070675_100132024 Ga0070675_1001320242 264
338 3300005355 Ga0070671_100019262 Ga0070671_1000192623 264
339 3300005356 Ga0070674_100108635 Ga0070674_1001086352 264
340 3300005366 Ga0070659_100163683 Ga0070659_1001636832 264
341 3300005367 Ga0070667_100002153 Ga0070667_10000215319 264
342 3300005367 Ga0070667_100015286 Ga0070667_1000152862 264
343 3300005367 Ga0070667_100038770 Ga0070667_1000387702 264
344 3300005441 Ga0070700_100015534 Ga0070700_1000155344 264
345 3300005445 Ga0070708_100291361 Ga0070708_1002913612 264
346 3300005455 Ga0070663_100055129 Ga0070663_1000551292 264
347 3300005456 Ga0070678_100081246 Ga0070678_1000812462 264
348 3300005457 Ga0070662_100111253 Ga0070662_1001112532 264
349 3300005459 Ga0068867_100000361 Ga0068867_10000036118 264
350 3300005459 Ga0068867_100040595 Ga0068867_1000405953 264
351 3300005459 Ga0068867_100154649 Ga0068867_1001546492 264
352 3300005467 Ga0070706_100000700 Ga0070706_10000070015 264
353 3300005468 Ga0070707_100168390 Ga0070707_1001683902 264
354 3300005518 Ga0070699_100287994 Ga0070699_1002879941 264
355 3300005543 Ga0070672_100039742 Ga0070672_1000397423 264
356 3300005543 Ga0070672_100045822 Ga0070672_1000458222 264
357 3300005548 Ga0070665_100023087 Ga0070665_1000230872 264
358 3300005548 Ga0070665_100297310 Ga0070665_1002973102 264
359 3300005548 Ga0070665_100372521 Ga0070665_1003725212 264
360 3300005564 Ga0070664_100104792 Ga0070664_1001047922 264
361 3300005577 Ga0068857_100074071 Ga0068857_1000740713 264
362 3300005577 Ga0068857_100091846 Ga0068857_1000918462 264
363 3300005616 Ga0068852_100173328 Ga0068852_1001733282 264
364 3300005616 Ga0068852_100235020 Ga0068852_1002350202 264
365 3300005617 Ga0068859_100062296 Ga0068859_1000622962 264
366 3300005618 Ga0068864_100011312 Ga0068864_1000113123 264
367 3300005618 Ga0068864_100022017 Ga0068864_1000220175 264
368 3300005718 Ga0068866_10119507 Ga0068866_101195071 264
369 3300005719 Ga0068861_100000432 Ga0068861_10000043217 264
370 3300005840 Ga0068870_10033348 Ga0068870_100333482 264
371 3300005841 Ga0068863_100010775 Ga0068863_10001077512 264
372 3300005843 Ga0068860_100001815 Ga0068860_10000181518 264
373 3300005843 Ga0068860_100060541 Ga0068860_1000605412 264
374 3300005844 Ga0068862_100005522 Ga0068862_1000055227 264
375 3300005844 Ga0068862_100011728 Ga0068862_1000117289 264
376 3300005844 Ga0068862_100021433 Ga0068862_1000214331 264
377 3300005937 Ga0081455_10104159 Ga0081455_101041592 264
378 3300006038 Ga0075365_10003502 Ga0075365_100035024 264
379 3300006038 Ga0075365_10139894 Ga0075365_101398942 264
380 3300006042 Ga0075368_10001377 Ga0075368_100013774 264
381 3300006042 Ga0075368_10061110 Ga0075368_100611102 264
382 3300006048 Ga0075363_100004369 Ga0075363_1000043695 264
383 3300006051 Ga0075364_10003245 Ga0075364_100032455 264
384 3300006051 Ga0075364_10105816 Ga0075364_101058162 264
385 3300006177 Ga0075362_10010353 Ga0075362_100103532 264
386 3300006177 Ga0075362_10010485 Ga0075362_100104852 264
387 3300006177 Ga0075362_10087148 Ga0075362_100871482 264
388 3300006177 Ga0075362_10131051 Ga0075362_101310511 264
389 3300006177 Ga0075362_10229604 Ga0075362_102296041 264
390 3300006178 Ga0075367_10005203 Ga0075367_100052032 264
391 3300006178 Ga0075367_10015184 Ga0075367_100151843 264
392 3300006178 Ga0075367_10024789 Ga0075367_100247892 264
393 3300006178 Ga0075367_10039066 Ga0075367_100390662 264
394 3300006186 Ga0075369_10098265 Ga0075369_100982651 264
395 3300006195 Ga0075366_10001971 Ga0075366_100019716 264
396 3300006195 Ga0075366_10021594 Ga0075366_100215942 264
397 3300006195 Ga0075366_10031292 Ga0075366_100312922 264
398 3300006195 Ga0075366_10036943 Ga0075366_100369432 264
399 3300006195 Ga0075366_10079348 Ga0075366_100793481 264
400 3300006195 Ga0075366_10086781 Ga0075366_100867812 264
401 3300006195 Ga0075366_10094058 Ga0075366_100940582 264
402 3300006195 Ga0075366_10147127 Ga0075366_101471272 264
403 3300006195 Ga0075366_10155520 Ga0075366_101555201 264
404 3300006237 Ga0097621_100018679 Ga0097621_1000186794 264
405 3300006237 Ga0097621_100402153 Ga0097621_1004021532 264
406 3300006353 Ga0075370_10001386 Ga0075370_100013866 264
407 3300006353 Ga0075370_10007999 Ga0075370_100079992 264
408 3300006353 Ga0075370_10011111 Ga0075370_100111112 264
409 3300006353 Ga0075370_10018775 Ga0075370_100187752 264
410 3300006353 Ga0075370_10026524 Ga0075370_100265242 264
411 3300006353 Ga0075370_10045856 Ga0075370_100458562 264
412 3300006358 Ga0068871_100010307 Ga0068871_1000103072 264
413 3300006846 Ga0075430_100122047 Ga0075430_1001220472 264
414 3300006880 Ga0075429_100002595 Ga0075429_10000259513 264
415 3300006881 Ga0068865_100015222 Ga0068865_1000152222 264
416 3300006931 Ga0097620_100062296 Ga0097620_1000622962 264
417 3300009093 Ga0105240_10011702 Ga0105240_100117022 264
418 3300009093 Ga0105240_10047257 Ga0105240_100472572 264
419 3300009098 Ga0105245_10017446 Ga0105245_100174464 264
420 3300009098 Ga0105245_10539905 Ga0105245_105399052 264
421 3300009148 Ga0105243_10008363 Ga0105243_100083632 264
422 3300009148 Ga0105243_10131940 Ga0105243_101319402 264
423 3300009148 Ga0105243_10166684 Ga0105243_101666842 264
424 3300009148 Ga0105243_10224520 Ga0105243_102245202 264
425 3300009176 Ga0105242_10002298 Ga0105242_1000229811 264
426 3300009176 Ga0105242_10285201 Ga0105242_102852012 264
427 3300009545 Ga0105237_10001363 Ga0105237_1000136330 264
428 3300009545 Ga0105237_10005313 Ga0105237_100053134 264
429 3300009551 Ga0105238_10002436 Ga0105238_1000243615 264
430 3300009553 Ga0105249_10025991 Ga0105249_100259912 264
431 3300010375 Ga0105239_10000954 Ga0105239_1000095438 264
432 3300010375 Ga0105239_10032384 Ga0105239_100323842 264
433 3300012497 Ga0157319_1000003 Ga0157319_100000347 264
434 3300013296 Ga0157374_10365774 Ga0157374_103657742 264
435 3300013297 Ga0157378_10002482 Ga0157378_1000248215 264
436 3300013297 Ga0157378_10162573 Ga0157378_101625732 264
437 3300013306 Ga0163162_10001152 Ga0163162_100011523 264
438 3300013308 Ga0157375_10010232 Ga0157375_100102323 264
439 3300013308 Ga0157375_10024377 Ga0157375_100243771 264
440 3300013308 Ga0157375_10027684 Ga0157375_100276842 264
441 3300013308 Ga0157375_10326293 Ga0157375_103262932 264
442 3300014325 Ga0163163_10096037 Ga0163163_100960372 264
443 3300014326 Ga0157380_10201644 Ga0157380_102016441 264
444 3300014745 Ga0157377_10189368 Ga0157377_101893681 264
445 3300014968 Ga0157379_10080208 Ga0157379_100802082 264
446 3300014968 Ga0157379_10122780 Ga0157379_101227802 264
447 3300014968 Ga0157379_10150722 Ga0157379_101507222 264
448 3300014969 Ga0157376_10076251 Ga0157376_100762512 264
449 3300021361 Ga0213872_10000175 Ga0213872_100001758 264
450 3300021361 Ga0213872_10000735 Ga0213872_1000073514 264
451 3300021361 Ga0213872_10103969 Ga0213872_101039692 264
452 3300025245 Ga0207425_1000545 Ga0207425_100054521 264
453 3300025258 Ga0209129_1000294 Ga0209129_100029437 264
454 3300025273 Ga0209673_1007230 Ga0209673_10072304 264
455 3300025295 Ga0209564_1000003 Ga0209564_100000322 264
456 3300025295 Ga0209564_1000300 Ga0209564_100030071 264
457 3300025297 Ga0209758_1000605 Ga0209758_100060552 264
458 3300025298 Ga0209050_1001043 Ga0209050_10010432 264
459 3300025299 Ga0209256_1000150 Ga0209256_10001507 264
460 3300025303 Ga0209051_1011161 Ga0209051_10111613 264
461 3300025304 Ga0209257_1000318 Ga0209257_100031893 264
462 3300025893 Ga0207682_10037579 Ga0207682_100375792 264
463 3300025907 Ga0207645_10002245 Ga0207645_1000224514 264
464 3300025908 Ga0207643_10088422 Ga0207643_100884222 264
465 3300025910 Ga0207684_10020637 Ga0207684_100206373 264
466 3300025913 Ga0207695_10168773 Ga0207695_101687732 264
467 3300025914 Ga0207671_10006342 Ga0207671_100063424 264
468 3300025914 Ga0207671_10029236 Ga0207671_100292364 264
469 3300025924 Ga0207694_10137473 Ga0207694_101374732 264
470 3300025925 Ga0207650_10002178 Ga0207650_1000217813 264
471 3300025925 Ga0207650_10017432 Ga0207650_100174323 264
472 3300025926 Ga0207659_10119494 Ga0207659_101194942 264
473 3300025926 Ga0207659_10286481 Ga0207659_102864811 264
474 3300025927 Ga0207687_10006568 Ga0207687_100065682 264
475 3300025927 Ga0207687_10273821 Ga0207687_102738212 264
476 3300025931 Ga0207644_10016858 Ga0207644_100168582 264
477 3300025932 Ga0207690_10093091 Ga0207690_100930912 264
478 3300025933 Ga0207706_10204919 Ga0207706_102049192 264
479 3300025935 Ga0207709_10012031 Ga0207709_100120313 264
480 3300025935 Ga0207709_10099526 Ga0207709_100995262 264
481 3300025937 Ga0207669_10027794 Ga0207669_100277942 264
482 3300025940 Ga0207691_10007606 Ga0207691_100076069 264
483 3300025940 Ga0207691_10103118 Ga0207691_101031182 264
484 3300025942 Ga0207689_10011133 Ga0207689_100111335 264
485 3300025942 Ga0207689_10113104 Ga0207689_101131041 264
486 3300025945 Ga0207679_10118750 Ga0207679_101187502 264
487 3300025960 Ga0207651_10004284 Ga0207651_100042843 264
488 3300025981 Ga0207640_10126666 Ga0207640_101266662 264
489 3300025986 Ga0207658_10001079 Ga0207658_100010794 264
490 3300026023 Ga0207677_10041675 Ga0207677_100416752 264
491 3300026023 Ga0207677_10144971 Ga0207677_101449712 264
492 3300026023 Ga0207677_10370976 Ga0207677_103709761 264
493 3300026041 Ga0207639_10502004 Ga0207639_105020042 264
494 3300026067 Ga0207678_10031607 Ga0207678_100316075 264
495 3300026075 Ga0207708_10044187 Ga0207708_100441872 264
496 3300026088 Ga0207641_10009800 Ga0207641_1000980011 264
497 3300026088 Ga0207641_10323502 Ga0207641_103235021 264
498 3300026089 Ga0207648_10000393 Ga0207648_1000039343 264
499 3300026089 Ga0207648_10048470 Ga0207648_100484703 264
500 3300026089 Ga0207648_10234015 Ga0207648_102340152 264
501 3300026095 Ga0207676_10014656 Ga0207676_100146566 264
502 3300026095 Ga0207676_10051117 Ga0207676_100511173 264
503 3300026116 Ga0207674_10008702 Ga0207674_100087028 264
504 3300026116 Ga0207674_10070363 Ga0207674_100703632 264
505 3300026118 Ga0207675_100001788 Ga0207675_10000178819 264
506 3300026121 Ga0207683_10026363 Ga0207683_100263633 264
507 3300026121 Ga0207683_10190003 Ga0207683_101900032 264
508 3300026142 Ga0207698_10230812 Ga0207698_102308122 264
509 3300026142 Ga0207698_10409876 Ga0207698_104098761 264
510 3300027526 Ga0209968_1001023 Ga0209968_10010232 264
511 3300027614 Ga0209970_1000068 Ga0209970_10000685 264
512 3300027695 Ga0209966_1000035 Ga0209966_100003547 264
513 3300027866 Ga0209813_10002804 Ga0209813_100028042 264
514 3300028379 Ga0268266_10016016 Ga0268266_100160167 264
515 3300028379 Ga0268266_10297747 Ga0268266_102977471 264
516 3300028380 Ga0268265_10021206 Ga0268265_100212062 264
517 3300028380 Ga0268265_10042503 Ga0268265_100425032 264
518 3300028381 Ga0268264_10009229 Ga0268264_100092292 264
519 3300028786 Ga0307517_10063967 Ga0307517_100639672 264
520 3300028786 Ga0307517_10157710 Ga0307517_101577102 264
521 3300028794 Ga0307515_10018010 Ga0307515_100180108 264
522 3300028794 Ga0307515_10052957 Ga0307515_100529574 264
523 3300028794 Ga0307515_10071375 Ga0307515_100713752 264
524 3300028794 Ga0307515_10216759 Ga0307515_102167592 264
525 3300030522 Ga0307512_10023350 Ga0307512_100233504 264
526 3300030522 Ga0307512_10112528 Ga0307512_101125281 264
527 3300031235 Ga0265330_10000046 Ga0265330_1000004658 264
528 3300031238 Ga0265332_10000028 Ga0265332_1000002855 264
529 3300031239 Ga0265328_10026430 Ga0265328_100264302 264
530 3300031247 Ga0265340_10040751 Ga0265340_100407512 264
531 3300031250 Ga0265331_10012894 Ga0265331_100128942 264
532 3300031251 Ga0265327_10000042 Ga0265327_10000042180 264
533 3300031251 Ga0265327_10000419 Ga0265327_100004196 264
534 3300031344 Ga0265316_10000332 Ga0265316_1000033241 264
535 3300031456 Ga0307513_10011506 Ga0307513_100115063 264
536 3300031507 Ga0307509_10000063 Ga0307509_1000006391 264
537 3300031507 Ga0307509_10005231 Ga0307509_100052318 264
538 3300031507 Ga0307509_10018876 Ga0307509_100188767 264
539 3300031507 Ga0307509_10050207 Ga0307509_100502072 264
540 3300031548 Ga0307408_100000029 Ga0307408_10000002998 264
541 3300031548 Ga0307408_100105449 Ga0307408_1001054492 264
542 3300031616 Ga0307508_10000109 Ga0307508_1000010910 264
543 3300031616 Ga0307508_10037138 Ga0307508_100371383 264
544 3300031616 Ga0307508_10129989 Ga0307508_101299892 264
545 3300031711 Ga0265314_10000054 Ga0265314_1000005455 264
546 3300031730 Ga0307516_10042443 Ga0307516_100424434 264
547 3300031730 Ga0307516_10205000 Ga0307516_102050002 264
548 3300031911 Ga0307412_10091723 Ga0307412_100917232 264
549 3300032004 Ga0307414_10125240 Ga0307414_101252402 264
550 3300032005 Ga0307411_10000099 Ga0307411_100000996 264
551 3300033179 Ga0307507_10194813 Ga0307507_101948132 264
552 3300033180 Ga0307510_10006488 Ga0307510_100064883 264
553 3300033180 Ga0307510_10081052 Ga0307510_100810522 264
554 3300033180 Ga0307510_10126918 Ga0307510_101269182 264
555 3300033180 Ga0307510_10136225 Ga0307510_101362252 264
556 3300034820 Ga0373959_0006759 Ga0373959_0006759_118_936 264
557 3300035091 Ga0373951_0016550 Ga0373951_0016550_83_901 264
558 3300035114 Ga0373939_0000012 Ga0373939_0000012_59688_60506 264
559 3300035121 Ga0373960_0008082 Ga0373960_0008082_254_1072 264
560 3300035691 Ga0373931_0000235 Ga0373931_0000235_2693_3511 264
561 3300035691 Ga0373931_0001846 Ga0373931_0001846_5151_6065 264
562 3300035691 Ga0373931_0005977 Ga0373931_0005977_2682_3629 264
563 3300037068 Ga0373925_0317765 Ga0373925_0317765_199_1014 264
564 3300037418 Ga0395900_0000183 Ga0395900_0000183_6924_7763 264
565 3300037418 Ga0395900_0352392 Ga0395900_0352392_81_923 264
566 3300037466 Ga0395898_0002107 Ga0395898_0002107_5835_6674 264
567 3300037466 Ga0395898_0324776 Ga0395898_0324776_84_917 264
568 3300037471 Ga0395905_0000805 Ga0395905_0000805_27935_28753 264
569 3300037471 Ga0395905_0004208 Ga0395905_0004208_1142_1975 264
570 3300039447 Ga0436361_0027820 Ga0436361_0027820_266_1096 264
571 3300039447 Ga0436361_0105405 Ga0436361_0105405_3333_4148 264
572 3300039447 Ga0436361_0491913 Ga0436361_0491913_3832_4674 264
573 3300039447 Ga0436361_1221151 Ga0436361_1221151_1565_2407 264
574 3300041408 Ga0439453_0028120 Ga0439453_0028120_22_858 264
575 3300041997 Ga0439431_0001954 Ga0439431_0001954_2007_2834 264
576 3300042004 Ga0439445_0014021 Ga0439445_0014021_280_1095 264
577 3300042115 Ga0450911_000351 Ga0450911_000351_4154_4969 264
578 3300042119 Ga0450915_000577 Ga0450915_000577_229_1047 264
579 3300042120 Ga0450917_000046 Ga0450917_000046_1242_2060 264
580 3300042126 Ga0450888_000419 Ga0450888_000419_1479_2297 264
581 3300042127 Ga0450890_000389 Ga0450890_000389_3330_4181 264
582 3300042127 Ga0450890_008313 Ga0450890_008313_341_1159 264
583 3300042129 Ga0450891_000914 Ga0450891_000914_184_1002 264
584 3300042138 Ga0450903_003345 Ga0450903_003345_1772_2590 264
585 3300042157 Ga0439458_0013278 Ga0439458_0013278_620_1447 264
586 3300042435 Ga0439434_0021932 Ga0439434_0021932_920_1747 264
587 3300042435 Ga0439434_0033674 Ga0439434_0033674_663_1493 264
588 3300042438 Ga0439459_0031306 Ga0439459_0031306_174_992 264
589 3300042530 Ga0450916_000613 Ga0450916_000613_557_1375 264
590 3300042876 Ga0451577_0003091 Ga0451577_0003091_9918_10748 264
591 3300042876 Ga0451577_0011731 Ga0451577_0011731_5356_6201 264
592 3300042876 Ga0451577_0167433 Ga0451577_0167433_472_1290 264
593 3300044656 Ga0466969_0000020 Ga0466969_0000020_53658_54488 264
594 3300044658 Ga0466972_0017534 Ga0466972_0017534_2108_2932 264
595 3300044683 Ga0466965_0057642 Ga0466965_0057642_477_1301 264
596 3300044683 Ga0466965_0070808 Ga0466965_0070808_471_1295 264
597 3300044683 Ga0466965_0285624 Ga0466965_0285624_20_850 264
598 3300044684 Ga0466966_0003281 Ga0466966_0003281_5769_6623 264
599 3300044684 Ga0466966_0027606 Ga0466966_0027606_964_1794 264
600 3300044693 Ga0466961_0019410 Ga0466961_0019410_2733_3587 264
601 3300044693 Ga0466961_0037440 Ga0466961_0037440_239_1069 264
602 3300044706 Ga0466964_0003293 Ga0466964_0003293_3565_4419 264
603 3300044719 Ga0466971_0033639 Ga0466971_0033639_1137_1991 264
604 3300044765 Ga0466970_0050042 Ga0466970_0050042_852_1706 264
605 3300044901 Ga0466960_0016831 Ga0466960_0016831_1437_2261 264
606 3300045049 Ga0466959_0000424 Ga0466959_0000424_14618_15472 264
607 3300045049 Ga0466959_0087107 Ga0466959_0087107_824_1654 264
608 3300045051 Ga0451576_0134961 Ga0451576_0134961_1554_2555 264
609 3300045836 Ga0466958_0262389 Ga0466958_0262389_161_991 264
610 3300045976 Ga0466967_0007150 Ga0466967_0007150_334_1188 264
611 3300045976 Ga0466967_0215366 Ga0466967_0215366_305_1174 264
612 3300046457 Ga0495590_0052281 Ga0495590_0052281_55_870 264
613 3300046460 Ga0495638_0214307 Ga0495638_0214307_113_928 264
614 3300046474 Ga0495605_0132957 Ga0495605_0132957_149_964 264
615 3300046492 Ga0495585_0010595 Ga0495585_0010595_3241_4143 264
616 3300046512 Ga0495610_0054381 Ga0495610_0054381_494_1309 264
617 3300046518 Ga0495631_0067422 Ga0495631_0067422_202_1017 264
618 3300046519 Ga0495632_0003922 Ga0495632_0003922_2549_3382 264
619 3300046519 Ga0495632_0012106 Ga0495632_0012106_3640_4455 264
620 3300046542 Ga0495597_0016564 Ga0495597_0016564_1019_1834 264
621 3300046542 Ga0495597_0053924 Ga0495597_0053924_733_1548 264
622 3300046616 Ga0495668_0053052 Ga0495668_0053052_959_1774 264
623 3300046660 Ga0495625_0017804 Ga0495625_0017804_3048_3863 264
624 3300046660 Ga0495625_0147050 Ga0495625_0147050_447_1262 264
625 3300046665 Ga0495661_0000223 Ga0495661_0000223_29177_29989 264
626 3300046692 Ga0495671_0031717 Ga0495671_0031717_1861_2691 264
627 3300046692 Ga0495671_0114036 Ga0495671_0114036_107_922 264
628 3300046694 Ga0495649_0000671 Ga0495649_0000671_374_1189 264
629 3300047443 Ga0495687_001419 Ga0495687_001419_4680_5495 264
630 3300047443 Ga0495687_013134 Ga0495687_013134_2819_3634 264
631 3300047469 Ga0495673_0077964 Ga0495673_0077964_178_993 264
632 3300047471 Ga0495684_0139253 Ga0495684_0139253_634_1449 264
633 3300048091 Ga0495626_0041866 Ga0495626_0041866_788_1603 264
634 3300048905 Ga0496102_0023496 Ga0496102_0023496_4308_5135 264
635 3300048912 Ga0496109_0347864 Ga0496109_0347864_191_1030 264
636 3300048913 Ga0496110_0001725 Ga0496110_0001725_9785_10636 264
637 3300048924 Ga0496121_0012277 Ga0496121_0012277_8409_9224 264
638 3300048924 Ga0496121_0012411 Ga0496121_0012411_4017_4850 264
639 3300048926 Ga0496123_0034818 Ga0496123_0034818_1182_1997 264
640 3300048927 Ga0496124_0000108 Ga0496124_0000108_148643_149476 264
641 3300048927 Ga0496124_0019272 Ga0496124_0019272_3969_4820 264
642 3300048927 Ga0496124_0023176 Ga0496124_0023176_4292_5107 264
643 3300048928 Ga0496125_0001189 Ga0496125_0001189_19457_20272 264
644 3300048928 Ga0496125_0006406 Ga0496125_0006406_3803_4618 264
645 3300048928 Ga0496125_0022269 Ga0496125_0022269_3249_4064 264
646 3300048928 Ga0496125_0023763 Ga0496125_0023763_3682_4515 264
647 3300048928 Ga0496125_0096368 Ga0496125_0096368_10_825 264
648 3300048929 Ga0496126_0001477 Ga0496126_0001477_6410_7225 264
649 3300049517 Ga0501294_004908 Ga0501294_004908_378_1196 264
650 3300049652 Ga0501202_004215 Ga0501202_004215_292_1110 264
651 3300049662 Ga0501222_005361 Ga0501222_005361_524_1342 264
652 3300049663 Ga0501223_035016 Ga0501223_035016_11_829 264
653 3300049668 Ga0501233_014551 Ga0501233_014551_357_1175 264
654 3300049669 Ga0501235_007166 Ga0501235_007166_870_1688 264
655 3300049684 Ga0501255_001464 Ga0501255_001464_243_1061 264
656 3300049704 Ga0501221_002008 Ga0501221_002008_1203_2021 264
657 3300049706 Ga0501229_000186 Ga0501229_000186_1296_2114 264
658 3300049763 Ga0501266_000075 Ga0501266_000075_929_1741 264
659 3300050489 nmdc:mga03683_29418_c1 nmdc:mga03683_29418_c1_309_1124 264
660 3300050489 nmdc:mga03683_40775_c1 nmdc:mga03683_40775_c1_807_1622 264
661 3300050489 nmdc:mga03683_98275_c1 nmdc:mga03683_98275_c1_108_923 264
662 3300050491 nmdc:mga00v17_6284_c1 nmdc:mga00v17_6284_c1_2433_3248 264
663 3300050491 nmdc:mga00v17_8113_c1 nmdc:mga00v17_8113_c1_833_1648 264
664 3300050492 nmdc:mga0yw44_26115_c1 nmdc:mga0yw44_26115_c1_2209_3024 264
665 3300050493 nmdc:mga0k408_124890_c1 nmdc:mga0k408_124890_c1_234_1064 264
666 3300050493 nmdc:mga0k408_131034_c1 nmdc:mga0k408_131034_c1_425_1240 264
667 3300050493 nmdc:mga0k408_1570_c1 nmdc:mga0k408_1570_c1_10564_11379 264
668 3300050493 nmdc:mga0k408_213_c1 nmdc:mga0k408_213_c1_26254_27069 264
669 3300050493 nmdc:mga0k408_2767_c1 nmdc:mga0k408_2767_c1_4993_5808 264
670 3300050493 nmdc:mga0k408_302_c1 nmdc:mga0k408_302_c1_11793_12608 264
671 3300050493 nmdc:mga0k408_31417_c1 nmdc:mga0k408_31417_c1_1620_2438 264
672 3300050493 nmdc:mga0k408_83946_c1 nmdc:mga0k408_83946_c1_798_1613 264
673 3300050494 nmdc:mga06z11_155652_c1 nmdc:mga06z11_155652_c1_21_836 264
674 3300050494 nmdc:mga06z11_199777_c1 nmdc:mga06z11_199777_c1_16_834 264
675 3300050494 nmdc:mga06z11_27335_c1 nmdc:mga06z11_27335_c1_1186_2001 264
676 3300050494 nmdc:mga06z11_83057_c1 nmdc:mga06z11_83057_c1_632_1447 264
677 3300050496 nmdc:mga07m45_11126_c1 nmdc:mga07m45_11126_c1_3672_4523 264
678 3300050496 nmdc:mga07m45_1209_c1 nmdc:mga07m45_1209_c1_3423_4238 264
679 3300050496 nmdc:mga07m45_1376_c1 nmdc:mga07m45_1376_c1_8781_9596 264
680 3300050496 nmdc:mga07m45_15735_c1 nmdc:mga07m45_15735_c1_808_1623 264
681 3300050496 nmdc:mga07m45_18652_c1 nmdc:mga07m45_18652_c1_234_1052 264
682 3300050496 nmdc:mga07m45_270029_c1 nmdc:mga07m45_270029_c1_75_890 264
683 3300050496 nmdc:mga07m45_3296_c1 nmdc:mga07m45_3296_c1_1738_2556 264
684 3300050496 nmdc:mga07m45_869_c1 nmdc:mga07m45_869_c1_8739_9554 264
685 3300050508 nmdc:mga09592_25627_c1 nmdc:mga09592_25627_c1_1437_2267 264
686 3300050516 nmdc:mga0sz30_8224_c1 nmdc:mga0sz30_8224_c1_2113_2928 264
687 3300053086 Ga0500578_0000025 Ga0500578_0000025_58622_59455 264
688 3300053086 Ga0500578_0014283 Ga0500578_0014283_1046_1861 264
689 3300053086 Ga0500578_0090581 Ga0500578_0090581_40_855 264
690 3300053088 Ga0500644_0023781 Ga0500644_0023781_982_1797 264
691 3300053092 Ga0500583_0048284 Ga0500583_0048284_1031_1846 264
692 3300053093 Ga0500651_0061141 Ga0500651_0061141_1273_2088 264
693 3300053118 Ga0500594_0000969 Ga0500594_0000969_251_1066 264
694 3300053130 Ga0500642_0030457 Ga0500642_0030457_429_1256 264
695 3300053131 Ga0500652_000682 Ga0500652_000682_2428_3261 264
696 3300053133 Ga0500655_006155 Ga0500655_006155_87_920 264
697 3300053134 Ga0500658_0001671 Ga0500658_0001671_3079_3894 264
698 3300053134 Ga0500658_0092454 Ga0500658_0092454_216_1049 264
699 3300053136 Ga0500559_0000013 Ga0500559_0000013_117585_118400 264
700 3300053156 Ga0500622_0000087 Ga0500622_0000087_85605_86438 264
701 3300053156 Ga0500622_0002441 Ga0500622_0002441_6798_7649 264
702 3300053156 Ga0500622_0005795 Ga0500622_0005795_1683_2498 264
703 3300053160 Ga0500633_0091737 Ga0500633_0091737_125_940 264
704 3300053177 Ga0500636_0030670 Ga0500636_0030670_556_1371 264
705 3300053730 Ga0500645_001614 Ga0500645_001614_6390_7292 264
706 3300053739 Ga0500587_000704 Ga0500587_000704_2972_3787 264
707 3300061719 Ga0466962_0021520 Ga0466962_0021520_1518_2372 264
708 3300061719 Ga0466962_0092207 Ga0466962_0092207_71_901 264
709 iso_pu_bacteria 2585428058 2587735017 264
710 3300005456 Ga0070678_100414386 Ga0070678_1004143862 265
711 3300009011 Ga0105251_10028894 Ga0105251_100288942 265
712 3300009092 Ga0105250_10028986 Ga0105250_100289862 265
713 3300013306 Ga0163162_10030246 Ga0163162_100302462 265
714 3300013308 Ga0157375_10011836 Ga0157375_100118366 265
715 3300021361 Ga0213872_10000006 Ga0213872_1000000610 265
716 3300025711 Ga0207696_1030321 Ga0207696_10303212 265
717 3300025941 Ga0207711_10007438 Ga0207711_100074386 265
718 3300026067 Ga0207678_10034740 Ga0207678_100347402 265
719 3300039447 Ga0436361_0169339 Ga0436361_0169339_16169_17032 265
720 3300046460 Ga0495638_0012776 Ga0495638_0012776_444_1274 265
721 3300046471 Ga0495650_0001952 Ga0495650_0001952_3329_4150 265
722 3300046474 Ga0495605_0002292 Ga0495605_0002292_3020_3850 265
723 3300046492 Ga0495585_0079639 Ga0495585_0079639_755_1585 265
724 3300046691 Ga0495670_0142712 Ga0495670_0142712_35_865 265
725 3300046794 Ga0495589_0149981 Ga0495589_0149981_36_968 265
726 3300048910 Ga0496107_0070361 Ga0496107_0070361_200_1030 265
727 3300005289 Ga0065704_10122127 Ga0065704_101221272 266
728 3300006946 Ga0079104_1000055 Ga0079104_100005592 266
729 3300009092 Ga0105250_10000934 Ga0105250_1000093412 266
730 3300009148 Ga0105243_10010416 Ga0105243_100104165 266
731 3300025711 Ga0207696_1002314 Ga0207696_10023142 266
732 3300025935 Ga0207709_10000728 Ga0207709_100007286 266
733 3300027111 Ga0209281_1000007 Ga0209281_1000007737 266
734 3300005544 Ga0070686_100200796 Ga0070686_1002007962 267
735 3300035119 Ga0373956_0033580 Ga0373956_0033580_702_1517 267
736 3300035172 Ga0373955_0071786 Ga0373955_0071786_1051_1866 267
737 3300005365 Ga0070688_100322378 Ga0070688_1003223781 268
738 3300005444 Ga0070694_100112910 Ga0070694_1001129101 268
739 3300005444 Ga0070694_100147173 Ga0070694_1001471732 268
740 3300005444 Ga0070694_100623131 Ga0070694_1006231311 268
741 3300005471 Ga0070698_100021426 Ga0070698_1000214266 268
742 3300005544 Ga0070686_100124691 Ga0070686_1001246912 268
743 3300005549 Ga0070704_100015068 Ga0070704_1000150683 268
744 3300006844 Ga0075428_100055238 Ga0075428_1000552384 268
745 3300006846 Ga0075430_100369170 Ga0075430_1003691702 268
746 3300006847 Ga0075431_100007163 Ga0075431_1000071638 268
747 3300006847 Ga0075431_100096050 Ga0075431_1000960504 268
748 3300006871 Ga0075434_100387249 Ga0075434_1003872492 268
749 3300007076 Ga0075435_100034464 Ga0075435_1000344643 268
750 3300007076 Ga0075435_100103511 Ga0075435_1001035114 268
751 3300009147 Ga0114129_10088714 Ga0114129_100887143 268
752 3300025922 Ga0207646_10532955 Ga0207646_105329551 268
753 3300045051 Ga0451576_0078392 Ga0451576_0078392_1213_2019 268
754 3300050507 nmdc:mga05p37_1554_c1 nmdc:mga05p37_1554_c1_3788_4594 268
755 3300050508 nmdc:mga09592_357_c1 nmdc:mga09592_357_c1_23006_23812 268
756 3300050510 nmdc:mga06r32_18169_c1 nmdc:mga06r32_18169_c1_3617_4423 268
757 3300050511 nmdc:mga08y16_249543_c1 nmdc:mga08y16_249543_c1_682_1488 268
758 3300050513 nmdc:mga0rr50_89493_c1 nmdc:mga0rr50_89493_c1_945_1751 268
759 3300050515 nmdc:mga0a205_137891_c1 nmdc:mga0a205_137891_c1_211_1017 268
760 3300050515 nmdc:mga0a205_320677_c1 nmdc:mga0a205_320677_c1_172_978 268
761 3300005336 Ga0070680_100363684 Ga0070680_1003636841 269
762 3300005440 Ga0070705_100126710 Ga0070705_1001267102 269
763 3300005444 Ga0070694_100001590 Ga0070694_10000159011 269
764 3300005444 Ga0070694_100251484 Ga0070694_1002514842 269
765 3300005544 Ga0070686_100373077 Ga0070686_1003730772 269
766 3300005545 Ga0070695_100004255 Ga0070695_1000042556 269
767 3300005549 Ga0070704_100011971 Ga0070704_1000119712 269
768 3300005549 Ga0070704_100179843 Ga0070704_1001798432 269
769 3300005617 Ga0068859_100069882 Ga0068859_1000698824 269
770 3300006852 Ga0075433_10005939 Ga0075433_100059396 269
771 3300006931 Ga0097620_100069882 Ga0097620_1000698824 269
772 3300009176 Ga0105242_10008113 Ga0105242_100081135 269
773 3300025934 Ga0207686_10014921 Ga0207686_100149213 269
774 3300025935 Ga0207709_10579633 Ga0207709_105796331 269
775 3300031665 Ga0316575_10003572 Ga0316575_100035724 269
776 3300031691 Ga0316579_10001228 Ga0316579_100012289 269
777 3300031728 Ga0316578_10007343 Ga0316578_100073432 269
778 3300032133 Ga0316583_10000892 Ga0316583_1000089210 269
779 3300032133 Ga0316583_10003087 Ga0316583_100030874 269
780 3300035113 Ga0373936_0052765 Ga0373936_0052765_612_1421 269
781 3300035118 Ga0373954_0000014 Ga0373954_0000014_43761_44570 269
782 3300035398 Ga0316574_0118606 Ga0316574_0118606_379_1188 269
783 3300035691 Ga0373931_0043878 Ga0373931_0043878_341_1150 269
784 3300035724 Ga0373933_0012021 Ga0373933_0012021_500_1309 269
785 3300035724 Ga0373933_0099713 Ga0373933_0099713_523_1332 269
786 3300036401 Ga0373937_0000218 Ga0373937_0000218_12202_13011 269
787 3300036401 Ga0373937_0039513 Ga0373937_0039513_3291_4100 269
788 3300036401 Ga0373937_0243575 Ga0373937_0243575_141_1004 269
789 3300036647 Ga0316582_0001739 Ga0316582_0001739_6119_6928 269
790 3300036712 Ga0316584_0066683 Ga0316584_0066683_873_1682 269
791 3300037588 Ga0316581_0008060 Ga0316581_0008060_736_1545 269
792 3300046683 Ga0495658_0073124 Ga0495658_0073124_35_889 269
793 3300049568 Ga0501031_0074212 Ga0501031_0074212_38_847 269
794 3300049570 Ga0501033_0056527 Ga0501033_0056527_1797_2609 269
795 3300049572 Ga0501036_0056015 Ga0501036_0056015_361_1170 269
796 3300049573 Ga0501037_0281425 Ga0501037_0281425_160_969 269
797 3300049574 Ga0501038_0035777 Ga0501038_0035777_1176_1988 269
798 3300049575 Ga0501039_0018752 Ga0501039_0018752_3089_3901 269
799 3300049576 Ga0501040_0024046 Ga0501040_0024046_400_1212 269
800 3300049577 Ga0501041_0244979 Ga0501041_0244979_178_990 269
801 3300049580 Ga0501046_0196977 Ga0501046_0196977_237_1046 269
802 3300049582 Ga0501048_0086449 Ga0501048_0086449_905_1717 269
803 3300049588 Ga0501072_0179833 Ga0501072_0179833_649_1479 269
804 3300049591 Ga0501075_0184131 Ga0501075_0184131_198_1007 269
805 3300049593 Ga0501077_0131892 Ga0501077_0131892_666_1475 269
806 3300049741 Ga0501079_0156374 Ga0501079_0156374_546_1355 269
807 3300049743 Ga0501081_0031033 Ga0501081_0031033_749_1558 269
808 3300049822 Ga0501035_0510410 Ga0501035_0510410_57_866 269
809 3300049824 Ga0501045_0090202 Ga0501045_0090202_1146_1958 269
810 3300050514 nmdc:mga08x19_24472_c1 nmdc:mga08x19_24472_c1_2526_3335 269
811 3300060353 Ga0501082_0022351 Ga0501082_0022351_3170_3979 269
812 3300005549 Ga0070704_100268615 Ga0070704_1002686151 270
813 3300035092 Ga0373952_0001055 Ga0373952_0001055_4051_4863 270
814 3300035207 Ga0373942_0104615 Ga0373942_0104615_22_834 270
815 3300037466 Ga0395898_0021926 Ga0395898_0021926_210_1046 270
816 3300038443 Ga0395901_0178882 Ga0395901_0178882_404_1240 270
817 3300045051 Ga0451576_0036167 Ga0451576_0036167_2939_3838 270
818 3300049573 Ga0501037_0356111 Ga0501037_0356111_50_886 270
819 3300005327 Ga0070658_10002808 Ga0070658_1000280812 271
820 3300005329 Ga0070683_100034664 Ga0070683_1000346645 271
821 3300005330 Ga0070690_100250778 Ga0070690_1002507782 271
822 3300005336 Ga0070680_100008477 Ga0070680_1000084772 271
823 3300005340 Ga0070689_100010914 Ga0070689_1000109147 271
824 3300005340 Ga0070689_100303737 Ga0070689_1003037371 271
825 3300005354 Ga0070675_100026872 Ga0070675_1000268723 271
826 3300005367 Ga0070667_100243970 Ga0070667_1002439703 271
827 3300005436 Ga0070713_100019399 Ga0070713_1000193992 271
828 3300005445 Ga0070708_100617770 Ga0070708_1006177701 271
829 3300005456 Ga0070678_100036527 Ga0070678_1000365273 271
830 3300005456 Ga0070678_100302711 Ga0070678_1003027111 271
831 3300005458 Ga0070681_10018158 Ga0070681_100181589 271
832 3300005467 Ga0070706_100124278 Ga0070706_1001242782 271
833 3300005467 Ga0070706_100394299 Ga0070706_1003942992 271
834 3300005471 Ga0070698_100003213 Ga0070698_10000321316 271
835 3300005518 Ga0070699_100094302 Ga0070699_1000943023 271
836 3300005530 Ga0070679_100003097 Ga0070679_10000309711 271
837 3300005535 Ga0070684_100033679 Ga0070684_1000336795 271
838 3300005539 Ga0068853_100240125 Ga0068853_1002401252 271
839 3300005543 Ga0070672_100184205 Ga0070672_1001842052 271
840 3300005548 Ga0070665_100018865 Ga0070665_1000188652 271
841 3300005548 Ga0070665_100083744 Ga0070665_1000837442 271
842 3300005548 Ga0070665_100288758 Ga0070665_1002887583 271
843 3300005563 Ga0068855_100020041 Ga0068855_1000200415 271
844 3300005563 Ga0068855_100461598 Ga0068855_1004615982 271
845 3300005564 Ga0070664_100204848 Ga0070664_1002048481 271
846 3300005614 Ga0068856_100034640 Ga0068856_1000346402 271
847 3300005616 Ga0068852_100042700 Ga0068852_1000427003 271
848 3300005843 Ga0068860_100823767 Ga0068860_1008237671 271
849 3300005844 Ga0068862_100131676 Ga0068862_1001316761 271
850 3300005937 Ga0081455_10001851 Ga0081455_100018518 271
851 3300005937 Ga0081455_10002478 Ga0081455_1000247819 271
852 3300005937 Ga0081455_10007317 Ga0081455_1000731710 271
853 3300005985 Ga0081539_10001293 Ga0081539_1000129311 271
854 3300005985 Ga0081539_10007008 Ga0081539_100070087 271
855 3300006038 Ga0075365_10073341 Ga0075365_100733411 271
856 3300006051 Ga0075364_10207427 Ga0075364_102074271 271
857 3300006051 Ga0075364_10280762 Ga0075364_102807622 271
858 3300006175 Ga0070712_100121184 Ga0070712_1001211842 271
859 3300006177 Ga0075362_10052153 Ga0075362_100521531 271
860 3300006177 Ga0075362_10052751 Ga0075362_100527512 271
861 3300006177 Ga0075362_10203717 Ga0075362_102037172 271
862 3300006178 Ga0075367_10035949 Ga0075367_100359492 271
863 3300006186 Ga0075369_10007032 Ga0075369_100070325 271
864 3300006186 Ga0075369_10049913 Ga0075369_100499132 271
865 3300006186 Ga0075369_10135117 Ga0075369_101351172 271
866 3300006195 Ga0075366_10018528 Ga0075366_100185285 271
867 3300006237 Ga0097621_100560588 Ga0097621_1005605881 271
868 3300006353 Ga0075370_10010161 Ga0075370_100101613 271
869 3300006844 Ga0075428_100236770 Ga0075428_1002367702 271
870 3300007265 Ga0099794_10043244 Ga0099794_100432443 271
871 3300007265 Ga0099794_10086157 Ga0099794_100861572 271
872 3300009093 Ga0105240_10010321 Ga0105240_100103212 271
873 3300009148 Ga0105243_10342764 Ga0105243_103427642 271
874 3300009177 Ga0105248_10447694 Ga0105248_104476942 271
875 3300009545 Ga0105237_10570635 Ga0105237_105706351 271
876 3300009551 Ga0105238_10036475 Ga0105238_100364752 271
877 3300012497 Ga0157319_1000452 Ga0157319_10004522 271
878 3300013102 Ga0157371_10029522 Ga0157371_100295225 271
879 3300013105 Ga0157369_10304604 Ga0157369_103046041 271
880 3300013296 Ga0157374_10422996 Ga0157374_104229962 271
881 3300013307 Ga0157372_10384819 Ga0157372_103848192 271
882 3300014497 Ga0182008_10038919 Ga0182008_100389192 271
883 3300014968 Ga0157379_10127214 Ga0157379_101272143 271
884 3300014969 Ga0157376_10420785 Ga0157376_104207851 271
885 3300021441 Ga0213871_10001196 Ga0213871_100011962 271
886 3300025901 Ga0207688_10130383 Ga0207688_101303832 271
887 3300025904 Ga0207647_10138345 Ga0207647_101383452 271
888 3300025909 Ga0207705_10007165 Ga0207705_1000716510 271
889 3300025910 Ga0207684_10265702 Ga0207684_102657021 271
890 3300025912 Ga0207707_10003527 Ga0207707_1000352714 271
891 3300025913 Ga0207695_10016461 Ga0207695_100164612 271
892 3300025916 Ga0207663_10426562 Ga0207663_104265622 271
893 3300025919 Ga0207657_10393855 Ga0207657_103938551 271
894 3300025921 Ga0207652_10009517 Ga0207652_100095175 271
895 3300025925 Ga0207650_10095254 Ga0207650_100952543 271
896 3300025926 Ga0207659_10191058 Ga0207659_101910584 271
897 3300025926 Ga0207659_10192642 Ga0207659_101926422 271
898 3300025928 Ga0207700_10012529 Ga0207700_100125292 271
899 3300025933 Ga0207706_10203160 Ga0207706_102031602 271
900 3300025936 Ga0207670_10020673 Ga0207670_100206732 271
901 3300025937 Ga0207669_10059288 Ga0207669_100592882 271
902 3300025940 Ga0207691_10169098 Ga0207691_101690982 271
903 3300025941 Ga0207711_10257008 Ga0207711_102570082 271
904 3300025945 Ga0207679_10006048 Ga0207679_100060486 271
905 3300025949 Ga0207667_10002821 Ga0207667_1000282117 271
906 3300025986 Ga0207658_10119301 Ga0207658_101193013 271
907 3300026041 Ga0207639_10149577 Ga0207639_101495772 271
908 3300026078 Ga0207702_10023845 Ga0207702_100238455 271
909 3300026121 Ga0207683_10056923 Ga0207683_100569233 271
910 3300026121 Ga0207683_10211874 Ga0207683_102118742 271
911 3300028379 Ga0268266_10004061 Ga0268266_100040619 271
912 3300028379 Ga0268266_10039802 Ga0268266_100398022 271
913 3300028379 Ga0268266_10121161 Ga0268266_101211613 271
914 3300028380 Ga0268265_10442268 Ga0268265_104422682 271
915 3300028573 Ga0265334_10006563 Ga0265334_100065633 271
916 3300028794 Ga0307515_10033140 Ga0307515_100331409 271
917 3300031344 Ga0265316_10214578 Ga0265316_102145782 271
918 3300031456 Ga0307513_10423420 Ga0307513_104234202 271
919 3300031548 Ga0307408_100101113 Ga0307408_1001011132 271
920 3300035691 Ga0373931_0047326 Ga0373931_0047326_38_877 271
921 3300035691 Ga0373931_0081180 Ga0373931_0081180_478_1317 271
922 3300036647 Ga0316582_0098172 Ga0316582_0098172_281_1096 271
923 3300037068 Ga0373925_0218977 Ga0373925_0218977_393_1232 271
924 3300037312 Ga0395899_0008576 Ga0395899_0008576_5402_6241 271
925 3300037418 Ga0395900_0046371 Ga0395900_0046371_1962_2801 271
926 3300037418 Ga0395900_0074822 Ga0395900_0074822_384_1223 271
927 3300037466 Ga0395898_0156177 Ga0395898_0156177_1215_2054 271
928 3300038443 Ga0395901_0007074 Ga0395901_0007074_6442_7281 271
929 3300038443 Ga0395901_0015701 Ga0395901_0015701_4019_4858 271
930 3300039437 Ga0436365_0086324 Ga0436365_0086324_193_1032 271
931 3300039437 Ga0436365_1817572 Ga0436365_1817572_144_983 271
932 3300039438 Ga0436360_1076911 Ga0436360_1076911_7765_8604 271
933 3300039447 Ga0436361_0438458 Ga0436361_0438458_299_1138 271
934 3300039450 Ga0436363_0146039 Ga0436363_0146039_140_955 271
935 3300041410 Ga0439461_0031344 Ga0439461_0031344_37_876 271
936 3300042005 Ga0439448_0115196 Ga0439448_0115196_32_871 271
937 3300042436 Ga0439435_0010927 Ga0439435_0010927_397_1212 271
938 3300044673 Ga0453683_0098685 Ga0453683_0098685_390_1205 271
939 3300045051 Ga0451576_0267711 Ga0451576_0267711_478_1293 271
940 3300048929 Ga0496126_0038262 Ga0496126_0038262_3005_3844 271
941 3300049571 Ga0501034_0007498 Ga0501034_0007498_2802_3641 271
942 3300049571 Ga0501034_0026574 Ga0501034_0026574_2806_3645 271
943 3300049573 Ga0501037_0090190 Ga0501037_0090190_634_1449 271
944 3300049579 Ga0501043_0122242 Ga0501043_0122242_548_1384 271
945 3300049580 Ga0501046_0159709 Ga0501046_0159709_63_902 271
946 3300049582 Ga0501048_0044213 Ga0501048_0044213_1635_2450 271
947 3300049584 Ga0501068_0215809 Ga0501068_0215809_293_1126 271
948 3300049586 Ga0501070_0037789 Ga0501070_0037789_309_1148 271
949 3300049589 Ga0501073_0262420 Ga0501073_0262420_136_972 271
950 3300049741 Ga0501079_0186934 Ga0501079_0186934_742_1557 271
951 3300049822 Ga0501035_0353626 Ga0501035_0353626_162_998 271
952 3300050489 nmdc:mga03683_128920_c1 nmdc:mga03683_128920_c1_134_973 271
953 3300050489 nmdc:mga03683_2990_c1 nmdc:mga03683_2990_c1_85_924 271
954 3300050489 nmdc:mga03683_46636_c1 nmdc:mga03683_46636_c1_440_1279 271
955 3300050491 nmdc:mga00v17_192813_c1 nmdc:mga00v17_192813_c1_95_934 271
956 3300050493 nmdc:mga0k408_8381_c1 nmdc:mga0k408_8381_c1_1558_2397 271
957 3300050494 nmdc:mga06z11_7906_c1 nmdc:mga06z11_7906_c1_1154_1993 271
958 3300050495 nmdc:mga04h51_51263_c1 nmdc:mga04h51_51263_c1_83_922 271
959 3300050496 nmdc:mga07m45_106428_c1 nmdc:mga07m45_106428_c1_612_1451 271
960 3300050496 nmdc:mga07m45_4997_c1 nmdc:mga07m45_4997_c1_3090_3929 271
961 3300050513 nmdc:mga0rr50_205561_c1 nmdc:mga0rr50_205561_c1_560_1375 271
962 3300050516 nmdc:mga0sz30_58151_c1 nmdc:mga0sz30_58151_c1_156_995 271
963 3300050516 nmdc:mga0sz30_73041_c1 nmdc:mga0sz30_73041_c1_327_1166 271
964 3300053088 Ga0500644_0076499 Ga0500644_0076499_163_1002 271
965 3300053094 Ga0500566_0130643 Ga0500566_0130643_274_1113 271
966 3300053096 Ga0500641_0002690 Ga0500641_0002690_5250_6089 271
967 3300053130 Ga0500642_0084850 Ga0500642_0084850_451_1290 271
968 3300053134 Ga0500658_0046838 Ga0500658_0046838_582_1421 271
969 3300053139 Ga0500568_0001263 Ga0500568_0001263_9615_10430 271
970 3300053153 Ga0500616_0010218 Ga0500616_0010218_2742_3581 271
971 3300053155 Ga0500620_004765 Ga0500620_004765_1071_1910 271
972 3300053733 Ga0500552_000398 Ga0500552_000398_2683_3522 271
973 3300060353 Ga0501082_0058818 Ga0501082_0058818_2371_3186 271
974 3300006051 Ga0075364_10000618 Ga0075364_1000061811 273
975 3300042876 Ga0451577_0005873 Ga0451577_0005873_2312_3139 273
976 3300044712 Ga0453684_0046865 Ga0453684_0046865_374_1201 273
977 3300046501 Ga0495607_0000044 Ga0495607_0000044_38460_39284 273
978 3300049568 Ga0501031_0132915 Ga0501031_0132915_644_1471 273
979 3300049568 Ga0501031_0292429 Ga0501031_0292429_163_990 273
980 3300049823 Ga0501044_0134313 Ga0501044_0134313_1094_1921 273
981 3300050491 nmdc:mga00v17_17442_c1 nmdc:mga00v17_17442_c1_3041_3868 273
982 3300050491 nmdc:mga00v17_32530_c1 nmdc:mga00v17_32530_c1_1488_2315 273
983 3300046526 Ga0495666_0018480 Ga0495666_0018480_2358_3284 276
984 3300047317 Ga0495604_0027486 Ga0495604_0027486_309_1235 276
985 3300046499 Ga0495594_0040077 Ga0495594_0040077_1312_2232 279
986 iso_pu_bacteria 2596583598 2597031253 283
987 iso_pu_bacteria 2834641062 2834641123 283
988 iso_pu_bacteria 2885266251 2885269070 283
989 iso_pu_bacteria 2900577576 2900582208 283
990 iso_pu_bacteria 2928058823 2928061170 283
991 iso_pu_bacteria 8003400568 8003403300 283
992 3300003841 Ga0055541_1012321 Ga0055541_10123211 286
993 3300001979 JGI24740J21852_10004293 JGI24740J21852_100042936 287
994 3300001979 JGI24740J21852_10019851 JGI24740J21852_100198512 287
995 3300003752 Ga0055539_1000547 Ga0055539_10005475 287
996 3300003759 Ga0055525_1000177 Ga0055525_10001777 287
997 3300003760 Ga0055527_1002546 Ga0055527_10025462 287
998 3300003761 Ga0055535_1000004 Ga0055535_1000004242 287
999 3300003763 Ga0055529_1000022 Ga0055529_100002279 287
1000 3300005344 Ga0070661_100000012 Ga0070661_10000001219 287
1001 3300005455 Ga0070663_100000003 Ga0070663_100000003144 287
1002 3300005564 Ga0070664_100000003 Ga0070664_10000000372 287
1003 3300005578 Ga0068854_100000020 Ga0068854_10000002058 287
1004 3300009093 Ga0105240_10056122 Ga0105240_100561222 287
1005 3300013100 Ga0157373_10007631 Ga0157373_100076316 287
1006 3300013102 Ga0157371_10000567 Ga0157371_1000056739 287
1007 3300013104 Ga0157370_10000633 Ga0157370_1000063339 287
1008 3300013105 Ga0157369_10010717 Ga0157369_100107175 287
1009 3300013307 Ga0157372_10003682 Ga0157372_1000368212 287
1010 3300014497 Ga0182008_10034166 Ga0182008_100341662 287
1011 3300015261 Ga0182006_1001900 Ga0182006_10019005 287
1012 3300015261 Ga0182006_1012562 Ga0182006_10125621 287
1013 3300015262 Ga0182007_10006742 Ga0182007_100067421 287
1014 3300020070 Ga0206356_11584573 Ga0206356_115845731 287
1015 3300020610 Ga0154015_1561949 Ga0154015_156194912 287
1016 3300025224 Ga0209784_100006 Ga0209784_100006805 287
1017 3300025225 Ga0209566_100002 Ga0209566_100002805 287
1018 3300025226 Ga0209674_100010 Ga0209674_100010332 287
1019 3300025226 Ga0209674_100050 Ga0209674_100050267 287
1020 3300025228 Ga0209672_100111 Ga0209672_10011115 287
1021 3300025229 Ga0209147_100015 Ga0209147_100015304 287
1022 3300025230 Ga0209563_100004 Ga0209563_100004216 287
1023 3300025242 Ga0209258_100021 Ga0209258_100021304 287
1024 3300025253 Ga0209677_100007 Ga0209677_100007805 287
1025 3300025256 Ga0209759_1001943 Ga0209759_10019434 287
1026 3300025272 Ga0209455_1000028 Ga0209455_1000028304 287
1027 3300025913 Ga0207695_10000762 Ga0207695_100007625 287
1028 3300025920 Ga0207649_10000181 Ga0207649_100001812 287
1029 3300025945 Ga0207679_10000007 Ga0207679_10000007146 287
1030 3300025981 Ga0207640_10000087 Ga0207640_1000008738 287
1031 3300026067 Ga0207678_10000011 Ga0207678_1000001123 287
1032 3300026078 Ga0207702_10000018 Ga0207702_1000001889 287
1033 3300026116 Ga0207674_10005933 Ga0207674_1000593315 287
1034 3300037418 Ga0395900_0035720 Ga0395900_0035720_1338_2219 287
1035 3300044650 Ga0466986_0015166 Ga0466986_0015166_3886_4761 287
1036 3300044656 Ga0466969_0022256 Ga0466969_0022256_1621_2484 287
1037 3300044671 Ga0466978_0036798 Ga0466978_0036798_291_1154 287
1038 3300044672 Ga0466982_0068387 Ga0466982_0068387_916_1779 287
1039 3300044683 Ga0466965_0008128 Ga0466965_0008128_1405_2268 287
1040 3300044693 Ga0466961_0002611 Ga0466961_0002611_6226_7089 287
1041 3300044694 Ga0466963_0141651 Ga0466963_0141651_787_1650 287
1042 3300044706 Ga0466964_0004560 Ga0466964_0004560_3586_4449 287
1043 3300044735 Ga0466968_0023135 Ga0466968_0023135_280_1143 287
1044 3300044765 Ga0466970_0009727 Ga0466970_0009727_3250_4113 287
1045 3300044842 Ga0466957_0012573 Ga0466957_0012573_274_1137 287
1046 3300048928 Ga0496125_0079710 Ga0496125_0079710_836_1717 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

192

284

0.98

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

304

333

0.97

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

62

174

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k82-assembly4.cif.gz_D crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna 0.9504 2 287
1k82-assembly4.cif.gz_D crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna 0.9469 2 287
3sat-assembly1.cif.gz_A mutm slanted complex 6 with r112a mutation 0.9377 2 287
3saw-assembly1.cif.gz_A mutm slanted complex 8 with r112a mutation 0.9372 2 287
3sat-assembly1.cif.gz_A mutm slanted complex 6 with r112a mutation 0.9341 2 287
ID Description Score Start End Superfamily
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9564 147 287 1.10.8.50
1k82C02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9507 147 287 1.10.8.50
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9488 147 287 1.10.8.50
1k82C02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9437 147 287 1.10.8.50
af_P05523_2_128_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9369 2 144 3.20.190.10
ID Description Score Start End GO Terms
AF-A0A534BKW6-F1-model_v4 DNA-formamidopyrimidine glycosylase 0.9755 125 287 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0034039
AF-A0A424RDD1-F1-model_v4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) 0.9737 1 287 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A1P8FFC1-F1-model_v4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) 0.9732 1 287 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A3N5XR05-F1-model_v4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) 0.9716 1 286 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A0H4J238-F1-model_v4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) 0.9701 1 287 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078

Feature Viewer

pLDDT pTM Quality
90.55 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map