F488966
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1046 | 490 | 1016 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0134961|Ga0451576_0134961_1554_2555 |
| Length | 333 |
| Sequence | LETLSKSFAARASGCGRIAALQMLAMVRPWLCFAPCAASLIRARPLAQNLLSISADYDFRPMPELPEVEVTRRSFASAIQGARVTGLRLGKPLRWPLGTDPETLLGSRVGAVQRRGKYLWLPLEGSGGLLMHLGMSGSLAFLGGTPAAGVHDHFDLHTDRGLLRLTDPRRFGAVVWAPALDAEPVSTLLGGLGLEPFDERFDGPHLHAGLSGRRVPVKQALLAGDIVVGAGNIYACEALFLAGIDPRLPAGKLSRPRAARLAEAVRTVLAQALKAGGTTLRDFRDAHGVAGSFQMQAQVYGREGEACRRCGTAIRRIVQGQRSTFYCPSCQKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 6 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 7 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 8 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 9 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 10 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 11 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 12 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 13 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 14 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 15 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 16 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 17 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 18 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 19 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 20 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 21 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 22 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 23 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 24 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 25 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 26 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 27 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 28 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 29 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 30 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 31 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 32 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 33 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 34 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 35 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 36 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 37 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 38 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 39 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 50 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 58 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 62 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 71 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 83 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 97 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 99 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 100 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 101 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 102 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 103 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 104 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 105 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 106 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 109 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 110 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 111 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 112 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 113 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 114 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 115 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 116 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 117 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 120 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 121 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 122 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 123 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 125 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 126 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 127 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 128 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 129 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 130 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 131 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 132 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 133 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 134 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 136 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 137 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 138 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 152 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 164 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 169 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 173 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 174 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 184 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 187 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 248 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 260 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 261 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 262 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 263 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 264 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 265 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 266 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 267 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 268 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 269 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 270 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 271 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 272 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 273 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 274 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 275 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 276 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 277 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 278 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 279 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 280 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 281 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 282 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 283 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 284 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 285 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 286 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 287 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 288 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 289 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 290 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 291 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 292 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 293 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 294 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 295 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 296 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 297 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 298 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 299 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 301 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 302 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 303 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 305 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 306 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 308 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 309 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 310 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 311 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 312 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 313 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 314 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 315 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 316 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 317 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 318 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 319 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 320 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 321 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 322 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 323 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 324 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 325 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 326 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 327 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 328 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 329 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 330 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 331 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 332 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 333 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 334 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 335 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 336 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 337 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 338 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 339 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 340 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 341 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 342 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 343 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 344 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 345 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 346 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 347 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 348 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 349 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 350 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 351 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 352 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 353 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 354 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 355 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 356 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 357 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 358 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 359 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 360 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 361 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 397 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 398 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 399 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 402 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 403 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 404 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 405 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 406 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 407 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 408 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 409 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 430 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 431 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 432 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 433 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 434 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 435 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 436 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 437 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 438 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 439 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 443 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 444 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 445 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 449 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 450 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 451 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 452 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 453 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 454 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 455 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 465 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 466 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 467 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 469 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 470 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 471 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 472 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 473 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 474 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 475 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 476 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 477 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 478 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 479 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 480 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 481 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 482 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 483 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 484 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 485 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 486 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 487 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 488 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 490 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.94 |
| Metatranscriptomes | 0.19 |
| Isolates | 2.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.83 |
| Nodule | 0.48 |
| Rhizoplane | 0.96 |
| Rhizosphere | 70.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004293 | 3300001979 | Bacteria | 6143 |
| 2 | JGI24740J21852_10019851 | 3300001979 | Bacteria | 2359 |
| 3 | JGI24744J21845_10009944 | 3300002077 | Bacteria | 1951 |
| 4 | JGI25156J39149_1000474 | 3300002705 | Bacteria | 24235 |
| 5 | JGI25157J39369_1000008 | 3300002741 | Bacteria | 211083 |
| 6 | JGI25153J46596_10007844 | 3300003215 | Bacteria | 5184 |
| 7 | rootH1_10046143 | 3300003316 | Bacteria | 4758 |
| 8 | rootH2_10057619 | 3300003320 | Bacteria | 7538 |
| 9 | rootL2_10068954 | 3300003322 | Bacteria | 5150 |
| 10 | rootL2_10105231 | 3300003322 | Bacteria | 2770 |
| 11 | rootH1_10099221 | 3300003323 | Bacteria | 5338 |
| 12 | rootH1_10111419 | 3300003323 | Bacteria | 2399 |
| 13 | Ga0055539_1000425 | 3300003752 | Bacteria | 15373 |
| 14 | Ga0055539_1000547 | 3300003752 | Bacteria | 10979 |
| 15 | Ga0055539_1000697 | 3300003752 | Bacteria | 8639 |
| 16 | Ga0055533_1000040 | 3300003756 | Bacteria | 242927 |
| 17 | Ga0055525_1000177 | 3300003759 | Bacteria | 79402 |
| 18 | Ga0055525_1000566 | 3300003759 | Bacteria | 16650 |
| 19 | Ga0055527_1002546 | 3300003760 | Bacteria | 3029 |
| 20 | Ga0055535_1000004 | 3300003761 | Bacteria | 451244 |
| 21 | Ga0055535_1000052 | 3300003761 | Bacteria | 132513 |
| 22 | Ga0055529_1000022 | 3300003763 | Bacteria | 320108 |
| 23 | Ga0055529_1000053 | 3300003763 | Bacteria | 198996 |
| 24 | Ga0055524_1000247 | 3300003775 | Bacteria | 56379 |
| 25 | Ga0055540_1000260 | 3300003792 | Bacteria | 47714 |
| 26 | Ga0055531_10005151 | 3300003794 | Bacteria | 7709 |
| 27 | Ga0055541_1012321 | 3300003841 | Bacteria | 1230 |
| 28 | Ga0065165_1001775 | 3300005262 | Bacteria | 21338 |
| 29 | Ga0065704_10083986 | 3300005289 | Bacteria | 3391 |
| 30 | Ga0065704_10122127 | 3300005289 | Bacteria | 1754 |
| 31 | Ga0070658_10002808 | 3300005327 | Bacteria | 14470 |
| 32 | Ga0070658_10048068 | 3300005327 | Bacteria | 3453 |
| 33 | Ga0070658_10193722 | 3300005327 | Bacteria | 1714 |
| 34 | Ga0070658_10256045 | 3300005327 | Bacteria | 1485 |
| 35 | Ga0070676_10002205 | 3300005328 | Bacteria | 9935 |
| 36 | Ga0070683_100034664 | 3300005329 | Bacteria | 4612 |
| 37 | Ga0070690_100018751 | 3300005330 | Bacteria | 4185 |
| 38 | Ga0070690_100250778 | 3300005330 | Bacteria | 1252 |
| 39 | Ga0070670_100003795 | 3300005331 | Bacteria | 12583 |
| 40 | Ga0070670_100105517 | 3300005331 | Bacteria | 2428 |
| 41 | Ga0070677_10042789 | 3300005333 | Bacteria | 1796 |
| 42 | Ga0068869_100002877 | 3300005334 | Bacteria | 10453 |
| 43 | Ga0068869_100057158 | 3300005334 | Bacteria | 2847 |
| 44 | Ga0068869_100116753 | 3300005334 | Bacteria | 2036 |
| 45 | Ga0070666_10140391 | 3300005335 | Bacteria | 1683 |
| 46 | Ga0070680_100008477 | 3300005336 | Bacteria | 7871 |
| 47 | Ga0070680_100290611 | 3300005336 | Bacteria | 1385 |
| 48 | Ga0070680_100363684 | 3300005336 | Bacteria | 1231 |
| 49 | Ga0070682_100043594 | 3300005337 | Bacteria | 2775 |
| 50 | Ga0068868_100005532 | 3300005338 | Bacteria | 8885 |
| 51 | Ga0068868_100061412 | 3300005338 | Bacteria | 2977 |
| 52 | Ga0068868_100206684 | 3300005338 | Bacteria | 1639 |
| 53 | Ga0070660_100024054 | 3300005339 | Bacteria | 4518 |
| 54 | Ga0070689_100010914 | 3300005340 | Bacteria | 6491 |
| 55 | Ga0070689_100303737 | 3300005340 | Bacteria | 1329 |
| 56 | Ga0070661_100000012 | 3300005344 | Bacteria | 167998 |
| 57 | Ga0070661_100000641 | 3300005344 | Bacteria | 25944 |
| 58 | Ga0070669_100015088 | 3300005353 | Bacteria | 5505 |
| 59 | Ga0070669_100189807 | 3300005353 | Bacteria | 1611 |
| 60 | Ga0070675_100001810 | 3300005354 | Bacteria | 15812 |
| 61 | Ga0070675_100004319 | 3300005354 | Bacteria | 10835 |
| 62 | Ga0070675_100026872 | 3300005354 | Bacteria | 4621 |
| 63 | Ga0070675_100132024 | 3300005354 | Bacteria | 2129 |
| 64 | Ga0070675_100394270 | 3300005354 | Bacteria | 1234 |
| 65 | Ga0070671_100019262 | 3300005355 | Bacteria | 5552 |
| 66 | Ga0070674_100108635 | 3300005356 | Bacteria | 2033 |
| 67 | Ga0070673_100007444 | 3300005364 | Bacteria | 7220 |
| 68 | Ga0070673_100008102 | 3300005364 | Bacteria | 6970 |
| 69 | Ga0070688_100088113 | 3300005365 | Bacteria | 2023 |
| 70 | Ga0070688_100322378 | 3300005365 | Bacteria | 1123 |
| 71 | Ga0070659_100002940 | 3300005366 | Bacteria | 12145 |
| 72 | Ga0070659_100163683 | 3300005366 | Bacteria | 1820 |
| 73 | Ga0070667_100002153 | 3300005367 | Bacteria | 17348 |
| 74 | Ga0070667_100015286 | 3300005367 | Bacteria | 6344 |
| 75 | Ga0070667_100038770 | 3300005367 | Bacteria | 3995 |
| 76 | Ga0070667_100178857 | 3300005367 | Bacteria | 1875 |
| 77 | Ga0070667_100243970 | 3300005367 | Bacteria | 1605 |
| 78 | Ga0070713_100019399 | 3300005436 | Bacteria | 5190 |
| 79 | Ga0070705_100126710 | 3300005440 | Bacteria | 1659 |
| 80 | Ga0070700_100015534 | 3300005441 | Bacteria | 4320 |
| 81 | Ga0070700_100057858 | 3300005441 | Bacteria | 2434 |
| 82 | Ga0070694_100001590 | 3300005444 | Bacteria | 13368 |
| 83 | Ga0070694_100112910 | 3300005444 | Bacteria | 1938 |
| 84 | Ga0070694_100147173 | 3300005444 | Bacteria | 1717 |
| 85 | Ga0070694_100251484 | 3300005444 | Bacteria | 1337 |
| 86 | Ga0070694_100623131 | 3300005444 | Bacteria | 871 |
| 87 | Ga0070708_100291361 | 3300005445 | Bacteria | 1537 |
| 88 | Ga0070708_100617770 | 3300005445 | Bacteria | 1022 |
| 89 | Ga0070663_100000003 | 3300005455 | Bacteria | 260492 |
| 90 | Ga0070663_100055129 | 3300005455 | Bacteria | 2844 |
| 91 | Ga0070678_100036527 | 3300005456 | Bacteria | 3440 |
| 92 | Ga0070678_100081246 | 3300005456 | Bacteria | 2457 |
| 93 | Ga0070678_100302711 | 3300005456 | Bacteria | 1359 |
| 94 | Ga0070678_100414386 | 3300005456 | Bacteria | 1173 |
| 95 | Ga0070678_100494243 | 3300005456 | Bacteria | 1078 |
| 96 | Ga0070662_100001973 | 3300005457 | Bacteria | 12604 |
| 97 | Ga0070662_100054350 | 3300005457 | Bacteria | 2902 |
| 98 | Ga0070662_100111253 | 3300005457 | Bacteria | 2086 |
| 99 | Ga0070681_10018158 | 3300005458 | Bacteria | 7031 |
| 100 | Ga0068867_100000361 | 3300005459 | Bacteria | 30295 |
| 101 | Ga0068867_100040595 | 3300005459 | Bacteria | 3397 |
| 102 | Ga0068867_100154649 | 3300005459 | Bacteria | 1804 |
| 103 | Ga0070685_10115977 | 3300005466 | Bacteria | 1657 |
| 104 | Ga0070706_100000700 | 3300005467 | Bacteria | 37931 |
| 105 | Ga0070706_100124278 | 3300005467 | Bacteria | 2406 |
| 106 | Ga0070706_100394299 | 3300005467 | Bacteria | 1288 |
| 107 | Ga0070707_100168390 | 3300005468 | Bacteria | 2135 |
| 108 | Ga0070698_100003213 | 3300005471 | Bacteria | 18005 |
| 109 | Ga0070698_100021426 | 3300005471 | Bacteria | 6770 |
| 110 | Ga0070699_100094302 | 3300005518 | Bacteria | 2620 |
| 111 | Ga0070699_100287994 | 3300005518 | Bacteria | 1472 |
| 112 | Ga0070679_100003097 | 3300005530 | Bacteria | 15194 |
| 113 | Ga0070684_100024883 | 3300005535 | Bacteria | 5025 |
| 114 | Ga0070684_100033679 | 3300005535 | Bacteria | 4376 |
| 115 | Ga0068853_100240125 | 3300005539 | Bacteria | 1660 |
| 116 | Ga0070672_100039742 | 3300005543 | Bacteria | 3605 |
| 117 | Ga0070672_100045822 | 3300005543 | Bacteria | 3385 |
| 118 | Ga0070672_100184205 | 3300005543 | Bacteria | 1741 |
| 119 | Ga0070672_100254964 | 3300005543 | Bacteria | 1478 |
| 120 | Ga0070672_100466918 | 3300005543 | Bacteria | 1089 |
| 121 | Ga0070686_100124691 | 3300005544 | Bacteria | 1773 |
| 122 | Ga0070686_100200796 | 3300005544 | Bacteria | 1429 |
| 123 | Ga0070686_100373077 | 3300005544 | Bacteria | 1078 |
| 124 | Ga0070695_100004255 | 3300005545 | Bacteria | 8374 |
| 125 | Ga0070695_100132662 | 3300005545 | Bacteria | 1718 |
| 126 | Ga0070665_100018865 | 3300005548 | Bacteria | 6916 |
| 127 | Ga0070665_100023087 | 3300005548 | Bacteria | 6266 |
| 128 | Ga0070665_100083744 | 3300005548 | Bacteria | 3194 |
| 129 | Ga0070665_100288758 | 3300005548 | Bacteria | 1643 |
| 130 | Ga0070665_100297310 | 3300005548 | Bacteria | 1617 |
| 131 | Ga0070665_100323715 | 3300005548 | Bacteria | 1546 |
| 132 | Ga0070665_100372521 | 3300005548 | Bacteria | 1435 |
| 133 | Ga0070704_100011971 | 3300005549 | Bacteria | 5344 |
| 134 | Ga0070704_100015068 | 3300005549 | Bacteria | 4846 |
| 135 | Ga0070704_100179843 | 3300005549 | Bacteria | 1690 |
| 136 | Ga0070704_100268615 | 3300005549 | Bacteria | 1408 |
| 137 | Ga0068855_100020041 | 3300005563 | Bacteria | 8030 |
| 138 | Ga0068855_100029384 | 3300005563 | Bacteria | 6572 |
| 139 | Ga0068855_100245298 | 3300005563 | Bacteria | 1999 |
| 140 | Ga0068855_100461598 | 3300005563 | Bacteria | 1385 |
| 141 | Ga0070664_100000003 | 3300005564 | Bacteria | 325604 |
| 142 | Ga0070664_100001233 | 3300005564 | Bacteria | 20476 |
| 143 | Ga0070664_100104792 | 3300005564 | Bacteria | 2463 |
| 144 | Ga0070664_100204848 | 3300005564 | Bacteria | 1761 |
| 145 | Ga0068857_100005237 | 3300005577 | Bacteria | 11044 |
| 146 | Ga0068857_100074071 | 3300005577 | Bacteria | 3035 |
| 147 | Ga0068857_100091846 | 3300005577 | Bacteria | 2718 |
| 148 | Ga0068854_100000020 | 3300005578 | Bacteria | 132163 |
| 149 | Ga0068854_100002868 | 3300005578 | Bacteria | 10722 |
| 150 | Ga0068856_100001987 | 3300005614 | Bacteria | 21317 |
| 151 | Ga0068856_100034640 | 3300005614 | Bacteria | 4945 |
| 152 | Ga0068852_100042700 | 3300005616 | Bacteria | 3840 |
| 153 | Ga0068852_100043187 | 3300005616 | Bacteria | 3822 |
| 154 | Ga0068852_100099690 | 3300005616 | Bacteria | 2619 |
| 155 | Ga0068852_100149454 | 3300005616 | Bacteria | 2171 |
| 156 | Ga0068852_100173328 | 3300005616 | Bacteria | 2024 |
| 157 | Ga0068852_100235020 | 3300005616 | Bacteria | 1749 |
| 158 | Ga0068852_100237412 | 3300005616 | Bacteria | 1740 |
| 159 | Ga0068859_100062296 | 3300005617 | Bacteria | 3760 |
| 160 | Ga0068859_100069882 | 3300005617 | Bacteria | 3547 |
| 161 | Ga0068864_100001083 | 3300005618 | Bacteria | 22791 |
| 162 | Ga0068864_100011312 | 3300005618 | Bacteria | 7373 |
| 163 | Ga0068864_100022017 | 3300005618 | Bacteria | 5342 |
| 164 | Ga0068866_10119507 | 3300005718 | Bacteria | 1483 |
| 165 | Ga0068861_100000432 | 3300005719 | Bacteria | 24368 |
| 166 | Ga0068870_10020755 | 3300005840 | Bacteria | 3204 |
| 167 | Ga0068870_10033348 | 3300005840 | Bacteria | 2627 |
| 168 | Ga0068863_100010775 | 3300005841 | Bacteria | 8869 |
| 169 | Ga0068863_100020774 | 3300005841 | Bacteria | 6271 |
| 170 | Ga0068863_100504205 | 3300005841 | Unclassified | 1192 |
| 171 | Ga0068858_100081732 | 3300005842 | Bacteria | 3003 |
| 172 | Ga0068860_100001815 | 3300005843 | Bacteria | 22723 |
| 173 | Ga0068860_100060541 | 3300005843 | Bacteria | 3598 |
| 174 | Ga0068860_100823767 | 3300005843 | Bacteria | 942 |
| 175 | Ga0068862_100002346 | 3300005844 | Bacteria | 16855 |
| 176 | Ga0068862_100005522 | 3300005844 | Bacteria | 10563 |
| 177 | Ga0068862_100011728 | 3300005844 | Bacteria | 7234 |
| 178 | Ga0068862_100021433 | 3300005844 | Bacteria | 5399 |
| 179 | Ga0068862_100131676 | 3300005844 | Bacteria | 2212 |
| 180 | Ga0081455_10001851 | 3300005937 | Bacteria | 25467 |
| 181 | Ga0081455_10002478 | 3300005937 | Bacteria | 21945 |
| 182 | Ga0081455_10007317 | 3300005937 | Bacteria | 11641 |
| 183 | Ga0081455_10104159 | 3300005937 | Bacteria | 2270 |
| 184 | Ga0081539_10001293 | 3300005985 | Bacteria | 43956 |
| 185 | Ga0081539_10007008 | 3300005985 | Bacteria | 10455 |
| 186 | Ga0075365_10003502 | 3300006038 | Bacteria | 8111 |
| 187 | Ga0075365_10073341 | 3300006038 | Bacteria | 2307 |
| 188 | Ga0075365_10139894 | 3300006038 | Bacteria | 1680 |
| 189 | Ga0075368_10001377 | 3300006042 | Bacteria | 7744 |
| 190 | Ga0075368_10048412 | 3300006042 | Bacteria | 1685 |
| 191 | Ga0075368_10061110 | 3300006042 | Bacteria | 1508 |
| 192 | Ga0075363_100004369 | 3300006048 | Bacteria | 6170 |
| 193 | Ga0075363_100009854 | 3300006048 | Bacteria | 4507 |
| 194 | Ga0075364_10000618 | 3300006051 | Bacteria | 18341 |
| 195 | Ga0075364_10003245 | 3300006051 | Bacteria | 9211 |
| 196 | Ga0075364_10105816 | 3300006051 | Bacteria | 1875 |
| 197 | Ga0075364_10207427 | 3300006051 | Bacteria | 1329 |
| 198 | Ga0075364_10280762 | 3300006051 | Bacteria | 1133 |
| 199 | Ga0070715_10101356 | 3300006163 | Bacteria | 1343 |
| 200 | Ga0070712_100121184 | 3300006175 | Bacteria | 1968 |
| 201 | Ga0075362_10010353 | 3300006177 | Bacteria | 3639 |
| 202 | Ga0075362_10010485 | 3300006177 | Bacteria | 3619 |
| 203 | Ga0075362_10052153 | 3300006177 | Bacteria | 1832 |
| 204 | Ga0075362_10052751 | 3300006177 | Bacteria | 1823 |
| 205 | Ga0075362_10087148 | 3300006177 | Bacteria | 1445 |
| 206 | Ga0075362_10131051 | 3300006177 | Bacteria | 1193 |
| 207 | Ga0075362_10203717 | 3300006177 | Bacteria | 964 |
| 208 | Ga0075362_10229604 | 3300006177 | Bacteria | 909 |
| 209 | Ga0075367_10005203 | 3300006178 | Bacteria | 6431 |
| 210 | Ga0075367_10015184 | 3300006178 | Bacteria | 4180 |
| 211 | Ga0075367_10024789 | 3300006178 | Bacteria | 3384 |
| 212 | Ga0075367_10035949 | 3300006178 | Bacteria | 2870 |
| 213 | Ga0075367_10039066 | 3300006178 | Bacteria | 2766 |
| 214 | Ga0075367_10114561 | 3300006178 | Bacteria | 1657 |
| 215 | Ga0075369_10007032 | 3300006186 | Bacteria | 4275 |
| 216 | Ga0075369_10049913 | 3300006186 | Bacteria | 1808 |
| 217 | Ga0075369_10098265 | 3300006186 | Bacteria | 1312 |
| 218 | Ga0075369_10135117 | 3300006186 | Bacteria | 1122 |
| 219 | Ga0075366_10001135 | 3300006195 | Bacteria | 13140 |
| 220 | Ga0075366_10001971 | 3300006195 | Bacteria | 10385 |
| 221 | Ga0075366_10010718 | 3300006195 | Bacteria | 5153 |
| 222 | Ga0075366_10018528 | 3300006195 | Bacteria | 4020 |
| 223 | Ga0075366_10021594 | 3300006195 | Bacteria | 3742 |
| 224 | Ga0075366_10031292 | 3300006195 | Bacteria | 3131 |
| 225 | Ga0075366_10036943 | 3300006195 | Bacteria | 2881 |
| 226 | Ga0075366_10079348 | 3300006195 | Bacteria | 1959 |
| 227 | Ga0075366_10086781 | 3300006195 | Bacteria | 1872 |
| 228 | Ga0075366_10094058 | 3300006195 | Bacteria | 1797 |
| 229 | Ga0075366_10106828 | 3300006195 | Bacteria | 1683 |
| 230 | Ga0075366_10147127 | 3300006195 | Bacteria | 1426 |
| 231 | Ga0075366_10155520 | 3300006195 | Bacteria | 1385 |
| 232 | Ga0075366_10345988 | 3300006195 | Bacteria | 912 |
| 233 | Ga0097621_100018679 | 3300006237 | Bacteria | 5304 |
| 234 | Ga0097621_100161788 | 3300006237 | Bacteria | 1925 |
| 235 | Ga0097621_100181689 | 3300006237 | Bacteria | 1818 |
| 236 | Ga0097621_100402153 | 3300006237 | Bacteria | 1226 |
| 237 | Ga0097621_100560588 | 3300006237 | Bacteria | 1041 |
| 238 | Ga0075370_10000282 | 3300006353 | Bacteria | 18351 |
| 239 | Ga0075370_10001386 | 3300006353 | Bacteria | 10451 |
| 240 | Ga0075370_10002451 | 3300006353 | Bacteria | 8607 |
| 241 | Ga0075370_10005682 | 3300006353 | Bacteria | 6223 |
| 242 | Ga0075370_10007999 | 3300006353 | Bacteria | 5420 |
| 243 | Ga0075370_10010161 | 3300006353 | Bacteria | 4907 |
| 244 | Ga0075370_10011111 | 3300006353 | Bacteria | 4721 |
| 245 | Ga0075370_10018775 | 3300006353 | Bacteria | 3755 |
| 246 | Ga0075370_10026524 | 3300006353 | Bacteria | 3210 |
| 247 | Ga0075370_10045856 | 3300006353 | Bacteria | 2473 |
| 248 | Ga0075370_10077033 | 3300006353 | Bacteria | 1913 |
| 249 | Ga0068871_100010307 | 3300006358 | Bacteria | 6813 |
| 250 | Ga0075428_100005985 | 3300006844 | Bacteria | 13511 |
| 251 | Ga0075428_100055238 | 3300006844 | Bacteria | 4351 |
| 252 | Ga0075428_100143532 | 3300006844 | Bacteria | 2595 |
| 253 | Ga0075428_100236770 | 3300006844 | Bacteria | 1970 |
| 254 | Ga0075430_100085601 | 3300006846 | Bacteria | 2639 |
| 255 | Ga0075430_100122047 | 3300006846 | Bacteria | 2172 |
| 256 | Ga0075430_100230009 | 3300006846 | Bacteria | 1537 |
| 257 | Ga0075430_100369170 | 3300006846 | Bacteria | 1185 |
| 258 | Ga0075430_100404034 | 3300006846 | Bacteria | 1127 |
| 259 | Ga0075431_100007163 | 3300006847 | Bacteria | 11088 |
| 260 | Ga0075431_100048259 | 3300006847 | Bacteria | 4391 |
| 261 | Ga0075431_100068636 | 3300006847 | Bacteria | 3658 |
| 262 | Ga0075431_100096050 | 3300006847 | Bacteria | 3060 |
| 263 | Ga0075433_10005939 | 3300006852 | Bacteria | 9614 |
| 264 | Ga0075434_100387249 | 3300006871 | Bacteria | 1419 |
| 265 | Ga0075429_100002595 | 3300006880 | Bacteria | 15231 |
| 266 | Ga0075429_100025560 | 3300006880 | Bacteria | 5125 |
| 267 | Ga0075429_100097514 | 3300006880 | Bacteria | 2564 |
| 268 | Ga0068865_100015222 | 3300006881 | Bacteria | 4902 |
| 269 | Ga0068865_100051354 | 3300006881 | Bacteria | 2853 |
| 270 | Ga0075436_100228896 | 3300006914 | Bacteria | 1320 |
| 271 | Ga0097620_100062296 | 3300006931 | Bacteria | 3760 |
| 272 | Ga0097620_100069882 | 3300006931 | Bacteria | 3547 |
| 273 | Ga0079104_1000055 | 3300006946 | Bacteria | 166522 |
| 274 | Ga0079104_1000714 | 3300006946 | Bacteria | 30116 |
| 275 | Ga0075435_100034464 | 3300007076 | Bacteria | 4012 |
| 276 | Ga0075435_100103511 | 3300007076 | Bacteria | 2361 |
| 277 | Ga0075435_100115469 | 3300007076 | Bacteria | 2235 |
| 278 | Ga0099794_10043244 | 3300007265 | Bacteria | 2150 |
| 279 | Ga0099794_10086157 | 3300007265 | Bacteria | 1555 |
| 280 | Ga0105251_10028894 | 3300009011 | Bacteria | 2798 |
| 281 | Ga0105250_10000934 | 3300009092 | Bacteria | 17188 |
| 282 | Ga0105250_10028986 | 3300009092 | Bacteria | 2228 |
| 283 | Ga0105240_10010321 | 3300009093 | Bacteria | 13142 |
| 284 | Ga0105240_10011702 | 3300009093 | Bacteria | 12192 |
| 285 | Ga0105240_10047257 | 3300009093 | Bacteria | 5447 |
| 286 | Ga0105240_10056122 | 3300009093 | Bacteria | 4928 |
| 287 | Ga0105240_10116664 | 3300009093 | Bacteria | 3220 |
| 288 | Ga0111539_10395255 | 3300009094 | Bacteria | 1610 |
| 289 | Ga0111539_10671687 | 3300009094 | Bacteria | 1206 |
| 290 | Ga0105245_10017446 | 3300009098 | Bacteria | 6262 |
| 291 | Ga0105245_10373181 | 3300009098 | Bacteria | 1419 |
| 292 | Ga0105245_10539905 | 3300009098 | Bacteria | 1187 |
| 293 | Ga0114129_10088714 | 3300009147 | Bacteria | 4287 |
| 294 | Ga0114129_10114832 | 3300009147 | Bacteria | 3712 |
| 295 | Ga0114129_10121865 | 3300009147 | Bacteria | 3588 |
| 296 | Ga0105243_10008363 | 3300009148 | Bacteria | 7943 |
| 297 | Ga0105243_10010416 | 3300009148 | Bacteria | 7060 |
| 298 | Ga0105243_10131940 | 3300009148 | Bacteria | 2120 |
| 299 | Ga0105243_10166684 | 3300009148 | Bacteria | 1904 |
| 300 | Ga0105243_10224520 | 3300009148 | Bacteria | 1662 |
| 301 | Ga0105243_10342764 | 3300009148 | Bacteria | 1369 |
| 302 | Ga0105242_10002298 | 3300009176 | Bacteria | 15099 |
| 303 | Ga0105242_10008113 | 3300009176 | Bacteria | 8078 |
| 304 | Ga0105242_10195169 | 3300009176 | Bacteria | 1795 |
| 305 | Ga0105242_10285201 | 3300009176 | Bacteria | 1501 |
| 306 | Ga0105242_10389265 | 3300009176 | Bacteria | 1298 |
| 307 | Ga0105248_10062998 | 3300009177 | Bacteria | 4162 |
| 308 | Ga0105248_10322965 | 3300009177 | Bacteria | 1738 |
| 309 | Ga0105248_10447694 | 3300009177 | Bacteria | 1455 |
| 310 | Ga0105237_10001363 | 3300009545 | Bacteria | 32325 |
| 311 | Ga0105237_10005313 | 3300009545 | Bacteria | 14566 |
| 312 | Ga0105237_10570635 | 3300009545 | Bacteria | 1138 |
| 313 | Ga0105238_10002436 | 3300009551 | Bacteria | 18670 |
| 314 | Ga0105238_10036475 | 3300009551 | Bacteria | 4998 |
| 315 | Ga0105238_10326761 | 3300009551 | Bacteria | 1520 |
| 316 | Ga0105249_10025991 | 3300009553 | Bacteria | 5273 |
| 317 | Ga0105249_10091843 | 3300009553 | Bacteria | 2841 |
| 318 | Ga0105239_10000954 | 3300010375 | Bacteria | 40769 |
| 319 | Ga0105239_10032384 | 3300010375 | Bacteria | 5745 |
| 320 | Ga0157319_1000003 | 3300012497 | Bacteria | 397199 |
| 321 | Ga0157319_1000452 | 3300012497 | Bacteria | 1872 |
| 322 | Ga0157373_10007631 | 3300013100 | Bacteria | 8034 |
| 323 | Ga0157371_10000567 | 3300013102 | Bacteria | 43827 |
| 324 | Ga0157371_10029522 | 3300013102 | Bacteria | 3963 |
| 325 | Ga0157370_10000633 | 3300013104 | Bacteria | 43884 |
| 326 | Ga0157369_10010717 | 3300013105 | Bacteria | 10432 |
| 327 | Ga0157369_10024567 | 3300013105 | Bacteria | 6699 |
| 328 | Ga0157369_10304604 | 3300013105 | Bacteria | 1657 |
| 329 | Ga0157374_10214251 | 3300013296 | Bacteria | 1889 |
| 330 | Ga0157374_10365774 | 3300013296 | Bacteria | 1435 |
| 331 | Ga0157374_10422996 | 3300013296 | Bacteria | 1331 |
| 332 | Ga0157378_10002482 | 3300013297 | Bacteria | 16403 |
| 333 | Ga0157378_10162573 | 3300013297 | Bacteria | 2089 |
| 334 | Ga0157378_10643519 | 3300013297 | Bacteria | 1075 |
| 335 | Ga0163162_10001152 | 3300013306 | Bacteria | 24673 |
| 336 | Ga0163162_10030246 | 3300013306 | Bacteria | 5366 |
| 337 | Ga0157372_10003682 | 3300013307 | Bacteria | 16477 |
| 338 | Ga0157372_10384819 | 3300013307 | Bacteria | 1634 |
| 339 | Ga0157375_10010232 | 3300013308 | Bacteria | 8251 |
| 340 | Ga0157375_10011836 | 3300013308 | Bacteria | 7714 |
| 341 | Ga0157375_10024377 | 3300013308 | Bacteria | 5598 |
| 342 | Ga0157375_10026053 | 3300013308 | Bacteria | 5444 |
| 343 | Ga0157375_10027684 | 3300013308 | Bacteria | 5302 |
| 344 | Ga0157375_10326293 | 3300013308 | Bacteria | 1700 |
| 345 | Ga0163163_10037755 | 3300014325 | Bacteria | 4701 |
| 346 | Ga0163163_10096037 | 3300014325 | Bacteria | 2984 |
| 347 | Ga0157380_10201644 | 3300014326 | Bacteria | 1765 |
| 348 | Ga0182008_10034166 | 3300014497 | Bacteria | 2550 |
| 349 | Ga0182008_10038919 | 3300014497 | Bacteria | 2377 |
| 350 | Ga0157377_10189368 | 3300014745 | Bacteria | 1299 |
| 351 | Ga0157379_10040265 | 3300014968 | Bacteria | 4170 |
| 352 | Ga0157379_10080208 | 3300014968 | Bacteria | 2923 |
| 353 | Ga0157379_10122780 | 3300014968 | Bacteria | 2337 |
| 354 | Ga0157379_10127214 | 3300014968 | Bacteria | 2293 |
| 355 | Ga0157379_10150722 | 3300014968 | Bacteria | 2097 |
| 356 | Ga0157376_10076251 | 3300014969 | Bacteria | 2864 |
| 357 | Ga0157376_10420785 | 3300014969 | Bacteria | 1296 |
| 358 | Ga0182006_1001900 | 3300015261 | Bacteria | 11909 |
| 359 | Ga0182006_1012562 | 3300015261 | Bacteria | 3702 |
| 360 | Ga0182007_10006742 | 3300015262 | Bacteria | 4902 |
| 361 | Ga0163161_10525912 | 3300017792 | Bacteria | 966 |
| 362 | Ga0206356_11584573 | 3300020070 | Bacteria | 1662 |
| 363 | Ga0154015_1561949 | 3300020610 | Bacteria | 17677 |
| 364 | Ga0213872_10000006 | 3300021361 | Bacteria | 249845 |
| 365 | Ga0213872_10000175 | 3300021361 | Bacteria | 57086 |
| 366 | Ga0213872_10000735 | 3300021361 | Bacteria | 24387 |
| 367 | Ga0213872_10103969 | 3300021361 | Bacteria | 1264 |
| 368 | Ga0213871_10001196 | 3300021441 | Bacteria | 4187 |
| 369 | Ga0209784_100006 | 3300025224 | Bacteria | 930704 |
| 370 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 371 | Ga0209674_100010 | 3300025226 | Bacteria | 1038638 |
| 372 | Ga0209674_100050 | 3300025226 | Bacteria | 341738 |
| 373 | Ga0209674_100066 | 3300025226 | Bacteria | 256739 |
| 374 | Ga0209672_100111 | 3300025228 | Bacteria | 94440 |
| 375 | Ga0209672_106766 | 3300025228 | Bacteria | 1831 |
| 376 | Ga0209147_100015 | 3300025229 | Bacteria | 565073 |
| 377 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 378 | Ga0209563_100107 | 3300025230 | Bacteria | 143807 |
| 379 | Ga0207427_100848 | 3300025231 | Bacteria | 13647 |
| 380 | Ga0209258_100021 | 3300025242 | Bacteria | 565073 |
| 381 | Ga0209258_100074 | 3300025242 | Bacteria | 271062 |
| 382 | Ga0209258_101083 | 3300025242 | Bacteria | 11674 |
| 383 | Ga0207425_1000545 | 3300025245 | Bacteria | 22453 |
| 384 | Ga0209646_1000039 | 3300025246 | Bacteria | 349637 |
| 385 | Ga0209026_1000006 | 3300025250 | Bacteria | 677225 |
| 386 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 387 | Ga0209677_100052 | 3300025253 | Bacteria | 167826 |
| 388 | Ga0209677_100131 | 3300025253 | Bacteria | 72722 |
| 389 | Ga0209677_102745 | 3300025253 | Bacteria | 6292 |
| 390 | Ga0209759_1000020 | 3300025256 | Bacteria | 344904 |
| 391 | Ga0209759_1001101 | 3300025256 | Bacteria | 17455 |
| 392 | Ga0209759_1001776 | 3300025256 | Bacteria | 10977 |
| 393 | Ga0209759_1001943 | 3300025256 | Bacteria | 10044 |
| 394 | Ga0209129_1000294 | 3300025258 | Bacteria | 47351 |
| 395 | Ga0209455_1000028 | 3300025272 | Bacteria | 565073 |
| 396 | Ga0209455_1000066 | 3300025272 | Bacteria | 316811 |
| 397 | Ga0209673_1007230 | 3300025273 | Bacteria | 5170 |
| 398 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 399 | Ga0209564_1000300 | 3300025295 | Bacteria | 98386 |
| 400 | Ga0209758_1000453 | 3300025297 | Bacteria | 68482 |
| 401 | Ga0209758_1000605 | 3300025297 | Bacteria | 55552 |
| 402 | Ga0209050_1001043 | 3300025298 | Bacteria | 34245 |
| 403 | Ga0209050_1001662 | 3300025298 | Bacteria | 22481 |
| 404 | Ga0209050_1016584 | 3300025298 | Bacteria | 3002 |
| 405 | Ga0209256_1000049 | 3300025299 | Bacteria | 310696 |
| 406 | Ga0209256_1000150 | 3300025299 | Bacteria | 146086 |
| 407 | Ga0209051_1000247 | 3300025303 | Bacteria | 91122 |
| 408 | Ga0209051_1001846 | 3300025303 | Bacteria | 16707 |
| 409 | Ga0209051_1011161 | 3300025303 | Bacteria | 4462 |
| 410 | Ga0209051_1054828 | 3300025303 | Bacteria | 1298 |
| 411 | Ga0209257_1000141 | 3300025304 | Bacteria | 201130 |
| 412 | Ga0209257_1000318 | 3300025304 | Bacteria | 101186 |
| 413 | Ga0207696_1002314 | 3300025711 | Bacteria | 9448 |
| 414 | Ga0207696_1030321 | 3300025711 | Bacteria | 1644 |
| 415 | Ga0207682_10037579 | 3300025893 | Bacteria | 1962 |
| 416 | Ga0207682_10044355 | 3300025893 | Bacteria | 1823 |
| 417 | Ga0207688_10130383 | 3300025901 | Bacteria | 1474 |
| 418 | Ga0207647_10138345 | 3300025904 | Bacteria | 1428 |
| 419 | Ga0207685_10057319 | 3300025905 | Bacteria | 1528 |
| 420 | Ga0207645_10000239 | 3300025907 | Bacteria | 45441 |
| 421 | Ga0207645_10002245 | 3300025907 | Bacteria | 15384 |
| 422 | Ga0207643_10021888 | 3300025908 | Bacteria | 3517 |
| 423 | Ga0207643_10088422 | 3300025908 | Bacteria | 1803 |
| 424 | Ga0207705_10007165 | 3300025909 | Bacteria | 8214 |
| 425 | Ga0207705_10051903 | 3300025909 | Bacteria | 2951 |
| 426 | Ga0207705_10061679 | 3300025909 | Bacteria | 2708 |
| 427 | Ga0207705_10152132 | 3300025909 | Bacteria | 1734 |
| 428 | Ga0207684_10020637 | 3300025910 | Bacteria | 5629 |
| 429 | Ga0207684_10184701 | 3300025910 | Bacteria | 1798 |
| 430 | Ga0207684_10265702 | 3300025910 | Bacteria | 1480 |
| 431 | Ga0207707_10003527 | 3300025912 | Bacteria | 13853 |
| 432 | Ga0207695_10000762 | 3300025913 | Bacteria | 61636 |
| 433 | Ga0207695_10006803 | 3300025913 | Bacteria | 14738 |
| 434 | Ga0207695_10016461 | 3300025913 | Bacteria | 8650 |
| 435 | Ga0207695_10168773 | 3300025913 | Bacteria | 2115 |
| 436 | Ga0207671_10006342 | 3300025914 | Bacteria | 10552 |
| 437 | Ga0207671_10029236 | 3300025914 | Bacteria | 4116 |
| 438 | Ga0207663_10426562 | 3300025916 | Bacteria | 1019 |
| 439 | Ga0207657_10026018 | 3300025919 | Bacteria | 5386 |
| 440 | Ga0207657_10155305 | 3300025919 | Bacteria | 1861 |
| 441 | Ga0207657_10393855 | 3300025919 | Bacteria | 1090 |
| 442 | Ga0207649_10000181 | 3300025920 | Bacteria | 51550 |
| 443 | Ga0207649_10000335 | 3300025920 | Bacteria | 35710 |
| 444 | Ga0207652_10009517 | 3300025921 | Bacteria | 7814 |
| 445 | Ga0207646_10522289 | 3300025922 | Bacteria | 1069 |
| 446 | Ga0207646_10532955 | 3300025922 | Unclassified | 1057 |
| 447 | Ga0207681_10461679 | 3300025923 | Bacteria | 1034 |
| 448 | Ga0207694_10032788 | 3300025924 | Bacteria | 3977 |
| 449 | Ga0207694_10137473 | 3300025924 | Bacteria | 1963 |
| 450 | Ga0207650_10002178 | 3300025925 | Bacteria | 13682 |
| 451 | Ga0207650_10017432 | 3300025925 | Bacteria | 5030 |
| 452 | Ga0207650_10095254 | 3300025925 | Bacteria | 2282 |
| 453 | Ga0207659_10119494 | 3300025926 | Bacteria | 2018 |
| 454 | Ga0207659_10191058 | 3300025926 | Bacteria | 1630 |
| 455 | Ga0207659_10192642 | 3300025926 | Bacteria | 1623 |
| 456 | Ga0207659_10286481 | 3300025926 | Bacteria | 1348 |
| 457 | Ga0207687_10006568 | 3300025927 | Bacteria | 7673 |
| 458 | Ga0207687_10273821 | 3300025927 | Bacteria | 1350 |
| 459 | Ga0207700_10012529 | 3300025928 | Bacteria | 5474 |
| 460 | Ga0207644_10016858 | 3300025931 | Bacteria | 4922 |
| 461 | Ga0207690_10000176 | 3300025932 | Bacteria | 49560 |
| 462 | Ga0207690_10093091 | 3300025932 | Bacteria | 2135 |
| 463 | Ga0207690_10117344 | 3300025932 | Bacteria | 1927 |
| 464 | Ga0207706_10000269 | 3300025933 | Bacteria | 56605 |
| 465 | Ga0207706_10005101 | 3300025933 | Bacteria | 12262 |
| 466 | Ga0207706_10203160 | 3300025933 | Bacteria | 1738 |
| 467 | Ga0207706_10204919 | 3300025933 | Bacteria | 1729 |
| 468 | Ga0207686_10014921 | 3300025934 | Bacteria | 4337 |
| 469 | Ga0207686_10105189 | 3300025934 | Bacteria | 1892 |
| 470 | Ga0207709_10000728 | 3300025935 | Bacteria | 26361 |
| 471 | Ga0207709_10012031 | 3300025935 | Bacteria | 4772 |
| 472 | Ga0207709_10099526 | 3300025935 | Bacteria | 1919 |
| 473 | Ga0207709_10579633 | 3300025935 | Bacteria | 886 |
| 474 | Ga0207670_10020673 | 3300025936 | Bacteria | 4049 |
| 475 | Ga0207669_10027794 | 3300025937 | Bacteria | 3103 |
| 476 | Ga0207669_10059288 | 3300025937 | Bacteria | 2341 |
| 477 | Ga0207691_10007606 | 3300025940 | Bacteria | 10427 |
| 478 | Ga0207691_10027019 | 3300025940 | Bacteria | 5385 |
| 479 | Ga0207691_10103118 | 3300025940 | Bacteria | 2544 |
| 480 | Ga0207691_10169098 | 3300025940 | Bacteria | 1915 |
| 481 | Ga0207691_10605176 | 3300025940 | Bacteria | 928 |
| 482 | Ga0207711_10007438 | 3300025941 | Bacteria | 9168 |
| 483 | Ga0207711_10257008 | 3300025941 | Bacteria | 1605 |
| 484 | Ga0207689_10007794 | 3300025942 | Bacteria | 9369 |
| 485 | Ga0207689_10011133 | 3300025942 | Bacteria | 7721 |
| 486 | Ga0207689_10113104 | 3300025942 | Bacteria | 2231 |
| 487 | Ga0207679_10000007 | 3300025945 | Bacteria | 460140 |
| 488 | Ga0207679_10000168 | 3300025945 | Bacteria | 54187 |
| 489 | Ga0207679_10006048 | 3300025945 | Bacteria | 7628 |
| 490 | Ga0207679_10118750 | 3300025945 | Bacteria | 2101 |
| 491 | Ga0207667_10002821 | 3300025949 | Bacteria | 21552 |
| 492 | Ga0207667_10008762 | 3300025949 | Bacteria | 11983 |
| 493 | Ga0207667_10027793 | 3300025949 | Bacteria | 6152 |
| 494 | Ga0207651_10004284 | 3300025960 | Bacteria | 7162 |
| 495 | Ga0207651_10015741 | 3300025960 | Bacteria | 4406 |
| 496 | Ga0207640_10000087 | 3300025981 | Bacteria | 72872 |
| 497 | Ga0207640_10004871 | 3300025981 | Bacteria | 7292 |
| 498 | Ga0207640_10126666 | 3300025981 | Bacteria | 1840 |
| 499 | Ga0207658_10001079 | 3300025986 | Bacteria | 22086 |
| 500 | Ga0207658_10091760 | 3300025986 | Bacteria | 2357 |
| 501 | Ga0207658_10119301 | 3300025986 | Bacteria | 2100 |
| 502 | Ga0207677_10041675 | 3300026023 | Bacteria | 3038 |
| 503 | Ga0207677_10144971 | 3300026023 | Bacteria | 1824 |
| 504 | Ga0207677_10370976 | 3300026023 | Bacteria | 1205 |
| 505 | Ga0207703_10140367 | 3300026035 | Bacteria | 2096 |
| 506 | Ga0207703_10381503 | 3300026035 | Bacteria | 1304 |
| 507 | Ga0207639_10149577 | 3300026041 | Bacteria | 1954 |
| 508 | Ga0207639_10502004 | 3300026041 | Bacteria | 1108 |
| 509 | Ga0207678_10000011 | 3300026067 | Bacteria | 147685 |
| 510 | Ga0207678_10031607 | 3300026067 | Bacteria | 4617 |
| 511 | Ga0207678_10034740 | 3300026067 | Bacteria | 4391 |
| 512 | Ga0207708_10044187 | 3300026075 | Bacteria | 3395 |
| 513 | Ga0207702_10000018 | 3300026078 | Bacteria | 212617 |
| 514 | Ga0207702_10000310 | 3300026078 | Bacteria | 55596 |
| 515 | Ga0207702_10023845 | 3300026078 | Bacteria | 5075 |
| 516 | Ga0207641_10009800 | 3300026088 | Bacteria | 7888 |
| 517 | Ga0207641_10040044 | 3300026088 | Bacteria | 3920 |
| 518 | Ga0207641_10323502 | 3300026088 | Bacteria | 1463 |
| 519 | Ga0207648_10000393 | 3300026089 | Bacteria | 48485 |
| 520 | Ga0207648_10006738 | 3300026089 | Bacteria | 11394 |
| 521 | Ga0207648_10048470 | 3300026089 | Bacteria | 3719 |
| 522 | Ga0207648_10189848 | 3300026089 | Bacteria | 1820 |
| 523 | Ga0207648_10234015 | 3300026089 | Bacteria | 1635 |
| 524 | Ga0207648_10293309 | 3300026089 | Bacteria | 1457 |
| 525 | Ga0207676_10014656 | 3300026095 | Bacteria | 5645 |
| 526 | Ga0207676_10051117 | 3300026095 | Bacteria | 3225 |
| 527 | Ga0207674_10005933 | 3300026116 | Bacteria | 14445 |
| 528 | Ga0207674_10008702 | 3300026116 | Bacteria | 11684 |
| 529 | Ga0207674_10019532 | 3300026116 | Bacteria | 7338 |
| 530 | Ga0207674_10070363 | 3300026116 | Bacteria | 3518 |
| 531 | Ga0207675_100000241 | 3300026118 | Bacteria | 52027 |
| 532 | Ga0207675_100001788 | 3300026118 | Bacteria | 21504 |
| 533 | Ga0207675_100009646 | 3300026118 | Bacteria | 9034 |
| 534 | Ga0207683_10026363 | 3300026121 | Bacteria | 5016 |
| 535 | Ga0207683_10056923 | 3300026121 | Bacteria | 3431 |
| 536 | Ga0207683_10190003 | 3300026121 | Bacteria | 1864 |
| 537 | Ga0207683_10211874 | 3300026121 | Bacteria | 1764 |
| 538 | Ga0207698_10230812 | 3300026142 | Bacteria | 1680 |
| 539 | Ga0207698_10304799 | 3300026142 | Bacteria | 1484 |
| 540 | Ga0207698_10409876 | 3300026142 | Bacteria | 1298 |
| 541 | Ga0207698_10542380 | 3300026142 | Bacteria | 1139 |
| 542 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 543 | Ga0209281_1001190 | 3300027111 | Bacteria | 17791 |
| 544 | Ga0209968_1001023 | 3300027526 | Bacteria | 4300 |
| 545 | Ga0209970_1000068 | 3300027614 | Bacteria | 14109 |
| 546 | Ga0209970_1004215 | 3300027614 | Bacteria | 2395 |
| 547 | Ga0209983_1001464 | 3300027665 | Bacteria | 5249 |
| 548 | Ga0209983_1001937 | 3300027665 | Bacteria | 4590 |
| 549 | Ga0209971_1002797 | 3300027682 | Bacteria | 4169 |
| 550 | Ga0209966_1000035 | 3300027695 | Bacteria | 56067 |
| 551 | Ga0209998_10000299 | 3300027717 | Bacteria | 15058 |
| 552 | Ga0209813_10002804 | 3300027866 | Bacteria | 4028 |
| 553 | Ga0209974_10001503 | 3300027876 | Bacteria | 8474 |
| 554 | Ga0209974_10018896 | 3300027876 | Bacteria | 2286 |
| 555 | Ga0268266_10004061 | 3300028379 | Bacteria | 14147 |
| 556 | Ga0268266_10016016 | 3300028379 | Bacteria | 6412 |
| 557 | Ga0268266_10039802 | 3300028379 | Bacteria | 4004 |
| 558 | Ga0268266_10121161 | 3300028379 | Bacteria | 2328 |
| 559 | Ga0268266_10297747 | 3300028379 | Bacteria | 1504 |
| 560 | Ga0268265_10021206 | 3300028380 | Bacteria | 4547 |
| 561 | Ga0268265_10042503 | 3300028380 | Bacteria | 3373 |
| 562 | Ga0268265_10043519 | 3300028380 | Bacteria | 3339 |
| 563 | Ga0268265_10442268 | 3300028380 | Bacteria | 1212 |
| 564 | Ga0268264_10009229 | 3300028381 | Bacteria | 8172 |
| 565 | Ga0265334_10006563 | 3300028573 | Bacteria | 5007 |
| 566 | Ga0265336_10000024 | 3300028666 | Bacteria | 188787 |
| 567 | Ga0307517_10063967 | 3300028786 | Bacteria | 3428 |
| 568 | Ga0307517_10157710 | 3300028786 | Bacteria | 1534 |
| 569 | Ga0307515_10000477 | 3300028794 | Bacteria | 95378 |
| 570 | Ga0307515_10001774 | 3300028794 | Bacteria | 48109 |
| 571 | Ga0307515_10001873 | 3300028794 | Bacteria | 46808 |
| 572 | Ga0307515_10018010 | 3300028794 | Bacteria | 12820 |
| 573 | Ga0307515_10033140 | 3300028794 | Bacteria | 8518 |
| 574 | Ga0307515_10052957 | 3300028794 | Bacteria | 6003 |
| 575 | Ga0307515_10071375 | 3300028794 | Bacteria | 4707 |
| 576 | Ga0307515_10216759 | 3300028794 | Bacteria | 1743 |
| 577 | Ga0307515_10231694 | 3300028794 | Bacteria | 1638 |
| 578 | Ga0265324_10000651 | 3300029957 | Bacteria | 23540 |
| 579 | Ga0307512_10023350 | 3300030522 | Bacteria | 5524 |
| 580 | Ga0307512_10062748 | 3300030522 | Bacteria | 2847 |
| 581 | Ga0307512_10112528 | 3300030522 | Bacteria | 1786 |
| 582 | Ga0265330_10000046 | 3300031235 | Bacteria | 108853 |
| 583 | Ga0265332_10000028 | 3300031238 | Bacteria | 184029 |
| 584 | Ga0265328_10026430 | 3300031239 | Bacteria | 2181 |
| 585 | Ga0265340_10040751 | 3300031247 | Bacteria | 2286 |
| 586 | Ga0265331_10012894 | 3300031250 | Bacteria | 4508 |
| 587 | Ga0265327_10000042 | 3300031251 | Bacteria | 287487 |
| 588 | Ga0265327_10000419 | 3300031251 | Bacteria | 77672 |
| 589 | Ga0265316_10000332 | 3300031344 | Bacteria | 52832 |
| 590 | Ga0265316_10214578 | 3300031344 | Bacteria | 1422 |
| 591 | Ga0307513_10011506 | 3300031456 | Bacteria | 10991 |
| 592 | Ga0307513_10022921 | 3300031456 | Bacteria | 7317 |
| 593 | Ga0307513_10423420 | 3300031456 | Bacteria | 1061 |
| 594 | Ga0307509_10000063 | 3300031507 | Bacteria | 143708 |
| 595 | Ga0307509_10005231 | 3300031507 | Bacteria | 18184 |
| 596 | Ga0307509_10018876 | 3300031507 | Bacteria | 7890 |
| 597 | Ga0307509_10050207 | 3300031507 | Bacteria | 4468 |
| 598 | Ga0307509_10097488 | 3300031507 | Bacteria | 2988 |
| 599 | Ga0307408_100000029 | 3300031548 | Bacteria | 227806 |
| 600 | Ga0307408_100039098 | 3300031548 | Bacteria | 3351 |
| 601 | Ga0307408_100101113 | 3300031548 | Bacteria | 2197 |
| 602 | Ga0307408_100105449 | 3300031548 | Bacteria | 2155 |
| 603 | Ga0307508_10000053 | 3300031616 | Bacteria | 128020 |
| 604 | Ga0307508_10000109 | 3300031616 | Bacteria | 97316 |
| 605 | Ga0307508_10037138 | 3300031616 | Bacteria | 4383 |
| 606 | Ga0307508_10129989 | 3300031616 | Bacteria | 2121 |
| 607 | Ga0307508_10230618 | 3300031616 | Bacteria | 1450 |
| 608 | Ga0307514_10003555 | 3300031649 | Bacteria | 14852 |
| 609 | Ga0316575_10003572 | 3300031665 | Bacteria | 5379 |
| 610 | Ga0316579_10001228 | 3300031691 | Bacteria | 9188 |
| 611 | Ga0265314_10000054 | 3300031711 | Bacteria | 184029 |
| 612 | Ga0316578_10007343 | 3300031728 | Bacteria | 5518 |
| 613 | Ga0307516_10000290 | 3300031730 | Bacteria | 65231 |
| 614 | Ga0307516_10000676 | 3300031730 | Bacteria | 46208 |
| 615 | Ga0307516_10003323 | 3300031730 | Bacteria | 20804 |
| 616 | Ga0307516_10042443 | 3300031730 | Bacteria | 4512 |
| 617 | Ga0307516_10205000 | 3300031730 | Bacteria | 1689 |
| 618 | Ga0307412_10091723 | 3300031911 | Bacteria | 2127 |
| 619 | Ga0307412_10416480 | 3300031911 | Bacteria | 1098 |
| 620 | Ga0307414_10125240 | 3300032004 | Bacteria | 1984 |
| 621 | Ga0307411_10000099 | 3300032005 | Bacteria | 26770 |
| 622 | Ga0316583_10000892 | 3300032133 | Bacteria | 9552 |
| 623 | Ga0316583_10003087 | 3300032133 | Bacteria | 5855 |
| 624 | Ga0307507_10166349 | 3300033179 | Bacteria | 1615 |
| 625 | Ga0307507_10194813 | 3300033179 | Bacteria | 1416 |
| 626 | Ga0307510_10006488 | 3300033180 | Bacteria | 13955 |
| 627 | Ga0307510_10081052 | 3300033180 | Bacteria | 3150 |
| 628 | Ga0307510_10098226 | 3300033180 | Bacteria | 2733 |
| 629 | Ga0307510_10126918 | 3300033180 | Bacteria | 2237 |
| 630 | Ga0307510_10136225 | 3300033180 | Bacteria | 2112 |
| 631 | Ga0373959_0006759 | 3300034820 | Bacteria | 1913 |
| 632 | Ga0373934_0015566 | 3300035086 | Bacteria | 2887 |
| 633 | Ga0373951_0016550 | 3300035091 | Bacteria | 1664 |
| 634 | Ga0373952_0001055 | 3300035092 | Bacteria | 5034 |
| 635 | Ga0373936_0052765 | 3300035113 | Bacteria | 1648 |
| 636 | Ga0373939_0000012 | 3300035114 | Bacteria | 67223 |
| 637 | Ga0373953_0110954 | 3300035117 | Bacteria | 1160 |
| 638 | Ga0373954_0000014 | 3300035118 | Bacteria | 71012 |
| 639 | Ga0373956_0033580 | 3300035119 | Bacteria | 2257 |
| 640 | Ga0373960_0008082 | 3300035121 | Bacteria | 2511 |
| 641 | Ga0373955_0071786 | 3300035172 | Bacteria | 1938 |
| 642 | Ga0373942_0104615 | 3300035207 | Bacteria | 869 |
| 643 | Ga0316574_0118606 | 3300035398 | Bacteria | 1698 |
| 644 | Ga0373931_0000235 | 3300035691 | Bacteria | 23527 |
| 645 | Ga0373931_0001846 | 3300035691 | Bacteria | 9220 |
| 646 | Ga0373931_0005977 | 3300035691 | Bacteria | 5659 |
| 647 | Ga0373931_0043878 | 3300035691 | Bacteria | 2357 |
| 648 | Ga0373931_0047326 | 3300035691 | Bacteria | 2276 |
| 649 | Ga0373931_0081180 | 3300035691 | Bacteria | 1790 |
| 650 | Ga0373933_0012021 | 3300035724 | Bacteria | 4780 |
| 651 | Ga0373933_0099713 | 3300035724 | Bacteria | 1801 |
| 652 | Ga0373937_0000218 | 3300036401 | Bacteria | 55605 |
| 653 | Ga0373937_0039513 | 3300036401 | Bacteria | 4300 |
| 654 | Ga0373937_0243575 | 3300036401 | Bacteria | 1694 |
| 655 | Ga0316582_0001739 | 3300036647 | Bacteria | 9792 |
| 656 | Ga0316582_0098172 | 3300036647 | Bacteria | 1937 |
| 657 | Ga0316584_0066683 | 3300036712 | Bacteria | 2697 |
| 658 | Ga0373925_0218977 | 3300037068 | Bacteria | 1519 |
| 659 | Ga0373925_0317765 | 3300037068 | Bacteria | 1260 |
| 660 | Ga0395899_0008576 | 3300037312 | Bacteria | 7870 |
| 661 | Ga0395899_0047209 | 3300037312 | Bacteria | 3207 |
| 662 | Ga0395900_0000183 | 3300037418 | Bacteria | 100749 |
| 663 | Ga0395900_0035720 | 3300037418 | Bacteria | 5120 |
| 664 | Ga0395900_0046371 | 3300037418 | Bacteria | 4475 |
| 665 | Ga0395900_0074822 | 3300037418 | Bacteria | 3481 |
| 666 | Ga0395900_0352392 | 3300037418 | Bacteria | 1445 |
| 667 | Ga0395898_0002107 | 3300037466 | Bacteria | 24665 |
| 668 | Ga0395898_0021926 | 3300037466 | Bacteria | 6470 |
| 669 | Ga0395898_0108462 | 3300037466 | Bacteria | 2662 |
| 670 | Ga0395898_0156177 | 3300037466 | Bacteria | 2182 |
| 671 | Ga0395898_0324776 | 3300037466 | Bacteria | 1468 |
| 672 | Ga0395905_0000805 | 3300037471 | Bacteria | 41184 |
| 673 | Ga0395905_0004023 | 3300037471 | Bacteria | 15426 |
| 674 | Ga0395905_0004208 | 3300037471 | Bacteria | 15056 |
| 675 | Ga0395905_0011566 | 3300037471 | Bacteria | 8525 |
| 676 | Ga0395905_0046448 | 3300037471 | Bacteria | 4072 |
| 677 | Ga0316581_0008060 | 3300037588 | Bacteria | 2850 |
| 678 | Ga0395901_0007074 | 3300038443 | Bacteria | 11341 |
| 679 | Ga0395901_0015701 | 3300038443 | Bacteria | 7714 |
| 680 | Ga0395901_0068369 | 3300038443 | Bacteria | 3700 |
| 681 | Ga0395901_0178882 | 3300038443 | Bacteria | 2224 |
| 682 | Ga0436365_0086324 | 3300039437 | Bacteria | 1303 |
| 683 | Ga0436365_1817572 | 3300039437 | Bacteria | 1085 |
| 684 | Ga0436360_1076911 | 3300039438 | Bacteria | 12198 |
| 685 | Ga0436361_0027820 | 3300039447 | Bacteria | 4959 |
| 686 | Ga0436361_0105405 | 3300039447 | Bacteria | 5290 |
| 687 | Ga0436361_0169339 | 3300039447 | Bacteria | 26126 |
| 688 | Ga0436361_0438458 | 3300039447 | Bacteria | 1639 |
| 689 | Ga0436361_0491913 | 3300039447 | Bacteria | 14451 |
| 690 | Ga0436361_1221151 | 3300039447 | Bacteria | 2512 |
| 691 | Ga0436363_0146039 | 3300039450 | Bacteria | 1328 |
| 692 | Ga0439453_0028120 | 3300041408 | Bacteria | 1051 |
| 693 | Ga0439461_0031344 | 3300041410 | Bacteria | 1110 |
| 694 | Ga0451847_0578485 | 3300041503 | Unclassified | 1221 |
| 695 | Ga0439431_0001954 | 3300041997 | Bacteria | 4573 |
| 696 | Ga0439445_0014021 | 3300042004 | Bacteria | 1947 |
| 697 | Ga0439448_0115196 | 3300042005 | Bacteria | 920 |
| 698 | Ga0450911_000351 | 3300042115 | Bacteria | 15672 |
| 699 | Ga0450915_000577 | 3300042119 | Bacteria | 1407 |
| 700 | Ga0450917_000046 | 3300042120 | Bacteria | 6255 |
| 701 | Ga0450919_000354 | 3300042121 | Bacteria | 5543 |
| 702 | Ga0450921_000418 | 3300042123 | Bacteria | 1978 |
| 703 | Ga0450888_000419 | 3300042126 | Bacteria | 4010 |
| 704 | Ga0450890_000389 | 3300042127 | Bacteria | 6440 |
| 705 | Ga0450890_008313 | 3300042127 | Bacteria | 1327 |
| 706 | Ga0450891_000914 | 3300042129 | Bacteria | 3087 |
| 707 | Ga0450903_003345 | 3300042138 | Bacteria | 2781 |
| 708 | Ga0450907_015630 | 3300042146 | Bacteria | 1267 |
| 709 | Ga0439458_0013278 | 3300042157 | Bacteria | 1854 |
| 710 | Ga0439434_0021932 | 3300042435 | Bacteria | 1919 |
| 711 | Ga0439434_0033674 | 3300042435 | Bacteria | 1563 |
| 712 | Ga0439435_0010927 | 3300042436 | Bacteria | 2168 |
| 713 | Ga0439459_0031306 | 3300042438 | Bacteria | 1084 |
| 714 | Ga0450916_000613 | 3300042530 | Bacteria | 3200 |
| 715 | Ga0450918_000406 | 3300042531 | Bacteria | 9338 |
| 716 | Ga0451577_0003091 | 3300042876 | Bacteria | 18789 |
| 717 | Ga0451577_0005873 | 3300042876 | Bacteria | 12410 |
| 718 | Ga0451577_0011731 | 3300042876 | Bacteria | 8271 |
| 719 | Ga0451577_0167433 | 3300042876 | Bacteria | 1980 |
| 720 | Ga0466986_0015166 | 3300044650 | Bacteria | 4923 |
| 721 | Ga0466969_0000020 | 3300044656 | Bacteria | 101861 |
| 722 | Ga0466969_0019679 | 3300044656 | Bacteria | 3505 |
| 723 | Ga0466969_0022256 | 3300044656 | Bacteria | 3272 |
| 724 | Ga0466972_0012887 | 3300044658 | Bacteria | 4198 |
| 725 | Ga0466972_0017534 | 3300044658 | Bacteria | 3584 |
| 726 | Ga0466978_0036798 | 3300044671 | Bacteria | 3014 |
| 727 | Ga0466982_0068387 | 3300044672 | Bacteria | 2191 |
| 728 | Ga0453683_0098685 | 3300044673 | Bacteria | 1834 |
| 729 | Ga0466965_0006671 | 3300044683 | Bacteria | 5260 |
| 730 | Ga0466965_0008128 | 3300044683 | Bacteria | 4845 |
| 731 | Ga0466965_0057642 | 3300044683 | Bacteria | 1936 |
| 732 | Ga0466965_0070808 | 3300044683 | Bacteria | 1753 |
| 733 | Ga0466965_0285624 | 3300044683 | Bacteria | 892 |
| 734 | Ga0466966_0003281 | 3300044684 | Bacteria | 10664 |
| 735 | Ga0466966_0008789 | 3300044684 | Bacteria | 6687 |
| 736 | Ga0466966_0027606 | 3300044684 | Bacteria | 3700 |
| 737 | Ga0466961_0002611 | 3300044693 | Bacteria | 11188 |
| 738 | Ga0466961_0019410 | 3300044693 | Bacteria | 4371 |
| 739 | Ga0466961_0037440 | 3300044693 | Bacteria | 3111 |
| 740 | Ga0466961_0135237 | 3300044693 | Bacteria | 1544 |
| 741 | Ga0466963_0141651 | 3300044694 | Bacteria | 1666 |
| 742 | Ga0466964_0003293 | 3300044706 | Bacteria | 5881 |
| 743 | Ga0466964_0004560 | 3300044706 | Bacteria | 5123 |
| 744 | Ga0466964_0043434 | 3300044706 | Bacteria | 1823 |
| 745 | Ga0466964_0056995 | 3300044706 | Bacteria | 1616 |
| 746 | Ga0453684_0046865 | 3300044712 | Bacteria | 5742 |
| 747 | Ga0466971_0033639 | 3300044719 | Bacteria | 2296 |
| 748 | Ga0466971_0047363 | 3300044719 | Bacteria | 1932 |
| 749 | Ga0466968_0023135 | 3300044735 | Bacteria | 2529 |
| 750 | Ga0466968_0031434 | 3300044735 | Bacteria | 2202 |
| 751 | Ga0466970_0009727 | 3300044765 | Bacteria | 4865 |
| 752 | Ga0466970_0050042 | 3300044765 | Bacteria | 2228 |
| 753 | Ga0466957_0012573 | 3300044842 | Bacteria | 4900 |
| 754 | Ga0466957_0019692 | 3300044842 | Bacteria | 3969 |
| 755 | Ga0466960_0016831 | 3300044901 | Bacteria | 3178 |
| 756 | Ga0466960_0042006 | 3300044901 | Bacteria | 2169 |
| 757 | Ga0466960_0232415 | 3300044901 | Bacteria | 1018 |
| 758 | Ga0466959_0000424 | 3300045049 | Bacteria | 24579 |
| 759 | Ga0466959_0079880 | 3300045049 | Bacteria | 2358 |
| 760 | Ga0466959_0087107 | 3300045049 | Bacteria | 2246 |
| 761 | Ga0451576_0036167 | 3300045051 | Bacteria | 5236 |
| 762 | Ga0451576_0078392 | 3300045051 | Bacteria | 3438 |
| 763 | Ga0451576_0134961 | 3300045051 | Bacteria | 2573 |
| 764 | Ga0451576_0267711 | 3300045051 | Bacteria | 1786 |
| 765 | Ga0451576_0435673 | 3300045051 | Bacteria | 1375 |
| 766 | Ga0466958_0262389 | 3300045836 | Bacteria | 1106 |
| 767 | Ga0466967_0007150 | 3300045976 | Bacteria | 8013 |
| 768 | Ga0466967_0184518 | 3300045976 | Bacteria | 1969 |
| 769 | Ga0466967_0215366 | 3300045976 | Bacteria | 1823 |
| 770 | Ga0466967_0598066 | 3300045976 | Bacteria | 1088 |
| 771 | Ga0495590_0052281 | 3300046457 | Bacteria | 1427 |
| 772 | Ga0495629_0220557 | 3300046459 | Bacteria | 1308 |
| 773 | Ga0495638_0012776 | 3300046460 | Bacteria | 5738 |
| 774 | Ga0495638_0214307 | 3300046460 | Bacteria | 1080 |
| 775 | Ga0495650_0001952 | 3300046471 | Bacteria | 18228 |
| 776 | Ga0495650_0010282 | 3300046471 | Bacteria | 5233 |
| 777 | Ga0495582_0161148 | 3300046473 | Bacteria | 1276 |
| 778 | Ga0495605_0002292 | 3300046474 | Bacteria | 11951 |
| 779 | Ga0495605_0132957 | 3300046474 | Bacteria | 1121 |
| 780 | Ga0495585_0010595 | 3300046492 | Bacteria | 5481 |
| 781 | Ga0495585_0079639 | 3300046492 | Bacteria | 1777 |
| 782 | Ga0495594_0040077 | 3300046499 | Bacteria | 2562 |
| 783 | Ga0495607_0000044 | 3300046501 | Bacteria | 125410 |
| 784 | Ga0495583_0000034 | 3300046506 | Bacteria | 246856 |
| 785 | Ga0495606_0004244 | 3300046507 | Bacteria | 14497 |
| 786 | Ga0495610_0054381 | 3300046512 | Bacteria | 1934 |
| 787 | Ga0495631_0067422 | 3300046518 | Bacteria | 1548 |
| 788 | Ga0495632_0003922 | 3300046519 | Bacteria | 10332 |
| 789 | Ga0495632_0012106 | 3300046519 | Bacteria | 4991 |
| 790 | Ga0495643_0051137 | 3300046522 | Bacteria | 2223 |
| 791 | Ga0495666_0018480 | 3300046526 | Bacteria | 3469 |
| 792 | Ga0495597_0016564 | 3300046542 | Bacteria | 3480 |
| 793 | Ga0495597_0053924 | 3300046542 | Bacteria | 1767 |
| 794 | Ga0495645_0011842 | 3300046543 | Bacteria | 6145 |
| 795 | Ga0495622_0116063 | 3300046557 | Bacteria | 1224 |
| 796 | Ga0495668_0024868 | 3300046616 | Bacteria | 3405 |
| 797 | Ga0495668_0053052 | 3300046616 | Bacteria | 2243 |
| 798 | Ga0495625_0001672 | 3300046660 | Bacteria | 25960 |
| 799 | Ga0495625_0015803 | 3300046660 | Bacteria | 5959 |
| 800 | Ga0495625_0017804 | 3300046660 | Bacteria | 5553 |
| 801 | Ga0495625_0147050 | 3300046660 | Bacteria | 1586 |
| 802 | Ga0495661_0000223 | 3300046665 | Archaea | 65277 |
| 803 | Ga0495658_0073124 | 3300046683 | Bacteria | 1995 |
| 804 | Ga0495669_0004642 | 3300046684 | Bacteria | 5694 |
| 805 | Ga0495670_0142712 | 3300046691 | Bacteria | 1253 |
| 806 | Ga0495671_0031717 | 3300046692 | Bacteria | 2701 |
| 807 | Ga0495671_0091255 | 3300046692 | Bacteria | 1491 |
| 808 | Ga0495671_0114036 | 3300046692 | Bacteria | 1320 |
| 809 | Ga0495671_0156027 | 3300046692 | Bacteria | 1111 |
| 810 | Ga0495649_0000324 | 3300046694 | Bacteria | 41534 |
| 811 | Ga0495649_0000671 | 3300046694 | Bacteria | 27902 |
| 812 | Ga0495649_0004399 | 3300046694 | Bacteria | 9214 |
| 813 | Ga0495589_0098616 | 3300046794 | Bacteria | 1415 |
| 814 | Ga0495589_0149981 | 3300046794 | Bacteria | 1113 |
| 815 | Ga0495604_0027486 | 3300047317 | Bacteria | 4524 |
| 816 | Ga0495676_0058548 | 3300047321 | Bacteria | 3031 |
| 817 | Ga0495687_001419 | 3300047443 | Bacteria | 22047 |
| 818 | Ga0495687_011765 | 3300047443 | Bacteria | 4678 |
| 819 | Ga0495687_013134 | 3300047443 | Bacteria | 4336 |
| 820 | Ga0495673_0077964 | 3300047469 | Bacteria | 1379 |
| 821 | Ga0495684_0139253 | 3300047471 | Bacteria | 1820 |
| 822 | Ga0495686_0000988 | 3300047472 | Bacteria | 34672 |
| 823 | Ga0495626_0041866 | 3300048091 | Bacteria | 2154 |
| 824 | Ga0496102_0001217 | 3300048905 | Bacteria | 23346 |
| 825 | Ga0496102_0023496 | 3300048905 | Bacteria | 5477 |
| 826 | Ga0496104_0076976 | 3300048907 | Bacteria | 3178 |
| 827 | Ga0496107_0070361 | 3300048910 | Bacteria | 2540 |
| 828 | Ga0496108_0057028 | 3300048911 | Bacteria | 3282 |
| 829 | Ga0496109_0347864 | 3300048912 | Bacteria | 1400 |
| 830 | Ga0496109_0404843 | 3300048912 | Bacteria | 1289 |
| 831 | Ga0496110_0001725 | 3300048913 | Bacteria | 16100 |
| 832 | Ga0496114_0015814 | 3300048917 | Bacteria | 6072 |
| 833 | Ga0496114_0101704 | 3300048917 | Bacteria | 2454 |
| 834 | Ga0496121_0012277 | 3300048924 | Bacteria | 9376 |
| 835 | Ga0496121_0012411 | 3300048924 | Bacteria | 9299 |
| 836 | Ga0496123_0034818 | 3300048926 | Bacteria | 3599 |
| 837 | Ga0496124_0000108 | 3300048927 | Bacteria | 167473 |
| 838 | Ga0496124_0019272 | 3300048927 | Bacteria | 6358 |
| 839 | Ga0496124_0023176 | 3300048927 | Bacteria | 5673 |
| 840 | Ga0496124_0109268 | 3300048927 | Bacteria | 2229 |
| 841 | Ga0496125_0001189 | 3300048928 | Bacteria | 39370 |
| 842 | Ga0496125_0006406 | 3300048928 | Bacteria | 12743 |
| 843 | Ga0496125_0022269 | 3300048928 | Bacteria | 5888 |
| 844 | Ga0496125_0023763 | 3300048928 | Bacteria | 5651 |
| 845 | Ga0496125_0079710 | 3300048928 | Bacteria | 2510 |
| 846 | Ga0496125_0096368 | 3300048928 | Bacteria | 2196 |
| 847 | Ga0496126_0001477 | 3300048929 | Bacteria | 36534 |
| 848 | Ga0496126_0038262 | 3300048929 | Bacteria | 4466 |
| 849 | Ga0496126_0678718 | 3300048929 | Bacteria | 803 |
| 850 | Ga0501294_004908 | 3300049517 | Bacteria | 1264 |
| 851 | Ga0501031_0002015 | 3300049568 | Bacteria | 12792 |
| 852 | Ga0501031_0074212 | 3300049568 | Bacteria | 2215 |
| 853 | Ga0501031_0132915 | 3300049568 | Bacteria | 1625 |
| 854 | Ga0501031_0292429 | 3300049568 | Bacteria | 1056 |
| 855 | Ga0501032_0236070 | 3300049569 | Bacteria | 1188 |
| 856 | Ga0501033_0056527 | 3300049570 | Bacteria | 2900 |
| 857 | Ga0501034_0007498 | 3300049571 | Bacteria | 11602 |
| 858 | Ga0501034_0026574 | 3300049571 | Bacteria | 5894 |
| 859 | Ga0501036_0056015 | 3300049572 | Bacteria | 3340 |
| 860 | Ga0501037_0090190 | 3300049573 | Bacteria | 2218 |
| 861 | Ga0501037_0281425 | 3300049573 | Bacteria | 1159 |
| 862 | Ga0501037_0356111 | 3300049573 | Bacteria | 1009 |
| 863 | Ga0501038_0035777 | 3300049574 | Bacteria | 4359 |
| 864 | Ga0501039_0018752 | 3300049575 | Bacteria | 5311 |
| 865 | Ga0501040_0024046 | 3300049576 | Bacteria | 4088 |
| 866 | Ga0501041_0244979 | 3300049577 | Bacteria | 1126 |
| 867 | Ga0501043_0000002 | 3300049579 | Bacteria | 351081 |
| 868 | Ga0501043_0122242 | 3300049579 | Bacteria | 2042 |
| 869 | Ga0501046_0000008 | 3300049580 | Bacteria | 351167 |
| 870 | Ga0501046_0159709 | 3300049580 | Bacteria | 1696 |
| 871 | Ga0501046_0196977 | 3300049580 | Bacteria | 1500 |
| 872 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 873 | Ga0501048_0000983 | 3300049582 | Bacteria | 21145 |
| 874 | Ga0501048_0044213 | 3300049582 | Bacteria | 3186 |
| 875 | Ga0501048_0086449 | 3300049582 | Bacteria | 2212 |
| 876 | Ga0501068_0215809 | 3300049584 | Bacteria | 1219 |
| 877 | Ga0501070_0037789 | 3300049586 | Bacteria | 4030 |
| 878 | Ga0501072_0179833 | 3300049588 | Bacteria | 1687 |
| 879 | Ga0501073_0262420 | 3300049589 | Bacteria | 1192 |
| 880 | Ga0501075_0184131 | 3300049591 | Bacteria | 1593 |
| 881 | Ga0501077_0131892 | 3300049593 | Bacteria | 1584 |
| 882 | Ga0501198_000024 | 3300049649 | Bacteria | 67171 |
| 883 | Ga0501202_004215 | 3300049652 | Bacteria | 2512 |
| 884 | Ga0501206_005518 | 3300049653 | Bacteria | 1628 |
| 885 | Ga0501222_000020 | 3300049662 | Bacteria | 67164 |
| 886 | Ga0501222_005361 | 3300049662 | Bacteria | 1732 |
| 887 | Ga0501223_035016 | 3300049663 | Bacteria | 977 |
| 888 | Ga0501233_014551 | 3300049668 | Bacteria | 1609 |
| 889 | Ga0501235_007166 | 3300049669 | Bacteria | 2430 |
| 890 | Ga0501255_001464 | 3300049684 | Bacteria | 1911 |
| 891 | Ga0501221_002008 | 3300049704 | Bacteria | 3393 |
| 892 | Ga0501229_000186 | 3300049706 | Bacteria | 6655 |
| 893 | Ga0501079_0156374 | 3300049741 | Bacteria | 1777 |
| 894 | Ga0501079_0186934 | 3300049741 | Bacteria | 1617 |
| 895 | Ga0501080_0421860 | 3300049742 | Bacteria | 1198 |
| 896 | Ga0501081_0031033 | 3300049743 | Bacteria | 3621 |
| 897 | Ga0501265_000443 | 3300049762 | Bacteria | 4352 |
| 898 | Ga0501266_000075 | 3300049763 | Bacteria | 12913 |
| 899 | Ga0501273_018696 | 3300049770 | Bacteria | 924 |
| 900 | Ga0501035_0353626 | 3300049822 | Bacteria | 1229 |
| 901 | Ga0501035_0510410 | 3300049822 | Bacteria | 989 |
| 902 | Ga0501044_0134313 | 3300049823 | Bacteria | 2466 |
| 903 | Ga0501044_0140116 | 3300049823 | Bacteria | 2407 |
| 904 | Ga0501045_0001581 | 3300049824 | Bacteria | 15187 |
| 905 | Ga0501045_0090202 | 3300049824 | Bacteria | 2265 |
| 906 | nmdc:mga03683_128920_c1 | 3300050489 | Bacteria | 1130 |
| 907 | nmdc:mga03683_29418_c1 | 3300050489 | Bacteria | 2191 |
| 908 | nmdc:mga03683_2990_c1 | 3300050489 | Bacteria | 4138 |
| 909 | nmdc:mga03683_40775_c1 | 3300050489 | Bacteria | 1905 |
| 910 | nmdc:mga03683_46636_c1 | 3300050489 | Bacteria | 1797 |
| 911 | nmdc:mga03683_98275_c1 | 3300050489 | Bacteria | 1284 |
| 912 | nmdc:mga00v17_121220_c1 | 3300050491 | Bacteria | 1665 |
| 913 | nmdc:mga00v17_17442_c1 | 3300050491 | Bacteria | 4065 |
| 914 | nmdc:mga00v17_192813_c1 | 3300050491 | Bacteria | 1316 |
| 915 | nmdc:mga00v17_32530_c1 | 3300050491 | Bacteria | 3084 |
| 916 | nmdc:mga00v17_6284_c1 | 3300050491 | Bacteria | 6297 |
| 917 | nmdc:mga00v17_8113_c1 | 3300050491 | Bacteria | 5636 |
| 918 | nmdc:mga0yw44_26115_c1 | 3300050492 | Bacteria | 3332 |
| 919 | nmdc:mga0yw44_405660_c1 | 3300050492 | Bacteria | 922 |
| 920 | nmdc:mga0k408_124890_c1 | 3300050493 | Bacteria | 1526 |
| 921 | nmdc:mga0k408_131034_c1 | 3300050493 | Bacteria | 1489 |
| 922 | nmdc:mga0k408_1570_c1 | 3300050493 | Bacteria | 12344 |
| 923 | nmdc:mga0k408_1611_c1 | 3300050493 | Bacteria | 12218 |
| 924 | nmdc:mga0k408_213_c1 | 3300050493 | Bacteria | 31180 |
| 925 | nmdc:mga0k408_2767_c1 | 3300050493 | Bacteria | 9325 |
| 926 | nmdc:mga0k408_302_c1 | 3300050493 | Bacteria | 26707 |
| 927 | nmdc:mga0k408_31417_c1 | 3300050493 | Bacteria | 3032 |
| 928 | nmdc:mga0k408_3792_c1 | 3300050493 | Bacteria | 8010 |
| 929 | nmdc:mga0k408_8381_c1 | 3300050493 | Bacteria | 5544 |
| 930 | nmdc:mga0k408_83946_c1 | 3300050493 | Bacteria | 1868 |
| 931 | nmdc:mga06z11_155652_c1 | 3300050494 | Bacteria | 1303 |
| 932 | nmdc:mga06z11_199777_c1 | 3300050494 | Bacteria | 1161 |
| 933 | nmdc:mga06z11_27335_c1 | 3300050494 | Bacteria | 2727 |
| 934 | nmdc:mga06z11_7906_c1 | 3300050494 | Bacteria | 4403 |
| 935 | nmdc:mga06z11_83057_c1 | 3300050494 | Bacteria | 1723 |
| 936 | nmdc:mga04h51_51263_c1 | 3300050495 | Bacteria | 1386 |
| 937 | nmdc:mga07m45_106428_c1 | 3300050496 | Bacteria | 1613 |
| 938 | nmdc:mga07m45_11126_c1 | 3300050496 | Bacteria | 4721 |
| 939 | nmdc:mga07m45_11434_c1 | 3300050496 | Bacteria | 4663 |
| 940 | nmdc:mga07m45_118303_c1 | 3300050496 | Bacteria | 1530 |
| 941 | nmdc:mga07m45_1209_c1 | 3300050496 | Bacteria | 11695 |
| 942 | nmdc:mga07m45_1376_c1 | 3300050496 | Bacteria | 11088 |
| 943 | nmdc:mga07m45_15735_c1 | 3300050496 | Bacteria | 4042 |
| 944 | nmdc:mga07m45_18652_c1 | 3300050496 | Bacteria | 3751 |
| 945 | nmdc:mga07m45_2100_c1 | 3300050496 | Bacteria | 9260 |
| 946 | nmdc:mga07m45_257_c1 | 3300050496 | Bacteria | 21611 |
| 947 | nmdc:mga07m45_270029_c1 | 3300050496 | Bacteria | 989 |
| 948 | nmdc:mga07m45_3296_c1 | 3300050496 | Bacteria | 7770 |
| 949 | nmdc:mga07m45_401_c1 | 3300050496 | Bacteria | 17879 |
| 950 | nmdc:mga07m45_4997_c1 | 3300050496 | Bacteria | 6549 |
| 951 | nmdc:mga07m45_869_c1 | 3300050496 | Bacteria | 13176 |
| 952 | nmdc:mga05p37_1554_c1 | 3300050507 | Bacteria | 26686 |
| 953 | nmdc:mga09592_140995_c1 | 3300050508 | Bacteria | 2078 |
| 954 | nmdc:mga09592_25627_c1 | 3300050508 | Bacteria | 4883 |
| 955 | nmdc:mga09592_357_c1 | 3300050508 | Bacteria | 33391 |
| 956 | nmdc:mga09592_76250_c1 | 3300050508 | Bacteria | 2851 |
| 957 | nmdc:mga0qj67_118120_c1 | 3300050509 | Bacteria | 2144 |
| 958 | nmdc:mga0qj67_210864_c1 | 3300050509 | Bacteria | 1578 |
| 959 | nmdc:mga06r32_18169_c1 | 3300050510 | Bacteria | 6433 |
| 960 | nmdc:mga06r32_270778_c1 | 3300050510 | Bacteria | 1686 |
| 961 | nmdc:mga06r32_46479_c1 | 3300050510 | Bacteria | 4142 |
| 962 | nmdc:mga06r32_77840_c1 | 3300050510 | Bacteria | 3222 |
| 963 | nmdc:mga08y16_249543_c1 | 3300050511 | Bacteria | 1834 |
| 964 | nmdc:mga0n895_209520_c1 | 3300050512 | Bacteria | 1980 |
| 965 | nmdc:mga0rr50_205561_c1 | 3300050513 | Bacteria | 1620 |
| 966 | nmdc:mga0rr50_37854_c1 | 3300050513 | Bacteria | 3486 |
| 967 | nmdc:mga0rr50_89493_c1 | 3300050513 | Bacteria | 2393 |
| 968 | nmdc:mga08x19_127169_c1 | 3300050514 | Bacteria | 1712 |
| 969 | nmdc:mga08x19_24472_c1 | 3300050514 | Bacteria | 3753 |
| 970 | nmdc:mga0a205_137891_c1 | 3300050515 | Bacteria | 2339 |
| 971 | nmdc:mga0a205_320677_c1 | 3300050515 | Bacteria | 1420 |
| 972 | nmdc:mga0a205_9263_c1 | 3300050515 | Bacteria | 8993 |
| 973 | nmdc:mga0sz30_58151_c1 | 3300050516 | Bacteria | 1648 |
| 974 | nmdc:mga0sz30_73041_c1 | 3300050516 | Bacteria | 1478 |
| 975 | nmdc:mga0sz30_8224_c1 | 3300050516 | Bacteria | 3933 |
| 976 | Ga0500635_0000008 | 3300053080 | Bacteria | 167327 |
| 977 | Ga0500635_0016953 | 3300053080 | Bacteria | 2174 |
| 978 | Ga0500578_0000025 | 3300053086 | Bacteria | 151485 |
| 979 | Ga0500578_0014283 | 3300053086 | Bacteria | 5110 |
| 980 | Ga0500578_0090581 | 3300053086 | Bacteria | 1941 |
| 981 | Ga0500644_0023781 | 3300053088 | Bacteria | 1865 |
| 982 | Ga0500644_0076499 | 3300053088 | Bacteria | 1220 |
| 983 | Ga0500644_0136260 | 3300053088 | Bacteria | 971 |
| 984 | Ga0500583_0048284 | 3300053092 | Bacteria | 1964 |
| 985 | Ga0500651_0061141 | 3300053093 | Bacteria | 2353 |
| 986 | Ga0500566_0130643 | 3300053094 | Bacteria | 1344 |
| 987 | Ga0500641_0002690 | 3300053096 | Bacteria | 6280 |
| 988 | Ga0500593_000047 | 3300053117 | Bacteria | 42992 |
| 989 | Ga0500594_0000969 | 3300053118 | Bacteria | 6170 |
| 990 | Ga0500642_0030457 | 3300053130 | Bacteria | 2245 |
| 991 | Ga0500642_0084850 | 3300053130 | Bacteria | 1459 |
| 992 | Ga0500652_000682 | 3300053131 | Bacteria | 11525 |
| 993 | Ga0500655_006155 | 3300053133 | Bacteria | 2162 |
| 994 | Ga0500658_0001671 | 3300053134 | Bacteria | 8812 |
| 995 | Ga0500658_0021676 | 3300053134 | Bacteria | 2436 |
| 996 | Ga0500658_0046838 | 3300053134 | Bacteria | 1753 |
| 997 | Ga0500658_0092454 | 3300053134 | Bacteria | 1310 |
| 998 | Ga0500559_0000013 | 3300053136 | Bacteria | 163436 |
| 999 | Ga0500568_0001263 | 3300053139 | Bacteria | 16721 |
| 1000 | Ga0500616_0010218 | 3300053153 | Bacteria | 5630 |
| 1001 | Ga0500620_004765 | 3300053155 | Bacteria | 3068 |
| 1002 | Ga0500622_0000087 | 3300053156 | Bacteria | 98385 |
| 1003 | Ga0500622_0002441 | 3300053156 | Bacteria | 13419 |
| 1004 | Ga0500622_0005795 | 3300053156 | Bacteria | 7323 |
| 1005 | Ga0500633_0091737 | 3300053160 | Bacteria | 1110 |
| 1006 | Ga0500636_0005063 | 3300053177 | Bacteria | 7481 |
| 1007 | Ga0500636_0030670 | 3300053177 | Bacteria | 3182 |
| 1008 | Ga0500645_001614 | 3300053730 | Bacteria | 11168 |
| 1009 | Ga0500552_000398 | 3300053733 | Bacteria | 3990 |
| 1010 | Ga0500587_000050 | 3300053739 | Bacteria | 9871 |
| 1011 | Ga0500587_000704 | 3300053739 | Bacteria | 4275 |
| 1012 | Ga0501082_0022351 | 3300060353 | Bacteria | 5448 |
| 1013 | Ga0501082_0058818 | 3300060353 | Bacteria | 3312 |
| 1014 | Ga0466962_0021520 | 3300061719 | Bacteria | 3096 |
| 1015 | Ga0466962_0024752 | 3300061719 | Bacteria | 2882 |
| 1016 | Ga0466962_0092207 | 3300061719 | Bacteria | 1452 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049770 | Ga0501273_018696 | Ga0501273_018696_176_913 | 213 |
| 2 | 3300053088 | Ga0500644_0136260 | Ga0500644_0136260_52_726 | 217 |
| 3 | 3300026035 | Ga0207703_10381503 | Ga0207703_103815032 | 222 |
| 4 | 3300050491 | nmdc:mga00v17_121220_c1 | nmdc:mga00v17_121220_c1_973_1653 | 224 |
| 5 | 3300050492 | nmdc:mga0yw44_405660_c1 | nmdc:mga0yw44_405660_c1_91_822 | 235 |
| 6 | 3300025922 | Ga0207646_10522289 | Ga0207646_105222891 | 236 |
| 7 | 3300009094 | Ga0111539_10671687 | Ga0111539_106716871 | 237 |
| 8 | 3300048929 | Ga0496126_0678718 | Ga0496126_0678718_23_757 | 237 |
| 9 | 3300049569 | Ga0501032_0236070 | Ga0501032_0236070_406_1170 | 237 |
| 10 | 3300042123 | Ga0450921_000418 | Ga0450921_000418_155_877 | 240 |
| 11 | 3300031548 | Ga0307408_100039098 | Ga0307408_1000390982 | 244 |
| 12 | 3300031911 | Ga0307412_10416480 | Ga0307412_104164801 | 244 |
| 13 | 3300049653 | Ga0501206_005518 | Ga0501206_005518_360_1178 | 244 |
| 14 | 3300049762 | Ga0501265_000443 | Ga0501265_000443_241_1104 | 244 |
| 15 | 3300006195 | Ga0075366_10001135 | Ga0075366_1000113511 | 245 |
| 16 | 3300006195 | Ga0075366_10345988 | Ga0075366_103459881 | 245 |
| 17 | 3300006353 | Ga0075370_10005682 | Ga0075370_100056823 | 245 |
| 18 | 3300050493 | nmdc:mga0k408_1611_c1 | nmdc:mga0k408_1611_c1_5386_6201 | 245 |
| 19 | 3300050496 | nmdc:mga07m45_401_c1 | nmdc:mga07m45_401_c1_3044_3859 | 245 |
| 20 | 3300025910 | Ga0207684_10184701 | Ga0207684_101847011 | 246 |
| 21 | 3300031730 | Ga0307516_10000290 | Ga0307516_1000029017 | 246 |
| 22 | 3300049568 | Ga0501031_0002015 | Ga0501031_0002015_9275_10090 | 246 |
| 23 | 3300033180 | Ga0307510_10098226 | Ga0307510_100982262 | 247 |
| 24 | 3300046543 | Ga0495645_0011842 | Ga0495645_0011842_1097_1912 | 247 |
| 25 | 3300031507 | Ga0307509_10097488 | Ga0307509_100974882 | 248 |
| 26 | 3300046459 | Ga0495629_0220557 | Ga0495629_0220557_238_1140 | 248 |
| 27 | 3300046473 | Ga0495582_0161148 | Ga0495582_0161148_293_1108 | 248 |
| 28 | 3300046557 | Ga0495622_0116063 | Ga0495622_0116063_254_1156 | 248 |
| 29 | 3300047321 | Ga0495676_0058548 | Ga0495676_0058548_341_1156 | 248 |
| 30 | 3300047472 | Ga0495686_0000988 | Ga0495686_0000988_4182_4997 | 248 |
| 31 | 3300006178 | Ga0075367_10114561 | Ga0075367_101145612 | 250 |
| 32 | 3300006048 | Ga0075363_100009854 | Ga0075363_1000098543 | 251 |
| 33 | 3300006353 | Ga0075370_10000282 | Ga0075370_100002826 | 251 |
| 34 | 3300050496 | nmdc:mga07m45_11434_c1 | nmdc:mga07m45_11434_c1_1149_1994 | 251 |
| 35 | iso_pu_bacteria | 2857542790 | 2857543007 | 253 |
| 36 | 3300005336 | Ga0070680_100290611 | Ga0070680_1002906112 | 254 |
| 37 | 3300005353 | Ga0070669_100189807 | Ga0070669_1001898072 | 254 |
| 38 | 3300005441 | Ga0070700_100057858 | Ga0070700_1000578582 | 254 |
| 39 | 3300005456 | Ga0070678_100494243 | Ga0070678_1004942432 | 254 |
| 40 | 3300005543 | Ga0070672_100254964 | Ga0070672_1002549643 | 254 |
| 41 | 3300005545 | Ga0070695_100132662 | Ga0070695_1001326622 | 254 |
| 42 | 3300005840 | Ga0068870_10020755 | Ga0068870_100207551 | 254 |
| 43 | 3300005844 | Ga0068862_100002346 | Ga0068862_10000234617 | 254 |
| 44 | 3300006844 | Ga0075428_100005985 | Ga0075428_10000598514 | 254 |
| 45 | 3300006844 | Ga0075428_100143532 | Ga0075428_1001435321 | 254 |
| 46 | 3300006846 | Ga0075430_100085601 | Ga0075430_1000856012 | 254 |
| 47 | 3300006846 | Ga0075430_100230009 | Ga0075430_1002300093 | 254 |
| 48 | 3300006846 | Ga0075430_100404034 | Ga0075430_1004040343 | 254 |
| 49 | 3300006847 | Ga0075431_100048259 | Ga0075431_1000482593 | 254 |
| 50 | 3300006847 | Ga0075431_100068636 | Ga0075431_1000686363 | 254 |
| 51 | 3300006880 | Ga0075429_100097514 | Ga0075429_1000975144 | 254 |
| 52 | 3300009094 | Ga0111539_10395255 | Ga0111539_103952552 | 254 |
| 53 | 3300009176 | Ga0105242_10389265 | Ga0105242_103892652 | 254 |
| 54 | 3300009553 | Ga0105249_10091843 | Ga0105249_100918432 | 254 |
| 55 | 3300017792 | Ga0163161_10525912 | Ga0163161_105259121 | 254 |
| 56 | 3300025907 | Ga0207645_10000239 | Ga0207645_1000023921 | 254 |
| 57 | 3300025908 | Ga0207643_10021888 | Ga0207643_100218884 | 254 |
| 58 | 3300025923 | Ga0207681_10461679 | Ga0207681_104616791 | 254 |
| 59 | 3300025933 | Ga0207706_10000269 | Ga0207706_1000026911 | 254 |
| 60 | 3300025940 | Ga0207691_10027019 | Ga0207691_100270194 | 254 |
| 61 | 3300026089 | Ga0207648_10006738 | Ga0207648_100067383 | 254 |
| 62 | 3300026118 | Ga0207675_100000241 | Ga0207675_1000002415 | 254 |
| 63 | 3300027665 | Ga0209983_1001937 | Ga0209983_10019373 | 254 |
| 64 | 3300027682 | Ga0209971_1002797 | Ga0209971_10027973 | 254 |
| 65 | 3300027717 | Ga0209998_10000299 | Ga0209998_1000029911 | 254 |
| 66 | 3300027876 | Ga0209974_10001503 | Ga0209974_100015037 | 254 |
| 67 | 3300028380 | Ga0268265_10043519 | Ga0268265_100435192 | 254 |
| 68 | 3300050508 | nmdc:mga09592_140995_c1 | nmdc:mga09592_140995_c1_464_1228 | 254 |
| 69 | 3300050509 | nmdc:mga0qj67_118120_c1 | nmdc:mga0qj67_118120_c1_334_1098 | 254 |
| 70 | 3300050509 | nmdc:mga0qj67_210864_c1 | nmdc:mga0qj67_210864_c1_490_1254 | 254 |
| 71 | 3300050510 | nmdc:mga06r32_270778_c1 | nmdc:mga06r32_270778_c1_819_1583 | 254 |
| 72 | 3300050510 | nmdc:mga06r32_77840_c1 | nmdc:mga06r32_77840_c1_343_1107 | 254 |
| 73 | 3300006914 | Ga0075436_100228896 | Ga0075436_1002288962 | 255 |
| 74 | 3300007076 | Ga0075435_100115469 | Ga0075435_1001154692 | 255 |
| 75 | 3300050512 | nmdc:mga0n895_209520_c1 | nmdc:mga0n895_209520_c1_871_1638 | 255 |
| 76 | 3300050513 | nmdc:mga0rr50_37854_c1 | nmdc:mga0rr50_37854_c1_1247_2014 | 255 |
| 77 | 3300050514 | nmdc:mga08x19_127169_c1 | nmdc:mga08x19_127169_c1_19_786 | 255 |
| 78 | 3300050515 | nmdc:mga0a205_9263_c1 | nmdc:mga0a205_9263_c1_4179_4946 | 255 |
| 79 | 3300003215 | JGI25153J46596_10007844 | JGI25153J46596_100078442 | 257 |
| 80 | 3300025297 | Ga0209758_1000453 | Ga0209758_100045369 | 257 |
| 81 | 3300049649 | Ga0501198_000024 | Ga0501198_000024_3872_4702 | 257 |
| 82 | 3300049662 | Ga0501222_000020 | Ga0501222_000020_62488_63318 | 257 |
| 83 | 3300049742 | Ga0501080_0421860 | Ga0501080_0421860_377_1162 | 257 |
| 84 | 3300025940 | Ga0207691_10605176 | Ga0207691_106051761 | 258 |
| 85 | 3300049579 | Ga0501043_0000002 | Ga0501043_0000002_192778_193608 | 259 |
| 86 | 3300049580 | Ga0501046_0000008 | Ga0501046_0000008_192861_193691 | 259 |
| 87 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_216043_216873 | 259 |
| 88 | 3300049582 | Ga0501048_0000983 | Ga0501048_0000983_16435_17265 | 259 |
| 89 | 3300049823 | Ga0501044_0140116 | Ga0501044_0140116_986_1816 | 259 |
| 90 | 3300049824 | Ga0501045_0001581 | Ga0501045_0001581_12732_13562 | 259 |
| 91 | iso_pu_bacteria | 2585428062 | 2587758456 | 259 |
| 92 | iso_pu_bacteria | 2643221644 | 2644244857 | 259 |
| 93 | 3300047443 | Ga0495687_011765 | Ga0495687_011765_445_1275 | 260 |
| 94 | iso_pu_bacteria | 2585428057 | 2587725549 | 260 |
| 95 | iso_pu_bacteria | 2588253510 | 2588290549 | 260 |
| 96 | iso_pu_bacteria | 2643221544 | 2643743655 | 260 |
| 97 | iso_pu_bacteria | 2643221585 | 2643936581 | 260 |
| 98 | iso_pu_bacteria | 2643221592 | 2643970064 | 260 |
| 99 | iso_pu_bacteria | 2643221609 | 2644062411 | 260 |
| 100 | iso_pu_bacteria | 2643221611 | 2644071323 | 260 |
| 101 | iso_pu_bacteria | 2643221625 | 2644142962 | 260 |
| 102 | iso_pu_bacteria | 2643221639 | 2644222463 | 260 |
| 103 | iso_pu_bacteria | 2643221648 | 2644271978 | 260 |
| 104 | iso_pu_bacteria | 2643221654 | 2644303283 | 260 |
| 105 | iso_pu_bacteria | 2643221656 | 2644317937 | 260 |
| 106 | iso_pu_bacteria | 2738541337 | 2739058193 | 260 |
| 107 | iso_pu_bacteria | 2738543012 | 2739246475 | 260 |
| 108 | iso_pu_bacteria | 2816332133 | 2816471139 | 260 |
| 109 | iso_pu_bacteria | 2842718218 | 2842718781 | 260 |
| 110 | iso_pu_bacteria | 2919704043 | 2919704148 | 260 |
| 111 | iso_pu_bacteria | 2939631187 | 2939632121 | 260 |
| 112 | 3300006042 | Ga0075368_10048412 | Ga0075368_100484122 | 261 |
| 113 | 3300009147 | Ga0114129_10121865 | Ga0114129_101218654 | 261 |
| 114 | 3300006880 | Ga0075429_100025560 | Ga0075429_1000255605 | 262 |
| 115 | 3300009147 | Ga0114129_10114832 | Ga0114129_101148325 | 262 |
| 116 | 3300027614 | Ga0209970_1004215 | Ga0209970_10042153 | 262 |
| 117 | 3300027665 | Ga0209983_1001464 | Ga0209983_10014643 | 262 |
| 118 | 3300046694 | Ga0495649_0004399 | Ga0495649_0004399_4949_5779 | 262 |
| 119 | 3300048927 | Ga0496124_0109268 | Ga0496124_0109268_624_1451 | 262 |
| 120 | 3300050508 | nmdc:mga09592_76250_c1 | nmdc:mga09592_76250_c1_378_1187 | 262 |
| 121 | 3300050510 | nmdc:mga06r32_46479_c1 | nmdc:mga06r32_46479_c1_1109_1918 | 262 |
| 122 | iso_pu_bacteria | 2721755523 | 2722882036 | 262 |
| 123 | iso_pu_bacteria | 2839138175 | 2839142545 | 262 |
| 124 | 3300002705 | JGI25156J39149_1000474 | JGI25156J39149_10004746 | 263 |
| 125 | 3300002741 | JGI25157J39369_1000008 | JGI25157J39369_1000008102 | 263 |
| 126 | 3300003316 | rootH1_10046143 | rootH1_100461434 | 263 |
| 127 | 3300003320 | rootH2_10057619 | rootH2_100576196 | 263 |
| 128 | 3300003322 | rootL2_10105231 | rootL2_101052312 | 263 |
| 129 | 3300003323 | rootH1_10099221 | rootH1_100992212 | 263 |
| 130 | 3300003323 | rootH1_10111419 | rootH1_101114192 | 263 |
| 131 | 3300003752 | Ga0055539_1000425 | Ga0055539_100042511 | 263 |
| 132 | 3300003752 | Ga0055539_1000697 | Ga0055539_10006974 | 263 |
| 133 | 3300003756 | Ga0055533_1000040 | Ga0055533_1000040145 | 263 |
| 134 | 3300003759 | Ga0055525_1000566 | Ga0055525_10005668 | 263 |
| 135 | 3300003761 | Ga0055535_1000052 | Ga0055535_100005226 | 263 |
| 136 | 3300003763 | Ga0055529_1000053 | Ga0055529_1000053171 | 263 |
| 137 | 3300003775 | Ga0055524_1000247 | Ga0055524_100024738 | 263 |
| 138 | 3300003792 | Ga0055540_1000260 | Ga0055540_100026016 | 263 |
| 139 | 3300003794 | Ga0055531_10005151 | Ga0055531_100051517 | 263 |
| 140 | 3300005327 | Ga0070658_10048068 | Ga0070658_100480682 | 263 |
| 141 | 3300005327 | Ga0070658_10193722 | Ga0070658_101937222 | 263 |
| 142 | 3300005327 | Ga0070658_10256045 | Ga0070658_102560451 | 263 |
| 143 | 3300005330 | Ga0070690_100018751 | Ga0070690_1000187512 | 263 |
| 144 | 3300005333 | Ga0070677_10042789 | Ga0070677_100427892 | 263 |
| 145 | 3300005334 | Ga0068869_100057158 | Ga0068869_1000571582 | 263 |
| 146 | 3300005338 | Ga0068868_100005532 | Ga0068868_1000055325 | 263 |
| 147 | 3300005339 | Ga0070660_100024054 | Ga0070660_1000240543 | 263 |
| 148 | 3300005344 | Ga0070661_100000641 | Ga0070661_10000064117 | 263 |
| 149 | 3300005354 | Ga0070675_100001810 | Ga0070675_1000018106 | 263 |
| 150 | 3300005354 | Ga0070675_100394270 | Ga0070675_1003942701 | 263 |
| 151 | 3300005364 | Ga0070673_100007444 | Ga0070673_1000074442 | 263 |
| 152 | 3300005364 | Ga0070673_100008102 | Ga0070673_1000081023 | 263 |
| 153 | 3300005365 | Ga0070688_100088113 | Ga0070688_1000881132 | 263 |
| 154 | 3300005366 | Ga0070659_100002940 | Ga0070659_10000294015 | 263 |
| 155 | 3300005367 | Ga0070667_100178857 | Ga0070667_1001788572 | 263 |
| 156 | 3300005457 | Ga0070662_100001973 | Ga0070662_10000197318 | 263 |
| 157 | 3300005457 | Ga0070662_100054350 | Ga0070662_1000543502 | 263 |
| 158 | 3300005466 | Ga0070685_10115977 | Ga0070685_101159772 | 263 |
| 159 | 3300005535 | Ga0070684_100024883 | Ga0070684_1000248832 | 263 |
| 160 | 3300005543 | Ga0070672_100466918 | Ga0070672_1004669181 | 263 |
| 161 | 3300005548 | Ga0070665_100323715 | Ga0070665_1003237152 | 263 |
| 162 | 3300005563 | Ga0068855_100029384 | Ga0068855_1000293845 | 263 |
| 163 | 3300005563 | Ga0068855_100245298 | Ga0068855_1002452982 | 263 |
| 164 | 3300005564 | Ga0070664_100001233 | Ga0070664_10000123317 | 263 |
| 165 | 3300005577 | Ga0068857_100005237 | Ga0068857_1000052376 | 263 |
| 166 | 3300005578 | Ga0068854_100002868 | Ga0068854_10000286811 | 263 |
| 167 | 3300005614 | Ga0068856_100001987 | Ga0068856_10000198710 | 263 |
| 168 | 3300005616 | Ga0068852_100043187 | Ga0068852_1000431872 | 263 |
| 169 | 3300005616 | Ga0068852_100099690 | Ga0068852_1000996902 | 263 |
| 170 | 3300005616 | Ga0068852_100149454 | Ga0068852_1001494542 | 263 |
| 171 | 3300005616 | Ga0068852_100237412 | Ga0068852_1002374122 | 263 |
| 172 | 3300005618 | Ga0068864_100001083 | Ga0068864_10000108319 | 263 |
| 173 | 3300005841 | Ga0068863_100020774 | Ga0068863_1000207744 | 263 |
| 174 | 3300005841 | Ga0068863_100504205 | Ga0068863_1005042052 | 263 |
| 175 | 3300005842 | Ga0068858_100081732 | Ga0068858_1000817321 | 263 |
| 176 | 3300006163 | Ga0070715_10101356 | Ga0070715_101013561 | 263 |
| 177 | 3300006195 | Ga0075366_10010718 | Ga0075366_100107184 | 263 |
| 178 | 3300006195 | Ga0075366_10106828 | Ga0075366_101068282 | 263 |
| 179 | 3300006237 | Ga0097621_100161788 | Ga0097621_1001617882 | 263 |
| 180 | 3300006237 | Ga0097621_100181689 | Ga0097621_1001816892 | 263 |
| 181 | 3300006353 | Ga0075370_10002451 | Ga0075370_100024513 | 263 |
| 182 | 3300006353 | Ga0075370_10077033 | Ga0075370_100770332 | 263 |
| 183 | 3300006881 | Ga0068865_100051354 | Ga0068865_1000513542 | 263 |
| 184 | 3300006946 | Ga0079104_1000714 | Ga0079104_100071412 | 263 |
| 185 | 3300009093 | Ga0105240_10116664 | Ga0105240_101166642 | 263 |
| 186 | 3300009098 | Ga0105245_10373181 | Ga0105245_103731811 | 263 |
| 187 | 3300009176 | Ga0105242_10195169 | Ga0105242_101951691 | 263 |
| 188 | 3300009177 | Ga0105248_10062998 | Ga0105248_100629982 | 263 |
| 189 | 3300009177 | Ga0105248_10322965 | Ga0105248_103229652 | 263 |
| 190 | 3300009551 | Ga0105238_10326761 | Ga0105238_103267612 | 263 |
| 191 | 3300013105 | Ga0157369_10024567 | Ga0157369_100245672 | 263 |
| 192 | 3300013296 | Ga0157374_10214251 | Ga0157374_102142512 | 263 |
| 193 | 3300013297 | Ga0157378_10643519 | Ga0157378_106435192 | 263 |
| 194 | 3300013308 | Ga0157375_10026053 | Ga0157375_100260532 | 263 |
| 195 | 3300014325 | Ga0163163_10037755 | Ga0163163_100377552 | 263 |
| 196 | 3300014968 | Ga0157379_10040265 | Ga0157379_100402652 | 263 |
| 197 | 3300025226 | Ga0209674_100066 | Ga0209674_10006694 | 263 |
| 198 | 3300025228 | Ga0209672_106766 | Ga0209672_1067661 | 263 |
| 199 | 3300025230 | Ga0209563_100107 | Ga0209563_10010777 | 263 |
| 200 | 3300025231 | Ga0207427_100848 | Ga0207427_1008486 | 263 |
| 201 | 3300025242 | Ga0209258_100074 | Ga0209258_100074133 | 263 |
| 202 | 3300025242 | Ga0209258_101083 | Ga0209258_1010833 | 263 |
| 203 | 3300025246 | Ga0209646_1000039 | Ga0209646_1000039155 | 263 |
| 204 | 3300025250 | Ga0209026_1000006 | Ga0209026_1000006446 | 263 |
| 205 | 3300025253 | Ga0209677_100052 | Ga0209677_10005294 | 263 |
| 206 | 3300025253 | Ga0209677_100131 | Ga0209677_1001316 | 263 |
| 207 | 3300025253 | Ga0209677_102745 | Ga0209677_1027452 | 263 |
| 208 | 3300025256 | Ga0209759_1000020 | Ga0209759_1000020101 | 263 |
| 209 | 3300025256 | Ga0209759_1001101 | Ga0209759_100110112 | 263 |
| 210 | 3300025256 | Ga0209759_1001776 | Ga0209759_10017765 | 263 |
| 211 | 3300025272 | Ga0209455_1000066 | Ga0209455_1000066173 | 263 |
| 212 | 3300025298 | Ga0209050_1001662 | Ga0209050_10016626 | 263 |
| 213 | 3300025298 | Ga0209050_1016584 | Ga0209050_10165842 | 263 |
| 214 | 3300025299 | Ga0209256_1000049 | Ga0209256_100004936 | 263 |
| 215 | 3300025303 | Ga0209051_1000247 | Ga0209051_100024716 | 263 |
| 216 | 3300025303 | Ga0209051_1001846 | Ga0209051_10018462 | 263 |
| 217 | 3300025303 | Ga0209051_1054828 | Ga0209051_10548282 | 263 |
| 218 | 3300025304 | Ga0209257_1000141 | Ga0209257_100014116 | 263 |
| 219 | 3300025893 | Ga0207682_10044355 | Ga0207682_100443552 | 263 |
| 220 | 3300025905 | Ga0207685_10057319 | Ga0207685_100573192 | 263 |
| 221 | 3300025909 | Ga0207705_10051903 | Ga0207705_100519031 | 263 |
| 222 | 3300025909 | Ga0207705_10061679 | Ga0207705_100616792 | 263 |
| 223 | 3300025909 | Ga0207705_10152132 | Ga0207705_101521322 | 263 |
| 224 | 3300025913 | Ga0207695_10006803 | Ga0207695_100068034 | 263 |
| 225 | 3300025919 | Ga0207657_10026018 | Ga0207657_100260182 | 263 |
| 226 | 3300025919 | Ga0207657_10155305 | Ga0207657_101553052 | 263 |
| 227 | 3300025920 | Ga0207649_10000335 | Ga0207649_1000033536 | 263 |
| 228 | 3300025924 | Ga0207694_10032788 | Ga0207694_100327883 | 263 |
| 229 | 3300025932 | Ga0207690_10000176 | Ga0207690_1000017645 | 263 |
| 230 | 3300025932 | Ga0207690_10117344 | Ga0207690_101173442 | 263 |
| 231 | 3300025933 | Ga0207706_10005101 | Ga0207706_100051012 | 263 |
| 232 | 3300025934 | Ga0207686_10105189 | Ga0207686_101051892 | 263 |
| 233 | 3300025942 | Ga0207689_10007794 | Ga0207689_100077946 | 263 |
| 234 | 3300025945 | Ga0207679_10000168 | Ga0207679_1000016831 | 263 |
| 235 | 3300025949 | Ga0207667_10008762 | Ga0207667_100087628 | 263 |
| 236 | 3300025949 | Ga0207667_10027793 | Ga0207667_100277933 | 263 |
| 237 | 3300025960 | Ga0207651_10015741 | Ga0207651_100157412 | 263 |
| 238 | 3300025981 | Ga0207640_10004871 | Ga0207640_100048712 | 263 |
| 239 | 3300025986 | Ga0207658_10091760 | Ga0207658_100917602 | 263 |
| 240 | 3300026035 | Ga0207703_10140367 | Ga0207703_101403671 | 263 |
| 241 | 3300026078 | Ga0207702_10000310 | Ga0207702_1000031032 | 263 |
| 242 | 3300026088 | Ga0207641_10040044 | Ga0207641_100400442 | 263 |
| 243 | 3300026089 | Ga0207648_10189848 | Ga0207648_101898482 | 263 |
| 244 | 3300026089 | Ga0207648_10293309 | Ga0207648_102933091 | 263 |
| 245 | 3300026116 | Ga0207674_10019532 | Ga0207674_100195325 | 263 |
| 246 | 3300026118 | Ga0207675_100009646 | Ga0207675_1000096462 | 263 |
| 247 | 3300026142 | Ga0207698_10304799 | Ga0207698_103047991 | 263 |
| 248 | 3300026142 | Ga0207698_10542380 | Ga0207698_105423801 | 263 |
| 249 | 3300027111 | Ga0209281_1001190 | Ga0209281_100119011 | 263 |
| 250 | 3300027876 | Ga0209974_10018896 | Ga0209974_100188962 | 263 |
| 251 | 3300028666 | Ga0265336_10000024 | Ga0265336_1000002495 | 263 |
| 252 | 3300028794 | Ga0307515_10000477 | Ga0307515_1000047710 | 263 |
| 253 | 3300028794 | Ga0307515_10001774 | Ga0307515_1000177420 | 263 |
| 254 | 3300028794 | Ga0307515_10001873 | Ga0307515_1000187324 | 263 |
| 255 | 3300028794 | Ga0307515_10231694 | Ga0307515_102316942 | 263 |
| 256 | 3300029957 | Ga0265324_10000651 | Ga0265324_1000065110 | 263 |
| 257 | 3300030522 | Ga0307512_10062748 | Ga0307512_100627482 | 263 |
| 258 | 3300031456 | Ga0307513_10022921 | Ga0307513_100229216 | 263 |
| 259 | 3300031616 | Ga0307508_10000053 | Ga0307508_1000005369 | 263 |
| 260 | 3300031616 | Ga0307508_10230618 | Ga0307508_102306181 | 263 |
| 261 | 3300031649 | Ga0307514_10003555 | Ga0307514_1000355513 | 263 |
| 262 | 3300031730 | Ga0307516_10000676 | Ga0307516_1000067617 | 263 |
| 263 | 3300031730 | Ga0307516_10003323 | Ga0307516_100033234 | 263 |
| 264 | 3300033179 | Ga0307507_10166349 | Ga0307507_101663492 | 263 |
| 265 | 3300035086 | Ga0373934_0015566 | Ga0373934_0015566_1625_2512 | 263 |
| 266 | 3300035117 | Ga0373953_0110954 | Ga0373953_0110954_237_1052 | 263 |
| 267 | 3300037312 | Ga0395899_0047209 | Ga0395899_0047209_1940_2827 | 263 |
| 268 | 3300037466 | Ga0395898_0108462 | Ga0395898_0108462_960_1847 | 263 |
| 269 | 3300037471 | Ga0395905_0004023 | Ga0395905_0004023_8072_8902 | 263 |
| 270 | 3300037471 | Ga0395905_0011566 | Ga0395905_0011566_1785_2627 | 263 |
| 271 | 3300037471 | Ga0395905_0046448 | Ga0395905_0046448_2440_3303 | 263 |
| 272 | 3300038443 | Ga0395901_0068369 | Ga0395901_0068369_209_1096 | 263 |
| 273 | 3300041503 | Ga0451847_0578485 | Ga0451847_0578485_336_1151 | 263 |
| 274 | 3300042121 | Ga0450919_000354 | Ga0450919_000354_13_903 | 263 |
| 275 | 3300042146 | Ga0450907_015630 | Ga0450907_015630_52_921 | 263 |
| 276 | 3300042531 | Ga0450918_000406 | Ga0450918_000406_686_1501 | 263 |
| 277 | 3300044656 | Ga0466969_0019679 | Ga0466969_0019679_1667_2587 | 263 |
| 278 | 3300044658 | Ga0466972_0012887 | Ga0466972_0012887_522_1355 | 263 |
| 279 | 3300044683 | Ga0466965_0006671 | Ga0466965_0006671_1373_2293 | 263 |
| 280 | 3300044684 | Ga0466966_0008789 | Ga0466966_0008789_3920_4840 | 263 |
| 281 | 3300044693 | Ga0466961_0135237 | Ga0466961_0135237_12_932 | 263 |
| 282 | 3300044706 | Ga0466964_0043434 | Ga0466964_0043434_86_904 | 263 |
| 283 | 3300044706 | Ga0466964_0056995 | Ga0466964_0056995_501_1421 | 263 |
| 284 | 3300044719 | Ga0466971_0047363 | Ga0466971_0047363_160_1080 | 263 |
| 285 | 3300044735 | Ga0466968_0031434 | Ga0466968_0031434_30_863 | 263 |
| 286 | 3300044842 | Ga0466957_0019692 | Ga0466957_0019692_1374_2294 | 263 |
| 287 | 3300044901 | Ga0466960_0042006 | Ga0466960_0042006_1202_2035 | 263 |
| 288 | 3300044901 | Ga0466960_0232415 | Ga0466960_0232415_35_853 | 263 |
| 289 | 3300045049 | Ga0466959_0079880 | Ga0466959_0079880_954_1874 | 263 |
| 290 | 3300045051 | Ga0451576_0435673 | Ga0451576_0435673_65_901 | 263 |
| 291 | 3300045976 | Ga0466967_0184518 | Ga0466967_0184518_1039_1947 | 263 |
| 292 | 3300045976 | Ga0466967_0598066 | Ga0466967_0598066_87_1007 | 263 |
| 293 | 3300046471 | Ga0495650_0010282 | Ga0495650_0010282_1511_2401 | 263 |
| 294 | 3300046506 | Ga0495583_0000034 | Ga0495583_0000034_39156_40046 | 263 |
| 295 | 3300046507 | Ga0495606_0004244 | Ga0495606_0004244_13384_14274 | 263 |
| 296 | 3300046522 | Ga0495643_0051137 | Ga0495643_0051137_1128_1943 | 263 |
| 297 | 3300046616 | Ga0495668_0024868 | Ga0495668_0024868_120_1010 | 263 |
| 298 | 3300046660 | Ga0495625_0001672 | Ga0495625_0001672_12519_13334 | 263 |
| 299 | 3300046660 | Ga0495625_0015803 | Ga0495625_0015803_4930_5820 | 263 |
| 300 | 3300046684 | Ga0495669_0004642 | Ga0495669_0004642_4717_5607 | 263 |
| 301 | 3300046692 | Ga0495671_0091255 | Ga0495671_0091255_550_1365 | 263 |
| 302 | 3300046692 | Ga0495671_0156027 | Ga0495671_0156027_39_929 | 263 |
| 303 | 3300046694 | Ga0495649_0000324 | Ga0495649_0000324_8626_9516 | 263 |
| 304 | 3300046794 | Ga0495589_0098616 | Ga0495589_0098616_440_1330 | 263 |
| 305 | 3300048905 | Ga0496102_0001217 | Ga0496102_0001217_3599_4414 | 263 |
| 306 | 3300048907 | Ga0496104_0076976 | Ga0496104_0076976_1083_1979 | 263 |
| 307 | 3300048911 | Ga0496108_0057028 | Ga0496108_0057028_2256_3170 | 263 |
| 308 | 3300048912 | Ga0496109_0404843 | Ga0496109_0404843_116_931 | 263 |
| 309 | 3300048917 | Ga0496114_0015814 | Ga0496114_0015814_949_1764 | 263 |
| 310 | 3300048917 | Ga0496114_0101704 | Ga0496114_0101704_1055_1870 | 263 |
| 311 | 3300050493 | nmdc:mga0k408_3792_c1 | nmdc:mga0k408_3792_c1_3212_4099 | 263 |
| 312 | 3300050496 | nmdc:mga07m45_118303_c1 | nmdc:mga07m45_118303_c1_48_863 | 263 |
| 313 | 3300050496 | nmdc:mga07m45_2100_c1 | nmdc:mga07m45_2100_c1_7463_8305 | 263 |
| 314 | 3300050496 | nmdc:mga07m45_257_c1 | nmdc:mga07m45_257_c1_7260_8144 | 263 |
| 315 | 3300053080 | Ga0500635_0000008 | Ga0500635_0000008_96283_97164 | 263 |
| 316 | 3300053080 | Ga0500635_0016953 | Ga0500635_0016953_38_928 | 263 |
| 317 | 3300053117 | Ga0500593_000047 | Ga0500593_000047_16801_17616 | 263 |
| 318 | 3300053134 | Ga0500658_0021676 | Ga0500658_0021676_211_1026 | 263 |
| 319 | 3300053177 | Ga0500636_0005063 | Ga0500636_0005063_5734_6624 | 263 |
| 320 | 3300053739 | Ga0500587_000050 | Ga0500587_000050_4548_5363 | 263 |
| 321 | 3300061719 | Ga0466962_0024752 | Ga0466962_0024752_1110_2030 | 263 |
| 322 | 3300002077 | JGI24744J21845_10009944 | JGI24744J21845_100099442 | 264 |
| 323 | 3300003322 | rootL2_10068954 | rootL2_100689543 | 264 |
| 324 | 3300005262 | Ga0065165_1001775 | Ga0065165_100177514 | 264 |
| 325 | 3300005289 | Ga0065704_10083986 | Ga0065704_100839862 | 264 |
| 326 | 3300005328 | Ga0070676_10002205 | Ga0070676_100022052 | 264 |
| 327 | 3300005331 | Ga0070670_100003795 | Ga0070670_1000037958 | 264 |
| 328 | 3300005331 | Ga0070670_100105517 | Ga0070670_1001055172 | 264 |
| 329 | 3300005334 | Ga0068869_100002877 | Ga0068869_1000028773 | 264 |
| 330 | 3300005334 | Ga0068869_100116753 | Ga0068869_1001167531 | 264 |
| 331 | 3300005335 | Ga0070666_10140391 | Ga0070666_101403912 | 264 |
| 332 | 3300005337 | Ga0070682_100043594 | Ga0070682_1000435942 | 264 |
| 333 | 3300005338 | Ga0068868_100061412 | Ga0068868_1000614122 | 264 |
| 334 | 3300005338 | Ga0068868_100206684 | Ga0068868_1002066841 | 264 |
| 335 | 3300005353 | Ga0070669_100015088 | Ga0070669_1000150883 | 264 |
| 336 | 3300005354 | Ga0070675_100004319 | Ga0070675_1000043195 | 264 |
| 337 | 3300005354 | Ga0070675_100132024 | Ga0070675_1001320242 | 264 |
| 338 | 3300005355 | Ga0070671_100019262 | Ga0070671_1000192623 | 264 |
| 339 | 3300005356 | Ga0070674_100108635 | Ga0070674_1001086352 | 264 |
| 340 | 3300005366 | Ga0070659_100163683 | Ga0070659_1001636832 | 264 |
| 341 | 3300005367 | Ga0070667_100002153 | Ga0070667_10000215319 | 264 |
| 342 | 3300005367 | Ga0070667_100015286 | Ga0070667_1000152862 | 264 |
| 343 | 3300005367 | Ga0070667_100038770 | Ga0070667_1000387702 | 264 |
| 344 | 3300005441 | Ga0070700_100015534 | Ga0070700_1000155344 | 264 |
| 345 | 3300005445 | Ga0070708_100291361 | Ga0070708_1002913612 | 264 |
| 346 | 3300005455 | Ga0070663_100055129 | Ga0070663_1000551292 | 264 |
| 347 | 3300005456 | Ga0070678_100081246 | Ga0070678_1000812462 | 264 |
| 348 | 3300005457 | Ga0070662_100111253 | Ga0070662_1001112532 | 264 |
| 349 | 3300005459 | Ga0068867_100000361 | Ga0068867_10000036118 | 264 |
| 350 | 3300005459 | Ga0068867_100040595 | Ga0068867_1000405953 | 264 |
| 351 | 3300005459 | Ga0068867_100154649 | Ga0068867_1001546492 | 264 |
| 352 | 3300005467 | Ga0070706_100000700 | Ga0070706_10000070015 | 264 |
| 353 | 3300005468 | Ga0070707_100168390 | Ga0070707_1001683902 | 264 |
| 354 | 3300005518 | Ga0070699_100287994 | Ga0070699_1002879941 | 264 |
| 355 | 3300005543 | Ga0070672_100039742 | Ga0070672_1000397423 | 264 |
| 356 | 3300005543 | Ga0070672_100045822 | Ga0070672_1000458222 | 264 |
| 357 | 3300005548 | Ga0070665_100023087 | Ga0070665_1000230872 | 264 |
| 358 | 3300005548 | Ga0070665_100297310 | Ga0070665_1002973102 | 264 |
| 359 | 3300005548 | Ga0070665_100372521 | Ga0070665_1003725212 | 264 |
| 360 | 3300005564 | Ga0070664_100104792 | Ga0070664_1001047922 | 264 |
| 361 | 3300005577 | Ga0068857_100074071 | Ga0068857_1000740713 | 264 |
| 362 | 3300005577 | Ga0068857_100091846 | Ga0068857_1000918462 | 264 |
| 363 | 3300005616 | Ga0068852_100173328 | Ga0068852_1001733282 | 264 |
| 364 | 3300005616 | Ga0068852_100235020 | Ga0068852_1002350202 | 264 |
| 365 | 3300005617 | Ga0068859_100062296 | Ga0068859_1000622962 | 264 |
| 366 | 3300005618 | Ga0068864_100011312 | Ga0068864_1000113123 | 264 |
| 367 | 3300005618 | Ga0068864_100022017 | Ga0068864_1000220175 | 264 |
| 368 | 3300005718 | Ga0068866_10119507 | Ga0068866_101195071 | 264 |
| 369 | 3300005719 | Ga0068861_100000432 | Ga0068861_10000043217 | 264 |
| 370 | 3300005840 | Ga0068870_10033348 | Ga0068870_100333482 | 264 |
| 371 | 3300005841 | Ga0068863_100010775 | Ga0068863_10001077512 | 264 |
| 372 | 3300005843 | Ga0068860_100001815 | Ga0068860_10000181518 | 264 |
| 373 | 3300005843 | Ga0068860_100060541 | Ga0068860_1000605412 | 264 |
| 374 | 3300005844 | Ga0068862_100005522 | Ga0068862_1000055227 | 264 |
| 375 | 3300005844 | Ga0068862_100011728 | Ga0068862_1000117289 | 264 |
| 376 | 3300005844 | Ga0068862_100021433 | Ga0068862_1000214331 | 264 |
| 377 | 3300005937 | Ga0081455_10104159 | Ga0081455_101041592 | 264 |
| 378 | 3300006038 | Ga0075365_10003502 | Ga0075365_100035024 | 264 |
| 379 | 3300006038 | Ga0075365_10139894 | Ga0075365_101398942 | 264 |
| 380 | 3300006042 | Ga0075368_10001377 | Ga0075368_100013774 | 264 |
| 381 | 3300006042 | Ga0075368_10061110 | Ga0075368_100611102 | 264 |
| 382 | 3300006048 | Ga0075363_100004369 | Ga0075363_1000043695 | 264 |
| 383 | 3300006051 | Ga0075364_10003245 | Ga0075364_100032455 | 264 |
| 384 | 3300006051 | Ga0075364_10105816 | Ga0075364_101058162 | 264 |
| 385 | 3300006177 | Ga0075362_10010353 | Ga0075362_100103532 | 264 |
| 386 | 3300006177 | Ga0075362_10010485 | Ga0075362_100104852 | 264 |
| 387 | 3300006177 | Ga0075362_10087148 | Ga0075362_100871482 | 264 |
| 388 | 3300006177 | Ga0075362_10131051 | Ga0075362_101310511 | 264 |
| 389 | 3300006177 | Ga0075362_10229604 | Ga0075362_102296041 | 264 |
| 390 | 3300006178 | Ga0075367_10005203 | Ga0075367_100052032 | 264 |
| 391 | 3300006178 | Ga0075367_10015184 | Ga0075367_100151843 | 264 |
| 392 | 3300006178 | Ga0075367_10024789 | Ga0075367_100247892 | 264 |
| 393 | 3300006178 | Ga0075367_10039066 | Ga0075367_100390662 | 264 |
| 394 | 3300006186 | Ga0075369_10098265 | Ga0075369_100982651 | 264 |
| 395 | 3300006195 | Ga0075366_10001971 | Ga0075366_100019716 | 264 |
| 396 | 3300006195 | Ga0075366_10021594 | Ga0075366_100215942 | 264 |
| 397 | 3300006195 | Ga0075366_10031292 | Ga0075366_100312922 | 264 |
| 398 | 3300006195 | Ga0075366_10036943 | Ga0075366_100369432 | 264 |
| 399 | 3300006195 | Ga0075366_10079348 | Ga0075366_100793481 | 264 |
| 400 | 3300006195 | Ga0075366_10086781 | Ga0075366_100867812 | 264 |
| 401 | 3300006195 | Ga0075366_10094058 | Ga0075366_100940582 | 264 |
| 402 | 3300006195 | Ga0075366_10147127 | Ga0075366_101471272 | 264 |
| 403 | 3300006195 | Ga0075366_10155520 | Ga0075366_101555201 | 264 |
| 404 | 3300006237 | Ga0097621_100018679 | Ga0097621_1000186794 | 264 |
| 405 | 3300006237 | Ga0097621_100402153 | Ga0097621_1004021532 | 264 |
| 406 | 3300006353 | Ga0075370_10001386 | Ga0075370_100013866 | 264 |
| 407 | 3300006353 | Ga0075370_10007999 | Ga0075370_100079992 | 264 |
| 408 | 3300006353 | Ga0075370_10011111 | Ga0075370_100111112 | 264 |
| 409 | 3300006353 | Ga0075370_10018775 | Ga0075370_100187752 | 264 |
| 410 | 3300006353 | Ga0075370_10026524 | Ga0075370_100265242 | 264 |
| 411 | 3300006353 | Ga0075370_10045856 | Ga0075370_100458562 | 264 |
| 412 | 3300006358 | Ga0068871_100010307 | Ga0068871_1000103072 | 264 |
| 413 | 3300006846 | Ga0075430_100122047 | Ga0075430_1001220472 | 264 |
| 414 | 3300006880 | Ga0075429_100002595 | Ga0075429_10000259513 | 264 |
| 415 | 3300006881 | Ga0068865_100015222 | Ga0068865_1000152222 | 264 |
| 416 | 3300006931 | Ga0097620_100062296 | Ga0097620_1000622962 | 264 |
| 417 | 3300009093 | Ga0105240_10011702 | Ga0105240_100117022 | 264 |
| 418 | 3300009093 | Ga0105240_10047257 | Ga0105240_100472572 | 264 |
| 419 | 3300009098 | Ga0105245_10017446 | Ga0105245_100174464 | 264 |
| 420 | 3300009098 | Ga0105245_10539905 | Ga0105245_105399052 | 264 |
| 421 | 3300009148 | Ga0105243_10008363 | Ga0105243_100083632 | 264 |
| 422 | 3300009148 | Ga0105243_10131940 | Ga0105243_101319402 | 264 |
| 423 | 3300009148 | Ga0105243_10166684 | Ga0105243_101666842 | 264 |
| 424 | 3300009148 | Ga0105243_10224520 | Ga0105243_102245202 | 264 |
| 425 | 3300009176 | Ga0105242_10002298 | Ga0105242_1000229811 | 264 |
| 426 | 3300009176 | Ga0105242_10285201 | Ga0105242_102852012 | 264 |
| 427 | 3300009545 | Ga0105237_10001363 | Ga0105237_1000136330 | 264 |
| 428 | 3300009545 | Ga0105237_10005313 | Ga0105237_100053134 | 264 |
| 429 | 3300009551 | Ga0105238_10002436 | Ga0105238_1000243615 | 264 |
| 430 | 3300009553 | Ga0105249_10025991 | Ga0105249_100259912 | 264 |
| 431 | 3300010375 | Ga0105239_10000954 | Ga0105239_1000095438 | 264 |
| 432 | 3300010375 | Ga0105239_10032384 | Ga0105239_100323842 | 264 |
| 433 | 3300012497 | Ga0157319_1000003 | Ga0157319_100000347 | 264 |
| 434 | 3300013296 | Ga0157374_10365774 | Ga0157374_103657742 | 264 |
| 435 | 3300013297 | Ga0157378_10002482 | Ga0157378_1000248215 | 264 |
| 436 | 3300013297 | Ga0157378_10162573 | Ga0157378_101625732 | 264 |
| 437 | 3300013306 | Ga0163162_10001152 | Ga0163162_100011523 | 264 |
| 438 | 3300013308 | Ga0157375_10010232 | Ga0157375_100102323 | 264 |
| 439 | 3300013308 | Ga0157375_10024377 | Ga0157375_100243771 | 264 |
| 440 | 3300013308 | Ga0157375_10027684 | Ga0157375_100276842 | 264 |
| 441 | 3300013308 | Ga0157375_10326293 | Ga0157375_103262932 | 264 |
| 442 | 3300014325 | Ga0163163_10096037 | Ga0163163_100960372 | 264 |
| 443 | 3300014326 | Ga0157380_10201644 | Ga0157380_102016441 | 264 |
| 444 | 3300014745 | Ga0157377_10189368 | Ga0157377_101893681 | 264 |
| 445 | 3300014968 | Ga0157379_10080208 | Ga0157379_100802082 | 264 |
| 446 | 3300014968 | Ga0157379_10122780 | Ga0157379_101227802 | 264 |
| 447 | 3300014968 | Ga0157379_10150722 | Ga0157379_101507222 | 264 |
| 448 | 3300014969 | Ga0157376_10076251 | Ga0157376_100762512 | 264 |
| 449 | 3300021361 | Ga0213872_10000175 | Ga0213872_100001758 | 264 |
| 450 | 3300021361 | Ga0213872_10000735 | Ga0213872_1000073514 | 264 |
| 451 | 3300021361 | Ga0213872_10103969 | Ga0213872_101039692 | 264 |
| 452 | 3300025245 | Ga0207425_1000545 | Ga0207425_100054521 | 264 |
| 453 | 3300025258 | Ga0209129_1000294 | Ga0209129_100029437 | 264 |
| 454 | 3300025273 | Ga0209673_1007230 | Ga0209673_10072304 | 264 |
| 455 | 3300025295 | Ga0209564_1000003 | Ga0209564_100000322 | 264 |
| 456 | 3300025295 | Ga0209564_1000300 | Ga0209564_100030071 | 264 |
| 457 | 3300025297 | Ga0209758_1000605 | Ga0209758_100060552 | 264 |
| 458 | 3300025298 | Ga0209050_1001043 | Ga0209050_10010432 | 264 |
| 459 | 3300025299 | Ga0209256_1000150 | Ga0209256_10001507 | 264 |
| 460 | 3300025303 | Ga0209051_1011161 | Ga0209051_10111613 | 264 |
| 461 | 3300025304 | Ga0209257_1000318 | Ga0209257_100031893 | 264 |
| 462 | 3300025893 | Ga0207682_10037579 | Ga0207682_100375792 | 264 |
| 463 | 3300025907 | Ga0207645_10002245 | Ga0207645_1000224514 | 264 |
| 464 | 3300025908 | Ga0207643_10088422 | Ga0207643_100884222 | 264 |
| 465 | 3300025910 | Ga0207684_10020637 | Ga0207684_100206373 | 264 |
| 466 | 3300025913 | Ga0207695_10168773 | Ga0207695_101687732 | 264 |
| 467 | 3300025914 | Ga0207671_10006342 | Ga0207671_100063424 | 264 |
| 468 | 3300025914 | Ga0207671_10029236 | Ga0207671_100292364 | 264 |
| 469 | 3300025924 | Ga0207694_10137473 | Ga0207694_101374732 | 264 |
| 470 | 3300025925 | Ga0207650_10002178 | Ga0207650_1000217813 | 264 |
| 471 | 3300025925 | Ga0207650_10017432 | Ga0207650_100174323 | 264 |
| 472 | 3300025926 | Ga0207659_10119494 | Ga0207659_101194942 | 264 |
| 473 | 3300025926 | Ga0207659_10286481 | Ga0207659_102864811 | 264 |
| 474 | 3300025927 | Ga0207687_10006568 | Ga0207687_100065682 | 264 |
| 475 | 3300025927 | Ga0207687_10273821 | Ga0207687_102738212 | 264 |
| 476 | 3300025931 | Ga0207644_10016858 | Ga0207644_100168582 | 264 |
| 477 | 3300025932 | Ga0207690_10093091 | Ga0207690_100930912 | 264 |
| 478 | 3300025933 | Ga0207706_10204919 | Ga0207706_102049192 | 264 |
| 479 | 3300025935 | Ga0207709_10012031 | Ga0207709_100120313 | 264 |
| 480 | 3300025935 | Ga0207709_10099526 | Ga0207709_100995262 | 264 |
| 481 | 3300025937 | Ga0207669_10027794 | Ga0207669_100277942 | 264 |
| 482 | 3300025940 | Ga0207691_10007606 | Ga0207691_100076069 | 264 |
| 483 | 3300025940 | Ga0207691_10103118 | Ga0207691_101031182 | 264 |
| 484 | 3300025942 | Ga0207689_10011133 | Ga0207689_100111335 | 264 |
| 485 | 3300025942 | Ga0207689_10113104 | Ga0207689_101131041 | 264 |
| 486 | 3300025945 | Ga0207679_10118750 | Ga0207679_101187502 | 264 |
| 487 | 3300025960 | Ga0207651_10004284 | Ga0207651_100042843 | 264 |
| 488 | 3300025981 | Ga0207640_10126666 | Ga0207640_101266662 | 264 |
| 489 | 3300025986 | Ga0207658_10001079 | Ga0207658_100010794 | 264 |
| 490 | 3300026023 | Ga0207677_10041675 | Ga0207677_100416752 | 264 |
| 491 | 3300026023 | Ga0207677_10144971 | Ga0207677_101449712 | 264 |
| 492 | 3300026023 | Ga0207677_10370976 | Ga0207677_103709761 | 264 |
| 493 | 3300026041 | Ga0207639_10502004 | Ga0207639_105020042 | 264 |
| 494 | 3300026067 | Ga0207678_10031607 | Ga0207678_100316075 | 264 |
| 495 | 3300026075 | Ga0207708_10044187 | Ga0207708_100441872 | 264 |
| 496 | 3300026088 | Ga0207641_10009800 | Ga0207641_1000980011 | 264 |
| 497 | 3300026088 | Ga0207641_10323502 | Ga0207641_103235021 | 264 |
| 498 | 3300026089 | Ga0207648_10000393 | Ga0207648_1000039343 | 264 |
| 499 | 3300026089 | Ga0207648_10048470 | Ga0207648_100484703 | 264 |
| 500 | 3300026089 | Ga0207648_10234015 | Ga0207648_102340152 | 264 |
| 501 | 3300026095 | Ga0207676_10014656 | Ga0207676_100146566 | 264 |
| 502 | 3300026095 | Ga0207676_10051117 | Ga0207676_100511173 | 264 |
| 503 | 3300026116 | Ga0207674_10008702 | Ga0207674_100087028 | 264 |
| 504 | 3300026116 | Ga0207674_10070363 | Ga0207674_100703632 | 264 |
| 505 | 3300026118 | Ga0207675_100001788 | Ga0207675_10000178819 | 264 |
| 506 | 3300026121 | Ga0207683_10026363 | Ga0207683_100263633 | 264 |
| 507 | 3300026121 | Ga0207683_10190003 | Ga0207683_101900032 | 264 |
| 508 | 3300026142 | Ga0207698_10230812 | Ga0207698_102308122 | 264 |
| 509 | 3300026142 | Ga0207698_10409876 | Ga0207698_104098761 | 264 |
| 510 | 3300027526 | Ga0209968_1001023 | Ga0209968_10010232 | 264 |
| 511 | 3300027614 | Ga0209970_1000068 | Ga0209970_10000685 | 264 |
| 512 | 3300027695 | Ga0209966_1000035 | Ga0209966_100003547 | 264 |
| 513 | 3300027866 | Ga0209813_10002804 | Ga0209813_100028042 | 264 |
| 514 | 3300028379 | Ga0268266_10016016 | Ga0268266_100160167 | 264 |
| 515 | 3300028379 | Ga0268266_10297747 | Ga0268266_102977471 | 264 |
| 516 | 3300028380 | Ga0268265_10021206 | Ga0268265_100212062 | 264 |
| 517 | 3300028380 | Ga0268265_10042503 | Ga0268265_100425032 | 264 |
| 518 | 3300028381 | Ga0268264_10009229 | Ga0268264_100092292 | 264 |
| 519 | 3300028786 | Ga0307517_10063967 | Ga0307517_100639672 | 264 |
| 520 | 3300028786 | Ga0307517_10157710 | Ga0307517_101577102 | 264 |
| 521 | 3300028794 | Ga0307515_10018010 | Ga0307515_100180108 | 264 |
| 522 | 3300028794 | Ga0307515_10052957 | Ga0307515_100529574 | 264 |
| 523 | 3300028794 | Ga0307515_10071375 | Ga0307515_100713752 | 264 |
| 524 | 3300028794 | Ga0307515_10216759 | Ga0307515_102167592 | 264 |
| 525 | 3300030522 | Ga0307512_10023350 | Ga0307512_100233504 | 264 |
| 526 | 3300030522 | Ga0307512_10112528 | Ga0307512_101125281 | 264 |
| 527 | 3300031235 | Ga0265330_10000046 | Ga0265330_1000004658 | 264 |
| 528 | 3300031238 | Ga0265332_10000028 | Ga0265332_1000002855 | 264 |
| 529 | 3300031239 | Ga0265328_10026430 | Ga0265328_100264302 | 264 |
| 530 | 3300031247 | Ga0265340_10040751 | Ga0265340_100407512 | 264 |
| 531 | 3300031250 | Ga0265331_10012894 | Ga0265331_100128942 | 264 |
| 532 | 3300031251 | Ga0265327_10000042 | Ga0265327_10000042180 | 264 |
| 533 | 3300031251 | Ga0265327_10000419 | Ga0265327_100004196 | 264 |
| 534 | 3300031344 | Ga0265316_10000332 | Ga0265316_1000033241 | 264 |
| 535 | 3300031456 | Ga0307513_10011506 | Ga0307513_100115063 | 264 |
| 536 | 3300031507 | Ga0307509_10000063 | Ga0307509_1000006391 | 264 |
| 537 | 3300031507 | Ga0307509_10005231 | Ga0307509_100052318 | 264 |
| 538 | 3300031507 | Ga0307509_10018876 | Ga0307509_100188767 | 264 |
| 539 | 3300031507 | Ga0307509_10050207 | Ga0307509_100502072 | 264 |
| 540 | 3300031548 | Ga0307408_100000029 | Ga0307408_10000002998 | 264 |
| 541 | 3300031548 | Ga0307408_100105449 | Ga0307408_1001054492 | 264 |
| 542 | 3300031616 | Ga0307508_10000109 | Ga0307508_1000010910 | 264 |
| 543 | 3300031616 | Ga0307508_10037138 | Ga0307508_100371383 | 264 |
| 544 | 3300031616 | Ga0307508_10129989 | Ga0307508_101299892 | 264 |
| 545 | 3300031711 | Ga0265314_10000054 | Ga0265314_1000005455 | 264 |
| 546 | 3300031730 | Ga0307516_10042443 | Ga0307516_100424434 | 264 |
| 547 | 3300031730 | Ga0307516_10205000 | Ga0307516_102050002 | 264 |
| 548 | 3300031911 | Ga0307412_10091723 | Ga0307412_100917232 | 264 |
| 549 | 3300032004 | Ga0307414_10125240 | Ga0307414_101252402 | 264 |
| 550 | 3300032005 | Ga0307411_10000099 | Ga0307411_100000996 | 264 |
| 551 | 3300033179 | Ga0307507_10194813 | Ga0307507_101948132 | 264 |
| 552 | 3300033180 | Ga0307510_10006488 | Ga0307510_100064883 | 264 |
| 553 | 3300033180 | Ga0307510_10081052 | Ga0307510_100810522 | 264 |
| 554 | 3300033180 | Ga0307510_10126918 | Ga0307510_101269182 | 264 |
| 555 | 3300033180 | Ga0307510_10136225 | Ga0307510_101362252 | 264 |
| 556 | 3300034820 | Ga0373959_0006759 | Ga0373959_0006759_118_936 | 264 |
| 557 | 3300035091 | Ga0373951_0016550 | Ga0373951_0016550_83_901 | 264 |
| 558 | 3300035114 | Ga0373939_0000012 | Ga0373939_0000012_59688_60506 | 264 |
| 559 | 3300035121 | Ga0373960_0008082 | Ga0373960_0008082_254_1072 | 264 |
| 560 | 3300035691 | Ga0373931_0000235 | Ga0373931_0000235_2693_3511 | 264 |
| 561 | 3300035691 | Ga0373931_0001846 | Ga0373931_0001846_5151_6065 | 264 |
| 562 | 3300035691 | Ga0373931_0005977 | Ga0373931_0005977_2682_3629 | 264 |
| 563 | 3300037068 | Ga0373925_0317765 | Ga0373925_0317765_199_1014 | 264 |
| 564 | 3300037418 | Ga0395900_0000183 | Ga0395900_0000183_6924_7763 | 264 |
| 565 | 3300037418 | Ga0395900_0352392 | Ga0395900_0352392_81_923 | 264 |
| 566 | 3300037466 | Ga0395898_0002107 | Ga0395898_0002107_5835_6674 | 264 |
| 567 | 3300037466 | Ga0395898_0324776 | Ga0395898_0324776_84_917 | 264 |
| 568 | 3300037471 | Ga0395905_0000805 | Ga0395905_0000805_27935_28753 | 264 |
| 569 | 3300037471 | Ga0395905_0004208 | Ga0395905_0004208_1142_1975 | 264 |
| 570 | 3300039447 | Ga0436361_0027820 | Ga0436361_0027820_266_1096 | 264 |
| 571 | 3300039447 | Ga0436361_0105405 | Ga0436361_0105405_3333_4148 | 264 |
| 572 | 3300039447 | Ga0436361_0491913 | Ga0436361_0491913_3832_4674 | 264 |
| 573 | 3300039447 | Ga0436361_1221151 | Ga0436361_1221151_1565_2407 | 264 |
| 574 | 3300041408 | Ga0439453_0028120 | Ga0439453_0028120_22_858 | 264 |
| 575 | 3300041997 | Ga0439431_0001954 | Ga0439431_0001954_2007_2834 | 264 |
| 576 | 3300042004 | Ga0439445_0014021 | Ga0439445_0014021_280_1095 | 264 |
| 577 | 3300042115 | Ga0450911_000351 | Ga0450911_000351_4154_4969 | 264 |
| 578 | 3300042119 | Ga0450915_000577 | Ga0450915_000577_229_1047 | 264 |
| 579 | 3300042120 | Ga0450917_000046 | Ga0450917_000046_1242_2060 | 264 |
| 580 | 3300042126 | Ga0450888_000419 | Ga0450888_000419_1479_2297 | 264 |
| 581 | 3300042127 | Ga0450890_000389 | Ga0450890_000389_3330_4181 | 264 |
| 582 | 3300042127 | Ga0450890_008313 | Ga0450890_008313_341_1159 | 264 |
| 583 | 3300042129 | Ga0450891_000914 | Ga0450891_000914_184_1002 | 264 |
| 584 | 3300042138 | Ga0450903_003345 | Ga0450903_003345_1772_2590 | 264 |
| 585 | 3300042157 | Ga0439458_0013278 | Ga0439458_0013278_620_1447 | 264 |
| 586 | 3300042435 | Ga0439434_0021932 | Ga0439434_0021932_920_1747 | 264 |
| 587 | 3300042435 | Ga0439434_0033674 | Ga0439434_0033674_663_1493 | 264 |
| 588 | 3300042438 | Ga0439459_0031306 | Ga0439459_0031306_174_992 | 264 |
| 589 | 3300042530 | Ga0450916_000613 | Ga0450916_000613_557_1375 | 264 |
| 590 | 3300042876 | Ga0451577_0003091 | Ga0451577_0003091_9918_10748 | 264 |
| 591 | 3300042876 | Ga0451577_0011731 | Ga0451577_0011731_5356_6201 | 264 |
| 592 | 3300042876 | Ga0451577_0167433 | Ga0451577_0167433_472_1290 | 264 |
| 593 | 3300044656 | Ga0466969_0000020 | Ga0466969_0000020_53658_54488 | 264 |
| 594 | 3300044658 | Ga0466972_0017534 | Ga0466972_0017534_2108_2932 | 264 |
| 595 | 3300044683 | Ga0466965_0057642 | Ga0466965_0057642_477_1301 | 264 |
| 596 | 3300044683 | Ga0466965_0070808 | Ga0466965_0070808_471_1295 | 264 |
| 597 | 3300044683 | Ga0466965_0285624 | Ga0466965_0285624_20_850 | 264 |
| 598 | 3300044684 | Ga0466966_0003281 | Ga0466966_0003281_5769_6623 | 264 |
| 599 | 3300044684 | Ga0466966_0027606 | Ga0466966_0027606_964_1794 | 264 |
| 600 | 3300044693 | Ga0466961_0019410 | Ga0466961_0019410_2733_3587 | 264 |
| 601 | 3300044693 | Ga0466961_0037440 | Ga0466961_0037440_239_1069 | 264 |
| 602 | 3300044706 | Ga0466964_0003293 | Ga0466964_0003293_3565_4419 | 264 |
| 603 | 3300044719 | Ga0466971_0033639 | Ga0466971_0033639_1137_1991 | 264 |
| 604 | 3300044765 | Ga0466970_0050042 | Ga0466970_0050042_852_1706 | 264 |
| 605 | 3300044901 | Ga0466960_0016831 | Ga0466960_0016831_1437_2261 | 264 |
| 606 | 3300045049 | Ga0466959_0000424 | Ga0466959_0000424_14618_15472 | 264 |
| 607 | 3300045049 | Ga0466959_0087107 | Ga0466959_0087107_824_1654 | 264 |
| 608 | 3300045051 | Ga0451576_0134961 | Ga0451576_0134961_1554_2555 | 264 |
| 609 | 3300045836 | Ga0466958_0262389 | Ga0466958_0262389_161_991 | 264 |
| 610 | 3300045976 | Ga0466967_0007150 | Ga0466967_0007150_334_1188 | 264 |
| 611 | 3300045976 | Ga0466967_0215366 | Ga0466967_0215366_305_1174 | 264 |
| 612 | 3300046457 | Ga0495590_0052281 | Ga0495590_0052281_55_870 | 264 |
| 613 | 3300046460 | Ga0495638_0214307 | Ga0495638_0214307_113_928 | 264 |
| 614 | 3300046474 | Ga0495605_0132957 | Ga0495605_0132957_149_964 | 264 |
| 615 | 3300046492 | Ga0495585_0010595 | Ga0495585_0010595_3241_4143 | 264 |
| 616 | 3300046512 | Ga0495610_0054381 | Ga0495610_0054381_494_1309 | 264 |
| 617 | 3300046518 | Ga0495631_0067422 | Ga0495631_0067422_202_1017 | 264 |
| 618 | 3300046519 | Ga0495632_0003922 | Ga0495632_0003922_2549_3382 | 264 |
| 619 | 3300046519 | Ga0495632_0012106 | Ga0495632_0012106_3640_4455 | 264 |
| 620 | 3300046542 | Ga0495597_0016564 | Ga0495597_0016564_1019_1834 | 264 |
| 621 | 3300046542 | Ga0495597_0053924 | Ga0495597_0053924_733_1548 | 264 |
| 622 | 3300046616 | Ga0495668_0053052 | Ga0495668_0053052_959_1774 | 264 |
| 623 | 3300046660 | Ga0495625_0017804 | Ga0495625_0017804_3048_3863 | 264 |
| 624 | 3300046660 | Ga0495625_0147050 | Ga0495625_0147050_447_1262 | 264 |
| 625 | 3300046665 | Ga0495661_0000223 | Ga0495661_0000223_29177_29989 | 264 |
| 626 | 3300046692 | Ga0495671_0031717 | Ga0495671_0031717_1861_2691 | 264 |
| 627 | 3300046692 | Ga0495671_0114036 | Ga0495671_0114036_107_922 | 264 |
| 628 | 3300046694 | Ga0495649_0000671 | Ga0495649_0000671_374_1189 | 264 |
| 629 | 3300047443 | Ga0495687_001419 | Ga0495687_001419_4680_5495 | 264 |
| 630 | 3300047443 | Ga0495687_013134 | Ga0495687_013134_2819_3634 | 264 |
| 631 | 3300047469 | Ga0495673_0077964 | Ga0495673_0077964_178_993 | 264 |
| 632 | 3300047471 | Ga0495684_0139253 | Ga0495684_0139253_634_1449 | 264 |
| 633 | 3300048091 | Ga0495626_0041866 | Ga0495626_0041866_788_1603 | 264 |
| 634 | 3300048905 | Ga0496102_0023496 | Ga0496102_0023496_4308_5135 | 264 |
| 635 | 3300048912 | Ga0496109_0347864 | Ga0496109_0347864_191_1030 | 264 |
| 636 | 3300048913 | Ga0496110_0001725 | Ga0496110_0001725_9785_10636 | 264 |
| 637 | 3300048924 | Ga0496121_0012277 | Ga0496121_0012277_8409_9224 | 264 |
| 638 | 3300048924 | Ga0496121_0012411 | Ga0496121_0012411_4017_4850 | 264 |
| 639 | 3300048926 | Ga0496123_0034818 | Ga0496123_0034818_1182_1997 | 264 |
| 640 | 3300048927 | Ga0496124_0000108 | Ga0496124_0000108_148643_149476 | 264 |
| 641 | 3300048927 | Ga0496124_0019272 | Ga0496124_0019272_3969_4820 | 264 |
| 642 | 3300048927 | Ga0496124_0023176 | Ga0496124_0023176_4292_5107 | 264 |
| 643 | 3300048928 | Ga0496125_0001189 | Ga0496125_0001189_19457_20272 | 264 |
| 644 | 3300048928 | Ga0496125_0006406 | Ga0496125_0006406_3803_4618 | 264 |
| 645 | 3300048928 | Ga0496125_0022269 | Ga0496125_0022269_3249_4064 | 264 |
| 646 | 3300048928 | Ga0496125_0023763 | Ga0496125_0023763_3682_4515 | 264 |
| 647 | 3300048928 | Ga0496125_0096368 | Ga0496125_0096368_10_825 | 264 |
| 648 | 3300048929 | Ga0496126_0001477 | Ga0496126_0001477_6410_7225 | 264 |
| 649 | 3300049517 | Ga0501294_004908 | Ga0501294_004908_378_1196 | 264 |
| 650 | 3300049652 | Ga0501202_004215 | Ga0501202_004215_292_1110 | 264 |
| 651 | 3300049662 | Ga0501222_005361 | Ga0501222_005361_524_1342 | 264 |
| 652 | 3300049663 | Ga0501223_035016 | Ga0501223_035016_11_829 | 264 |
| 653 | 3300049668 | Ga0501233_014551 | Ga0501233_014551_357_1175 | 264 |
| 654 | 3300049669 | Ga0501235_007166 | Ga0501235_007166_870_1688 | 264 |
| 655 | 3300049684 | Ga0501255_001464 | Ga0501255_001464_243_1061 | 264 |
| 656 | 3300049704 | Ga0501221_002008 | Ga0501221_002008_1203_2021 | 264 |
| 657 | 3300049706 | Ga0501229_000186 | Ga0501229_000186_1296_2114 | 264 |
| 658 | 3300049763 | Ga0501266_000075 | Ga0501266_000075_929_1741 | 264 |
| 659 | 3300050489 | nmdc:mga03683_29418_c1 | nmdc:mga03683_29418_c1_309_1124 | 264 |
| 660 | 3300050489 | nmdc:mga03683_40775_c1 | nmdc:mga03683_40775_c1_807_1622 | 264 |
| 661 | 3300050489 | nmdc:mga03683_98275_c1 | nmdc:mga03683_98275_c1_108_923 | 264 |
| 662 | 3300050491 | nmdc:mga00v17_6284_c1 | nmdc:mga00v17_6284_c1_2433_3248 | 264 |
| 663 | 3300050491 | nmdc:mga00v17_8113_c1 | nmdc:mga00v17_8113_c1_833_1648 | 264 |
| 664 | 3300050492 | nmdc:mga0yw44_26115_c1 | nmdc:mga0yw44_26115_c1_2209_3024 | 264 |
| 665 | 3300050493 | nmdc:mga0k408_124890_c1 | nmdc:mga0k408_124890_c1_234_1064 | 264 |
| 666 | 3300050493 | nmdc:mga0k408_131034_c1 | nmdc:mga0k408_131034_c1_425_1240 | 264 |
| 667 | 3300050493 | nmdc:mga0k408_1570_c1 | nmdc:mga0k408_1570_c1_10564_11379 | 264 |
| 668 | 3300050493 | nmdc:mga0k408_213_c1 | nmdc:mga0k408_213_c1_26254_27069 | 264 |
| 669 | 3300050493 | nmdc:mga0k408_2767_c1 | nmdc:mga0k408_2767_c1_4993_5808 | 264 |
| 670 | 3300050493 | nmdc:mga0k408_302_c1 | nmdc:mga0k408_302_c1_11793_12608 | 264 |
| 671 | 3300050493 | nmdc:mga0k408_31417_c1 | nmdc:mga0k408_31417_c1_1620_2438 | 264 |
| 672 | 3300050493 | nmdc:mga0k408_83946_c1 | nmdc:mga0k408_83946_c1_798_1613 | 264 |
| 673 | 3300050494 | nmdc:mga06z11_155652_c1 | nmdc:mga06z11_155652_c1_21_836 | 264 |
| 674 | 3300050494 | nmdc:mga06z11_199777_c1 | nmdc:mga06z11_199777_c1_16_834 | 264 |
| 675 | 3300050494 | nmdc:mga06z11_27335_c1 | nmdc:mga06z11_27335_c1_1186_2001 | 264 |
| 676 | 3300050494 | nmdc:mga06z11_83057_c1 | nmdc:mga06z11_83057_c1_632_1447 | 264 |
| 677 | 3300050496 | nmdc:mga07m45_11126_c1 | nmdc:mga07m45_11126_c1_3672_4523 | 264 |
| 678 | 3300050496 | nmdc:mga07m45_1209_c1 | nmdc:mga07m45_1209_c1_3423_4238 | 264 |
| 679 | 3300050496 | nmdc:mga07m45_1376_c1 | nmdc:mga07m45_1376_c1_8781_9596 | 264 |
| 680 | 3300050496 | nmdc:mga07m45_15735_c1 | nmdc:mga07m45_15735_c1_808_1623 | 264 |
| 681 | 3300050496 | nmdc:mga07m45_18652_c1 | nmdc:mga07m45_18652_c1_234_1052 | 264 |
| 682 | 3300050496 | nmdc:mga07m45_270029_c1 | nmdc:mga07m45_270029_c1_75_890 | 264 |
| 683 | 3300050496 | nmdc:mga07m45_3296_c1 | nmdc:mga07m45_3296_c1_1738_2556 | 264 |
| 684 | 3300050496 | nmdc:mga07m45_869_c1 | nmdc:mga07m45_869_c1_8739_9554 | 264 |
| 685 | 3300050508 | nmdc:mga09592_25627_c1 | nmdc:mga09592_25627_c1_1437_2267 | 264 |
| 686 | 3300050516 | nmdc:mga0sz30_8224_c1 | nmdc:mga0sz30_8224_c1_2113_2928 | 264 |
| 687 | 3300053086 | Ga0500578_0000025 | Ga0500578_0000025_58622_59455 | 264 |
| 688 | 3300053086 | Ga0500578_0014283 | Ga0500578_0014283_1046_1861 | 264 |
| 689 | 3300053086 | Ga0500578_0090581 | Ga0500578_0090581_40_855 | 264 |
| 690 | 3300053088 | Ga0500644_0023781 | Ga0500644_0023781_982_1797 | 264 |
| 691 | 3300053092 | Ga0500583_0048284 | Ga0500583_0048284_1031_1846 | 264 |
| 692 | 3300053093 | Ga0500651_0061141 | Ga0500651_0061141_1273_2088 | 264 |
| 693 | 3300053118 | Ga0500594_0000969 | Ga0500594_0000969_251_1066 | 264 |
| 694 | 3300053130 | Ga0500642_0030457 | Ga0500642_0030457_429_1256 | 264 |
| 695 | 3300053131 | Ga0500652_000682 | Ga0500652_000682_2428_3261 | 264 |
| 696 | 3300053133 | Ga0500655_006155 | Ga0500655_006155_87_920 | 264 |
| 697 | 3300053134 | Ga0500658_0001671 | Ga0500658_0001671_3079_3894 | 264 |
| 698 | 3300053134 | Ga0500658_0092454 | Ga0500658_0092454_216_1049 | 264 |
| 699 | 3300053136 | Ga0500559_0000013 | Ga0500559_0000013_117585_118400 | 264 |
| 700 | 3300053156 | Ga0500622_0000087 | Ga0500622_0000087_85605_86438 | 264 |
| 701 | 3300053156 | Ga0500622_0002441 | Ga0500622_0002441_6798_7649 | 264 |
| 702 | 3300053156 | Ga0500622_0005795 | Ga0500622_0005795_1683_2498 | 264 |
| 703 | 3300053160 | Ga0500633_0091737 | Ga0500633_0091737_125_940 | 264 |
| 704 | 3300053177 | Ga0500636_0030670 | Ga0500636_0030670_556_1371 | 264 |
| 705 | 3300053730 | Ga0500645_001614 | Ga0500645_001614_6390_7292 | 264 |
| 706 | 3300053739 | Ga0500587_000704 | Ga0500587_000704_2972_3787 | 264 |
| 707 | 3300061719 | Ga0466962_0021520 | Ga0466962_0021520_1518_2372 | 264 |
| 708 | 3300061719 | Ga0466962_0092207 | Ga0466962_0092207_71_901 | 264 |
| 709 | iso_pu_bacteria | 2585428058 | 2587735017 | 264 |
| 710 | 3300005456 | Ga0070678_100414386 | Ga0070678_1004143862 | 265 |
| 711 | 3300009011 | Ga0105251_10028894 | Ga0105251_100288942 | 265 |
| 712 | 3300009092 | Ga0105250_10028986 | Ga0105250_100289862 | 265 |
| 713 | 3300013306 | Ga0163162_10030246 | Ga0163162_100302462 | 265 |
| 714 | 3300013308 | Ga0157375_10011836 | Ga0157375_100118366 | 265 |
| 715 | 3300021361 | Ga0213872_10000006 | Ga0213872_1000000610 | 265 |
| 716 | 3300025711 | Ga0207696_1030321 | Ga0207696_10303212 | 265 |
| 717 | 3300025941 | Ga0207711_10007438 | Ga0207711_100074386 | 265 |
| 718 | 3300026067 | Ga0207678_10034740 | Ga0207678_100347402 | 265 |
| 719 | 3300039447 | Ga0436361_0169339 | Ga0436361_0169339_16169_17032 | 265 |
| 720 | 3300046460 | Ga0495638_0012776 | Ga0495638_0012776_444_1274 | 265 |
| 721 | 3300046471 | Ga0495650_0001952 | Ga0495650_0001952_3329_4150 | 265 |
| 722 | 3300046474 | Ga0495605_0002292 | Ga0495605_0002292_3020_3850 | 265 |
| 723 | 3300046492 | Ga0495585_0079639 | Ga0495585_0079639_755_1585 | 265 |
| 724 | 3300046691 | Ga0495670_0142712 | Ga0495670_0142712_35_865 | 265 |
| 725 | 3300046794 | Ga0495589_0149981 | Ga0495589_0149981_36_968 | 265 |
| 726 | 3300048910 | Ga0496107_0070361 | Ga0496107_0070361_200_1030 | 265 |
| 727 | 3300005289 | Ga0065704_10122127 | Ga0065704_101221272 | 266 |
| 728 | 3300006946 | Ga0079104_1000055 | Ga0079104_100005592 | 266 |
| 729 | 3300009092 | Ga0105250_10000934 | Ga0105250_1000093412 | 266 |
| 730 | 3300009148 | Ga0105243_10010416 | Ga0105243_100104165 | 266 |
| 731 | 3300025711 | Ga0207696_1002314 | Ga0207696_10023142 | 266 |
| 732 | 3300025935 | Ga0207709_10000728 | Ga0207709_100007286 | 266 |
| 733 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007737 | 266 |
| 734 | 3300005544 | Ga0070686_100200796 | Ga0070686_1002007962 | 267 |
| 735 | 3300035119 | Ga0373956_0033580 | Ga0373956_0033580_702_1517 | 267 |
| 736 | 3300035172 | Ga0373955_0071786 | Ga0373955_0071786_1051_1866 | 267 |
| 737 | 3300005365 | Ga0070688_100322378 | Ga0070688_1003223781 | 268 |
| 738 | 3300005444 | Ga0070694_100112910 | Ga0070694_1001129101 | 268 |
| 739 | 3300005444 | Ga0070694_100147173 | Ga0070694_1001471732 | 268 |
| 740 | 3300005444 | Ga0070694_100623131 | Ga0070694_1006231311 | 268 |
| 741 | 3300005471 | Ga0070698_100021426 | Ga0070698_1000214266 | 268 |
| 742 | 3300005544 | Ga0070686_100124691 | Ga0070686_1001246912 | 268 |
| 743 | 3300005549 | Ga0070704_100015068 | Ga0070704_1000150683 | 268 |
| 744 | 3300006844 | Ga0075428_100055238 | Ga0075428_1000552384 | 268 |
| 745 | 3300006846 | Ga0075430_100369170 | Ga0075430_1003691702 | 268 |
| 746 | 3300006847 | Ga0075431_100007163 | Ga0075431_1000071638 | 268 |
| 747 | 3300006847 | Ga0075431_100096050 | Ga0075431_1000960504 | 268 |
| 748 | 3300006871 | Ga0075434_100387249 | Ga0075434_1003872492 | 268 |
| 749 | 3300007076 | Ga0075435_100034464 | Ga0075435_1000344643 | 268 |
| 750 | 3300007076 | Ga0075435_100103511 | Ga0075435_1001035114 | 268 |
| 751 | 3300009147 | Ga0114129_10088714 | Ga0114129_100887143 | 268 |
| 752 | 3300025922 | Ga0207646_10532955 | Ga0207646_105329551 | 268 |
| 753 | 3300045051 | Ga0451576_0078392 | Ga0451576_0078392_1213_2019 | 268 |
| 754 | 3300050507 | nmdc:mga05p37_1554_c1 | nmdc:mga05p37_1554_c1_3788_4594 | 268 |
| 755 | 3300050508 | nmdc:mga09592_357_c1 | nmdc:mga09592_357_c1_23006_23812 | 268 |
| 756 | 3300050510 | nmdc:mga06r32_18169_c1 | nmdc:mga06r32_18169_c1_3617_4423 | 268 |
| 757 | 3300050511 | nmdc:mga08y16_249543_c1 | nmdc:mga08y16_249543_c1_682_1488 | 268 |
| 758 | 3300050513 | nmdc:mga0rr50_89493_c1 | nmdc:mga0rr50_89493_c1_945_1751 | 268 |
| 759 | 3300050515 | nmdc:mga0a205_137891_c1 | nmdc:mga0a205_137891_c1_211_1017 | 268 |
| 760 | 3300050515 | nmdc:mga0a205_320677_c1 | nmdc:mga0a205_320677_c1_172_978 | 268 |
| 761 | 3300005336 | Ga0070680_100363684 | Ga0070680_1003636841 | 269 |
| 762 | 3300005440 | Ga0070705_100126710 | Ga0070705_1001267102 | 269 |
| 763 | 3300005444 | Ga0070694_100001590 | Ga0070694_10000159011 | 269 |
| 764 | 3300005444 | Ga0070694_100251484 | Ga0070694_1002514842 | 269 |
| 765 | 3300005544 | Ga0070686_100373077 | Ga0070686_1003730772 | 269 |
| 766 | 3300005545 | Ga0070695_100004255 | Ga0070695_1000042556 | 269 |
| 767 | 3300005549 | Ga0070704_100011971 | Ga0070704_1000119712 | 269 |
| 768 | 3300005549 | Ga0070704_100179843 | Ga0070704_1001798432 | 269 |
| 769 | 3300005617 | Ga0068859_100069882 | Ga0068859_1000698824 | 269 |
| 770 | 3300006852 | Ga0075433_10005939 | Ga0075433_100059396 | 269 |
| 771 | 3300006931 | Ga0097620_100069882 | Ga0097620_1000698824 | 269 |
| 772 | 3300009176 | Ga0105242_10008113 | Ga0105242_100081135 | 269 |
| 773 | 3300025934 | Ga0207686_10014921 | Ga0207686_100149213 | 269 |
| 774 | 3300025935 | Ga0207709_10579633 | Ga0207709_105796331 | 269 |
| 775 | 3300031665 | Ga0316575_10003572 | Ga0316575_100035724 | 269 |
| 776 | 3300031691 | Ga0316579_10001228 | Ga0316579_100012289 | 269 |
| 777 | 3300031728 | Ga0316578_10007343 | Ga0316578_100073432 | 269 |
| 778 | 3300032133 | Ga0316583_10000892 | Ga0316583_1000089210 | 269 |
| 779 | 3300032133 | Ga0316583_10003087 | Ga0316583_100030874 | 269 |
| 780 | 3300035113 | Ga0373936_0052765 | Ga0373936_0052765_612_1421 | 269 |
| 781 | 3300035118 | Ga0373954_0000014 | Ga0373954_0000014_43761_44570 | 269 |
| 782 | 3300035398 | Ga0316574_0118606 | Ga0316574_0118606_379_1188 | 269 |
| 783 | 3300035691 | Ga0373931_0043878 | Ga0373931_0043878_341_1150 | 269 |
| 784 | 3300035724 | Ga0373933_0012021 | Ga0373933_0012021_500_1309 | 269 |
| 785 | 3300035724 | Ga0373933_0099713 | Ga0373933_0099713_523_1332 | 269 |
| 786 | 3300036401 | Ga0373937_0000218 | Ga0373937_0000218_12202_13011 | 269 |
| 787 | 3300036401 | Ga0373937_0039513 | Ga0373937_0039513_3291_4100 | 269 |
| 788 | 3300036401 | Ga0373937_0243575 | Ga0373937_0243575_141_1004 | 269 |
| 789 | 3300036647 | Ga0316582_0001739 | Ga0316582_0001739_6119_6928 | 269 |
| 790 | 3300036712 | Ga0316584_0066683 | Ga0316584_0066683_873_1682 | 269 |
| 791 | 3300037588 | Ga0316581_0008060 | Ga0316581_0008060_736_1545 | 269 |
| 792 | 3300046683 | Ga0495658_0073124 | Ga0495658_0073124_35_889 | 269 |
| 793 | 3300049568 | Ga0501031_0074212 | Ga0501031_0074212_38_847 | 269 |
| 794 | 3300049570 | Ga0501033_0056527 | Ga0501033_0056527_1797_2609 | 269 |
| 795 | 3300049572 | Ga0501036_0056015 | Ga0501036_0056015_361_1170 | 269 |
| 796 | 3300049573 | Ga0501037_0281425 | Ga0501037_0281425_160_969 | 269 |
| 797 | 3300049574 | Ga0501038_0035777 | Ga0501038_0035777_1176_1988 | 269 |
| 798 | 3300049575 | Ga0501039_0018752 | Ga0501039_0018752_3089_3901 | 269 |
| 799 | 3300049576 | Ga0501040_0024046 | Ga0501040_0024046_400_1212 | 269 |
| 800 | 3300049577 | Ga0501041_0244979 | Ga0501041_0244979_178_990 | 269 |
| 801 | 3300049580 | Ga0501046_0196977 | Ga0501046_0196977_237_1046 | 269 |
| 802 | 3300049582 | Ga0501048_0086449 | Ga0501048_0086449_905_1717 | 269 |
| 803 | 3300049588 | Ga0501072_0179833 | Ga0501072_0179833_649_1479 | 269 |
| 804 | 3300049591 | Ga0501075_0184131 | Ga0501075_0184131_198_1007 | 269 |
| 805 | 3300049593 | Ga0501077_0131892 | Ga0501077_0131892_666_1475 | 269 |
| 806 | 3300049741 | Ga0501079_0156374 | Ga0501079_0156374_546_1355 | 269 |
| 807 | 3300049743 | Ga0501081_0031033 | Ga0501081_0031033_749_1558 | 269 |
| 808 | 3300049822 | Ga0501035_0510410 | Ga0501035_0510410_57_866 | 269 |
| 809 | 3300049824 | Ga0501045_0090202 | Ga0501045_0090202_1146_1958 | 269 |
| 810 | 3300050514 | nmdc:mga08x19_24472_c1 | nmdc:mga08x19_24472_c1_2526_3335 | 269 |
| 811 | 3300060353 | Ga0501082_0022351 | Ga0501082_0022351_3170_3979 | 269 |
| 812 | 3300005549 | Ga0070704_100268615 | Ga0070704_1002686151 | 270 |
| 813 | 3300035092 | Ga0373952_0001055 | Ga0373952_0001055_4051_4863 | 270 |
| 814 | 3300035207 | Ga0373942_0104615 | Ga0373942_0104615_22_834 | 270 |
| 815 | 3300037466 | Ga0395898_0021926 | Ga0395898_0021926_210_1046 | 270 |
| 816 | 3300038443 | Ga0395901_0178882 | Ga0395901_0178882_404_1240 | 270 |
| 817 | 3300045051 | Ga0451576_0036167 | Ga0451576_0036167_2939_3838 | 270 |
| 818 | 3300049573 | Ga0501037_0356111 | Ga0501037_0356111_50_886 | 270 |
| 819 | 3300005327 | Ga0070658_10002808 | Ga0070658_1000280812 | 271 |
| 820 | 3300005329 | Ga0070683_100034664 | Ga0070683_1000346645 | 271 |
| 821 | 3300005330 | Ga0070690_100250778 | Ga0070690_1002507782 | 271 |
| 822 | 3300005336 | Ga0070680_100008477 | Ga0070680_1000084772 | 271 |
| 823 | 3300005340 | Ga0070689_100010914 | Ga0070689_1000109147 | 271 |
| 824 | 3300005340 | Ga0070689_100303737 | Ga0070689_1003037371 | 271 |
| 825 | 3300005354 | Ga0070675_100026872 | Ga0070675_1000268723 | 271 |
| 826 | 3300005367 | Ga0070667_100243970 | Ga0070667_1002439703 | 271 |
| 827 | 3300005436 | Ga0070713_100019399 | Ga0070713_1000193992 | 271 |
| 828 | 3300005445 | Ga0070708_100617770 | Ga0070708_1006177701 | 271 |
| 829 | 3300005456 | Ga0070678_100036527 | Ga0070678_1000365273 | 271 |
| 830 | 3300005456 | Ga0070678_100302711 | Ga0070678_1003027111 | 271 |
| 831 | 3300005458 | Ga0070681_10018158 | Ga0070681_100181589 | 271 |
| 832 | 3300005467 | Ga0070706_100124278 | Ga0070706_1001242782 | 271 |
| 833 | 3300005467 | Ga0070706_100394299 | Ga0070706_1003942992 | 271 |
| 834 | 3300005471 | Ga0070698_100003213 | Ga0070698_10000321316 | 271 |
| 835 | 3300005518 | Ga0070699_100094302 | Ga0070699_1000943023 | 271 |
| 836 | 3300005530 | Ga0070679_100003097 | Ga0070679_10000309711 | 271 |
| 837 | 3300005535 | Ga0070684_100033679 | Ga0070684_1000336795 | 271 |
| 838 | 3300005539 | Ga0068853_100240125 | Ga0068853_1002401252 | 271 |
| 839 | 3300005543 | Ga0070672_100184205 | Ga0070672_1001842052 | 271 |
| 840 | 3300005548 | Ga0070665_100018865 | Ga0070665_1000188652 | 271 |
| 841 | 3300005548 | Ga0070665_100083744 | Ga0070665_1000837442 | 271 |
| 842 | 3300005548 | Ga0070665_100288758 | Ga0070665_1002887583 | 271 |
| 843 | 3300005563 | Ga0068855_100020041 | Ga0068855_1000200415 | 271 |
| 844 | 3300005563 | Ga0068855_100461598 | Ga0068855_1004615982 | 271 |
| 845 | 3300005564 | Ga0070664_100204848 | Ga0070664_1002048481 | 271 |
| 846 | 3300005614 | Ga0068856_100034640 | Ga0068856_1000346402 | 271 |
| 847 | 3300005616 | Ga0068852_100042700 | Ga0068852_1000427003 | 271 |
| 848 | 3300005843 | Ga0068860_100823767 | Ga0068860_1008237671 | 271 |
| 849 | 3300005844 | Ga0068862_100131676 | Ga0068862_1001316761 | 271 |
| 850 | 3300005937 | Ga0081455_10001851 | Ga0081455_100018518 | 271 |
| 851 | 3300005937 | Ga0081455_10002478 | Ga0081455_1000247819 | 271 |
| 852 | 3300005937 | Ga0081455_10007317 | Ga0081455_1000731710 | 271 |
| 853 | 3300005985 | Ga0081539_10001293 | Ga0081539_1000129311 | 271 |
| 854 | 3300005985 | Ga0081539_10007008 | Ga0081539_100070087 | 271 |
| 855 | 3300006038 | Ga0075365_10073341 | Ga0075365_100733411 | 271 |
| 856 | 3300006051 | Ga0075364_10207427 | Ga0075364_102074271 | 271 |
| 857 | 3300006051 | Ga0075364_10280762 | Ga0075364_102807622 | 271 |
| 858 | 3300006175 | Ga0070712_100121184 | Ga0070712_1001211842 | 271 |
| 859 | 3300006177 | Ga0075362_10052153 | Ga0075362_100521531 | 271 |
| 860 | 3300006177 | Ga0075362_10052751 | Ga0075362_100527512 | 271 |
| 861 | 3300006177 | Ga0075362_10203717 | Ga0075362_102037172 | 271 |
| 862 | 3300006178 | Ga0075367_10035949 | Ga0075367_100359492 | 271 |
| 863 | 3300006186 | Ga0075369_10007032 | Ga0075369_100070325 | 271 |
| 864 | 3300006186 | Ga0075369_10049913 | Ga0075369_100499132 | 271 |
| 865 | 3300006186 | Ga0075369_10135117 | Ga0075369_101351172 | 271 |
| 866 | 3300006195 | Ga0075366_10018528 | Ga0075366_100185285 | 271 |
| 867 | 3300006237 | Ga0097621_100560588 | Ga0097621_1005605881 | 271 |
| 868 | 3300006353 | Ga0075370_10010161 | Ga0075370_100101613 | 271 |
| 869 | 3300006844 | Ga0075428_100236770 | Ga0075428_1002367702 | 271 |
| 870 | 3300007265 | Ga0099794_10043244 | Ga0099794_100432443 | 271 |
| 871 | 3300007265 | Ga0099794_10086157 | Ga0099794_100861572 | 271 |
| 872 | 3300009093 | Ga0105240_10010321 | Ga0105240_100103212 | 271 |
| 873 | 3300009148 | Ga0105243_10342764 | Ga0105243_103427642 | 271 |
| 874 | 3300009177 | Ga0105248_10447694 | Ga0105248_104476942 | 271 |
| 875 | 3300009545 | Ga0105237_10570635 | Ga0105237_105706351 | 271 |
| 876 | 3300009551 | Ga0105238_10036475 | Ga0105238_100364752 | 271 |
| 877 | 3300012497 | Ga0157319_1000452 | Ga0157319_10004522 | 271 |
| 878 | 3300013102 | Ga0157371_10029522 | Ga0157371_100295225 | 271 |
| 879 | 3300013105 | Ga0157369_10304604 | Ga0157369_103046041 | 271 |
| 880 | 3300013296 | Ga0157374_10422996 | Ga0157374_104229962 | 271 |
| 881 | 3300013307 | Ga0157372_10384819 | Ga0157372_103848192 | 271 |
| 882 | 3300014497 | Ga0182008_10038919 | Ga0182008_100389192 | 271 |
| 883 | 3300014968 | Ga0157379_10127214 | Ga0157379_101272143 | 271 |
| 884 | 3300014969 | Ga0157376_10420785 | Ga0157376_104207851 | 271 |
| 885 | 3300021441 | Ga0213871_10001196 | Ga0213871_100011962 | 271 |
| 886 | 3300025901 | Ga0207688_10130383 | Ga0207688_101303832 | 271 |
| 887 | 3300025904 | Ga0207647_10138345 | Ga0207647_101383452 | 271 |
| 888 | 3300025909 | Ga0207705_10007165 | Ga0207705_1000716510 | 271 |
| 889 | 3300025910 | Ga0207684_10265702 | Ga0207684_102657021 | 271 |
| 890 | 3300025912 | Ga0207707_10003527 | Ga0207707_1000352714 | 271 |
| 891 | 3300025913 | Ga0207695_10016461 | Ga0207695_100164612 | 271 |
| 892 | 3300025916 | Ga0207663_10426562 | Ga0207663_104265622 | 271 |
| 893 | 3300025919 | Ga0207657_10393855 | Ga0207657_103938551 | 271 |
| 894 | 3300025921 | Ga0207652_10009517 | Ga0207652_100095175 | 271 |
| 895 | 3300025925 | Ga0207650_10095254 | Ga0207650_100952543 | 271 |
| 896 | 3300025926 | Ga0207659_10191058 | Ga0207659_101910584 | 271 |
| 897 | 3300025926 | Ga0207659_10192642 | Ga0207659_101926422 | 271 |
| 898 | 3300025928 | Ga0207700_10012529 | Ga0207700_100125292 | 271 |
| 899 | 3300025933 | Ga0207706_10203160 | Ga0207706_102031602 | 271 |
| 900 | 3300025936 | Ga0207670_10020673 | Ga0207670_100206732 | 271 |
| 901 | 3300025937 | Ga0207669_10059288 | Ga0207669_100592882 | 271 |
| 902 | 3300025940 | Ga0207691_10169098 | Ga0207691_101690982 | 271 |
| 903 | 3300025941 | Ga0207711_10257008 | Ga0207711_102570082 | 271 |
| 904 | 3300025945 | Ga0207679_10006048 | Ga0207679_100060486 | 271 |
| 905 | 3300025949 | Ga0207667_10002821 | Ga0207667_1000282117 | 271 |
| 906 | 3300025986 | Ga0207658_10119301 | Ga0207658_101193013 | 271 |
| 907 | 3300026041 | Ga0207639_10149577 | Ga0207639_101495772 | 271 |
| 908 | 3300026078 | Ga0207702_10023845 | Ga0207702_100238455 | 271 |
| 909 | 3300026121 | Ga0207683_10056923 | Ga0207683_100569233 | 271 |
| 910 | 3300026121 | Ga0207683_10211874 | Ga0207683_102118742 | 271 |
| 911 | 3300028379 | Ga0268266_10004061 | Ga0268266_100040619 | 271 |
| 912 | 3300028379 | Ga0268266_10039802 | Ga0268266_100398022 | 271 |
| 913 | 3300028379 | Ga0268266_10121161 | Ga0268266_101211613 | 271 |
| 914 | 3300028380 | Ga0268265_10442268 | Ga0268265_104422682 | 271 |
| 915 | 3300028573 | Ga0265334_10006563 | Ga0265334_100065633 | 271 |
| 916 | 3300028794 | Ga0307515_10033140 | Ga0307515_100331409 | 271 |
| 917 | 3300031344 | Ga0265316_10214578 | Ga0265316_102145782 | 271 |
| 918 | 3300031456 | Ga0307513_10423420 | Ga0307513_104234202 | 271 |
| 919 | 3300031548 | Ga0307408_100101113 | Ga0307408_1001011132 | 271 |
| 920 | 3300035691 | Ga0373931_0047326 | Ga0373931_0047326_38_877 | 271 |
| 921 | 3300035691 | Ga0373931_0081180 | Ga0373931_0081180_478_1317 | 271 |
| 922 | 3300036647 | Ga0316582_0098172 | Ga0316582_0098172_281_1096 | 271 |
| 923 | 3300037068 | Ga0373925_0218977 | Ga0373925_0218977_393_1232 | 271 |
| 924 | 3300037312 | Ga0395899_0008576 | Ga0395899_0008576_5402_6241 | 271 |
| 925 | 3300037418 | Ga0395900_0046371 | Ga0395900_0046371_1962_2801 | 271 |
| 926 | 3300037418 | Ga0395900_0074822 | Ga0395900_0074822_384_1223 | 271 |
| 927 | 3300037466 | Ga0395898_0156177 | Ga0395898_0156177_1215_2054 | 271 |
| 928 | 3300038443 | Ga0395901_0007074 | Ga0395901_0007074_6442_7281 | 271 |
| 929 | 3300038443 | Ga0395901_0015701 | Ga0395901_0015701_4019_4858 | 271 |
| 930 | 3300039437 | Ga0436365_0086324 | Ga0436365_0086324_193_1032 | 271 |
| 931 | 3300039437 | Ga0436365_1817572 | Ga0436365_1817572_144_983 | 271 |
| 932 | 3300039438 | Ga0436360_1076911 | Ga0436360_1076911_7765_8604 | 271 |
| 933 | 3300039447 | Ga0436361_0438458 | Ga0436361_0438458_299_1138 | 271 |
| 934 | 3300039450 | Ga0436363_0146039 | Ga0436363_0146039_140_955 | 271 |
| 935 | 3300041410 | Ga0439461_0031344 | Ga0439461_0031344_37_876 | 271 |
| 936 | 3300042005 | Ga0439448_0115196 | Ga0439448_0115196_32_871 | 271 |
| 937 | 3300042436 | Ga0439435_0010927 | Ga0439435_0010927_397_1212 | 271 |
| 938 | 3300044673 | Ga0453683_0098685 | Ga0453683_0098685_390_1205 | 271 |
| 939 | 3300045051 | Ga0451576_0267711 | Ga0451576_0267711_478_1293 | 271 |
| 940 | 3300048929 | Ga0496126_0038262 | Ga0496126_0038262_3005_3844 | 271 |
| 941 | 3300049571 | Ga0501034_0007498 | Ga0501034_0007498_2802_3641 | 271 |
| 942 | 3300049571 | Ga0501034_0026574 | Ga0501034_0026574_2806_3645 | 271 |
| 943 | 3300049573 | Ga0501037_0090190 | Ga0501037_0090190_634_1449 | 271 |
| 944 | 3300049579 | Ga0501043_0122242 | Ga0501043_0122242_548_1384 | 271 |
| 945 | 3300049580 | Ga0501046_0159709 | Ga0501046_0159709_63_902 | 271 |
| 946 | 3300049582 | Ga0501048_0044213 | Ga0501048_0044213_1635_2450 | 271 |
| 947 | 3300049584 | Ga0501068_0215809 | Ga0501068_0215809_293_1126 | 271 |
| 948 | 3300049586 | Ga0501070_0037789 | Ga0501070_0037789_309_1148 | 271 |
| 949 | 3300049589 | Ga0501073_0262420 | Ga0501073_0262420_136_972 | 271 |
| 950 | 3300049741 | Ga0501079_0186934 | Ga0501079_0186934_742_1557 | 271 |
| 951 | 3300049822 | Ga0501035_0353626 | Ga0501035_0353626_162_998 | 271 |
| 952 | 3300050489 | nmdc:mga03683_128920_c1 | nmdc:mga03683_128920_c1_134_973 | 271 |
| 953 | 3300050489 | nmdc:mga03683_2990_c1 | nmdc:mga03683_2990_c1_85_924 | 271 |
| 954 | 3300050489 | nmdc:mga03683_46636_c1 | nmdc:mga03683_46636_c1_440_1279 | 271 |
| 955 | 3300050491 | nmdc:mga00v17_192813_c1 | nmdc:mga00v17_192813_c1_95_934 | 271 |
| 956 | 3300050493 | nmdc:mga0k408_8381_c1 | nmdc:mga0k408_8381_c1_1558_2397 | 271 |
| 957 | 3300050494 | nmdc:mga06z11_7906_c1 | nmdc:mga06z11_7906_c1_1154_1993 | 271 |
| 958 | 3300050495 | nmdc:mga04h51_51263_c1 | nmdc:mga04h51_51263_c1_83_922 | 271 |
| 959 | 3300050496 | nmdc:mga07m45_106428_c1 | nmdc:mga07m45_106428_c1_612_1451 | 271 |
| 960 | 3300050496 | nmdc:mga07m45_4997_c1 | nmdc:mga07m45_4997_c1_3090_3929 | 271 |
| 961 | 3300050513 | nmdc:mga0rr50_205561_c1 | nmdc:mga0rr50_205561_c1_560_1375 | 271 |
| 962 | 3300050516 | nmdc:mga0sz30_58151_c1 | nmdc:mga0sz30_58151_c1_156_995 | 271 |
| 963 | 3300050516 | nmdc:mga0sz30_73041_c1 | nmdc:mga0sz30_73041_c1_327_1166 | 271 |
| 964 | 3300053088 | Ga0500644_0076499 | Ga0500644_0076499_163_1002 | 271 |
| 965 | 3300053094 | Ga0500566_0130643 | Ga0500566_0130643_274_1113 | 271 |
| 966 | 3300053096 | Ga0500641_0002690 | Ga0500641_0002690_5250_6089 | 271 |
| 967 | 3300053130 | Ga0500642_0084850 | Ga0500642_0084850_451_1290 | 271 |
| 968 | 3300053134 | Ga0500658_0046838 | Ga0500658_0046838_582_1421 | 271 |
| 969 | 3300053139 | Ga0500568_0001263 | Ga0500568_0001263_9615_10430 | 271 |
| 970 | 3300053153 | Ga0500616_0010218 | Ga0500616_0010218_2742_3581 | 271 |
| 971 | 3300053155 | Ga0500620_004765 | Ga0500620_004765_1071_1910 | 271 |
| 972 | 3300053733 | Ga0500552_000398 | Ga0500552_000398_2683_3522 | 271 |
| 973 | 3300060353 | Ga0501082_0058818 | Ga0501082_0058818_2371_3186 | 271 |
| 974 | 3300006051 | Ga0075364_10000618 | Ga0075364_1000061811 | 273 |
| 975 | 3300042876 | Ga0451577_0005873 | Ga0451577_0005873_2312_3139 | 273 |
| 976 | 3300044712 | Ga0453684_0046865 | Ga0453684_0046865_374_1201 | 273 |
| 977 | 3300046501 | Ga0495607_0000044 | Ga0495607_0000044_38460_39284 | 273 |
| 978 | 3300049568 | Ga0501031_0132915 | Ga0501031_0132915_644_1471 | 273 |
| 979 | 3300049568 | Ga0501031_0292429 | Ga0501031_0292429_163_990 | 273 |
| 980 | 3300049823 | Ga0501044_0134313 | Ga0501044_0134313_1094_1921 | 273 |
| 981 | 3300050491 | nmdc:mga00v17_17442_c1 | nmdc:mga00v17_17442_c1_3041_3868 | 273 |
| 982 | 3300050491 | nmdc:mga00v17_32530_c1 | nmdc:mga00v17_32530_c1_1488_2315 | 273 |
| 983 | 3300046526 | Ga0495666_0018480 | Ga0495666_0018480_2358_3284 | 276 |
| 984 | 3300047317 | Ga0495604_0027486 | Ga0495604_0027486_309_1235 | 276 |
| 985 | 3300046499 | Ga0495594_0040077 | Ga0495594_0040077_1312_2232 | 279 |
| 986 | iso_pu_bacteria | 2596583598 | 2597031253 | 283 |
| 987 | iso_pu_bacteria | 2834641062 | 2834641123 | 283 |
| 988 | iso_pu_bacteria | 2885266251 | 2885269070 | 283 |
| 989 | iso_pu_bacteria | 2900577576 | 2900582208 | 283 |
| 990 | iso_pu_bacteria | 2928058823 | 2928061170 | 283 |
| 991 | iso_pu_bacteria | 8003400568 | 8003403300 | 283 |
| 992 | 3300003841 | Ga0055541_1012321 | Ga0055541_10123211 | 286 |
| 993 | 3300001979 | JGI24740J21852_10004293 | JGI24740J21852_100042936 | 287 |
| 994 | 3300001979 | JGI24740J21852_10019851 | JGI24740J21852_100198512 | 287 |
| 995 | 3300003752 | Ga0055539_1000547 | Ga0055539_10005475 | 287 |
| 996 | 3300003759 | Ga0055525_1000177 | Ga0055525_10001777 | 287 |
| 997 | 3300003760 | Ga0055527_1002546 | Ga0055527_10025462 | 287 |
| 998 | 3300003761 | Ga0055535_1000004 | Ga0055535_1000004242 | 287 |
| 999 | 3300003763 | Ga0055529_1000022 | Ga0055529_100002279 | 287 |
| 1000 | 3300005344 | Ga0070661_100000012 | Ga0070661_10000001219 | 287 |
| 1001 | 3300005455 | Ga0070663_100000003 | Ga0070663_100000003144 | 287 |
| 1002 | 3300005564 | Ga0070664_100000003 | Ga0070664_10000000372 | 287 |
| 1003 | 3300005578 | Ga0068854_100000020 | Ga0068854_10000002058 | 287 |
| 1004 | 3300009093 | Ga0105240_10056122 | Ga0105240_100561222 | 287 |
| 1005 | 3300013100 | Ga0157373_10007631 | Ga0157373_100076316 | 287 |
| 1006 | 3300013102 | Ga0157371_10000567 | Ga0157371_1000056739 | 287 |
| 1007 | 3300013104 | Ga0157370_10000633 | Ga0157370_1000063339 | 287 |
| 1008 | 3300013105 | Ga0157369_10010717 | Ga0157369_100107175 | 287 |
| 1009 | 3300013307 | Ga0157372_10003682 | Ga0157372_1000368212 | 287 |
| 1010 | 3300014497 | Ga0182008_10034166 | Ga0182008_100341662 | 287 |
| 1011 | 3300015261 | Ga0182006_1001900 | Ga0182006_10019005 | 287 |
| 1012 | 3300015261 | Ga0182006_1012562 | Ga0182006_10125621 | 287 |
| 1013 | 3300015262 | Ga0182007_10006742 | Ga0182007_100067421 | 287 |
| 1014 | 3300020070 | Ga0206356_11584573 | Ga0206356_115845731 | 287 |
| 1015 | 3300020610 | Ga0154015_1561949 | Ga0154015_156194912 | 287 |
| 1016 | 3300025224 | Ga0209784_100006 | Ga0209784_100006805 | 287 |
| 1017 | 3300025225 | Ga0209566_100002 | Ga0209566_100002805 | 287 |
| 1018 | 3300025226 | Ga0209674_100010 | Ga0209674_100010332 | 287 |
| 1019 | 3300025226 | Ga0209674_100050 | Ga0209674_100050267 | 287 |
| 1020 | 3300025228 | Ga0209672_100111 | Ga0209672_10011115 | 287 |
| 1021 | 3300025229 | Ga0209147_100015 | Ga0209147_100015304 | 287 |
| 1022 | 3300025230 | Ga0209563_100004 | Ga0209563_100004216 | 287 |
| 1023 | 3300025242 | Ga0209258_100021 | Ga0209258_100021304 | 287 |
| 1024 | 3300025253 | Ga0209677_100007 | Ga0209677_100007805 | 287 |
| 1025 | 3300025256 | Ga0209759_1001943 | Ga0209759_10019434 | 287 |
| 1026 | 3300025272 | Ga0209455_1000028 | Ga0209455_1000028304 | 287 |
| 1027 | 3300025913 | Ga0207695_10000762 | Ga0207695_100007625 | 287 |
| 1028 | 3300025920 | Ga0207649_10000181 | Ga0207649_100001812 | 287 |
| 1029 | 3300025945 | Ga0207679_10000007 | Ga0207679_10000007146 | 287 |
| 1030 | 3300025981 | Ga0207640_10000087 | Ga0207640_1000008738 | 287 |
| 1031 | 3300026067 | Ga0207678_10000011 | Ga0207678_1000001123 | 287 |
| 1032 | 3300026078 | Ga0207702_10000018 | Ga0207702_1000001889 | 287 |
| 1033 | 3300026116 | Ga0207674_10005933 | Ga0207674_1000593315 | 287 |
| 1034 | 3300037418 | Ga0395900_0035720 | Ga0395900_0035720_1338_2219 | 287 |
| 1035 | 3300044650 | Ga0466986_0015166 | Ga0466986_0015166_3886_4761 | 287 |
| 1036 | 3300044656 | Ga0466969_0022256 | Ga0466969_0022256_1621_2484 | 287 |
| 1037 | 3300044671 | Ga0466978_0036798 | Ga0466978_0036798_291_1154 | 287 |
| 1038 | 3300044672 | Ga0466982_0068387 | Ga0466982_0068387_916_1779 | 287 |
| 1039 | 3300044683 | Ga0466965_0008128 | Ga0466965_0008128_1405_2268 | 287 |
| 1040 | 3300044693 | Ga0466961_0002611 | Ga0466961_0002611_6226_7089 | 287 |
| 1041 | 3300044694 | Ga0466963_0141651 | Ga0466963_0141651_787_1650 | 287 |
| 1042 | 3300044706 | Ga0466964_0004560 | Ga0466964_0004560_3586_4449 | 287 |
| 1043 | 3300044735 | Ga0466968_0023135 | Ga0466968_0023135_280_1143 | 287 |
| 1044 | 3300044765 | Ga0466970_0009727 | Ga0466970_0009727_3250_4113 | 287 |
| 1045 | 3300044842 | Ga0466957_0012573 | Ga0466957_0012573_274_1137 | 287 |
| 1046 | 3300048928 | Ga0496125_0079710 | Ga0496125_0079710_836_1717 | 287 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1k82-assembly4.cif.gz_D | crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna | 0.9504 | 2 | 287 |
| 1k82-assembly4.cif.gz_D | crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna | 0.9469 | 2 | 287 |
| 3sat-assembly1.cif.gz_A | mutm slanted complex 6 with r112a mutation | 0.9377 | 2 | 287 |
| 3saw-assembly1.cif.gz_A | mutm slanted complex 8 with r112a mutation | 0.9372 | 2 | 287 |
| 3sat-assembly1.cif.gz_A | mutm slanted complex 6 with r112a mutation | 0.9341 | 2 | 287 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3sarA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9564 | 147 | 287 | 1.10.8.50 |
| 1k82C02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9507 | 147 | 287 | 1.10.8.50 |
| 3sarA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9488 | 147 | 287 | 1.10.8.50 |
| 1k82C02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9437 | 147 | 287 | 1.10.8.50 |
| af_P05523_2_128_3.20.190.10 | Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal | 0.9369 | 2 | 144 | 3.20.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534BKW6-F1-model_v4 | DNA-formamidopyrimidine glycosylase | 0.9755 | 125 | 287 |
GO:0003684
GO:0003906 GO:0006284 GO:0008270 GO:0034039 |
| AF-A0A424RDD1-F1-model_v4 | Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) | 0.9737 | 1 | 287 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A1P8FFC1-F1-model_v4 | Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) | 0.9732 | 1 | 287 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A3N5XR05-F1-model_v4 | Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) | 0.9716 | 1 | 286 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A0H4J238-F1-model_v4 | Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18) | 0.9701 | 1 | 287 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar