F488963

General Info

Members Datasets Scaffolds Average Seq Length
1046 443 1042 219

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0718923|Ga0451577_0718923_72_854
Length 260
Sequence LIDERAAEALSCAPGSRELARAMNLRRATMPNSHRQETTMQNTSRIFGPAIAAVLVLALAPAVHAQQSDMSFFVTSTPIGKGADLGGLDGADRHCQSLAAAAGAGGKTWHAYLSTQGAGAVNAKDRIGKGPWKNAKGVVIAKDVAELHGANNLTKQTALTEKGTVVNGRGDTPNMHDIVTGSQADGTAFPAGEDRTCGNYTKSDAGSVMLGHADRTGLDDSAAQKSWTTSHPSRGPGGGCSQDDLKSTGGNGLLYCFATN

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
5 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
6 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
7 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
8 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
9 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
10 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
11 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
12 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
13 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
18 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
19 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
20 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
21 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
22 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
23 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
24 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
25 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
30 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
31 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
68 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
77 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
107 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
122 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
123 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
124 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
129 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
146 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
147 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
153 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
166 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
172 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
240 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
246 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
247 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
248 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
249 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
250 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
251 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
252 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
253 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
254 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
255 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
256 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
257 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
258 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
259 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
260 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
261 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
262 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
263 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
264 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
265 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
268 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
269 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
270 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
271 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
272 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
273 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
274 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
275 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
276 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
277 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
278 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
279 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
280 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
281 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
282 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
283 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
284 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
285 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
286 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
287 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
288 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
289 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
290 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
291 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
292 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
294 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
296 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
297 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
298 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
299 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
301 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
302 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
303 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
304 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
305 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
306 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
307 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
308 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
309 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
310 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
311 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
312 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
313 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
314 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
315 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
316 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
317 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
318 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
319 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
320 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
321 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
322 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
323 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
324 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
325 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
326 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
327 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
328 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
329 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
330 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
331 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
332 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
333 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
334 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
335 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
336 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
337 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
338 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
339 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
340 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
341 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
342 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
343 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
344 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
345 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
346 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
347 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
348 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
349 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
350 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
351 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
352 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
353 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
354 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
355 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
356 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
357 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
358 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
359 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
360 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
378 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
379 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
380 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
381 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
382 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
392 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
393 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
394 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
395 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
396 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
397 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
398 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
399 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
400 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
401 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
402 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
403 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
404 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
405 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
406 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
407 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
408 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
409 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
410 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
411 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
412 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
413 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
414 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
415 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
416 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
417 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
418 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
419 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
420 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
421 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
422 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
423 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
424 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
425 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
426 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
427 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
428 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
429 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
430 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
431 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
432 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
433 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
434 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
435 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
436 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
437 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
438 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
439 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
440 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
441 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
442 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
443 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.38
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.74
Nodule 0
Rhizoplane 2.49
Rhizosphere 88.34
Stem 0
Stem Tuber 0
Unclassified 3.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214828542 2209111006 Bacteria 9284
2 ARcpr5oldR_c000138 3300000041 Bacteria 12428
3 ARSoilYngRDRAFT_c00004 3300000042 Bacteria 40941
4 ARcpr5yngRDRAFT_c000060 3300000043 Bacteria 17786
5 ARSoilOldRDRAFT_c000133 3300000044 Bacteria 13213
6 ARCol0oldRDRAFT_c00433 3300000045 Bacteria 3985
7 ARCol0yngRDRAFT_1000084 3300000652 Bacteria 17450
8 JGI24741J21665_1015598 3300001915 Bacteria 1252
9 JGI24747J21853_1013193 3300001978 Bacteria 851
10 JGI24737J22298_10000934 3300001990 Bacteria 10373
11 JGI24743J22301_10007855 3300001991 Bacteria 1859
12 JGI24735J21928_10028325 3300002067 Bacteria 1673
13 JGI24750J21931_1000032 3300002070 Bacteria 18759
14 JGI24748J21848_1000782 3300002074 Bacteria 3449
15 JGI24738J21930_10001211 3300002075 Bacteria 7234
16 JGI24749J21850_1003266 3300002076 Bacteria 2265
17 JGI24035J26624_1000066 3300002126 Bacteria 8330
18 JGI24033J26618_1000292 3300002155 Bacteria 5438
19 JGI24034J26672_10000075 3300002239 Bacteria 23231
20 JGI24742J22300_10000054 3300002244 Bacteria 16914
21 JGI24751J29686_10010139 3300002459 Bacteria 1942
22 JGI25152J39213_1005374 3300002773 Bacteria 3753
23 rootH1_10002881 3300003323 Bacteria 1145
24 Ga0055526_1015322 3300003771 Bacteria 3084
25 Ga0058859_11552955 3300004798 Unclassified 1976
26 Ga0058860_10052366 3300004801 Bacteria 2652
27 Ga0065717_1002020 3300005276 Bacteria 3534
28 Ga0065714_10180179 3300005288 Bacteria 966
29 Ga0065704_10072529 3300005289 Bacteria 8368
30 Ga0065715_10089082 3300005293 Bacteria 14764
31 Ga0065707_10127028 3300005295 Bacteria 1992
32 Ga0065707_10255063 3300005295 Bacteria 1113
33 Ga0070676_10000062 3300005328 Bacteria 35195
34 Ga0070683_100000259 3300005329 Bacteria 36454
35 Ga0070683_100069961 3300005329 Bacteria 3273
36 Ga0070683_100112039 3300005329 Bacteria 2574
37 Ga0070690_100001045 3300005330 Bacteria 14168
38 Ga0070690_100040233 3300005330 Bacteria 2956
39 Ga0070690_100175608 3300005330 Bacteria 1477
40 Ga0070690_100361168 3300005330 Bacteria 1057
41 Ga0070690_100375896 3300005330 Bacteria 1038
42 Ga0070670_100007548 3300005331 Bacteria 9229
43 Ga0070670_100008320 3300005331 Bacteria 8842
44 Ga0070670_100019991 3300005331 Bacteria 5749
45 Ga0070670_100054773 3300005331 Bacteria 3424
46 Ga0070670_100061705 3300005331 Bacteria 3218
47 Ga0070670_100102832 3300005331 Bacteria 2461
48 Ga0070677_10000077 3300005333 Bacteria 31203
49 Ga0070677_10000368 3300005333 Bacteria 15845
50 Ga0070677_10073698 3300005333 Bacteria 1443
51 Ga0068869_100000095 3300005334 Bacteria 41336
52 Ga0068869_100006240 3300005334 Bacteria 7548
53 Ga0068869_100159051 3300005334 Bacteria 1757
54 Ga0070666_10003027 3300005335 Bacteria 10196
55 Ga0070666_10032791 3300005335 Bacteria 3433
56 Ga0070666_10382206 3300005335 Bacteria 1011
57 Ga0070680_100001342 3300005336 Bacteria 17830
58 Ga0070680_100023963 3300005336 Bacteria 4872
59 Ga0070680_100102792 3300005336 Bacteria 2373
60 Ga0070680_100250387 3300005336 Bacteria 1498
61 Ga0070682_100000511 3300005337 Bacteria 24357
62 Ga0068868_100000824 3300005338 Bacteria 21004
63 Ga0068868_100009255 3300005338 Bacteria 7078
64 Ga0068868_100045718 3300005338 Bacteria 3426
65 Ga0068868_100376189 3300005338 Bacteria 1221
66 Ga0070660_100000871 3300005339 Bacteria 20136
67 Ga0070660_100057056 3300005339 Bacteria 3024
68 Ga0070660_100230869 3300005339 Bacteria 1506
69 Ga0070660_100355505 3300005339 Bacteria 1207
70 Ga0070689_100006542 3300005340 Bacteria 8077
71 Ga0070689_100081269 3300005340 Bacteria 2544
72 Ga0070689_100156508 3300005340 Bacteria 1840
73 Ga0070691_10014544 3300005341 Bacteria 3612
74 Ga0070687_100000489 3300005343 Bacteria 13206
75 Ga0070687_100091102 3300005343 Bacteria 1687
76 Ga0070661_100000912 3300005344 Bacteria 21210
77 Ga0070661_100001402 3300005344 Bacteria 16837
78 Ga0070661_100059933 3300005344 Bacteria 2792
79 Ga0070661_100251563 3300005344 Bacteria 1364
80 Ga0070692_10002749 3300005345 Bacteria 6920
81 Ga0070692_10132000 3300005345 Bacteria 1404
82 Ga0070668_100001817 3300005347 Bacteria 15523
83 Ga0070668_100004187 3300005347 Bacteria 10693
84 Ga0070668_100018430 3300005347 Bacteria 5241
85 Ga0070668_100039792 3300005347 Bacteria 3596
86 Ga0070668_100041387 3300005347 Bacteria 3530
87 Ga0070668_100087534 3300005347 Bacteria 2451
88 Ga0070668_100141893 3300005347 Bacteria 1937
89 Ga0070669_100000627 3300005353 Bacteria 26160
90 Ga0070669_100052561 3300005353 Bacteria 2981
91 Ga0070669_100059683 3300005353 Bacteria 2801
92 Ga0070669_100268259 3300005353 Bacteria 1364
93 Ga0070669_100632513 3300005353 Bacteria 899
94 Ga0070675_100000231 3300005354 Bacteria 35826
95 Ga0070675_100000524 3300005354 Bacteria 26172
96 Ga0070675_100011178 3300005354 Bacteria 7024
97 Ga0070675_100194073 3300005354 Bacteria 1760
98 Ga0070675_100346138 3300005354 Bacteria 1317
99 Ga0070671_100000689 3300005355 Bacteria 24261
100 Ga0070671_100000935 3300005355 Bacteria 21361
101 Ga0070671_100008470 3300005355 Bacteria 8241
102 Ga0070671_100023761 3300005355 Bacteria 5018
103 Ga0070671_100716796 3300005355 Bacteria 868
104 Ga0070674_100001658 3300005356 Bacteria 12014
105 Ga0070674_100002295 3300005356 Bacteria 10558
106 Ga0070674_100003262 3300005356 Bacteria 9061
107 Ga0070674_100012945 3300005356 Bacteria 5138
108 Ga0070673_100000144 3300005364 Bacteria 33872
109 Ga0070673_100002654 3300005364 Bacteria 10944
110 Ga0070673_100012746 3300005364 Bacteria 5783
111 Ga0070673_100060368 3300005364 Bacteria 3004
112 Ga0070673_100295331 3300005364 Bacteria 1425
113 Ga0070673_100307921 3300005364 Bacteria 1396
114 Ga0070688_100000524 3300005365 Bacteria 19410
115 Ga0070688_100118796 3300005365 Bacteria 1768
116 Ga0070688_100296014 3300005365 Bacteria 1168
117 Ga0070659_100001134 3300005366 Bacteria 19419
118 Ga0070659_100792638 3300005366 Bacteria 824
119 Ga0070667_100008892 3300005367 Bacteria 8313
120 Ga0070667_100071531 3300005367 Bacteria 2954
121 Ga0070667_100103969 3300005367 Bacteria 2456
122 Ga0070667_100154236 3300005367 Bacteria 2019
123 Ga0070667_100241346 3300005367 Bacteria 1613
124 Ga0070703_10003476 3300005406 Bacteria 4492
125 Ga0070714_100097015 3300005435 Bacteria 2591
126 Ga0070710_10141743 3300005437 Bacteria 1475
127 Ga0070701_10000059 3300005438 Bacteria 29115
128 Ga0070705_100000717 3300005440 Bacteria 18886
129 Ga0070705_100039696 3300005440 Bacteria 2672
130 Ga0070705_100214331 3300005440 Bacteria 1329
131 Ga0070705_100621343 3300005440 Bacteria 839
132 Ga0070700_100002047 3300005441 Bacteria 10242
133 Ga0070700_100149013 3300005441 Bacteria 1598
134 Ga0070700_100286538 3300005441 Bacteria 1196
135 Ga0070700_100310730 3300005441 Bacteria 1154
136 Ga0070694_100001020 3300005444 Bacteria 15907
137 Ga0070694_100105214 3300005444 Bacteria 2002
138 Ga0070694_100601952 3300005444 Bacteria 885
139 Ga0070708_100113828 3300005445 Bacteria 2488
140 Ga0070708_100276280 3300005445 Bacteria 1581
141 Ga0070663_100000339 3300005455 Bacteria 24358
142 Ga0070663_100097157 3300005455 Bacteria 2192
143 Ga0070678_100001198 3300005456 Bacteria 13787
144 Ga0070678_100005238 3300005456 Bacteria 7464
145 Ga0070678_100012230 3300005456 Bacteria 5326
146 Ga0070678_100040159 3300005456 Bacteria 3308
147 Ga0070678_100047325 3300005456 Bacteria 3089
148 Ga0070678_100099528 3300005456 Bacteria 2250
149 Ga0070678_100185416 3300005456 Bacteria 1707
150 Ga0070678_100191041 3300005456 Bacteria 1684
151 Ga0070662_100011568 3300005457 Bacteria 5823
152 Ga0070662_100058230 3300005457 Bacteria 2811
153 Ga0070662_100270900 3300005457 Bacteria 1371
154 Ga0070681_10002595 3300005458 Bacteria 16576
155 Ga0070681_10058787 3300005458 Bacteria 3824
156 Ga0070681_10105771 3300005458 Bacteria 2756
157 Ga0070681_10142015 3300005458 Bacteria 2330
158 Ga0070681_10435174 3300005458 Bacteria 1224
159 Ga0068867_100000325 3300005459 Bacteria 31413
160 Ga0068867_100001776 3300005459 Bacteria 14990
161 Ga0068867_100051479 3300005459 Bacteria 3037
162 Ga0068867_100287783 3300005459 Bacteria 1350
163 Ga0068867_100306259 3300005459 Bacteria 1311
164 Ga0070685_10002882 3300005466 Bacteria 8794
165 Ga0070706_100081665 3300005467 Bacteria 2994
166 Ga0070706_100168769 3300005467 Bacteria 2043
167 Ga0070706_100431386 3300005467 Bacteria 1226
168 Ga0070707_100878257 3300005468 Bacteria 861
169 Ga0070699_100275195 3300005518 Bacteria 1507
170 Ga0070679_100001410 3300005530 Bacteria 21239
171 Ga0070684_100000526 3300005535 Bacteria 26256
172 Ga0070684_100047686 3300005535 Bacteria 3713
173 Ga0070684_100079132 3300005535 Bacteria 2905
174 Ga0068853_100002423 3300005539 Bacteria 13938
175 Ga0068853_100018602 3300005539 Bacteria 5753
176 Ga0068853_100024074 3300005539 Bacteria 5104
177 Ga0068853_100426231 3300005539 Bacteria 1245
178 Ga0070672_100000358 3300005543 Bacteria 26306
179 Ga0070672_100000433 3300005543 Bacteria 24368
180 Ga0070672_100001907 3300005543 Bacteria 13071
181 Ga0070672_100004203 3300005543 Bacteria 9409
182 Ga0070672_100009042 3300005543 Bacteria 6849
183 Ga0070672_100009113 3300005543 Bacteria 6827
184 Ga0070686_100000704 3300005544 Bacteria 19403
185 Ga0070686_100091419 3300005544 Bacteria 2036
186 Ga0070695_100019851 3300005545 Bacteria 4098
187 Ga0070695_100058832 3300005545 Bacteria 2486
188 Ga0070695_100666978 3300005545 Bacteria 823
189 Ga0070696_100012571 3300005546 Bacteria 5684
190 Ga0070693_100017619 3300005547 Bacteria 3716
191 Ga0070693_100139929 3300005547 Bacteria 1522
192 Ga0070665_100288832 3300005548 Bacteria 1642
193 Ga0070665_100320009 3300005548 Bacteria 1555
194 Ga0070665_100541176 3300005548 Bacteria 1176
195 Ga0070665_100546888 3300005548 Bacteria 1170
196 Ga0070704_100000341 3300005549 Bacteria 21211
197 Ga0070704_100039605 3300005549 Bacteria 3237
198 Ga0070704_100225941 3300005549 Bacteria 1524
199 Ga0068855_100006286 3300005563 Bacteria 14478
200 Ga0068855_100013126 3300005563 Bacteria 9992
201 Ga0068855_100871674 3300005563 Bacteria 953
202 Ga0070664_100001370 3300005564 Bacteria 19408
203 Ga0070664_100072053 3300005564 Bacteria 2962
204 Ga0070664_100076766 3300005564 Bacteria 2871
205 Ga0070664_100096792 3300005564 Bacteria 2562
206 Ga0070664_100099808 3300005564 Bacteria 2523
207 Ga0070664_100240821 3300005564 Bacteria 1624
208 Ga0068857_100000521 3300005577 Bacteria 27715
209 Ga0068857_100000558 3300005577 Bacteria 27209
210 Ga0068857_100256915 3300005577 Bacteria 1603
211 Ga0068854_100000532 3300005578 Bacteria 23105
212 Ga0068854_100007092 3300005578 Bacteria 7154
213 Ga0068854_100344566 3300005578 Bacteria 1218
214 Ga0068856_100002364 3300005614 Bacteria 19400
215 Ga0068856_100061032 3300005614 Bacteria 3724
216 Ga0068856_100073582 3300005614 Bacteria 3383
217 Ga0070702_100000207 3300005615 Bacteria 19394
218 Ga0068852_100000954 3300005616 Bacteria 19044
219 Ga0068852_100006852 3300005616 Bacteria 8279
220 Ga0068852_100048811 3300005616 Bacteria 3618
221 Ga0068859_100002298 3300005617 Bacteria 19408
222 Ga0068859_100019725 3300005617 Bacteria 6770
223 Ga0068859_100284169 3300005617 Bacteria 1747
224 Ga0068859_100394422 3300005617 Bacteria 1480
225 Ga0068859_100620337 3300005617 Bacteria 1174
226 Ga0068859_100757944 3300005617 Bacteria 1059
227 Ga0068864_100003173 3300005618 Bacteria 13595
228 Ga0068864_100004967 3300005618 Bacteria 10906
229 Ga0068864_100048094 3300005618 Bacteria 3666
230 Ga0068864_100097466 3300005618 Bacteria 2603
231 Ga0068864_100281229 3300005618 Bacteria 1553
232 Ga0068864_100764493 3300005618 Bacteria 948
233 Ga0068864_100846264 3300005618 Unclassified 901
234 Ga0068866_10000912 3300005718 Bacteria 12955
235 Ga0068861_100000416 3300005719 Bacteria 24700
236 Ga0068861_100018282 3300005719 Bacteria 4992
237 Ga0068861_100127963 3300005719 Bacteria 2058
238 Ga0068861_100172952 3300005719 Bacteria 1791
239 Ga0068861_100674498 3300005719 Bacteria 958
240 Ga0068851_10037574 3300005834 Bacteria 2428
241 Ga0068851_10041248 3300005834 Bacteria 2320
242 Ga0068851_10048291 3300005834 Bacteria 2157
243 Ga0068851_10176076 3300005834 Bacteria 1183
244 Ga0068870_10000034 3300005840 Bacteria 43913
245 Ga0068870_10117303 3300005840 Bacteria 1528
246 Ga0068863_100002182 3300005841 Bacteria 19408
247 Ga0068863_100093442 3300005841 Bacteria 2854
248 Ga0068863_100097753 3300005841 Bacteria 2788
249 Ga0068863_100105059 3300005841 Bacteria 2687
250 Ga0068863_100792730 3300005841 Bacteria 945
251 Ga0068858_100004013 3300005842 Bacteria 14517
252 Ga0068858_100128549 3300005842 Bacteria 2374
253 Ga0068858_100620650 3300005842 Bacteria 1050
254 Ga0068860_100008063 3300005843 Bacteria 10495
255 Ga0068860_100048446 3300005843 Bacteria 4050
256 Ga0068860_100057315 3300005843 Bacteria 3703
257 Ga0068860_100069835 3300005843 Bacteria 3339
258 Ga0068860_100081432 3300005843 Bacteria 3078
259 Ga0068860_100322876 3300005843 Bacteria 1515
260 Ga0068860_100655696 3300005843 Bacteria 1058
261 Ga0068862_100001525 3300005844 Bacteria 21219
262 Ga0068862_100004818 3300005844 Bacteria 11361
263 Ga0068862_100053036 3300005844 Bacteria 3471
264 Ga0068862_100123082 3300005844 Bacteria 2288
265 Ga0068862_100218847 3300005844 Bacteria 1723
266 Ga0081455_10000204 3300005937 Bacteria 75793
267 Ga0081455_10005710 3300005937 Bacteria 13577
268 Ga0081538_10003120 3300005981 Bacteria 15750
269 Ga0081538_10043104 3300005981 Bacteria 2838
270 Ga0081540_1021931 3300005983 Bacteria 3783
271 Ga0081539_10003651 3300005985 Bacteria 18515
272 Ga0075365_10004100 3300006038 Bacteria 7659
273 Ga0075365_10074403 3300006038 Bacteria 2291
274 Ga0075365_10192936 3300006038 Bacteria 1426
275 Ga0075368_10001078 3300006042 Bacteria 8545
276 Ga0075368_10029548 3300006042 Bacteria 2119
277 Ga0075364_10068119 3300006051 Bacteria 2340
278 Ga0075364_10331685 3300006051 Bacteria 1036
279 Ga0075432_10002270 3300006058 Bacteria 6395
280 Ga0070712_100916821 3300006175 Bacteria 756
281 Ga0075362_10065976 3300006177 Bacteria 1644
282 Ga0075367_10028577 3300006178 Bacteria 3183
283 Ga0075367_10031593 3300006178 Bacteria 3041
284 Ga0075367_10034846 3300006178 Bacteria 2910
285 Ga0075367_10063896 3300006178 Bacteria 2201
286 Ga0075427_10002073 3300006194 Bacteria 2655
287 Ga0075366_10061603 3300006195 Bacteria 2230
288 Ga0075366_10329829 3300006195 Bacteria 935
289 Ga0097621_100000010 3300006237 Bacteria 112867
290 Ga0097621_100052380 3300006237 Bacteria 3325
291 Ga0075370_10015066 3300006353 Bacteria 4133
292 Ga0075370_10017847 3300006353 Bacteria 3839
293 Ga0068871_100000193 3300006358 Bacteria 41878
294 Ga0068871_100018026 3300006358 Bacteria 5358
295 Ga0068871_100054187 3300006358 Bacteria 3253
296 Ga0068871_100055683 3300006358 Bacteria 3211
297 Ga0068871_100055704 3300006358 Bacteria 3211
298 Ga0068871_100324958 3300006358 Bacteria 1356
299 Ga0075428_100021307 3300006844 Bacteria 7176
300 Ga0075428_100046620 3300006844 Bacteria 4760
301 Ga0075428_100153765 3300006844 Bacteria 2499
302 Ga0075428_100177449 3300006844 Bacteria 2307
303 Ga0075428_100185745 3300006844 Bacteria 2249
304 Ga0075430_100000112 3300006846 Bacteria 48871
305 Ga0075430_100026999 3300006846 Bacteria 4883
306 Ga0075430_100348418 3300006846 Bacteria 1223
307 Ga0075430_100364924 3300006846 Unclassified 1192
308 Ga0075431_100004280 3300006847 Bacteria 13986
309 Ga0075431_100168059 3300006847 Bacteria 2254
310 Ga0075431_100176379 3300006847 Bacteria 2195
311 Ga0075431_100205794 3300006847 Bacteria 2012
312 Ga0075431_100224512 3300006847 Bacteria 1915
313 Ga0075431_100307511 3300006847 Bacteria 1601
314 Ga0075431_100681393 3300006847 Bacteria 1007
315 Ga0075433_10000639 3300006852 Bacteria 23475
316 Ga0075433_10016732 3300006852 Bacteria 6054
317 Ga0075433_10028231 3300006852 Bacteria 4769
318 Ga0075433_10069403 3300006852 Bacteria 3096
319 Ga0075433_10830418 3300006852 Bacteria 807
320 Ga0075434_100000661 3300006871 Bacteria 26715
321 Ga0075434_100001173 3300006871 Bacteria 21711
322 Ga0075434_100015291 3300006871 Bacteria 7354
323 Ga0075434_100018111 3300006871 Bacteria 6796
324 Ga0075434_100280483 3300006871 Bacteria 1686
325 Ga0075429_100000479 3300006880 Bacteria 29848
326 Ga0075429_100010700 3300006880 Bacteria 7936
327 Ga0075429_100067370 3300006880 Bacteria 3115
328 Ga0075429_100126110 3300006880 Bacteria 2238
329 Ga0075429_100228267 3300006880 Bacteria 1631
330 Ga0068865_100000252 3300006881 Bacteria 29599
331 Ga0068865_100057899 3300006881 Bacteria 2705
332 Ga0075436_100058363 3300006914 Bacteria 2665
333 Ga0097620_100002298 3300006931 Bacteria 19408
334 Ga0097620_100019727 3300006931 Bacteria 6770
335 Ga0097620_100284156 3300006931 Bacteria 1747
336 Ga0097620_100394410 3300006931 Bacteria 1480
337 Ga0097620_100620307 3300006931 Bacteria 1174
338 Ga0097620_100757915 3300006931 Bacteria 1059
339 Ga0075435_100029917 3300007076 Bacteria 4278
340 Ga0075435_100048782 3300007076 Bacteria 3403
341 Ga0075435_100093896 3300007076 Bacteria 2479
342 Ga0075435_100154525 3300007076 Bacteria 1930
343 Ga0075435_100747087 3300007076 Bacteria 851
344 Ga0105240_10042779 3300009093 Bacteria 5770
345 Ga0105240_10289082 3300009093 Bacteria 1880
346 Ga0111539_10003320 3300009094 Bacteria 21239
347 Ga0111539_10004062 3300009094 Bacteria 19220
348 Ga0111539_10005715 3300009094 Bacteria 16085
349 Ga0111539_10088435 3300009094 Bacteria 3640
350 Ga0111539_10103969 3300009094 Bacteria 3333
351 Ga0105247_10001439 3300009101 Bacteria 17243
352 Ga0114129_10004085 3300009147 Bacteria 20622
353 Ga0114129_10010935 3300009147 Bacteria 12932
354 Ga0114129_10025348 3300009147 Bacteria 8403
355 Ga0114129_10055021 3300009147 Bacteria 5577
356 Ga0114129_10066913 3300009147 Bacteria 5010
357 Ga0114129_10129972 3300009147 Bacteria 3460
358 Ga0114129_10142943 3300009147 Bacteria 3278
359 Ga0114129_10437738 3300009147 Bacteria 1717
360 Ga0114129_10818454 3300009147 Bacteria 1187
361 Ga0105243_10002371 3300009148 Bacteria 15770
362 Ga0105241_10000770 3300009174 Bacteria 24359
363 Ga0105241_10252539 3300009174 Bacteria 1496
364 Ga0105242_10002422 3300009176 Bacteria 14653
365 Ga0105242_10934804 3300009176 Bacteria 870
366 Ga0105248_10002790 3300009177 Bacteria 19413
367 Ga0105248_10008272 3300009177 Bacteria 11429
368 Ga0105248_10093446 3300009177 Bacteria 3387
369 Ga0105248_10242071 3300009177 Bacteria 2031
370 Ga0105248_10277453 3300009177 Bacteria 1887
371 Ga0105237_10013310 3300009545 Bacteria 8629
372 Ga0105237_10149771 3300009545 Bacteria 2329
373 Ga0105237_10167776 3300009545 Bacteria 2195
374 Ga0105237_10234058 3300009545 Bacteria 1838
375 Ga0105238_10054770 3300009551 Bacteria 4005
376 Ga0105238_10104413 3300009551 Bacteria 2814
377 Ga0105249_10001686 3300009553 Bacteria 19382
378 Ga0105249_10048918 3300009553 Bacteria 3855
379 Ga0105249_10502274 3300009553 Bacteria 1258
380 Ga0099796_10018269 3300010159 Bacteria 2102
381 Ga0105239_10032940 3300010375 Bacteria 5693
382 Ga0105239_10297547 3300010375 Bacteria 1817
383 Ga0105246_10000081 3300011119 Bacteria 40525
384 Ga0105246_10379094 3300011119 Bacteria 1168
385 Ga0157344_1000345 3300012476 Bacteria 1741
386 Ga0157335_1001295 3300012492 Bacteria 1346
387 Ga0157341_1000159 3300012494 Bacteria 3005
388 Ga0157373_10012612 3300013100 Bacteria 6213
389 Ga0157373_10058688 3300013100 Bacteria 2727
390 Ga0157371_10020506 3300013102 Bacteria 4864
391 Ga0157371_10164913 3300013102 Bacteria 1582
392 Ga0157371_10198703 3300013102 Bacteria 1437
393 Ga0157370_10580206 3300013104 Bacteria 1027
394 Ga0157369_10002671 3300013105 Bacteria 21264
395 Ga0157374_10009607 3300013296 Bacteria 8309
396 Ga0157374_10027881 3300013296 Bacteria 5099
397 Ga0157374_10120006 3300013296 Bacteria 2536
398 Ga0157374_10455124 3300013296 Bacteria 1281
399 Ga0157378_10000990 3300013297 Bacteria 26013
400 Ga0157378_10091118 3300013297 Bacteria 2771
401 Ga0157378_10215132 3300013297 Bacteria 1824
402 Ga0157378_10575632 3300013297 Bacteria 1134
403 Ga0157378_10742239 3300013297 Bacteria 1004
404 Ga0157378_10814204 3300013297 Bacteria 960
405 Ga0163162_10005170 3300013306 Bacteria 12583
406 Ga0163162_10217636 3300013306 Bacteria 2040
407 Ga0163162_11619450 3300013306 Bacteria 739
408 Ga0157372_10012072 3300013307 Bacteria 9200
409 Ga0157372_10016190 3300013307 Bacteria 8000
410 Ga0157372_10132940 3300013307 Bacteria 2864
411 Ga0157375_10000944 3300013308 Bacteria 25192
412 Ga0157375_10002393 3300013308 Bacteria 16235
413 Ga0157375_10033432 3300013308 Bacteria 4887
414 Ga0157375_10108398 3300013308 Bacteria 2872
415 Ga0157375_10129377 3300013308 Bacteria 2643
416 Ga0157375_10180892 3300013308 Bacteria 2260
417 Ga0157375_10375468 3300013308 Bacteria 1588
418 Ga0157375_10949582 3300013308 Bacteria 1002
419 Ga0163163_10010654 3300014325 Bacteria 8286
420 Ga0163163_10032566 3300014325 Bacteria 5035
421 Ga0163163_10507948 3300014325 Bacteria 1267
422 Ga0163163_10586986 3300014325 Bacteria 1177
423 Ga0163163_10903823 3300014325 Bacteria 946
424 Ga0157380_10000321 3300014326 Bacteria 28973
425 Ga0157380_10097037 3300014326 Bacteria 2445
426 Ga0157380_10116040 3300014326 Bacteria 2259
427 Ga0182008_10101751 3300014497 Bacteria 1420
428 Ga0157379_10039887 3300014968 Bacteria 4190
429 Ga0157379_10118758 3300014968 Bacteria 2378
430 Ga0157379_10424071 3300014968 Bacteria 1225
431 Ga0157379_10905851 3300014968 Bacteria 837
432 Ga0157376_10000098 3300014969 Bacteria 63149
433 Ga0157376_10047593 3300014969 Bacteria 3541
434 Ga0157376_10098987 3300014969 Bacteria 2543
435 Ga0157376_10329793 3300014969 Bacteria 1454
436 Ga0163161_10000866 3300017792 Bacteria 23560
437 Ga0163161_10006805 3300017792 Bacteria 7904
438 Ga0163161_10025174 3300017792 Bacteria 4210
439 Ga0163161_10045283 3300017792 Bacteria 3172
440 Ga0206354_11042258 3300020081 Bacteria 1068
441 Ga0206353_12052891 3300020082 Bacteria 1136
442 Ga0213876_10155915 3300021384 Bacteria 1215
443 Ga0209129_1000326 3300025258 Bacteria 41836
444 Ga0209233_1023062 3300025261 Bacteria 1583
445 Ga0207666_1000027 3300025271 Bacteria 33321
446 Ga0209673_1051683 3300025273 Bacteria 1083
447 Ga0209564_1000057 3300025295 Bacteria 340400
448 Ga0209758_1000096 3300025297 Bacteria 231496
449 Ga0209758_1000174 3300025297 Bacteria 147347
450 Ga0209050_1016098 3300025298 Bacteria 3084
451 Ga0207697_10000553 3300025315 Bacteria 21216
452 Ga0207697_10043527 3300025315 Bacteria 1846
453 Ga0207697_10054565 3300025315 Bacteria 1656
454 Ga0207656_10129249 3300025321 Bacteria 1182
455 Ga0207653_10002753 3300025885 Bacteria 5592
456 Ga0207653_10093539 3300025885 Bacteria 1055
457 Ga0207682_10000006 3300025893 Bacteria 94953
458 Ga0207682_10000122 3300025893 Bacteria 35790
459 Ga0207682_10015241 3300025893 Bacteria 2992
460 Ga0207682_10113471 3300025893 Bacteria 1195
461 Ga0207642_10000107 3300025899 Bacteria 22438
462 Ga0207642_10008252 3300025899 Bacteria 3562
463 Ga0207710_10000632 3300025900 Bacteria 20218
464 Ga0207688_10000205 3300025901 Bacteria 26409
465 Ga0207680_10028658 3300025903 Bacteria 3118
466 Ga0207680_10076733 3300025903 Bacteria 2087
467 Ga0207680_10085030 3300025903 Bacteria 1997
468 Ga0207680_10108104 3300025903 Bacteria 1799
469 Ga0207647_10067576 3300025904 Bacteria 2166
470 Ga0207647_10117406 3300025904 Bacteria 1570
471 Ga0207647_10133908 3300025904 Bacteria 1455
472 Ga0207699_10019646 3300025906 Bacteria 3608
473 Ga0207645_10000023 3300025907 Bacteria 98724
474 Ga0207645_10000063 3300025907 Bacteria 76658
475 Ga0207645_10091642 3300025907 Bacteria 1955
476 Ga0207645_10131063 3300025907 Bacteria 1632
477 Ga0207643_10000007 3300025908 Bacteria 171706
478 Ga0207643_10006191 3300025908 Bacteria 6404
479 Ga0207643_10122334 3300025908 Bacteria 1542
480 Ga0207643_10156866 3300025908 Bacteria 1367
481 Ga0207705_10104709 3300025909 Bacteria 2085
482 Ga0207684_10020525 3300025910 Bacteria 5645
483 Ga0207684_10285449 3300025910 Bacteria 1423
484 Ga0207684_10290266 3300025910 Bacteria 1410
485 Ga0207684_10373988 3300025910 Bacteria 1226
486 Ga0207654_10001016 3300025911 Bacteria 15352
487 Ga0207707_10000786 3300025912 Bacteria 31086
488 Ga0207707_10026873 3300025912 Bacteria 5030
489 Ga0207707_10062947 3300025912 Bacteria 3229
490 Ga0207707_10130681 3300025912 Bacteria 2196
491 Ga0207707_10245998 3300025912 Bacteria 1554
492 Ga0207707_10376271 3300025912 Bacteria 1221
493 Ga0207695_10021722 3300025913 Bacteria 7315
494 Ga0207695_10070670 3300025913 Bacteria 3567
495 Ga0207671_10058655 3300025914 Bacteria 2854
496 Ga0207671_10194970 3300025914 Bacteria 1580
497 Ga0207671_10751091 3300025914 Unclassified 775
498 Ga0207660_10000058 3300025917 Bacteria 56791
499 Ga0207660_10057376 3300025917 Bacteria 2789
500 Ga0207660_10354010 3300025917 Bacteria 1177
501 Ga0207662_10000896 3300025918 Bacteria 13794
502 Ga0207662_10173270 3300025918 Bacteria 1385
503 Ga0207662_10190196 3300025918 Bacteria 1324
504 Ga0207657_10002630 3300025919 Bacteria 19398
505 Ga0207657_10059084 3300025919 Bacteria 3297
506 Ga0207657_10241770 3300025919 Bacteria 1441
507 Ga0207649_10000384 3300025920 Bacteria 33073
508 Ga0207649_10005635 3300025920 Bacteria 6776
509 Ga0207652_10000377 3300025921 Bacteria 46255
510 Ga0207681_10000100 3300025923 Bacteria 72913
511 Ga0207681_10001984 3300025923 Bacteria 13141
512 Ga0207681_10035031 3300025923 Bacteria 3306
513 Ga0207681_10126883 3300025923 Bacteria 1880
514 Ga0207681_10163502 3300025923 Bacteria 1680
515 Ga0207681_10169593 3300025923 Bacteria 1653
516 Ga0207694_10039684 3300025924 Bacteria 3623
517 Ga0207650_10000274 3300025925 Bacteria 54226
518 Ga0207650_10021279 3300025925 Bacteria 4584
519 Ga0207650_10038763 3300025925 Bacteria 3482
520 Ga0207650_10092631 3300025925 Bacteria 2312
521 Ga0207650_10159659 3300025925 Bacteria 1785
522 Ga0207650_10777379 3300025925 Bacteria 811
523 Ga0207659_10000044 3300025926 Bacteria 88759
524 Ga0207659_10001802 3300025926 Bacteria 12671
525 Ga0207659_10004273 3300025926 Bacteria 8637
526 Ga0207659_10203019 3300025926 Bacteria 1584
527 Ga0207687_10001241 3300025927 Bacteria 17449
528 Ga0207700_10126910 3300025928 Bacteria 2077
529 Ga0207664_10011801 3300025929 Bacteria 6228
530 Ga0207644_10000690 3300025931 Bacteria 21367
531 Ga0207644_10004596 3300025931 Bacteria 8977
532 Ga0207644_10014495 3300025931 Bacteria 5272
533 Ga0207644_10180703 3300025931 Bacteria 1653
534 Ga0207644_10756420 3300025931 Bacteria 812
535 Ga0207690_10000601 3300025932 Bacteria 23359
536 Ga0207690_10252935 3300025932 Bacteria 1362
537 Ga0207706_10001769 3300025933 Bacteria 21216
538 Ga0207706_10184470 3300025933 Bacteria 1832
539 Ga0207706_10210632 3300025933 Bacteria 1704
540 Ga0207706_10278191 3300025933 Bacteria 1460
541 Ga0207686_10000222 3300025934 Bacteria 43531
542 Ga0207709_10000154 3300025935 Bacteria 93456
543 Ga0207670_10000129 3300025936 Bacteria 49928
544 Ga0207670_10159585 3300025936 Bacteria 1682
545 Ga0207669_10000160 3300025937 Bacteria 32152
546 Ga0207669_10052574 3300025937 Bacteria 2448
547 Ga0207669_10132916 3300025937 Bacteria 1713
548 Ga0207669_10161723 3300025937 Bacteria 1582
549 Ga0207669_10191086 3300025937 Bacteria 1477
550 Ga0207704_10128918 3300025938 Bacteria 1747
551 Ga0207704_10497974 3300025938 Bacteria 981
552 Ga0207691_10000050 3300025940 Bacteria 94763
553 Ga0207691_10000405 3300025940 Bacteria 43134
554 Ga0207691_10000494 3300025940 Bacteria 39257
555 Ga0207691_10003496 3300025940 Bacteria 15284
556 Ga0207691_10023336 3300025940 Bacteria 5823
557 Ga0207691_10024298 3300025940 Bacteria 5699
558 Ga0207691_10096509 3300025940 Bacteria 2643
559 Ga0207711_10006895 3300025941 Bacteria 9539
560 Ga0207711_10038504 3300025941 Bacteria 4067
561 Ga0207711_10056663 3300025941 Bacteria 3368
562 Ga0207711_10274935 3300025941 Bacteria 1550
563 Ga0207711_10322428 3300025941 Bacteria 1428
564 Ga0207689_10000098 3300025942 Bacteria 69773
565 Ga0207689_10004462 3300025942 Bacteria 12690
566 Ga0207689_10146973 3300025942 Bacteria 1942
567 Ga0207689_10513950 3300025942 Bacteria 1004
568 Ga0207661_10000178 3300025944 Bacteria 41008
569 Ga0207661_10000576 3300025944 Bacteria 23427
570 Ga0207661_10079917 3300025944 Bacteria 2696
571 Ga0207661_10154952 3300025944 Bacteria 1983
572 Ga0207661_10484716 3300025944 Bacteria 1129
573 Ga0207679_10000029 3300025945 Bacteria 183002
574 Ga0207679_10002734 3300025945 Bacteria 10908
575 Ga0207679_10117306 3300025945 Bacteria 2112
576 Ga0207679_10141454 3300025945 Bacteria 1945
577 Ga0207667_10003212 3300025949 Bacteria 20183
578 Ga0207667_10049074 3300025949 Bacteria 4461
579 Ga0207667_10108943 3300025949 Bacteria 2857
580 Ga0207667_10440914 3300025949 Bacteria 1324
581 Ga0207651_10000031 3300025960 Bacteria 66688
582 Ga0207651_10001168 3300025960 Bacteria 11757
583 Ga0207651_10001963 3300025960 Bacteria 9673
584 Ga0207651_10007821 3300025960 Bacteria 5722
585 Ga0207712_10000129 3300025961 Bacteria 79246
586 Ga0207712_10031710 3300025961 Bacteria 3562
587 Ga0207712_10098538 3300025961 Bacteria 2168
588 Ga0207712_10110049 3300025961 Unclassified 2065
589 Ga0207668_10000158 3300025972 Bacteria 47189
590 Ga0207668_10011562 3300025972 Bacteria 5369
591 Ga0207668_10077299 3300025972 Bacteria 2399
592 Ga0207668_10085635 3300025972 Bacteria 2300
593 Ga0207668_10151481 3300025972 Bacteria 1796
594 Ga0207668_10657839 3300025972 Bacteria 917
595 Ga0207640_10000168 3300025981 Bacteria 47588
596 Ga0207640_10005748 3300025981 Bacteria 6758
597 Ga0207640_10182772 3300025981 Bacteria 1574
598 Ga0207640_10348715 3300025981 Bacteria 1189
599 Ga0207640_10445096 3300025981 Bacteria 1066
600 Ga0207658_10000655 3300025986 Bacteria 30194
601 Ga0207658_10009288 3300025986 Bacteria 6669
602 Ga0207658_10072411 3300025986 Bacteria 2612
603 Ga0207658_10105408 3300025986 Bacteria 2217
604 Ga0207658_10225789 3300025986 Bacteria 1578
605 Ga0207677_10000553 3300026023 Bacteria 23608
606 Ga0207677_10004591 3300026023 Bacteria 7428
607 Ga0207677_10333989 3300026023 Bacteria 1264
608 Ga0207677_10361291 3300026023 Bacteria 1220
609 Ga0207677_10602786 3300026023 Bacteria 964
610 Ga0207703_10000631 3300026035 Bacteria 35469
611 Ga0207703_10383940 3300026035 Bacteria 1300
612 Ga0207639_10001591 3300026041 Bacteria 15257
613 Ga0207639_10051592 3300026041 Bacteria 3129
614 Ga0207639_10055034 3300026041 Bacteria 3043
615 Ga0207639_10271729 3300026041 Bacteria 1487
616 Ga0207678_10001139 3300026067 Bacteria 24368
617 Ga0207678_10004837 3300026067 Bacteria 12095
618 Ga0207678_10470148 3300026067 Bacteria 1094
619 Ga0207708_10000660 3300026075 Bacteria 26442
620 Ga0207708_10031895 3300026075 Bacteria 4001
621 Ga0207708_10197342 3300026075 Bacteria 1604
622 Ga0207708_10285256 3300026075 Bacteria 1339
623 Ga0207702_10000404 3300026078 Bacteria 49177
624 Ga0207702_10014696 3300026078 Bacteria 6495
625 Ga0207702_10147535 3300026078 Bacteria 2136
626 Ga0207641_10000520 3300026088 Bacteria 43187
627 Ga0207641_10008171 3300026088 Bacteria 8660
628 Ga0207641_10010886 3300026088 Bacteria 7452
629 Ga0207641_10145849 3300026088 Bacteria 2140
630 Ga0207641_10294196 3300026088 Bacteria 1531
631 Ga0207648_10000072 3300026089 Bacteria 94957
632 Ga0207648_10047268 3300026089 Bacteria 3773
633 Ga0207648_10055433 3300026089 Bacteria 3460
634 Ga0207648_10096683 3300026089 Bacteria 2584
635 Ga0207648_10125504 3300026089 Bacteria 2258
636 Ga0207648_10179166 3300026089 Bacteria 1875
637 Ga0207676_10000180 3300026095 Bacteria 55634
638 Ga0207676_10043371 3300026095 Bacteria 3463
639 Ga0207676_10100932 3300026095 Bacteria 2392
640 Ga0207676_10268801 3300026095 Bacteria 1543
641 Ga0207676_10269596 3300026095 Bacteria 1541
642 Ga0207676_10552250 3300026095 Bacteria 1100
643 Ga0207676_10770313 3300026095 Unclassified 937
644 Ga0207674_10000049 3300026116 Bacteria 118784
645 Ga0207674_10003433 3300026116 Bacteria 19398
646 Ga0207674_10074109 3300026116 Bacteria 3417
647 Ga0207674_10113871 3300026116 Bacteria 2677
648 Ga0207674_10123631 3300026116 Bacteria 2553
649 Ga0207675_100021979 3300026118 Bacteria 5939
650 Ga0207675_100033128 3300026118 Bacteria 4814
651 Ga0207675_100052678 3300026118 Bacteria 3797
652 Ga0207675_100058840 3300026118 Bacteria 3586
653 Ga0207675_100124676 3300026118 Bacteria 2439
654 Ga0207675_100211395 3300026118 Bacteria 1866
655 Ga0207683_10000029 3300026121 Bacteria 109665
656 Ga0207683_10000521 3300026121 Bacteria 35599
657 Ga0207683_10005585 3300026121 Bacteria 10781
658 Ga0207683_10018977 3300026121 Bacteria 5868
659 Ga0207683_10055869 3300026121 Bacteria 3462
660 Ga0207683_10215857 3300026121 Bacteria 1747
661 Ga0207683_10537019 3300026121 Bacteria 1081
662 Ga0207698_10000682 3300026142 Bacteria 19692
663 Ga0207698_10002475 3300026142 Bacteria 10953
664 Ga0207698_10076422 3300026142 Bacteria 2680
665 Ga0210002_1000485 3300027617 Bacteria 5400
666 Ga0209588_1077418 3300027671 Bacteria 1075
667 Ga0209966_1008488 3300027695 Bacteria 1825
668 Ga0209966_1037871 3300027695 Bacteria 997
669 Ga0209998_10002969 3300027717 Bacteria 3784
670 Ga0209813_10001943 3300027866 Bacteria 4673
671 Ga0209813_10020110 3300027866 Bacteria 1864
672 Ga0209974_10030398 3300027876 Bacteria 1790
673 Ga0209974_10046169 3300027876 Bacteria 1456
674 Ga0207428_10000100 3300027907 Bacteria 119495
675 Ga0207428_10000124 3300027907 Bacteria 105795
676 Ga0207428_10000968 3300027907 Bacteria 31823
677 Ga0207428_10021134 3300027907 Bacteria 5513
678 Ga0268266_10008615 3300028379 Bacteria 9058
679 Ga0268266_10057152 3300028379 Bacteria 3357
680 Ga0268266_10181249 3300028379 Bacteria 1918
681 Ga0268266_10255085 3300028379 Bacteria 1623
682 Ga0268265_10000698 3300028380 Bacteria 32950
683 Ga0268265_10005564 3300028380 Bacteria 8599
684 Ga0268265_10333498 3300028380 Bacteria 1378
685 Ga0268264_10001558 3300028381 Bacteria 21254
686 Ga0268264_10046391 3300028381 Bacteria 3609
687 Ga0268264_10183495 3300028381 Bacteria 1902
688 Ga0268264_10285489 3300028381 Bacteria 1548
689 Ga0268264_10547190 3300028381 Bacteria 1135
690 Ga0265318_10006235 3300028577 Bacteria 5512
691 Ga0307517_10000644 3300028786 Bacteria 59773
692 Ga0307517_10137131 3300028786 Bacteria 1735
693 Ga0307515_10006527 3300028794 Bacteria 23330
694 Ga0307515_10176947 3300028794 Bacteria 2100
695 Ga0307515_10492371 3300028794 Bacteria 837
696 Ga0307512_10112651 3300030522 Bacteria 1784
697 Ga0265332_10063392 3300031238 Bacteria 1579
698 Ga0265328_10006421 3300031239 Unclassified 4984
699 Ga0265320_10023698 3300031240 Bacteria 3261
700 Ga0265325_10006840 3300031241 Bacteria 6892
701 Ga0265325_10073737 3300031241 Bacteria 1708
702 Ga0265329_10031811 3300031242 Bacteria 1712
703 Ga0265340_10040813 3300031247 Bacteria 2284
704 Ga0265340_10205686 3300031247 Bacteria 884
705 Ga0265339_10031699 3300031249 Bacteria 2986
706 Ga0265339_10064302 3300031249 Bacteria 1969
707 Ga0265331_10005867 3300031250 Bacteria 7351
708 Ga0265316_10082981 3300031344 Unclassified 2455
709 Ga0265316_10381201 3300031344 Bacteria 1017
710 Ga0307513_10171324 3300031456 Bacteria 2048
711 Ga0307509_10000041 3300031507 Bacteria 182302
712 Ga0307509_10003100 3300031507 Bacteria 25816
713 Ga0307509_10009112 3300031507 Bacteria 12477
714 Ga0265313_10026426 3300031595 Bacteria 3057
715 Ga0307508_10211428 3300031616 Bacteria 1540
716 Ga0307508_10316998 3300031616 Bacteria 1151
717 Ga0307514_10066812 3300031649 Bacteria 2717
718 Ga0307514_10195461 3300031649 Bacteria 1281
719 Ga0265314_10000992 3300031711 Bacteria 33381
720 Ga0265314_10150180 3300031711 Bacteria 1430
721 Ga0265342_10016326 3300031712 Bacteria 4858
722 Ga0265342_10023182 3300031712 Unclassified 3933
723 Ga0307516_10032420 3300031730 Bacteria 5262
724 Ga0307411_10464830 3300032005 Bacteria 1062
725 Ga0307507_10045329 3300033179 Bacteria 4328
726 Ga0307507_10205846 3300033179 Bacteria 1352
727 Ga0307510_10002283 3300033180 Bacteria 21628
728 Ga0307510_10009870 3300033180 Bacteria 11360
729 Ga0307510_10067350 3300033180 Bacteria 3605
730 Ga0307510_10100119 3300033180 Bacteria 2693
731 Ga0307510_10286362 3300033180 Bacteria 1115
732 Ga0373950_0001825 3300034818 Bacteria 2848
733 Ga0373950_0049201 3300034818 Bacteria 825
734 Ga0373938_0000494 3300034957 Bacteria 6354
735 Ga0373926_0186908 3300035083 Bacteria 795
736 Ga0373928_0009097 3300035084 Bacteria 1938
737 Ga0373929_0001228 3300035085 Bacteria 4958
738 Ga0373934_0010526 3300035086 Bacteria 3472
739 Ga0373940_0035624 3300035088 Bacteria 1348
740 Ga0373940_0081037 3300035088 Bacteria 959
741 Ga0373944_0013956 3300035089 Bacteria 2237
742 Ga0373949_0001228 3300035090 Bacteria 7565
743 Ga0373952_0001688 3300035092 Bacteria 4017
744 Ga0373923_0148735 3300035111 Bacteria 1062
745 Ga0373923_0248304 3300035111 Bacteria 832
746 Ga0373923_0267302 3300035111 Bacteria 804
747 Ga0373936_0068289 3300035113 Bacteria 1461
748 Ga0373939_0012040 3300035114 Bacteria 2197
749 Ga0373941_0015879 3300035115 Bacteria 2037
750 Ga0373953_0043817 3300035117 Bacteria 1787
751 Ga0373953_0109480 3300035117 Bacteria 1167
752 Ga0373954_0006658 3300035118 Bacteria 5042
753 Ga0373954_0029740 3300035118 Bacteria 2517
754 Ga0373954_0045779 3300035118 Bacteria 2044
755 Ga0373954_0281960 3300035118 Unclassified 819
756 Ga0373956_0004764 3300035119 Bacteria 5428
757 Ga0373956_0031015 3300035119 Bacteria 2339
758 Ga0373957_0031414 3300035120 Bacteria 1951
759 Ga0373946_0111546 3300035171 Unclassified 1238
760 Ga0373946_0252714 3300035171 Bacteria 860
761 Ga0373946_0255206 3300035171 Bacteria 856
762 Ga0373955_0022227 3300035172 Bacteria 3214
763 Ga0373942_0001685 3300035207 Bacteria 5598
764 Ga0373961_0014842 3300035241 Bacteria 1983
765 Ga0373962_0000138 3300035242 Bacteria 14991
766 Ga0373924_0101628 3300035410 Bacteria 1237
767 Ga0373931_0000239 3300035691 Bacteria 23413
768 Ga0373935_0039383 3300035692 Bacteria 2964
769 Ga0373935_0074833 3300035692 Bacteria 2190
770 Ga0373935_0134875 3300035692 Unclassified 1662
771 Ga0373927_0022826 3300035695 Unclassified 4099
772 Ga0373933_0114087 3300035724 Bacteria 1687
773 Ga0373933_0132460 3300035724 Bacteria 1568
774 Ga0373947_0345374 3300035725 Bacteria 998
775 Ga0373947_0391886 3300035725 Bacteria 936
776 Ga0373947_0570793 3300035725 Unclassified 770
777 Ga0373937_0051941 3300036401 Bacteria 3757
778 Ga0373937_0193468 3300036401 Bacteria 1911
779 Ga0373937_0226181 3300036401 Bacteria 1761
780 Ga0373937_0545123 3300036401 Bacteria 1102
781 Ga0373937_0687364 3300036401 Bacteria 969
782 Ga0373925_0030541 3300037068 Bacteria 3955
783 Ga0373925_0077575 3300037068 Bacteria 2522
784 Ga0373925_0095744 3300037068 Bacteria 2275
785 Ga0373925_0390326 3300037068 Unclassified 1134
786 Ga0395900_0003717 3300037418 Bacteria 16401
787 Ga0395898_0671469 3300037466 Bacteria 978
788 Ga0395905_0016990 3300037471 Bacteria 6909
789 Ga0395905_0058630 3300037471 Bacteria 3600
790 Ga0395905_0453243 3300037471 Bacteria 1181
791 Ga0395905_0827193 3300037471 Bacteria 829
792 Ga0436364_0517049 3300037853 Bacteria 1399
793 Ga0395901_0011964 3300038443 Bacteria 8799
794 Ga0436365_0019248 3300039437 Bacteria 1028
795 Ga0451802_2066676 3300041460 Bacteria 1399
796 Ga0439450_039217 3300042008 Bacteria 1094
797 Ga0439464_0069682 3300042439 Bacteria 1039
798 Ga0439460_0021573 3300042461 Bacteria 1761
799 Ga0451577_0718923 3300042876 Bacteria 904
800 Ga0453683_0002857 3300044673 Bacteria 13086
801 Ga0466967_0064520 3300045976 Bacteria 3257
802 Ga0495592_0001970 3300046454 Bacteria 14493
803 Ga0495592_0051483 3300046454 Bacteria 3058
804 Ga0495592_0057634 3300046454 Bacteria 2867
805 Ga0495592_0090135 3300046454 Bacteria 2200
806 Ga0495592_0128175 3300046454 Bacteria 1777
807 Ga0495590_0001111 3300046457 Bacteria 11827
808 Ga0495629_0151062 3300046459 Bacteria 1614
809 Ga0495629_0153427 3300046459 Bacteria 1601
810 Ga0495638_0116305 3300046460 Bacteria 1584
811 Ga0495641_0139804 3300046461 Bacteria 1081
812 Ga0495651_0046327 3300046462 Bacteria 3365
813 Ga0495651_0531080 3300046462 Bacteria 750
814 Ga0495653_0264103 3300046463 Bacteria 1136
815 Ga0495580_0000683 3300046472 Bacteria 28898
816 Ga0495580_0128872 3300046472 Bacteria 1755
817 Ga0495582_0104641 3300046473 Unclassified 1587
818 Ga0495605_0230228 3300046474 Bacteria 798
819 Ga0495639_0025312 3300046475 Bacteria 2616
820 Ga0495662_0025409 3300046476 Bacteria 2860
821 Ga0495664_0026882 3300046477 Bacteria 3353
822 Ga0495585_0282240 3300046492 Bacteria 821
823 Ga0495608_0024660 3300046511 Bacteria 4109
824 Ga0495608_0071301 3300046511 Bacteria 2267
825 Ga0495610_0037726 3300046512 Bacteria 2457
826 Ga0495618_0398466 3300046514 Unclassified 842
827 Ga0495628_0015428 3300046516 Bacteria 6378
828 Ga0495628_0018439 3300046516 Bacteria 5780
829 Ga0495628_0194020 3300046516 Bacteria 1533
830 Ga0495628_0312523 3300046516 Bacteria 1161
831 Ga0495628_0433060 3300046516 Unclassified 957
832 Ga0495630_0078045 3300046517 Bacteria 2497
833 Ga0495630_0094796 3300046517 Unclassified 2256
834 Ga0495630_0206881 3300046517 Unclassified 1498
835 Ga0495630_0283597 3300046517 Bacteria 1265
836 Ga0495632_0147584 3300046519 Bacteria 1088
837 Ga0495666_0189118 3300046526 Bacteria 949
838 Ga0495652_0018867 3300046529 Bacteria 6147
839 Ga0495652_0152169 3300046529 Bacteria 1806
840 Ga0495652_0191425 3300046529 Bacteria 1560
841 Ga0495640_0024230 3300046533 Bacteria 4415
842 Ga0495640_0060233 3300046533 Unclassified 2582
843 Ga0495586_0051513 3300046535 Bacteria 2228
844 Ga0495586_0250907 3300046535 Bacteria 1009
845 Ga0495587_0031018 3300046536 Bacteria 3239
846 Ga0495645_0025284 3300046543 Bacteria 4309
847 Ga0495622_0108936 3300046557 Bacteria 1268
848 Ga0495622_0271821 3300046557 Bacteria 742
849 Ga0495667_0036451 3300046559 Bacteria 3283
850 Ga0495667_0047951 3300046559 Bacteria 2821
851 Ga0495667_0050414 3300046559 Bacteria 2748
852 Ga0495634_0257114 3300046642 Bacteria 1066
853 Ga0495635_0050965 3300046663 Bacteria 2853
854 Ga0495635_0064172 3300046663 Bacteria 2522
855 Ga0495659_0020476 3300046664 Bacteria 2222
856 Ga0495657_0077848 3300046675 Bacteria 2150
857 Ga0495599_0037398 3300046678 Bacteria 3049
858 Ga0495646_0100828 3300046680 Bacteria 1656
859 Ga0495647_0023746 3300046681 Bacteria 2226
860 Ga0495658_0128525 3300046683 Bacteria 1540
861 Ga0495658_0135058 3300046683 Bacteria 1505
862 Ga0495669_0110227 3300046684 Bacteria 1285
863 Ga0495613_0066450 3300046689 Bacteria 2633
864 Ga0495624_0037607 3300046690 Bacteria 3112
865 Ga0495624_0429525 3300046690 Bacteria 792
866 Ga0495600_0220919 3300046809 Bacteria 1212
867 Ga0495660_0264306 3300046810 Bacteria 793
868 Ga0495674_0082122 3300047319 Bacteria 2763
869 Ga0495676_0078685 3300047321 Bacteria 2509
870 Ga0495680_0036557 3300047322 Bacteria 3941
871 Ga0495675_0124627 3300047444 Bacteria 1603
872 Ga0495675_0139732 3300047444 Bacteria 1502
873 Ga0495686_0221088 3300047472 Bacteria 1077
874 Ga0495593_0061448 3300047673 Bacteria 1965
875 Ga0495614_0266961 3300048089 Bacteria 786
876 Ga0496100_0002349 3300048903 Bacteria 9573
877 Ga0496101_0000187 3300048904 Bacteria 48785
878 Ga0496101_0014419 3300048904 Bacteria 5312
879 Ga0496102_0002906 3300048905 Bacteria 14522
880 Ga0496103_0000157 3300048906 Bacteria 71452
881 Ga0496104_0383570 3300048907 Bacteria 1318
882 Ga0496105_0250174 3300048908 Bacteria 1436
883 Ga0496106_0006890 3300048909 Bacteria 8407
884 Ga0496107_0000805 3300048910 Bacteria 18202
885 Ga0496108_0234055 3300048911 Bacteria 1597
886 Ga0496108_0805076 3300048911 Bacteria 811
887 Ga0496109_0000313 3300048912 Bacteria 45501
888 Ga0496109_0001125 3300048912 Bacteria 22254
889 Ga0496110_0096825 3300048913 Bacteria 2644
890 Ga0496111_0076468 3300048914 Bacteria 2440
891 Ga0496111_0083795 3300048914 Bacteria 2330
892 Ga0496112_0086476 3300048915 Bacteria 3102
893 Ga0496112_0105664 3300048915 Bacteria 2785
894 Ga0496112_0692166 3300048915 Bacteria 948
895 Ga0496113_0012990 3300048916 Bacteria 5619
896 Ga0496113_0018069 3300048916 Bacteria 4906
897 Ga0496113_0297226 3300048916 Bacteria 1293
898 Ga0496114_0005751 3300048917 Bacteria 9733
899 Ga0496114_0022185 3300048917 Bacteria 5172
900 Ga0496115_0001217 3300048918 Bacteria 18461
901 Ga0496118_0151636 3300048921 Bacteria 1450
902 Ga0496121_0003906 3300048924 Bacteria 20685
903 Ga0496123_0180276 3300048926 Bacteria 1104
904 Ga0496125_0000063 3300048928 Bacteria 250260
905 Ga0496125_0003433 3300048928 Bacteria 19212
906 Ga0496126_0051862 3300048929 Bacteria 3732
907 Ga0501031_0299947 3300049568 Bacteria 1041
908 Ga0501031_0415882 3300049568 Bacteria 869
909 Ga0501034_0010927 3300049571 Bacteria 9434
910 Ga0501038_0017675 3300049574 Bacteria 6446
911 Ga0501039_0084802 3300049575 Bacteria 2468
912 Ga0501040_0012090 3300049576 Bacteria 5652
913 Ga0501040_0012492 3300049576 Bacteria 5565
914 Ga0501041_0043939 3300049577 Bacteria 2716
915 Ga0501041_0073839 3300049577 Bacteria 2096
916 Ga0501042_0003421 3300049578 Bacteria 9968
917 Ga0501046_0350547 3300049580 Bacteria 1072
918 Ga0501048_0342264 3300049582 Bacteria 1066
919 Ga0501067_0089123 3300049583 Bacteria 1712
920 Ga0501068_0368546 3300049584 Bacteria 924
921 Ga0501068_0375390 3300049584 Bacteria 915
922 Ga0501069_0051380 3300049585 Bacteria 2294
923 Ga0501070_0192200 3300049586 Bacteria 1677
924 Ga0501071_0149658 3300049587 Bacteria 1741
925 Ga0501072_0007289 3300049588 Bacteria 8386
926 Ga0501072_0455892 3300049588 Bacteria 1012
927 Ga0501072_0617641 3300049588 Bacteria 854
928 Ga0501074_0158448 3300049590 Bacteria 1616
929 Ga0501074_0415371 3300049590 Bacteria 954
930 Ga0501075_0002401 3300049591 Bacteria 12446
931 Ga0501075_0059850 3300049591 Bacteria 2870
932 Ga0501075_0177917 3300049591 Bacteria 1623
933 Ga0501075_0384908 3300049591 Bacteria 1069
934 Ga0501076_0001488 3300049592 Bacteria 15703
935 Ga0501077_0074645 3300049593 Unclassified 2148
936 Ga0501077_0150832 3300049593 Bacteria 1475
937 Ga0501079_0006001 3300049741 Bacteria 9098
938 Ga0501079_0516427 3300049741 Bacteria 939
939 Ga0501080_0007934 3300049742 Bacteria 9615
940 Ga0501080_0337147 3300049742 Bacteria 1363
941 Ga0501080_0492636 3300049742 Bacteria 1096
942 Ga0501081_0377416 3300049743 Bacteria 1047
943 Ga0501083_0019458 3300049744 Bacteria 4730
944 nmdc:mga00v17_300694_c1 3300050491 Bacteria 1042
945 nmdc:mga00v17_58681_c1 3300050491 Bacteria 2359
946 nmdc:mga0yw44_48593_c1 3300050492 Bacteria 2558
947 nmdc:mga06z11_3482_c1 3300050494 Bacteria 6096
948 nmdc:mga06z11_4358_c1 3300050494 Bacteria 5566
949 nmdc:mga06z11_76410_c1 3300050494 Bacteria 1786
950 nmdc:mga04h51_18807_c1 3300050495 Bacteria 2040
951 nmdc:mga07m45_13302_c1 3300050496 Bacteria 4364
952 nmdc:mga07m45_139695_c1 3300050496 Bacteria 1403
953 nmdc:mga07m45_24947_c1 3300050496 Bacteria 3277
954 nmdc:mga05p37_10207_c1 3300050507 Bacteria 11151
955 nmdc:mga05p37_104271_c1 3300050507 Bacteria 2339
956 nmdc:mga05p37_13916_c1 3300050507 Bacteria 9642
957 nmdc:mga05p37_15856_c1 3300050507 Bacteria 9064
958 nmdc:mga05p37_164938_c1 3300050507 Bacteria 2704
959 nmdc:mga05p37_385834_c1 3300050507 Bacteria 1640
960 nmdc:mga05p37_39063_c1 3300050507 Bacteria 5824
961 nmdc:mga05p37_45_c1 3300050507 Bacteria 81140
962 nmdc:mga05p37_630292_c1 3300050507 Bacteria 1205
963 nmdc:mga05p37_85076_c1 3300050507 Bacteria 3897
964 nmdc:mga09592_169100_c1 3300050508 Bacteria 1890
965 nmdc:mga09592_182663_c1 3300050508 Bacteria 1815
966 nmdc:mga09592_47067_c1 3300050508 Bacteria 3634
967 nmdc:mga09592_5654_c1 3300050508 Bacteria 10199
968 nmdc:mga09592_58667_c1 3300050508 Bacteria 3255
969 nmdc:mga09592_7756_c1 3300050508 Bacteria 8725
970 nmdc:mga09592_81575_c1 3300050508 Bacteria 2756
971 nmdc:mga0qj67_1430_c1 3300050509 Bacteria 16714
972 nmdc:mga0qj67_160268_c1 3300050509 Bacteria 1826
973 nmdc:mga0qj67_348346_c1 3300050509 Unclassified 1198
974 nmdc:mga0qj67_58551_c1 3300050509 Bacteria 3054
975 nmdc:mga0qj67_67253_c1 3300050509 Bacteria 2855
976 nmdc:mga06r32_162043_c1 3300050510 Bacteria 2219
977 nmdc:mga06r32_203418_c1 3300050510 Bacteria 1968
978 nmdc:mga06r32_211300_c1 3300050510 Bacteria 1928
979 nmdc:mga06r32_35577_c1 3300050510 Bacteria 4699
980 nmdc:mga06r32_407_c1 3300050510 Bacteria 36327
981 nmdc:mga06r32_77499_c1 3300050510 Bacteria 3229
982 nmdc:mga08y16_2193_c1 3300050511 Bacteria 20044
983 nmdc:mga08y16_792_c1 3300050511 Bacteria 30185
984 nmdc:mga08y16_91943_c1 3300050511 Bacteria 3162
985 nmdc:mga0n895_1011_c1 3300050512 Bacteria 20432
986 nmdc:mga0n895_10668_c1 3300050512 Bacteria 8137
987 nmdc:mga0n895_15085_c1 3300050512 Bacteria 7042
988 nmdc:mga0n895_254415_c1 3300050512 Bacteria 1782
989 nmdc:mga0n895_8875_c1 3300050512 Bacteria 8753
990 nmdc:mga0rr50_104975_c1 3300050513 Bacteria 2227
991 nmdc:mga0rr50_107066_c1 3300050513 Bacteria 2207
992 nmdc:mga0rr50_135279_c1 3300050513 Bacteria 1978
993 nmdc:mga0rr50_142289_c1 3300050513 Bacteria 1931
994 nmdc:mga0rr50_235104_c1 3300050513 Bacteria 1517
995 nmdc:mga0rr50_43068_c1 3300050513 Bacteria 3301
996 nmdc:mga0rr50_918_c1 3300050513 Bacteria 15942
997 nmdc:mga08x19_170263_c1 3300050514 Bacteria 1483
998 nmdc:mga08x19_29952_c1 3300050514 Bacteria 3417
999 nmdc:mga08x19_63051_c1 3300050514 Bacteria 2404
1000 nmdc:mga0a205_1027039_c1 3300050515 Bacteria 671
1001 nmdc:mga0a205_22216_c1 3300050515 Bacteria 6007
1002 nmdc:mga0a205_242974_c1 3300050515 Unclassified 1681
1003 nmdc:mga0a205_6158_c1 3300050515 Bacteria 10825
1004 nmdc:mga0a205_6355_c1 3300050515 Bacteria 7369
1005 Ga0495601_0001636 3300053077 Bacteria 12353
1006 Ga0495601_0056964 3300053077 Bacteria 2475
1007 Ga0495601_0139901 3300053077 Bacteria 1578
1008 Ga0495595_0008204 3300053084 Bacteria 4287
1009 Ga0495595_0135150 3300053084 Bacteria 1207
1010 Ga0495619_0041195 3300053085 Bacteria 3020
1011 Ga0495619_0191701 3300053085 Unclassified 1415
1012 Ga0500578_0000236 3300053086 Bacteria 68048
1013 Ga0500578_0400015 3300053086 Bacteria 792
1014 Ga0500644_0003109 3300053088 Bacteria 4109
1015 Ga0500651_0023119 3300053093 Bacteria 3890
1016 Ga0500651_0102264 3300053093 Bacteria 1756
1017 Ga0500566_0158488 3300053094 Bacteria 1182
1018 Ga0500594_0017698 3300053118 Bacteria 1747
1019 Ga0500595_002989 3300053119 Bacteria 8040
1020 Ga0500595_010080 3300053119 Bacteria 3773
1021 Ga0500614_013998 3300053123 Bacteria 1770
1022 Ga0500652_000014 3300053131 Bacteria 147740
1023 Ga0500559_0000012 3300053136 Bacteria 164222
1024 Ga0500564_179043 3300053138 Bacteria 885
1025 Ga0500568_0057635 3300053139 Bacteria 1511
1026 Ga0500604_0014218 3300053151 Bacteria 2165
1027 Ga0500604_0014386 3300053151 Bacteria 2154
1028 Ga0500619_050551 3300053154 Bacteria 1344
1029 Ga0500622_0024833 3300053156 Bacteria 3169
1030 Ga0500627_0019136 3300053158 Bacteria 2723
1031 Ga0500636_0030839 3300053177 Bacteria 3173
1032 Ga0500645_025399 3300053730 Bacteria 1808
1033 Ga0500552_000373 3300053733 Bacteria 4171
1034 Ga0500587_022219 3300053739 Bacteria 833
1035 Ga0501084_0039843 3300054114 Bacteria 3929
1036 Ga0501084_0057776 3300054114 Bacteria 3246
1037 Ga0501082_0000007 3300060353 Bacteria 126506
1038 Ga0501082_0009692 3300060353 Bacteria 8293
1039 Ga0501082_0105127 3300060353 Bacteria 2443
1040 Ga0501082_0834466 3300060353 Bacteria 806
1041 Ga0530510_0000125 3300061734 Bacteria 44341
1042 Ga0530510_0070238 3300061734 Bacteria 2542

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_10934804 Ga0105242_109348042 178
2 3300048089 Ga0495614_0266961 Ga0495614_0266961_195_767 187
3 3300050491 nmdc:mga00v17_58681_c1 nmdc:mga00v17_58681_c1_27_599 187
4 3300048926 Ga0496123_0180276 Ga0496123_0180276_396_1085 191
5 3300049588 Ga0501072_0617641 Ga0501072_0617641_218_814 191
6 3300046462 Ga0495651_0531080 Ga0495651_0531080_61_660 192
7 3300046517 Ga0495630_0094796 Ga0495630_0094796_23_619 192
8 3300005356 Ga0070674_100012945 Ga0070674_1000129453 194
9 3300005456 Ga0070678_100099528 Ga0070678_1000995281 194
10 3300005459 Ga0068867_100287783 Ga0068867_1002877832 194
11 3300025937 Ga0207669_10132916 Ga0207669_101329162 194
12 3300026089 Ga0207648_10047268 Ga0207648_100472682 194
13 3300003323 rootH1_10002881 rootH1_100028812 195
14 3300048921 Ga0496118_0151636 Ga0496118_0151636_641_1411 195
15 3300005366 Ga0070659_100792638 Ga0070659_1007926381 196
16 3300046492 Ga0495585_0282240 Ga0495585_0282240_52_714 196
17 3300037471 Ga0395905_0827193 Ga0395905_0827193_105_779 198
18 3300002773 JGI25152J39213_1005374 JGI25152J39213_10053743 199
19 3300003771 Ga0055526_1015322 Ga0055526_10153224 199
20 3300025258 Ga0209129_1000326 Ga0209129_10003262 199
21 3300025273 Ga0209673_1051683 Ga0209673_10516832 199
22 3300025295 Ga0209564_1000057 Ga0209564_1000057276 199
23 3300025297 Ga0209758_1000174 Ga0209758_10001742 199
24 3300031507 Ga0307509_10003100 Ga0307509_1000310013 199
25 3300033179 Ga0307507_10205846 Ga0307507_102058462 199
26 3300033180 Ga0307510_10100119 Ga0307510_101001192 199
27 3300048924 Ga0496121_0003906 Ga0496121_0003906_16604_17374 199
28 3300009147 Ga0114129_10818454 Ga0114129_108184542 200
29 3300050507 nmdc:mga05p37_630292_c1 nmdc:mga05p37_630292_c1_439_1068 200
30 3300050508 nmdc:mga09592_182663_c1 nmdc:mga09592_182663_c1_782_1411 200
31 3300050508 nmdc:mga09592_47067_c1 nmdc:mga09592_47067_c1_2211_2846 201
32 3300050509 nmdc:mga0qj67_67253_c1 nmdc:mga0qj67_67253_c1_561_1196 201
33 3300009551 Ga0105238_10104413 Ga0105238_101044132 202
34 3300005458 Ga0070681_10058787 Ga0070681_100587871 203
35 3300025912 Ga0207707_10062947 Ga0207707_100629473 203
36 3300044673 Ga0453683_0002857 Ga0453683_0002857_1516_2190 203
37 3300050507 nmdc:mga05p37_164938_c1 nmdc:mga05p37_164938_c1_107_745 203
38 3300050510 nmdc:mga06r32_162043_c1 nmdc:mga06r32_162043_c1_693_1331 203
39 3300025912 Ga0207707_10130681 Ga0207707_101306813 204
40 3300025937 Ga0207669_10052574 Ga0207669_100525742 204
41 3300035725 Ga0373947_0345374 Ga0373947_0345374_12_656 204
42 3300046517 Ga0495630_0283597 Ga0495630_0283597_611_1255 204
43 3300005937 Ga0081455_10005710 Ga0081455_1000571012 205
44 3300045976 Ga0466967_0064520 Ga0466967_0064520_1215_1844 205
45 3300048928 Ga0496125_0000063 Ga0496125_0000063_85352_86038 205
46 3300050515 nmdc:mga0a205_22216_c1 nmdc:mga0a205_22216_c1_5358_5987 205
47 3300005329 Ga0070683_100112039 Ga0070683_1001120392 206
48 3300005336 Ga0070680_100250387 Ga0070680_1002503871 206
49 3300005339 Ga0070660_100355505 Ga0070660_1003555051 206
50 3300005344 Ga0070661_100059933 Ga0070661_1000599332 206
51 3300005535 Ga0070684_100079132 Ga0070684_1000791321 206
52 3300005564 Ga0070664_100099808 Ga0070664_1000998083 206
53 3300005578 Ga0068854_100344566 Ga0068854_1003445662 206
54 3300005614 Ga0068856_100073582 Ga0068856_1000735822 206
55 3300005616 Ga0068852_100048811 Ga0068852_1000488112 206
56 3300009174 Ga0105241_10252539 Ga0105241_102525392 206
57 3300009545 Ga0105237_10167776 Ga0105237_101677762 206
58 3300010375 Ga0105239_10297547 Ga0105239_102975472 206
59 3300013102 Ga0157371_10198703 Ga0157371_101987032 206
60 3300013104 Ga0157370_10580206 Ga0157370_105802061 206
61 3300013307 Ga0157372_10132940 Ga0157372_101329402 206
62 3300020081 Ga0206354_11042258 Ga0206354_110422581 206
63 3300020082 Ga0206353_12052891 Ga0206353_120528912 206
64 3300025904 Ga0207647_10117406 Ga0207647_101174062 206
65 3300025917 Ga0207660_10354010 Ga0207660_103540102 206
66 3300025933 Ga0207706_10210632 Ga0207706_102106321 206
67 3300025944 Ga0207661_10079917 Ga0207661_100799172 206
68 3300025949 Ga0207667_10108943 Ga0207667_101089432 206
69 3300025981 Ga0207640_10348715 Ga0207640_103487152 206
70 3300026041 Ga0207639_10271729 Ga0207639_102717292 206
71 3300026078 Ga0207702_10147535 Ga0207702_101475352 206
72 3300026116 Ga0207674_10113871 Ga0207674_101138712 206
73 3300026142 Ga0207698_10076422 Ga0207698_100764222 206
74 3300028379 Ga0268266_10181249 Ga0268266_101812492 206
75 3300035118 Ga0373954_0045779 Ga0373954_0045779_770_1420 206
76 3300037418 Ga0395900_0003717 Ga0395900_0003717_5690_6361 206
77 3300038443 Ga0395901_0011964 Ga0395901_0011964_3216_3887 206
78 3300048928 Ga0496125_0003433 Ga0496125_0003433_15185_15871 206
79 3300048929 Ga0496126_0051862 Ga0496126_0051862_1472_2158 206
80 3300050508 nmdc:mga09592_58667_c1 nmdc:mga09592_58667_c1_850_1500 206
81 3300050509 nmdc:mga0qj67_348346_c1 nmdc:mga0qj67_348346_c1_46_696 206
82 3300050510 nmdc:mga06r32_203418_c1 nmdc:mga06r32_203418_c1_939_1589 206
83 3300005347 Ga0070668_100018430 Ga0070668_1000184305 207
84 3300006844 Ga0075428_100177449 Ga0075428_1001774494 207
85 3300009147 Ga0114129_10010935 Ga0114129_1001093511 207
86 3300013297 Ga0157378_10091118 Ga0157378_100911181 207
87 3300025972 Ga0207668_10011562 Ga0207668_100115625 207
88 3300031238 Ga0265332_10063392 Ga0265332_100633923 207
89 3300031240 Ga0265320_10023698 Ga0265320_100236983 207
90 3300031241 Ga0265325_10073737 Ga0265325_100737371 207
91 3300031242 Ga0265329_10031811 Ga0265329_100318112 207
92 3300031247 Ga0265340_10205686 Ga0265340_102056861 207
93 3300031249 Ga0265339_10031699 Ga0265339_100316992 207
94 3300031595 Ga0265313_10026426 Ga0265313_100264264 207
95 3300031711 Ga0265314_10150180 Ga0265314_101501802 207
96 3300031712 Ga0265342_10016326 Ga0265342_100163266 207
97 3300036401 Ga0373937_0687364 Ga0373937_0687364_177_809 207
98 3300046454 Ga0495592_0057634 Ga0495592_0057634_2224_2856 207
99 3300046457 Ga0495590_0001111 Ga0495590_0001111_1866_2531 207
100 3300046516 Ga0495628_0015428 Ga0495628_0015428_156_806 207
101 3300046516 Ga0495628_0194020 Ga0495628_0194020_364_996 207
102 3300046535 Ga0495586_0051513 Ga0495586_0051513_1266_1898 207
103 3300046543 Ga0495645_0025284 Ga0495645_0025284_1965_2615 207
104 3300046559 Ga0495667_0047951 Ga0495667_0047951_1490_2122 207
105 3300046663 Ga0495635_0050965 Ga0495635_0050965_1489_2121 207
106 3300046678 Ga0495599_0037398 Ga0495599_0037398_1840_2472 207
107 3300046809 Ga0495600_0220919 Ga0495600_0220919_89_721 207
108 3300046810 Ga0495660_0264306 Ga0495660_0264306_52_717 207
109 3300049568 Ga0501031_0299947 Ga0501031_0299947_118_759 207
110 3300049574 Ga0501038_0017675 Ga0501038_0017675_5708_6349 207
111 3300049575 Ga0501039_0084802 Ga0501039_0084802_1664_2305 207
112 3300049576 Ga0501040_0012090 Ga0501040_0012090_15_656 207
113 3300049577 Ga0501041_0043939 Ga0501041_0043939_489_1130 207
114 3300049578 Ga0501042_0003421 Ga0501042_0003421_2460_3101 207
115 3300049584 Ga0501068_0368546 Ga0501068_0368546_223_864 207
116 3300049588 Ga0501072_0007289 Ga0501072_0007289_2534_3175 207
117 3300049590 Ga0501074_0158448 Ga0501074_0158448_254_895 207
118 3300049591 Ga0501075_0002401 Ga0501075_0002401_11680_12321 207
119 3300049592 Ga0501076_0001488 Ga0501076_0001488_11227_11868 207
120 3300049741 Ga0501079_0006001 Ga0501079_0006001_4898_5539 207
121 3300049742 Ga0501080_0007934 Ga0501080_0007934_3468_4109 207
122 3300050507 nmdc:mga05p37_13916_c1 nmdc:mga05p37_13916_c1_7471_8145 207
123 3300053077 Ga0495601_0056964 Ga0495601_0056964_161_793 207
124 3300053077 Ga0495601_0139901 Ga0495601_0139901_843_1493 207
125 3300053084 Ga0495595_0135150 Ga0495595_0135150_338_970 207
126 3300053085 Ga0495619_0041195 Ga0495619_0041195_603_1235 207
127 3300054114 Ga0501084_0039843 Ga0501084_0039843_3064_3705 207
128 3300060353 Ga0501082_0009692 Ga0501082_0009692_3937_4578 207
129 3300061734 Ga0530510_0000125 Ga0530510_0000125_43466_44107 207
130 3300005330 Ga0070690_100040233 Ga0070690_1000402332 208
131 3300005333 Ga0070677_10000368 Ga0070677_1000036810 208
132 3300005334 Ga0068869_100006240 Ga0068869_1000062403 208
133 3300005334 Ga0068869_100159051 Ga0068869_1001590512 208
134 3300005335 Ga0070666_10003027 Ga0070666_100030278 208
135 3300005335 Ga0070666_10032791 Ga0070666_100327914 208
136 3300005338 Ga0068868_100000824 Ga0068868_10000082417 208
137 3300005338 Ga0068868_100376189 Ga0068868_1003761891 208
138 3300005347 Ga0070668_100001817 Ga0070668_10000181711 208
139 3300005347 Ga0070668_100039792 Ga0070668_1000397923 208
140 3300005353 Ga0070669_100632513 Ga0070669_1006325131 208
141 3300005354 Ga0070675_100000231 Ga0070675_1000002313 208
142 3300005355 Ga0070671_100000689 Ga0070671_10000068924 208
143 3300005355 Ga0070671_100716796 Ga0070671_1007167961 208
144 3300005356 Ga0070674_100003262 Ga0070674_1000032622 208
145 3300005364 Ga0070673_100060368 Ga0070673_1000603684 208
146 3300005364 Ga0070673_100295331 Ga0070673_1002953313 208
147 3300005367 Ga0070667_100154236 Ga0070667_1001542363 208
148 3300005455 Ga0070663_100097157 Ga0070663_1000971573 208
149 3300005456 Ga0070678_100001198 Ga0070678_10000119814 208
150 3300005456 Ga0070678_100012230 Ga0070678_1000122302 208
151 3300005457 Ga0070662_100058230 Ga0070662_1000582301 208
152 3300005459 Ga0068867_100051479 Ga0068867_1000514792 208
153 3300005539 Ga0068853_100018602 Ga0068853_1000186027 208
154 3300005543 Ga0070672_100004203 Ga0070672_1000042037 208
155 3300005543 Ga0070672_100009042 Ga0070672_1000090428 208
156 3300005547 Ga0070693_100139929 Ga0070693_1001399292 208
157 3300005548 Ga0070665_100288832 Ga0070665_1002888322 208
158 3300005548 Ga0070665_100541176 Ga0070665_1005411762 208
159 3300005616 Ga0068852_100000954 Ga0068852_10000095424 208
160 3300005618 Ga0068864_100004967 Ga0068864_1000049678 208
161 3300005719 Ga0068861_100018282 Ga0068861_1000182824 208
162 3300005834 Ga0068851_10041248 Ga0068851_100412482 208
163 3300005840 Ga0068870_10117303 Ga0068870_101173032 208
164 3300005841 Ga0068863_100093442 Ga0068863_1000934422 208
165 3300005843 Ga0068860_100008063 Ga0068860_1000080633 208
166 3300005843 Ga0068860_100057315 Ga0068860_1000573154 208
167 3300006237 Ga0097621_100052380 Ga0097621_1000523803 208
168 3300006358 Ga0068871_100018026 Ga0068871_1000180262 208
169 3300006358 Ga0068871_100054187 Ga0068871_1000541872 208
170 3300006881 Ga0068865_100057899 Ga0068865_1000578992 208
171 3300009177 Ga0105248_10242071 Ga0105248_102420713 208
172 3300013296 Ga0157374_10027881 Ga0157374_100278816 208
173 3300013297 Ga0157378_10215132 Ga0157378_102151322 208
174 3300013297 Ga0157378_10575632 Ga0157378_105756322 208
175 3300013308 Ga0157375_10002393 Ga0157375_100023938 208
176 3300014968 Ga0157379_10424071 Ga0157379_104240711 208
177 3300014969 Ga0157376_10098987 Ga0157376_100989872 208
178 3300014969 Ga0157376_10329793 Ga0157376_103297932 208
179 3300017792 Ga0163161_10025174 Ga0163161_100251741 208
180 3300025315 Ga0207697_10043527 Ga0207697_100435272 208
181 3300025321 Ga0207656_10129249 Ga0207656_101292492 208
182 3300025893 Ga0207682_10000122 Ga0207682_1000012262 208
183 3300025899 Ga0207642_10008252 Ga0207642_100082523 208
184 3300025903 Ga0207680_10076733 Ga0207680_100767333 208
185 3300025903 Ga0207680_10085030 Ga0207680_100850302 208
186 3300025907 Ga0207645_10000063 Ga0207645_1000006332 208
187 3300025907 Ga0207645_10131063 Ga0207645_101310632 208
188 3300025908 Ga0207643_10006191 Ga0207643_100061912 208
189 3300025926 Ga0207659_10001802 Ga0207659_100018023 208
190 3300025926 Ga0207659_10203019 Ga0207659_102030192 208
191 3300025931 Ga0207644_10004596 Ga0207644_1000459612 208
192 3300025931 Ga0207644_10756420 Ga0207644_107564201 208
193 3300025938 Ga0207704_10128918 Ga0207704_101289182 208
194 3300025940 Ga0207691_10000050 Ga0207691_1000005072 208
195 3300025940 Ga0207691_10024298 Ga0207691_100242984 208
196 3300025941 Ga0207711_10274935 Ga0207711_102749352 208
197 3300025942 Ga0207689_10004462 Ga0207689_100044626 208
198 3300025942 Ga0207689_10146973 Ga0207689_101469732 208
199 3300025960 Ga0207651_10001963 Ga0207651_100019633 208
200 3300025972 Ga0207668_10077299 Ga0207668_100772992 208
201 3300025972 Ga0207668_10151481 Ga0207668_101514812 208
202 3300025981 Ga0207640_10445096 Ga0207640_104450961 208
203 3300025986 Ga0207658_10009288 Ga0207658_100092883 208
204 3300025986 Ga0207658_10105408 Ga0207658_101054082 208
205 3300026023 Ga0207677_10004591 Ga0207677_100045912 208
206 3300026023 Ga0207677_10333989 Ga0207677_103339891 208
207 3300026041 Ga0207639_10051592 Ga0207639_100515922 208
208 3300026067 Ga0207678_10004837 Ga0207678_100048372 208
209 3300026088 Ga0207641_10008171 Ga0207641_100081712 208
210 3300026089 Ga0207648_10055433 Ga0207648_100554332 208
211 3300026089 Ga0207648_10179166 Ga0207648_101791661 208
212 3300026095 Ga0207676_10268801 Ga0207676_102688011 208
213 3300026095 Ga0207676_10552250 Ga0207676_105522501 208
214 3300026118 Ga0207675_100021979 Ga0207675_1000219794 208
215 3300026121 Ga0207683_10000521 Ga0207683_1000052111 208
216 3300026121 Ga0207683_10005585 Ga0207683_100055857 208
217 3300028379 Ga0268266_10008615 Ga0268266_1000861510 208
218 3300028379 Ga0268266_10255085 Ga0268266_102550852 208
219 3300047472 Ga0495686_0221088 Ga0495686_0221088_341_1027 208
220 3300049591 Ga0501075_0384908 Ga0501075_0384908_369_1016 208
221 3300049744 Ga0501083_0019458 Ga0501083_0019458_758_1393 208
222 3300050515 nmdc:mga0a205_1027039_c1 nmdc:mga0a205_1027039_c1_26_661 208
223 3300053119 Ga0500595_002989 Ga0500595_002989_4707_5393 208
224 3300060353 Ga0501082_0000007 Ga0501082_0000007_98391_99026 208
225 3300005329 Ga0070683_100069961 Ga0070683_1000699615 209
226 3300005336 Ga0070680_100023963 Ga0070680_1000239634 209
227 3300005339 Ga0070660_100057056 Ga0070660_1000570565 209
228 3300005344 Ga0070661_100001402 Ga0070661_10000140216 209
229 3300005353 Ga0070669_100052561 Ga0070669_1000525613 209
230 3300005354 Ga0070675_100194073 Ga0070675_1001940731 209
231 3300005364 Ga0070673_100307921 Ga0070673_1003079211 209
232 3300005435 Ga0070714_100097015 Ga0070714_1000970151 209
233 3300005437 Ga0070710_10141743 Ga0070710_101417431 209
234 3300005441 Ga0070700_100149013 Ga0070700_1001490132 209
235 3300005444 Ga0070694_100601952 Ga0070694_1006019521 209
236 3300005456 Ga0070678_100040159 Ga0070678_1000401592 209
237 3300005458 Ga0070681_10142015 Ga0070681_101420154 209
238 3300005459 Ga0068867_100306259 Ga0068867_1003062592 209
239 3300005539 Ga0068853_100024074 Ga0068853_1000240747 209
240 3300005543 Ga0070672_100009113 Ga0070672_1000091134 209
241 3300005549 Ga0070704_100039605 Ga0070704_1000396054 209
242 3300005563 Ga0068855_100013126 Ga0068855_1000131262 209
243 3300005564 Ga0070664_100072053 Ga0070664_1000720533 209
244 3300005577 Ga0068857_100000558 Ga0068857_1000005585 209
245 3300005578 Ga0068854_100007092 Ga0068854_1000070923 209
246 3300005614 Ga0068856_100061032 Ga0068856_1000610323 209
247 3300005834 Ga0068851_10176076 Ga0068851_101760762 209
248 3300009545 Ga0105237_10149771 Ga0105237_101497716 209
249 3300009551 Ga0105238_10054770 Ga0105238_100547703 209
250 3300013100 Ga0157373_10012612 Ga0157373_100126127 209
251 3300013102 Ga0157371_10164913 Ga0157371_101649132 209
252 3300013105 Ga0157369_10002671 Ga0157369_1000267122 209
253 3300013296 Ga0157374_10120006 Ga0157374_101200062 209
254 3300013307 Ga0157372_10012072 Ga0157372_100120725 209
255 3300013308 Ga0157375_10375468 Ga0157375_103754682 209
256 3300025906 Ga0207699_10019646 Ga0207699_100196464 209
257 3300025908 Ga0207643_10122334 Ga0207643_101223342 209
258 3300025909 Ga0207705_10104709 Ga0207705_101047094 209
259 3300025912 Ga0207707_10026873 Ga0207707_100268734 209
260 3300025913 Ga0207695_10021722 Ga0207695_100217222 209
261 3300025914 Ga0207671_10194970 Ga0207671_101949702 209
262 3300025917 Ga0207660_10057376 Ga0207660_100573762 209
263 3300025919 Ga0207657_10059084 Ga0207657_100590845 209
264 3300025920 Ga0207649_10005635 Ga0207649_100056358 209
265 3300025923 Ga0207681_10126883 Ga0207681_101268832 209
266 3300025924 Ga0207694_10039684 Ga0207694_100396843 209
267 3300025928 Ga0207700_10126910 Ga0207700_101269102 209
268 3300025929 Ga0207664_10011801 Ga0207664_100118016 209
269 3300025940 Ga0207691_10023336 Ga0207691_100233362 209
270 3300025944 Ga0207661_10154952 Ga0207661_101549522 209
271 3300025945 Ga0207679_10002734 Ga0207679_100027342 209
272 3300025949 Ga0207667_10003212 Ga0207667_100032126 209
273 3300025981 Ga0207640_10005748 Ga0207640_100057482 209
274 3300026041 Ga0207639_10055034 Ga0207639_100550346 209
275 3300026075 Ga0207708_10031895 Ga0207708_100318954 209
276 3300026078 Ga0207702_10014696 Ga0207702_100146962 209
277 3300026116 Ga0207674_10000049 Ga0207674_1000004981 209
278 3300026142 Ga0207698_10002475 Ga0207698_1000247513 209
279 3300028786 Ga0307517_10000644 Ga0307517_1000064447 209
280 3300028786 Ga0307517_10137131 Ga0307517_101371312 209
281 3300028794 Ga0307515_10176947 Ga0307515_101769473 209
282 3300030522 Ga0307512_10112651 Ga0307512_101126512 209
283 3300031456 Ga0307513_10171324 Ga0307513_101713243 209
284 3300031507 Ga0307509_10000041 Ga0307509_100000416 209
285 3300031507 Ga0307509_10009112 Ga0307509_100091123 209
286 3300031616 Ga0307508_10316998 Ga0307508_103169983 209
287 3300031649 Ga0307514_10066812 Ga0307514_100668122 209
288 3300031649 Ga0307514_10195461 Ga0307514_101954612 209
289 3300033179 Ga0307507_10045329 Ga0307507_100453294 209
290 3300033180 Ga0307510_10002283 Ga0307510_100022839 209
291 3300033180 Ga0307510_10009870 Ga0307510_1000987011 209
292 3300033180 Ga0307510_10067350 Ga0307510_100673504 209
293 3300033180 Ga0307510_10286362 Ga0307510_102863621 209
294 3300034818 Ga0373950_0049201 Ga0373950_0049201_40_699 209
295 3300036401 Ga0373937_0051941 Ga0373937_0051941_28_666 209
296 3300037471 Ga0395905_0016990 Ga0395905_0016990_5309_5977 209
297 3300041460 Ga0451802_2066676 Ga0451802_2066676_501_1160 209
298 3300046454 Ga0495592_0001970 Ga0495592_0001970_1407_2069 209
299 3300046460 Ga0495638_0116305 Ga0495638_0116305_522_1181 209
300 3300046512 Ga0495610_0037726 Ga0495610_0037726_481_1140 209
301 3300046519 Ga0495632_0147584 Ga0495632_0147584_297_956 209
302 3300046526 Ga0495666_0189118 Ga0495666_0189118_30_692 209
303 3300046680 Ga0495646_0100828 Ga0495646_0100828_531_1193 209
304 3300050496 nmdc:mga07m45_24947_c1 nmdc:mga07m45_24947_c1_100_762 209
305 3300053086 Ga0500578_0400015 Ga0500578_0400015_17_679 209
306 3300053088 Ga0500644_0003109 Ga0500644_0003109_2143_2802 209
307 3300053093 Ga0500651_0023119 Ga0500651_0023119_374_1033 209
308 3300053093 Ga0500651_0102264 Ga0500651_0102264_393_1055 209
309 3300053118 Ga0500594_0017698 Ga0500594_0017698_222_881 209
310 3300053123 Ga0500614_013998 Ga0500614_013998_892_1551 209
311 3300053136 Ga0500559_0000012 Ga0500559_0000012_3825_4484 209
312 3300053138 Ga0500564_179043 Ga0500564_179043_26_688 209
313 3300053139 Ga0500568_0057635 Ga0500568_0057635_449_1108 209
314 3300053154 Ga0500619_050551 Ga0500619_050551_191_853 209
315 3300053156 Ga0500622_0024833 Ga0500622_0024833_1187_1846 209
316 3300053739 Ga0500587_022219 Ga0500587_022219_15_674 209
317 iso_pu_bacteria 2643221654 2644304114 209
318 3300005347 Ga0070668_100004187 Ga0070668_1000041876 210
319 3300005844 Ga0068862_100218847 Ga0068862_1002188472 210
320 3300009094 Ga0111539_10088435 Ga0111539_100884353 210
321 3300013308 Ga0157375_10033432 Ga0157375_100334322 210
322 3300013308 Ga0157375_10129377 Ga0157375_101293772 210
323 3300014325 Ga0163163_10586986 Ga0163163_105869862 210
324 3300014326 Ga0157380_10097037 Ga0157380_100970372 210
325 3300025923 Ga0207681_10035031 Ga0207681_100350312 210
326 3300025972 Ga0207668_10085635 Ga0207668_100856351 210
327 3300026118 Ga0207675_100033128 Ga0207675_1000331284 210
328 3300028380 Ga0268265_10333498 Ga0268265_103334981 210
329 3300035083 Ga0373926_0186908 Ga0373926_0186908_53_715 210
330 3300035086 Ga0373934_0010526 Ga0373934_0010526_378_1040 210
331 3300035111 Ga0373923_0148735 Ga0373923_0148735_49_711 210
332 3300035111 Ga0373923_0248304 Ga0373923_0248304_62_724 210
333 3300035113 Ga0373936_0068289 Ga0373936_0068289_785_1447 210
334 3300035117 Ga0373953_0043817 Ga0373953_0043817_100_762 210
335 3300035117 Ga0373953_0109480 Ga0373953_0109480_46_708 210
336 3300035118 Ga0373954_0006658 Ga0373954_0006658_4135_4797 210
337 3300035118 Ga0373954_0029740 Ga0373954_0029740_57_719 210
338 3300035118 Ga0373954_0281960 Ga0373954_0281960_91_750 210
339 3300035119 Ga0373956_0004764 Ga0373956_0004764_3315_3977 210
340 3300035119 Ga0373956_0031015 Ga0373956_0031015_1001_1663 210
341 3300035120 Ga0373957_0031414 Ga0373957_0031414_1246_1908 210
342 3300035171 Ga0373946_0252714 Ga0373946_0252714_141_803 210
343 3300035172 Ga0373955_0022227 Ga0373955_0022227_178_840 210
344 3300035410 Ga0373924_0101628 Ga0373924_0101628_285_947 210
345 3300035692 Ga0373935_0074833 Ga0373935_0074833_244_906 210
346 3300035724 Ga0373933_0114087 Ga0373933_0114087_164_826 210
347 3300035724 Ga0373933_0132460 Ga0373933_0132460_833_1495 210
348 3300036401 Ga0373937_0193468 Ga0373937_0193468_124_786 210
349 3300036401 Ga0373937_0226181 Ga0373937_0226181_429_1088 210
350 3300037068 Ga0373925_0030541 Ga0373925_0030541_844_1506 210
351 3300046454 Ga0495592_0051483 Ga0495592_0051483_1537_2199 210
352 3300046454 Ga0495592_0090135 Ga0495592_0090135_489_1151 210
353 3300046454 Ga0495592_0128175 Ga0495592_0128175_81_740 210
354 3300046459 Ga0495629_0151062 Ga0495629_0151062_335_1000 210
355 3300046459 Ga0495629_0153427 Ga0495629_0153427_378_1040 210
356 3300046461 Ga0495641_0139804 Ga0495641_0139804_71_733 210
357 3300046462 Ga0495651_0046327 Ga0495651_0046327_1489_2151 210
358 3300046463 Ga0495653_0264103 Ga0495653_0264103_327_989 210
359 3300046472 Ga0495580_0128872 Ga0495580_0128872_459_1121 210
360 3300046475 Ga0495639_0025312 Ga0495639_0025312_181_843 210
361 3300046476 Ga0495662_0025409 Ga0495662_0025409_1312_1974 210
362 3300046477 Ga0495664_0026882 Ga0495664_0026882_2666_3328 210
363 3300046511 Ga0495608_0024660 Ga0495608_0024660_122_784 210
364 3300046511 Ga0495608_0071301 Ga0495608_0071301_1137_1799 210
365 3300046516 Ga0495628_0018439 Ga0495628_0018439_1280_1942 210
366 3300046517 Ga0495630_0078045 Ga0495630_0078045_1555_2220 210
367 3300046529 Ga0495652_0018867 Ga0495652_0018867_1058_1717 210
368 3300046529 Ga0495652_0152169 Ga0495652_0152169_304_966 210
369 3300046529 Ga0495652_0191425 Ga0495652_0191425_239_901 210
370 3300046535 Ga0495586_0250907 Ga0495586_0250907_327_989 210
371 3300046536 Ga0495587_0031018 Ga0495587_0031018_1453_2115 210
372 3300046557 Ga0495622_0108936 Ga0495622_0108936_460_1125 210
373 3300046557 Ga0495622_0271821 Ga0495622_0271821_20_682 210
374 3300046559 Ga0495667_0036451 Ga0495667_0036451_379_1041 210
375 3300046559 Ga0495667_0050414 Ga0495667_0050414_883_1545 210
376 3300046642 Ga0495634_0257114 Ga0495634_0257114_78_740 210
377 3300046663 Ga0495635_0064172 Ga0495635_0064172_26_688 210
378 3300046675 Ga0495657_0077848 Ga0495657_0077848_1112_1774 210
379 3300046681 Ga0495647_0023746 Ga0495647_0023746_131_793 210
380 3300046683 Ga0495658_0128525 Ga0495658_0128525_420_1085 210
381 3300046689 Ga0495613_0066450 Ga0495613_0066450_1784_2446 210
382 3300046690 Ga0495624_0037607 Ga0495624_0037607_1435_2100 210
383 3300046690 Ga0495624_0429525 Ga0495624_0429525_65_727 210
384 3300047319 Ga0495674_0082122 Ga0495674_0082122_2055_2717 210
385 3300047321 Ga0495676_0078685 Ga0495676_0078685_833_1498 210
386 3300047322 Ga0495680_0036557 Ga0495680_0036557_845_1507 210
387 3300047444 Ga0495675_0124627 Ga0495675_0124627_704_1366 210
388 3300047444 Ga0495675_0139732 Ga0495675_0139732_722_1384 210
389 3300047673 Ga0495593_0061448 Ga0495593_0061448_279_944 210
390 3300050511 nmdc:mga08y16_91943_c1 nmdc:mga08y16_91943_c1_424_1083 210
391 3300053077 Ga0495601_0001636 Ga0495601_0001636_7983_8645 210
392 3300053084 Ga0495595_0008204 Ga0495595_0008204_717_1379 210
393 3300053733 Ga0500552_000373 Ga0500552_000373_240_938 210
394 iso_pu_bacteria 2585428058 2587734308 210
395 iso_pu_bacteria 2588253510 2588295242 210
396 iso_pu_bacteria 2643221547 2643755448 210
397 3300006038 Ga0075365_10074403 Ga0075365_100744033 211
398 3300021384 Ga0213876_10155915 Ga0213876_101559152 211
399 3300031730 Ga0307516_10032420 Ga0307516_100324204 211
400 3300037466 Ga0395898_0671469 Ga0395898_0671469_288_965 211
401 3300037471 Ga0395905_0058630 Ga0395905_0058630_2112_2786 211
402 3300037853 Ga0436364_0517049 Ga0436364_0517049_155_823 211
403 3300039437 Ga0436365_0019248 Ga0436365_0019248_250_918 211
404 3300048913 Ga0496110_0096825 Ga0496110_0096825_962_1717 211
405 3300050492 nmdc:mga0yw44_48593_c1 nmdc:mga0yw44_48593_c1_1673_2335 211
406 3300005355 Ga0070671_100008470 Ga0070671_1000084703 212
407 3300006051 Ga0075364_10331685 Ga0075364_103316852 212
408 3300006177 Ga0075362_10065976 Ga0075362_100659762 212
409 3300006178 Ga0075367_10034846 Ga0075367_100348462 212
410 3300006195 Ga0075366_10329829 Ga0075366_103298291 212
411 3300006353 Ga0075370_10015066 Ga0075370_100150664 212
412 3300013297 Ga0157378_10742239 Ga0157378_107422391 212
413 3300025297 Ga0209758_1000096 Ga0209758_10000962 212
414 3300025298 Ga0209050_1016098 Ga0209050_10160984 212
415 3300025925 Ga0207650_10777379 Ga0207650_107773791 212
416 3300025931 Ga0207644_10014495 Ga0207644_100144955 212
417 3300031247 Ga0265340_10040813 Ga0265340_100408132 212
418 3300048904 Ga0496101_0014419 Ga0496101_0014419_2947_3618 212
419 3300048907 Ga0496104_0383570 Ga0496104_0383570_211_882 212
420 3300048908 Ga0496105_0250174 Ga0496105_0250174_106_777 212
421 3300048911 Ga0496108_0805076 Ga0496108_0805076_13_684 212
422 3300048917 Ga0496114_0022185 Ga0496114_0022185_3912_4583 212
423 3300050496 nmdc:mga07m45_139695_c1 nmdc:mga07m45_139695_c1_277_942 212
424 3300050513 nmdc:mga0rr50_235104_c1 nmdc:mga0rr50_235104_c1_90_749 212
425 3300053086 Ga0500578_0000236 Ga0500578_0000236_2158_2823 212
426 3300053094 Ga0500566_0158488 Ga0500566_0158488_375_1031 212
427 3300053119 Ga0500595_010080 Ga0500595_010080_2171_2827 212
428 3300053131 Ga0500652_000014 Ga0500652_000014_104300_104956 212
429 3300053151 Ga0500604_0014218 Ga0500604_0014218_274_939 212
430 3300053151 Ga0500604_0014386 Ga0500604_0014386_269_934 212
431 3300053177 Ga0500636_0030839 Ga0500636_0030839_2250_2906 212
432 3300005331 Ga0070670_100054773 Ga0070670_1000547733 213
433 3300005333 Ga0070677_10073698 Ga0070677_100736981 213
434 3300005335 Ga0070666_10382206 Ga0070666_103822061 213
435 3300005338 Ga0068868_100045718 Ga0068868_1000457183 213
436 3300005340 Ga0070689_100156508 Ga0070689_1001565082 213
437 3300005347 Ga0070668_100141893 Ga0070668_1001418932 213
438 3300005353 Ga0070669_100059683 Ga0070669_1000596832 213
439 3300005354 Ga0070675_100346138 Ga0070675_1003461382 213
440 3300005355 Ga0070671_100023761 Ga0070671_1000237613 213
441 3300005356 Ga0070674_100002295 Ga0070674_1000022959 213
442 3300005364 Ga0070673_100002654 Ga0070673_1000026544 213
443 3300005456 Ga0070678_100047325 Ga0070678_1000473252 213
444 3300005459 Ga0068867_100001776 Ga0068867_1000017768 213
445 3300005535 Ga0070684_100047686 Ga0070684_1000476863 213
446 3300005543 Ga0070672_100001907 Ga0070672_1000019075 213
447 3300005548 Ga0070665_100320009 Ga0070665_1003200092 213
448 3300005564 Ga0070664_100096792 Ga0070664_1000967923 213
449 3300005618 Ga0068864_100048094 Ga0068864_1000480943 213
450 3300005834 Ga0068851_10048291 Ga0068851_100482912 213
451 3300005841 Ga0068863_100792730 Ga0068863_1007927302 213
452 3300006042 Ga0075368_10029548 Ga0075368_100295482 213
453 3300006358 Ga0068871_100055704 Ga0068871_1000557044 213
454 3300006844 Ga0075428_100185745 Ga0075428_1001857452 213
455 3300006847 Ga0075431_100681393 Ga0075431_1006813932 213
456 3300006880 Ga0075429_100126110 Ga0075429_1001261102 213
457 3300009093 Ga0105240_10289082 Ga0105240_102890823 213
458 3300009177 Ga0105248_10277453 Ga0105248_102774532 213
459 3300013296 Ga0157374_10455124 Ga0157374_104551242 213
460 3300013306 Ga0163162_10217636 Ga0163162_102176362 213
461 3300014325 Ga0163163_10903823 Ga0163163_109038231 213
462 3300014968 Ga0157379_10905851 Ga0157379_109058511 213
463 3300017792 Ga0163161_10006805 Ga0163161_100068055 213
464 3300025893 Ga0207682_10015241 Ga0207682_100152412 213
465 3300025907 Ga0207645_10091642 Ga0207645_100916422 213
466 3300025908 Ga0207643_10156866 Ga0207643_101568662 213
467 3300025923 Ga0207681_10001984 Ga0207681_100019848 213
468 3300025925 Ga0207650_10000274 Ga0207650_1000027442 213
469 3300025926 Ga0207659_10004273 Ga0207659_100042735 213
470 3300025936 Ga0207670_10159585 Ga0207670_101595852 213
471 3300025937 Ga0207669_10161723 Ga0207669_101617232 213
472 3300025940 Ga0207691_10000494 Ga0207691_1000049432 213
473 3300025944 Ga0207661_10000576 Ga0207661_1000057610 213
474 3300025960 Ga0207651_10001168 Ga0207651_100011684 213
475 3300026023 Ga0207677_10361291 Ga0207677_103612912 213
476 3300026067 Ga0207678_10470148 Ga0207678_104701481 213
477 3300026089 Ga0207648_10125504 Ga0207648_101255043 213
478 3300026095 Ga0207676_10043371 Ga0207676_100433712 213
479 3300026121 Ga0207683_10018977 Ga0207683_100189773 213
480 3300026121 Ga0207683_10537019 Ga0207683_105370192 213
481 3300028794 Ga0307515_10006527 Ga0307515_100065274 213
482 3300035089 Ga0373944_0013956 Ga0373944_0013956_29_718 213
483 3300048915 Ga0496112_0692166 Ga0496112_0692166_133_810 213
484 3300048916 Ga0496113_0297226 Ga0496113_0297226_462_1139 213
485 3300050495 nmdc:mga04h51_18807_c1 nmdc:mga04h51_18807_c1_376_1080 213
486 3300053730 Ga0500645_025399 Ga0500645_025399_1076_1771 213
487 3300005331 Ga0070670_100102832 Ga0070670_1001028322 214
488 3300006038 Ga0075365_10192936 Ga0075365_101929361 214
489 3300006178 Ga0075367_10031593 Ga0075367_100315931 214
490 3300006178 Ga0075367_10063896 Ga0075367_100638964 214
491 3300006358 Ga0068871_100324958 Ga0068871_1003249582 214
492 3300006871 Ga0075434_100280483 Ga0075434_1002804833 214
493 3300007076 Ga0075435_100747087 Ga0075435_1007470871 214
494 3300025261 Ga0209233_1023062 Ga0209233_10230621 214
495 3300027866 Ga0209813_10001943 Ga0209813_100019433 214
496 3300027907 Ga0207428_10021134 Ga0207428_100211344 214
497 3300028577 Ga0265318_10006235 Ga0265318_100062358 214
498 3300028794 Ga0307515_10492371 Ga0307515_104923711 214
499 3300031239 Ga0265328_10006421 Ga0265328_100064214 214
500 3300031250 Ga0265331_10005867 Ga0265331_100058676 214
501 3300031344 Ga0265316_10082981 Ga0265316_100829814 214
502 3300031711 Ga0265314_10000992 Ga0265314_1000099229 214
503 3300031712 Ga0265342_10023182 Ga0265342_100231822 214
504 3300032005 Ga0307411_10464830 Ga0307411_104648301 214
505 3300037068 Ga0373925_0077575 Ga0373925_0077575_196_882 214
506 3300046474 Ga0495605_0230228 Ga0495605_0230228_71_742 214
507 3300050494 nmdc:mga06z11_3482_c1 nmdc:mga06z11_3482_c1_4860_5519 214
508 3300050512 nmdc:mga0n895_254415_c1 nmdc:mga0n895_254415_c1_35_700 214
509 3300005445 Ga0070708_100276280 Ga0070708_1002762801 215
510 3300005458 Ga0070681_10105771 Ga0070681_101057715 215
511 3300005458 Ga0070681_10435174 Ga0070681_104351741 215
512 3300005467 Ga0070706_100081665 Ga0070706_1000816655 215
513 3300005467 Ga0070706_100431386 Ga0070706_1004313862 215
514 3300005548 Ga0070665_100546888 Ga0070665_1005468882 215
515 3300005549 Ga0070704_100225941 Ga0070704_1002259412 215
516 3300005563 Ga0068855_100871674 Ga0068855_1008716742 215
517 3300006844 Ga0075428_100046620 Ga0075428_1000466202 215
518 3300006846 Ga0075430_100348418 Ga0075430_1003484181 215
519 3300006846 Ga0075430_100364924 Ga0075430_1003649241 215
520 3300006847 Ga0075431_100168059 Ga0075431_1001680592 215
521 3300006847 Ga0075431_100224512 Ga0075431_1002245122 215
522 3300006880 Ga0075429_100067370 Ga0075429_1000673704 215
523 3300010159 Ga0099796_10018269 Ga0099796_100182692 215
524 3300025910 Ga0207684_10290266 Ga0207684_102902662 215
525 3300025910 Ga0207684_10373988 Ga0207684_103739881 215
526 3300025912 Ga0207707_10376271 Ga0207707_103762711 215
527 3300025949 Ga0207667_10440914 Ga0207667_104409142 215
528 3300026023 Ga0207677_10602786 Ga0207677_106027861 215
529 3300050508 nmdc:mga09592_81575_c1 nmdc:mga09592_81575_c1_939_1670 215
530 3300050509 nmdc:mga0qj67_160268_c1 nmdc:mga0qj67_160268_c1_966_1643 215
531 3300005440 Ga0070705_100621343 Ga0070705_1006213431 216
532 3300005545 Ga0070695_100666978 Ga0070695_1006669781 216
533 3300005617 Ga0068859_100019725 Ga0068859_1000197252 216
534 3300005617 Ga0068859_100757944 Ga0068859_1007579442 216
535 3300005618 Ga0068864_100764493 Ga0068864_1007644932 216
536 3300005719 Ga0068861_100172952 Ga0068861_1001729522 216
537 3300005843 Ga0068860_100081432 Ga0068860_1000814322 216
538 3300005844 Ga0068862_100004818 Ga0068862_1000048183 216
539 3300006871 Ga0075434_100015291 Ga0075434_1000152917 216
540 3300006931 Ga0097620_100019727 Ga0097620_1000197274 216
541 3300006931 Ga0097620_100757915 Ga0097620_1007579152 216
542 3300025885 Ga0207653_10093539 Ga0207653_100935392 216
543 3300025941 Ga0207711_10322428 Ga0207711_103224282 216
544 3300025961 Ga0207712_10031710 Ga0207712_100317103 216
545 3300026095 Ga0207676_10100932 Ga0207676_101009322 216
546 3300026116 Ga0207674_10074109 Ga0207674_100741091 216
547 3300026118 Ga0207675_100058840 Ga0207675_1000588401 216
548 3300028381 Ga0268264_10183495 Ga0268264_101834952 216
549 3300050512 nmdc:mga0n895_8875_c1 nmdc:mga0n895_8875_c1_4626_5294 216
550 3300005295 Ga0065707_10255063 Ga0065707_102550631 217
551 3300005330 Ga0070690_100175608 Ga0070690_1001756082 217
552 3300005330 Ga0070690_100361168 Ga0070690_1003611682 217
553 3300005331 Ga0070670_100007548 Ga0070670_1000075482 217
554 3300005344 Ga0070661_100251563 Ga0070661_1002515632 217
555 3300005347 Ga0070668_100087534 Ga0070668_1000875341 217
556 3300005353 Ga0070669_100268259 Ga0070669_1002682592 217
557 3300005354 Ga0070675_100011178 Ga0070675_1000111784 217
558 3300005364 Ga0070673_100012746 Ga0070673_1000127463 217
559 3300005365 Ga0070688_100118796 Ga0070688_1001187961 217
560 3300005440 Ga0070705_100039696 Ga0070705_1000396962 217
561 3300005441 Ga0070700_100310730 Ga0070700_1003107301 217
562 3300005456 Ga0070678_100185416 Ga0070678_1001854162 217
563 3300005456 Ga0070678_100191041 Ga0070678_1001910413 217
564 3300005457 Ga0070662_100270900 Ga0070662_1002709002 217
565 3300005467 Ga0070706_100168769 Ga0070706_1001687692 217
566 3300005518 Ga0070699_100275195 Ga0070699_1002751951 217
567 3300005543 Ga0070672_100000358 Ga0070672_10000035823 217
568 3300005618 Ga0068864_100097466 Ga0068864_1000974662 217
569 3300005719 Ga0068861_100127963 Ga0068861_1001279632 217
570 3300005841 Ga0068863_100097753 Ga0068863_1000977532 217
571 3300005841 Ga0068863_100105059 Ga0068863_1001050592 217
572 3300005843 Ga0068860_100048446 Ga0068860_1000484464 217
573 3300005844 Ga0068862_100123082 Ga0068862_1001230822 217
574 3300006038 Ga0075365_10004100 Ga0075365_100041008 217
575 3300006042 Ga0075368_10001078 Ga0075368_100010783 217
576 3300006051 Ga0075364_10068119 Ga0075364_100681192 217
577 3300006195 Ga0075366_10061603 Ga0075366_100616034 217
578 3300006353 Ga0075370_10017847 Ga0075370_100178476 217
579 3300006358 Ga0068871_100055683 Ga0068871_1000556833 217
580 3300006847 Ga0075431_100205794 Ga0075431_1002057942 217
581 3300006852 Ga0075433_10016732 Ga0075433_100167323 217
582 3300007076 Ga0075435_100029917 Ga0075435_1000299173 217
583 3300007076 Ga0075435_100048782 Ga0075435_1000487823 217
584 3300009147 Ga0114129_10004085 Ga0114129_100040854 217
585 3300009147 Ga0114129_10437738 Ga0114129_104377384 217
586 3300009177 Ga0105248_10093446 Ga0105248_100934462 217
587 3300013297 Ga0157378_10814204 Ga0157378_108142042 217
588 3300014325 Ga0163163_10507948 Ga0163163_105079481 217
589 3300014969 Ga0157376_10047593 Ga0157376_100475933 217
590 3300017792 Ga0163161_10045283 Ga0163161_100452834 217
591 3300025893 Ga0207682_10113471 Ga0207682_101134711 217
592 3300025903 Ga0207680_10028658 Ga0207680_100286581 217
593 3300025910 Ga0207684_10020525 Ga0207684_100205252 217
594 3300025910 Ga0207684_10285449 Ga0207684_102854492 217
595 3300025918 Ga0207662_10173270 Ga0207662_101732702 217
596 3300025923 Ga0207681_10169593 Ga0207681_101695932 217
597 3300025925 Ga0207650_10092631 Ga0207650_100926312 217
598 3300025931 Ga0207644_10180703 Ga0207644_101807032 217
599 3300025933 Ga0207706_10278191 Ga0207706_102781912 217
600 3300025938 Ga0207704_10497974 Ga0207704_104979742 217
601 3300025940 Ga0207691_10003496 Ga0207691_100034965 217
602 3300025941 Ga0207711_10038504 Ga0207711_100385044 217
603 3300025941 Ga0207711_10056663 Ga0207711_100566633 217
604 3300025942 Ga0207689_10513950 Ga0207689_105139502 217
605 3300025960 Ga0207651_10007821 Ga0207651_100078215 217
606 3300025972 Ga0207668_10657839 Ga0207668_106578391 217
607 3300026075 Ga0207708_10285256 Ga0207708_102852562 217
608 3300026088 Ga0207641_10010886 Ga0207641_100108863 217
609 3300026088 Ga0207641_10294196 Ga0207641_102941962 217
610 3300026089 Ga0207648_10096683 Ga0207648_100966832 217
611 3300026095 Ga0207676_10269596 Ga0207676_102695962 217
612 3300026118 Ga0207675_100052678 Ga0207675_1000526782 217
613 3300026121 Ga0207683_10055869 Ga0207683_100558694 217
614 3300026121 Ga0207683_10215857 Ga0207683_102158572 217
615 3300027866 Ga0209813_10020110 Ga0209813_100201102 217
616 3300028381 Ga0268264_10046391 Ga0268264_100463914 217
617 3300028381 Ga0268264_10547190 Ga0268264_105471902 217
618 3300031249 Ga0265339_10064302 Ga0265339_100643023 217
619 3300031344 Ga0265316_10381201 Ga0265316_103812012 217
620 3300031616 Ga0307508_10211428 Ga0307508_102114282 217
621 3300035088 Ga0373940_0035624 Ga0373940_0035624_53_715 217
622 3300036401 Ga0373937_0545123 Ga0373937_0545123_281_946 217
623 3300037471 Ga0395905_0453243 Ga0395905_0453243_82_768 217
624 3300046472 Ga0495580_0000683 Ga0495580_0000683_6421_7083 217
625 3300046664 Ga0495659_0020476 Ga0495659_0020476_532_1194 217
626 3300046684 Ga0495669_0110227 Ga0495669_0110227_599_1261 217
627 3300049576 Ga0501040_0012492 Ga0501040_0012492_3643_4326 217
628 3300049583 Ga0501067_0089123 Ga0501067_0089123_1036_1701 217
629 3300049584 Ga0501068_0375390 Ga0501068_0375390_235_900 217
630 3300049591 Ga0501075_0059850 Ga0501075_0059850_126_809 217
631 3300049741 Ga0501079_0516427 Ga0501079_0516427_222_905 217
632 3300050491 nmdc:mga00v17_300694_c1 nmdc:mga00v17_300694_c1_275_937 217
633 3300050494 nmdc:mga06z11_76410_c1 nmdc:mga06z11_76410_c1_387_1049 217
634 3300050496 nmdc:mga07m45_13302_c1 nmdc:mga07m45_13302_c1_1609_2271 217
635 3300050507 nmdc:mga05p37_385834_c1 nmdc:mga05p37_385834_c1_111_776 217
636 3300050507 nmdc:mga05p37_39063_c1 nmdc:mga05p37_39063_c1_276_941 217
637 3300050510 nmdc:mga06r32_211300_c1 nmdc:mga06r32_211300_c1_925_1590 217
638 3300050512 nmdc:mga0n895_15085_c1 nmdc:mga0n895_15085_c1_1608_2273 217
639 3300050513 nmdc:mga0rr50_104975_c1 nmdc:mga0rr50_104975_c1_938_1600 217
640 3300050513 nmdc:mga0rr50_107066_c1 nmdc:mga0rr50_107066_c1_386_1048 217
641 3300050513 nmdc:mga0rr50_43068_c1 nmdc:mga0rr50_43068_c1_1368_2033 217
642 3300050514 nmdc:mga08x19_29952_c1 nmdc:mga08x19_29952_c1_1608_2273 217
643 3300050514 nmdc:mga08x19_63051_c1 nmdc:mga08x19_63051_c1_149_811 217
644 3300053158 Ga0500627_0019136 Ga0500627_0019136_1523_2185 217
645 3300004798 Ga0058859_11552955 Ga0058859_115529551 218
646 3300004801 Ga0058860_10052366 Ga0058860_100523663 218
647 3300005331 Ga0070670_100019991 Ga0070670_1000199914 218
648 3300005331 Ga0070670_100061705 Ga0070670_1000617052 218
649 3300005367 Ga0070667_100103969 Ga0070667_1001039693 218
650 3300005617 Ga0068859_100394422 Ga0068859_1003944222 218
651 3300005617 Ga0068859_100620337 Ga0068859_1006203371 218
652 3300005981 Ga0081538_10003120 Ga0081538_100031205 218
653 3300005981 Ga0081538_10043104 Ga0081538_100431042 218
654 3300005985 Ga0081539_10003651 Ga0081539_1000365116 218
655 3300006175 Ga0070712_100916821 Ga0070712_1009168211 218
656 3300006844 Ga0075428_100153765 Ga0075428_1001537655 218
657 3300006846 Ga0075430_100026999 Ga0075430_1000269994 218
658 3300006847 Ga0075431_100176379 Ga0075431_1001763792 218
659 3300006847 Ga0075431_100307511 Ga0075431_1003075112 218
660 3300006852 Ga0075433_10830418 Ga0075433_108304181 218
661 3300006871 Ga0075434_100018111 Ga0075434_1000181118 218
662 3300006880 Ga0075429_100010700 Ga0075429_1000107006 218
663 3300006880 Ga0075429_100228267 Ga0075429_1002282672 218
664 3300006914 Ga0075436_100058363 Ga0075436_1000583633 218
665 3300006931 Ga0097620_100394410 Ga0097620_1003944102 218
666 3300006931 Ga0097620_100620307 Ga0097620_1006203071 218
667 3300007076 Ga0075435_100093896 Ga0075435_1000938963 218
668 3300009094 Ga0111539_10103969 Ga0111539_101039694 218
669 3300009147 Ga0114129_10055021 Ga0114129_100550212 218
670 3300009147 Ga0114129_10066913 Ga0114129_100669133 218
671 3300009147 Ga0114129_10129972 Ga0114129_101299723 218
672 3300009147 Ga0114129_10142943 Ga0114129_101429432 218
673 3300009553 Ga0105249_10048918 Ga0105249_100489183 218
674 3300013308 Ga0157375_10108398 Ga0157375_101083982 218
675 3300013308 Ga0157375_10180892 Ga0157375_101808922 218
676 3300025925 Ga0207650_10021279 Ga0207650_100212794 218
677 3300025925 Ga0207650_10159659 Ga0207650_101596592 218
678 3300025940 Ga0207691_10096509 Ga0207691_100965092 218
679 3300025961 Ga0207712_10098538 Ga0207712_100985381 218
680 3300027671 Ga0209588_1077418 Ga0209588_10774182 218
681 3300028380 Ga0268265_10005564 Ga0268265_100055642 218
682 3300031241 Ga0265325_10006840 Ga0265325_100068407 218
683 3300035111 Ga0373923_0267302 Ga0373923_0267302_23_697 218
684 3300035171 Ga0373946_0111546 Ga0373946_0111546_25_699 218
685 3300035171 Ga0373946_0255206 Ga0373946_0255206_160_834 218
686 3300035692 Ga0373935_0039383 Ga0373935_0039383_1780_2454 218
687 3300035692 Ga0373935_0134875 Ga0373935_0134875_888_1562 218
688 3300035695 Ga0373927_0022826 Ga0373927_0022826_3128_3802 218
689 3300035725 Ga0373947_0391886 Ga0373947_0391886_19_693 218
690 3300035725 Ga0373947_0570793 Ga0373947_0570793_60_734 218
691 3300037068 Ga0373925_0095744 Ga0373925_0095744_1375_2049 218
692 3300037068 Ga0373925_0390326 Ga0373925_0390326_290_964 218
693 3300042008 Ga0439450_039217 Ga0439450_039217_141_821 218
694 3300042876 Ga0451577_0718923 Ga0451577_0718923_72_854 218
695 3300046473 Ga0495582_0104641 Ga0495582_0104641_686_1360 218
696 3300046514 Ga0495618_0398466 Ga0495618_0398466_72_746 218
697 3300046516 Ga0495628_0312523 Ga0495628_0312523_87_761 218
698 3300046516 Ga0495628_0433060 Ga0495628_0433060_199_873 218
699 3300046517 Ga0495630_0206881 Ga0495630_0206881_654_1328 218
700 3300046533 Ga0495640_0024230 Ga0495640_0024230_3426_4100 218
701 3300046533 Ga0495640_0060233 Ga0495640_0060233_1642_2316 218
702 3300046683 Ga0495658_0135058 Ga0495658_0135058_34_708 218
703 3300049568 Ga0501031_0415882 Ga0501031_0415882_129_809 218
704 3300049577 Ga0501041_0073839 Ga0501041_0073839_77_757 218
705 3300049582 Ga0501048_0342264 Ga0501048_0342264_149_829 218
706 3300049587 Ga0501071_0149658 Ga0501071_0149658_530_1210 218
707 3300049588 Ga0501072_0455892 Ga0501072_0455892_209_889 218
708 3300049590 Ga0501074_0415371 Ga0501074_0415371_254_934 218
709 3300049591 Ga0501075_0177917 Ga0501075_0177917_468_1148 218
710 3300049593 Ga0501077_0074645 Ga0501077_0074645_853_1527 218
711 3300049742 Ga0501080_0337147 Ga0501080_0337147_369_1049 218
712 3300049743 Ga0501081_0377416 Ga0501081_0377416_114_794 218
713 3300050507 nmdc:mga05p37_10207_c1 nmdc:mga05p37_10207_c1_4000_4677 218
714 3300050507 nmdc:mga05p37_104271_c1 nmdc:mga05p37_104271_c1_601_1275 218
715 3300050507 nmdc:mga05p37_15856_c1 nmdc:mga05p37_15856_c1_952_1626 218
716 3300050507 nmdc:mga05p37_85076_c1 nmdc:mga05p37_85076_c1_1416_2084 218
717 3300050508 nmdc:mga09592_169100_c1 nmdc:mga09592_169100_c1_989_1663 218
718 3300050508 nmdc:mga09592_7756_c1 nmdc:mga09592_7756_c1_5524_6198 218
719 3300050509 nmdc:mga0qj67_58551_c1 nmdc:mga0qj67_58551_c1_73_747 218
720 3300050510 nmdc:mga06r32_35577_c1 nmdc:mga06r32_35577_c1_1850_2524 218
721 3300050510 nmdc:mga06r32_77499_c1 nmdc:mga06r32_77499_c1_1139_1813 218
722 3300050513 nmdc:mga0rr50_135279_c1 nmdc:mga0rr50_135279_c1_1111_1779 218
723 3300050514 nmdc:mga08x19_170263_c1 nmdc:mga08x19_170263_c1_497_1165 218
724 3300050515 nmdc:mga0a205_242974_c1 nmdc:mga0a205_242974_c1_55_729 218
725 3300053085 Ga0495619_0191701 Ga0495619_0191701_490_1164 218
726 3300054114 Ga0501084_0057776 Ga0501084_0057776_1342_2022 218
727 3300060353 Ga0501082_0834466 Ga0501082_0834466_65_745 218
728 3300061734 Ga0530510_0070238 Ga0530510_0070238_1320_2000 218
729 2209111006 2214828542 2213866878 219
730 3300000041 ARcpr5oldR_c000138 ARcpr5oldR_0001386 219
731 3300000042 ARSoilYngRDRAFT_c00004 ARSoilYngRDRAFT_0000419 219
732 3300000043 ARcpr5yngRDRAFT_c000060 ARcpr5yngRDRAFT_0000609 219
733 3300000044 ARSoilOldRDRAFT_c000133 ARSoilOldRDRAFT_00013313 219
734 3300000045 ARCol0oldRDRAFT_c00433 ARCol0oldRDRAFT_004333 219
735 3300000652 ARCol0yngRDRAFT_1000084 ARCol0yngRDRAFT_100008415 219
736 3300001915 JGI24741J21665_1015598 JGI24741J21665_10155982 219
737 3300001978 JGI24747J21853_1013193 JGI24747J21853_10131931 219
738 3300001990 JGI24737J22298_10000934 JGI24737J22298_100009344 219
739 3300001991 JGI24743J22301_10007855 JGI24743J22301_100078554 219
740 3300002067 JGI24735J21928_10028325 JGI24735J21928_100283254 219
741 3300002070 JGI24750J21931_1000032 JGI24750J21931_10000327 219
742 3300002074 JGI24748J21848_1000782 JGI24748J21848_10007826 219
743 3300002075 JGI24738J21930_10001211 JGI24738J21930_100012116 219
744 3300002076 JGI24749J21850_1003266 JGI24749J21850_10032664 219
745 3300002126 JGI24035J26624_1000066 JGI24035J26624_10000667 219
746 3300002155 JGI24033J26618_1000292 JGI24033J26618_10002924 219
747 3300002239 JGI24034J26672_10000075 JGI24034J26672_1000007524 219
748 3300002244 JGI24742J22300_10000054 JGI24742J22300_1000005417 219
749 3300002459 JGI24751J29686_10010139 JGI24751J29686_100101392 219
750 3300005276 Ga0065717_1002020 Ga0065717_10020203 219
751 3300005288 Ga0065714_10180179 Ga0065714_101801792 219
752 3300005289 Ga0065704_10072529 Ga0065704_100725299 219
753 3300005293 Ga0065715_10089082 Ga0065715_1008908215 219
754 3300005295 Ga0065707_10127028 Ga0065707_101270281 219
755 3300005328 Ga0070676_10000062 Ga0070676_100000628 219
756 3300005329 Ga0070683_100000259 Ga0070683_10000025926 219
757 3300005330 Ga0070690_100001045 Ga0070690_10000104515 219
758 3300005330 Ga0070690_100375896 Ga0070690_1003758962 219
759 3300005331 Ga0070670_100008320 Ga0070670_1000083201 219
760 3300005333 Ga0070677_10000077 Ga0070677_1000007726 219
761 3300005334 Ga0068869_100000095 Ga0068869_10000009526 219
762 3300005336 Ga0070680_100001342 Ga0070680_10000134218 219
763 3300005336 Ga0070680_100102792 Ga0070680_1001027923 219
764 3300005337 Ga0070682_100000511 Ga0070682_1000005118 219
765 3300005338 Ga0068868_100009255 Ga0068868_1000092552 219
766 3300005339 Ga0070660_100000871 Ga0070660_10000087122 219
767 3300005339 Ga0070660_100230869 Ga0070660_1002308691 219
768 3300005340 Ga0070689_100006542 Ga0070689_1000065423 219
769 3300005340 Ga0070689_100081269 Ga0070689_1000812693 219
770 3300005341 Ga0070691_10014544 Ga0070691_100145443 219
771 3300005343 Ga0070687_100000489 Ga0070687_1000004893 219
772 3300005343 Ga0070687_100091102 Ga0070687_1000911021 219
773 3300005344 Ga0070661_100000912 Ga0070661_10000091223 219
774 3300005345 Ga0070692_10002749 Ga0070692_100027496 219
775 3300005345 Ga0070692_10132000 Ga0070692_101320002 219
776 3300005347 Ga0070668_100041387 Ga0070668_1000413873 219
777 3300005353 Ga0070669_100000627 Ga0070669_10000062723 219
778 3300005354 Ga0070675_100000524 Ga0070675_1000005248 219
779 3300005355 Ga0070671_100000935 Ga0070671_10000093513 219
780 3300005356 Ga0070674_100001658 Ga0070674_1000016588 219
781 3300005364 Ga0070673_100000144 Ga0070673_10000014426 219
782 3300005365 Ga0070688_100000524 Ga0070688_1000005243 219
783 3300005365 Ga0070688_100296014 Ga0070688_1002960142 219
784 3300005366 Ga0070659_100001134 Ga0070659_10000113421 219
785 3300005367 Ga0070667_100008892 Ga0070667_10000889210 219
786 3300005367 Ga0070667_100071531 Ga0070667_1000715313 219
787 3300005367 Ga0070667_100241346 Ga0070667_1002413463 219
788 3300005406 Ga0070703_10003476 Ga0070703_100034762 219
789 3300005438 Ga0070701_10000059 Ga0070701_1000005930 219
790 3300005440 Ga0070705_100000717 Ga0070705_10000071720 219
791 3300005440 Ga0070705_100214331 Ga0070705_1002143311 219
792 3300005441 Ga0070700_100002047 Ga0070700_10000204711 219
793 3300005441 Ga0070700_100286538 Ga0070700_1002865382 219
794 3300005444 Ga0070694_100001020 Ga0070694_1000010203 219
795 3300005444 Ga0070694_100105214 Ga0070694_1001052142 219
796 3300005445 Ga0070708_100113828 Ga0070708_1001138283 219
797 3300005455 Ga0070663_100000339 Ga0070663_1000003398 219
798 3300005456 Ga0070678_100005238 Ga0070678_1000052385 219
799 3300005457 Ga0070662_100011568 Ga0070662_1000115683 219
800 3300005458 Ga0070681_10002595 Ga0070681_100025953 219
801 3300005459 Ga0068867_100000325 Ga0068867_10000032516 219
802 3300005466 Ga0070685_10002882 Ga0070685_100028825 219
803 3300005468 Ga0070707_100878257 Ga0070707_1008782571 219
804 3300005530 Ga0070679_100001410 Ga0070679_1000014103 219
805 3300005535 Ga0070684_100000526 Ga0070684_1000005263 219
806 3300005539 Ga0068853_100002423 Ga0068853_10000242311 219
807 3300005539 Ga0068853_100426231 Ga0068853_1004262311 219
808 3300005543 Ga0070672_100000433 Ga0070672_1000004339 219
809 3300005544 Ga0070686_100000704 Ga0070686_10000070421 219
810 3300005544 Ga0070686_100091419 Ga0070686_1000914192 219
811 3300005545 Ga0070695_100019851 Ga0070695_1000198513 219
812 3300005545 Ga0070695_100058832 Ga0070695_1000588323 219
813 3300005546 Ga0070696_100012571 Ga0070696_1000125716 219
814 3300005547 Ga0070693_100017619 Ga0070693_1000176193 219
815 3300005549 Ga0070704_100000341 Ga0070704_1000003413 219
816 3300005563 Ga0068855_100006286 Ga0068855_1000062869 219
817 3300005564 Ga0070664_100001370 Ga0070664_10000137021 219
818 3300005564 Ga0070664_100076766 Ga0070664_1000767663 219
819 3300005564 Ga0070664_100240821 Ga0070664_1002408212 219
820 3300005577 Ga0068857_100000521 Ga0068857_10000052117 219
821 3300005577 Ga0068857_100256915 Ga0068857_1002569152 219
822 3300005578 Ga0068854_100000532 Ga0068854_10000053224 219
823 3300005614 Ga0068856_100002364 Ga0068856_1000023644 219
824 3300005615 Ga0070702_100000207 Ga0070702_10000020715 219
825 3300005616 Ga0068852_100006852 Ga0068852_1000068529 219
826 3300005617 Ga0068859_100002298 Ga0068859_1000022984 219
827 3300005617 Ga0068859_100284169 Ga0068859_1002841691 219
828 3300005618 Ga0068864_100003173 Ga0068864_1000031734 219
829 3300005618 Ga0068864_100281229 Ga0068864_1002812292 219
830 3300005618 Ga0068864_100846264 Ga0068864_1008462641 219
831 3300005718 Ga0068866_10000912 Ga0068866_1000091214 219
832 3300005719 Ga0068861_100000416 Ga0068861_1000004164 219
833 3300005719 Ga0068861_100674498 Ga0068861_1006744981 219
834 3300005834 Ga0068851_10037574 Ga0068851_100375741 219
835 3300005840 Ga0068870_10000034 Ga0068870_1000003426 219
836 3300005841 Ga0068863_100002182 Ga0068863_1000021824 219
837 3300005842 Ga0068858_100004013 Ga0068858_10000401315 219
838 3300005842 Ga0068858_100128549 Ga0068858_1001285492 219
839 3300005842 Ga0068858_100620650 Ga0068858_1006206502 219
840 3300005843 Ga0068860_100069835 Ga0068860_1000698353 219
841 3300005843 Ga0068860_100322876 Ga0068860_1003228762 219
842 3300005843 Ga0068860_100655696 Ga0068860_1006556962 219
843 3300005844 Ga0068862_100001525 Ga0068862_10000152524 219
844 3300005844 Ga0068862_100053036 Ga0068862_1000530363 219
845 3300005937 Ga0081455_10000204 Ga0081455_1000020412 219
846 3300005983 Ga0081540_1021931 Ga0081540_10219312 219
847 3300006058 Ga0075432_10002270 Ga0075432_100022703 219
848 3300006178 Ga0075367_10028577 Ga0075367_100285772 219
849 3300006194 Ga0075427_10002073 Ga0075427_100020732 219
850 3300006237 Ga0097621_100000010 Ga0097621_100000010111 219
851 3300006358 Ga0068871_100000193 Ga0068871_10000019328 219
852 3300006844 Ga0075428_100021307 Ga0075428_1000213077 219
853 3300006846 Ga0075430_100000112 Ga0075430_10000011221 219
854 3300006847 Ga0075431_100004280 Ga0075431_10000428013 219
855 3300006852 Ga0075433_10000639 Ga0075433_1000063911 219
856 3300006852 Ga0075433_10028231 Ga0075433_100282315 219
857 3300006852 Ga0075433_10069403 Ga0075433_100694033 219
858 3300006871 Ga0075434_100000661 Ga0075434_10000066117 219
859 3300006871 Ga0075434_100001173 Ga0075434_1000011735 219
860 3300006880 Ga0075429_100000479 Ga0075429_10000047917 219
861 3300006881 Ga0068865_100000252 Ga0068865_10000025221 219
862 3300006931 Ga0097620_100002298 Ga0097620_10000229821 219
863 3300006931 Ga0097620_100284156 Ga0097620_1002841561 219
864 3300007076 Ga0075435_100154525 Ga0075435_1001545254 219
865 3300009093 Ga0105240_10042779 Ga0105240_100427796 219
866 3300009094 Ga0111539_10003320 Ga0111539_1000332023 219
867 3300009094 Ga0111539_10004062 Ga0111539_100040628 219
868 3300009094 Ga0111539_10005715 Ga0111539_1000571517 219
869 3300009101 Ga0105247_10001439 Ga0105247_100014393 219
870 3300009147 Ga0114129_10025348 Ga0114129_100253489 219
871 3300009148 Ga0105243_10002371 Ga0105243_1000237114 219
872 3300009174 Ga0105241_10000770 Ga0105241_100007709 219
873 3300009176 Ga0105242_10002422 Ga0105242_100024224 219
874 3300009177 Ga0105248_10002790 Ga0105248_100027904 219
875 3300009177 Ga0105248_10008272 Ga0105248_100082728 219
876 3300009545 Ga0105237_10013310 Ga0105237_100133101 219
877 3300009545 Ga0105237_10234058 Ga0105237_102340581 219
878 3300009553 Ga0105249_10001686 Ga0105249_1000168621 219
879 3300009553 Ga0105249_10502274 Ga0105249_105022742 219
880 3300010375 Ga0105239_10032940 Ga0105239_100329402 219
881 3300011119 Ga0105246_10000081 Ga0105246_100000819 219
882 3300011119 Ga0105246_10379094 Ga0105246_103790942 219
883 3300012476 Ga0157344_1000345 Ga0157344_10003452 219
884 3300012492 Ga0157335_1001295 Ga0157335_10012952 219
885 3300012494 Ga0157341_1000159 Ga0157341_10001592 219
886 3300013100 Ga0157373_10058688 Ga0157373_100586883 219
887 3300013102 Ga0157371_10020506 Ga0157371_100205065 219
888 3300013296 Ga0157374_10009607 Ga0157374_1000960710 219
889 3300013297 Ga0157378_10000990 Ga0157378_100009902 219
890 3300013306 Ga0163162_10005170 Ga0163162_100051707 219
891 3300013306 Ga0163162_11619450 Ga0163162_116194501 219
892 3300013307 Ga0157372_10016190 Ga0157372_100161909 219
893 3300013308 Ga0157375_10000944 Ga0157375_100009449 219
894 3300013308 Ga0157375_10949582 Ga0157375_109495821 219
895 3300014325 Ga0163163_10010654 Ga0163163_100106549 219
896 3300014325 Ga0163163_10032566 Ga0163163_100325667 219
897 3300014326 Ga0157380_10000321 Ga0157380_1000032127 219
898 3300014326 Ga0157380_10116040 Ga0157380_101160403 219
899 3300014497 Ga0182008_10101751 Ga0182008_101017511 219
900 3300014968 Ga0157379_10039887 Ga0157379_100398874 219
901 3300014968 Ga0157379_10118758 Ga0157379_101187583 219
902 3300014969 Ga0157376_10000098 Ga0157376_1000009852 219
903 3300017792 Ga0163161_10000866 Ga0163161_1000086625 219
904 3300025271 Ga0207666_1000027 Ga0207666_10000279 219
905 3300025315 Ga0207697_10000553 Ga0207697_100005534 219
906 3300025315 Ga0207697_10054565 Ga0207697_100545653 219
907 3300025885 Ga0207653_10002753 Ga0207653_100027533 219
908 3300025893 Ga0207682_10000006 Ga0207682_1000000679 219
909 3300025899 Ga0207642_10000107 Ga0207642_100001074 219
910 3300025900 Ga0207710_10000632 Ga0207710_100006323 219
911 3300025901 Ga0207688_10000205 Ga0207688_100002054 219
912 3300025903 Ga0207680_10108104 Ga0207680_101081041 219
913 3300025904 Ga0207647_10067576 Ga0207647_100675764 219
914 3300025904 Ga0207647_10133908 Ga0207647_101339082 219
915 3300025907 Ga0207645_10000023 Ga0207645_1000002397 219
916 3300025908 Ga0207643_10000007 Ga0207643_1000000788 219
917 3300025911 Ga0207654_10001016 Ga0207654_100010166 219
918 3300025912 Ga0207707_10000786 Ga0207707_1000078626 219
919 3300025912 Ga0207707_10245998 Ga0207707_102459982 219
920 3300025913 Ga0207695_10070670 Ga0207695_100706703 219
921 3300025914 Ga0207671_10058655 Ga0207671_100586553 219
922 3300025914 Ga0207671_10751091 Ga0207671_107510911 219
923 3300025917 Ga0207660_10000058 Ga0207660_1000005827 219
924 3300025918 Ga0207662_10000896 Ga0207662_100008964 219
925 3300025918 Ga0207662_10190196 Ga0207662_101901962 219
926 3300025919 Ga0207657_10002630 Ga0207657_100026304 219
927 3300025919 Ga0207657_10241770 Ga0207657_102417702 219
928 3300025920 Ga0207649_10000384 Ga0207649_1000038432 219
929 3300025921 Ga0207652_10000377 Ga0207652_1000037729 219
930 3300025923 Ga0207681_10000100 Ga0207681_100001008 219
931 3300025923 Ga0207681_10163502 Ga0207681_101635022 219
932 3300025925 Ga0207650_10038763 Ga0207650_100387633 219
933 3300025926 Ga0207659_10000044 Ga0207659_1000004423 219
934 3300025927 Ga0207687_10001241 Ga0207687_100012412 219
935 3300025931 Ga0207644_10000690 Ga0207644_100006905 219
936 3300025932 Ga0207690_10000601 Ga0207690_100006015 219
937 3300025932 Ga0207690_10252935 Ga0207690_102529352 219
938 3300025933 Ga0207706_10001769 Ga0207706_100017694 219
939 3300025933 Ga0207706_10184470 Ga0207706_101844702 219
940 3300025934 Ga0207686_10000222 Ga0207686_1000022225 219
941 3300025935 Ga0207709_10000154 Ga0207709_1000015426 219
942 3300025936 Ga0207670_10000129 Ga0207670_1000012927 219
943 3300025937 Ga0207669_10000160 Ga0207669_100001606 219
944 3300025937 Ga0207669_10191086 Ga0207669_101910862 219
945 3300025940 Ga0207691_10000405 Ga0207691_100004059 219
946 3300025941 Ga0207711_10006895 Ga0207711_100068959 219
947 3300025942 Ga0207689_10000098 Ga0207689_1000009821 219
948 3300025944 Ga0207661_10000178 Ga0207661_1000017823 219
949 3300025944 Ga0207661_10484716 Ga0207661_104847161 219
950 3300025945 Ga0207679_10000029 Ga0207679_10000029110 219
951 3300025945 Ga0207679_10117306 Ga0207679_101173062 219
952 3300025945 Ga0207679_10141454 Ga0207679_101414543 219
953 3300025949 Ga0207667_10049074 Ga0207667_100490745 219
954 3300025960 Ga0207651_10000031 Ga0207651_1000003123 219
955 3300025961 Ga0207712_10000129 Ga0207712_1000012914 219
956 3300025961 Ga0207712_10110049 Ga0207712_101100492 219
957 3300025972 Ga0207668_10000158 Ga0207668_1000015838 219
958 3300025981 Ga0207640_10000168 Ga0207640_1000016832 219
959 3300025981 Ga0207640_10182772 Ga0207640_101827722 219
960 3300025986 Ga0207658_10000655 Ga0207658_100006553 219
961 3300025986 Ga0207658_10072411 Ga0207658_100724113 219
962 3300025986 Ga0207658_10225789 Ga0207658_102257891 219
963 3300026023 Ga0207677_10000553 Ga0207677_1000055323 219
964 3300026035 Ga0207703_10000631 Ga0207703_100006319 219
965 3300026035 Ga0207703_10383940 Ga0207703_103839402 219
966 3300026041 Ga0207639_10001591 Ga0207639_1000159111 219
967 3300026067 Ga0207678_10001139 Ga0207678_1000113921 219
968 3300026075 Ga0207708_10000660 Ga0207708_100006604 219
969 3300026075 Ga0207708_10197342 Ga0207708_101973423 219
970 3300026078 Ga0207702_10000404 Ga0207702_1000040415 219
971 3300026088 Ga0207641_10000520 Ga0207641_1000052040 219
972 3300026088 Ga0207641_10145849 Ga0207641_101458493 219
973 3300026089 Ga0207648_10000072 Ga0207648_1000007287 219
974 3300026095 Ga0207676_10000180 Ga0207676_1000018040 219
975 3300026095 Ga0207676_10770313 Ga0207676_107703131 219
976 3300026116 Ga0207674_10003433 Ga0207674_1000343321 219
977 3300026116 Ga0207674_10123631 Ga0207674_101236313 219
978 3300026118 Ga0207675_100124676 Ga0207675_1001246764 219
979 3300026118 Ga0207675_100211395 Ga0207675_1002113952 219
980 3300026121 Ga0207683_10000029 Ga0207683_1000002997 219
981 3300026142 Ga0207698_10000682 Ga0207698_100006821 219
982 3300027617 Ga0210002_1000485 Ga0210002_10004854 219
983 3300027695 Ga0209966_1008488 Ga0209966_10084883 219
984 3300027695 Ga0209966_1037871 Ga0209966_10378711 219
985 3300027717 Ga0209998_10002969 Ga0209998_100029693 219
986 3300027876 Ga0209974_10030398 Ga0209974_100303984 219
987 3300027876 Ga0209974_10046169 Ga0209974_100461692 219
988 3300027907 Ga0207428_10000100 Ga0207428_1000010040 219
989 3300027907 Ga0207428_10000124 Ga0207428_1000012417 219
990 3300027907 Ga0207428_10000968 Ga0207428_1000096825 219
991 3300028379 Ga0268266_10057152 Ga0268266_100571524 219
992 3300028380 Ga0268265_10000698 Ga0268265_1000069823 219
993 3300028381 Ga0268264_10001558 Ga0268264_1000155823 219
994 3300028381 Ga0268264_10285489 Ga0268264_102854892 219
995 3300034818 Ga0373950_0001825 Ga0373950_0001825_318_977 219
996 3300034957 Ga0373938_0000494 Ga0373938_0000494_862_1521 219
997 3300035084 Ga0373928_0009097 Ga0373928_0009097_647_1306 219
998 3300035085 Ga0373929_0001228 Ga0373929_0001228_3404_4063 219
999 3300035088 Ga0373940_0081037 Ga0373940_0081037_24_683 219
1000 3300035090 Ga0373949_0001228 Ga0373949_0001228_1977_2636 219
1001 3300035092 Ga0373952_0001688 Ga0373952_0001688_2951_3610 219
1002 3300035114 Ga0373939_0012040 Ga0373939_0012040_1309_1968 219
1003 3300035115 Ga0373941_0015879 Ga0373941_0015879_414_1073 219
1004 3300035207 Ga0373942_0001685 Ga0373942_0001685_2818_3477 219
1005 3300035241 Ga0373961_0014842 Ga0373961_0014842_1064_1723 219
1006 3300035242 Ga0373962_0000138 Ga0373962_0000138_6694_7353 219
1007 3300035691 Ga0373931_0000239 Ga0373931_0000239_19681_20340 219
1008 3300042439 Ga0439464_0069682 Ga0439464_0069682_61_720 219
1009 3300042461 Ga0439460_0021573 Ga0439460_0021573_26_685 219
1010 3300048903 Ga0496100_0002349 Ga0496100_0002349_8749_9408 219
1011 3300048904 Ga0496101_0000187 Ga0496101_0000187_19300_19959 219
1012 3300048905 Ga0496102_0002906 Ga0496102_0002906_10918_11577 219
1013 3300048906 Ga0496103_0000157 Ga0496103_0000157_18373_19032 219
1014 3300048909 Ga0496106_0006890 Ga0496106_0006890_4872_5531 219
1015 3300048910 Ga0496107_0000805 Ga0496107_0000805_8182_8841 219
1016 3300048911 Ga0496108_0234055 Ga0496108_0234055_82_741 219
1017 3300048912 Ga0496109_0000313 Ga0496109_0000313_17644_18303 219
1018 3300048912 Ga0496109_0001125 Ga0496109_0001125_935_1594 219
1019 3300048914 Ga0496111_0076468 Ga0496111_0076468_394_1053 219
1020 3300048914 Ga0496111_0083795 Ga0496111_0083795_1518_2177 219
1021 3300048915 Ga0496112_0086476 Ga0496112_0086476_898_1557 219
1022 3300048915 Ga0496112_0105664 Ga0496112_0105664_594_1253 219
1023 3300048916 Ga0496113_0012990 Ga0496113_0012990_3751_4410 219
1024 3300048916 Ga0496113_0018069 Ga0496113_0018069_3378_4037 219
1025 3300048917 Ga0496114_0005751 Ga0496114_0005751_804_1463 219
1026 3300048918 Ga0496115_0001217 Ga0496115_0001217_4877_5536 219
1027 3300049571 Ga0501034_0010927 Ga0501034_0010927_1084_1752 219
1028 3300049580 Ga0501046_0350547 Ga0501046_0350547_36_704 219
1029 3300049585 Ga0501069_0051380 Ga0501069_0051380_1593_2261 219
1030 3300049586 Ga0501070_0192200 Ga0501070_0192200_895_1563 219
1031 3300049593 Ga0501077_0150832 Ga0501077_0150832_772_1431 219
1032 3300049742 Ga0501080_0492636 Ga0501080_0492636_293_952 219
1033 3300050494 nmdc:mga06z11_4358_c1 nmdc:mga06z11_4358_c1_2431_3090 219
1034 3300050507 nmdc:mga05p37_45_c1 nmdc:mga05p37_45_c1_18968_19627 219
1035 3300050508 nmdc:mga09592_5654_c1 nmdc:mga09592_5654_c1_3682_4341 219
1036 3300050509 nmdc:mga0qj67_1430_c1 nmdc:mga0qj67_1430_c1_12398_13057 219
1037 3300050510 nmdc:mga06r32_407_c1 nmdc:mga06r32_407_c1_10314_10973 219
1038 3300050511 nmdc:mga08y16_2193_c1 nmdc:mga08y16_2193_c1_2913_3572 219
1039 3300050511 nmdc:mga08y16_792_c1 nmdc:mga08y16_792_c1_10450_11109 219
1040 3300050512 nmdc:mga0n895_1011_c1 nmdc:mga0n895_1011_c1_18743_19402 219
1041 3300050512 nmdc:mga0n895_10668_c1 nmdc:mga0n895_10668_c1_5662_6321 219
1042 3300050513 nmdc:mga0rr50_142289_c1 nmdc:mga0rr50_142289_c1_870_1529 219
1043 3300050513 nmdc:mga0rr50_918_c1 nmdc:mga0rr50_918_c1_989_1648 219
1044 3300050515 nmdc:mga0a205_6158_c1 nmdc:mga0a205_6158_c1_8882_9541 219
1045 3300050515 nmdc:mga0a205_6355_c1 nmdc:mga0a205_6355_c1_2876_3535 219
1046 3300060353 Ga0501082_0105127 Ga0501082_0105127_1065_1724 219

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bnl-assembly1.cif.gz_A zinc dependent dimers observed in crystals of human endostatin 0.717 28 217
1dy0-assembly1.cif.gz_A murine endostatin, crystal form ii 0.711 30 217
1koe-assembly1.cif.gz_A endostatin 0.6885 29 217
1dy2-assembly1.cif.gz_A murine collagen alpha1(xv), endostatin domain 0.6842 29 217
1bnl-assembly1.cif.gz_A zinc dependent dimers observed in crystals of human endostatin 0.6827 28 217
ID Description Score Start End Superfamily
af_G5EGA4_982_1161_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7406 24 217 3.10.100.10
af_M9ND55_829_1006_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7377 30 218 3.10.100.10
af_P39059_1210_1388_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7125 28 219 3.10.100.10
af_G5EGA4_982_1161_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7041 24 217 3.10.100.10
af_M9ND55_829_1006_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.6935 30 218 3.10.100.10
ID Description Score Start End GO Terms
AF-A0A2V6TI47-F1-model_v4 Lectin 0.9855 16 219
AF-A0A1L3LXF0-F1-model_v4 Lectin 0.9663 29 219
AF-A0A528EI03-F1-model_v4 Lectin 0.9661 25 219
AF-A0A560B6C2-F1-model_v4 Lectin 0.9655 29 219
AF-A0A2V6TI47-F1-model_v4 Lectin 0.9621 16 219

Feature Viewer

pLDDT pTM Quality
90.41 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map