F488963
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1046 | 443 | 1042 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0718923|Ga0451577_0718923_72_854 |
| Length | 260 |
| Sequence | LIDERAAEALSCAPGSRELARAMNLRRATMPNSHRQETTMQNTSRIFGPAIAAVLVLALAPAVHAQQSDMSFFVTSTPIGKGADLGGLDGADRHCQSLAAAAGAGGKTWHAYLSTQGAGAVNAKDRIGKGPWKNAKGVVIAKDVAELHGANNLTKQTALTEKGTVVNGRGDTPNMHDIVTGSQADGTAFPAGEDRTCGNYTKSDAGSVMLGHADRTGLDDSAAQKSWTTSHPSRGPGGGCSQDDLKSTGGNGLLYCFATN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 5 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 6 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 8 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 10 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 11 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 12 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 13 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 16 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 17 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 18 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 19 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 20 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 21 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 22 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 23 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 24 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 25 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 26 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 27 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 30 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 31 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 74 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 107 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 108 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 111 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 112 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 122 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 123 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 124 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 125 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 126 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 127 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 128 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 129 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 146 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 147 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 160 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 166 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 246 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 247 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 248 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 249 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 251 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 252 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 253 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 254 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 255 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 256 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 258 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 259 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 260 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 261 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 262 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 263 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 264 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 265 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 266 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 267 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 268 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 269 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 270 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 271 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 272 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 273 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 274 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 279 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 280 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 281 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 282 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 284 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 285 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 287 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 289 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 291 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 292 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 293 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 294 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 296 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 297 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 298 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 301 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 302 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 303 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 304 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 305 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 306 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 307 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 308 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 309 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 310 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 311 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 312 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 313 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 364 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 365 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 366 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 367 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 368 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 369 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 372 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 373 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 374 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 378 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 379 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 380 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 381 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 382 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 406 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 407 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 408 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 409 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 410 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 423 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 425 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 426 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 427 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 428 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 429 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 430 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 431 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 433 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 434 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 435 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 436 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 437 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 438 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 439 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 440 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 441 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.24 |
| Metatranscriptomes | 0.38 |
| Isolates | 0.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.74 |
| Nodule | 0 |
| Rhizoplane | 2.49 |
| Rhizosphere | 88.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214828542 | 2209111006 | Bacteria | 9284 |
| 2 | ARcpr5oldR_c000138 | 3300000041 | Bacteria | 12428 |
| 3 | ARSoilYngRDRAFT_c00004 | 3300000042 | Bacteria | 40941 |
| 4 | ARcpr5yngRDRAFT_c000060 | 3300000043 | Bacteria | 17786 |
| 5 | ARSoilOldRDRAFT_c000133 | 3300000044 | Bacteria | 13213 |
| 6 | ARCol0oldRDRAFT_c00433 | 3300000045 | Bacteria | 3985 |
| 7 | ARCol0yngRDRAFT_1000084 | 3300000652 | Bacteria | 17450 |
| 8 | JGI24741J21665_1015598 | 3300001915 | Bacteria | 1252 |
| 9 | JGI24747J21853_1013193 | 3300001978 | Bacteria | 851 |
| 10 | JGI24737J22298_10000934 | 3300001990 | Bacteria | 10373 |
| 11 | JGI24743J22301_10007855 | 3300001991 | Bacteria | 1859 |
| 12 | JGI24735J21928_10028325 | 3300002067 | Bacteria | 1673 |
| 13 | JGI24750J21931_1000032 | 3300002070 | Bacteria | 18759 |
| 14 | JGI24748J21848_1000782 | 3300002074 | Bacteria | 3449 |
| 15 | JGI24738J21930_10001211 | 3300002075 | Bacteria | 7234 |
| 16 | JGI24749J21850_1003266 | 3300002076 | Bacteria | 2265 |
| 17 | JGI24035J26624_1000066 | 3300002126 | Bacteria | 8330 |
| 18 | JGI24033J26618_1000292 | 3300002155 | Bacteria | 5438 |
| 19 | JGI24034J26672_10000075 | 3300002239 | Bacteria | 23231 |
| 20 | JGI24742J22300_10000054 | 3300002244 | Bacteria | 16914 |
| 21 | JGI24751J29686_10010139 | 3300002459 | Bacteria | 1942 |
| 22 | JGI25152J39213_1005374 | 3300002773 | Bacteria | 3753 |
| 23 | rootH1_10002881 | 3300003323 | Bacteria | 1145 |
| 24 | Ga0055526_1015322 | 3300003771 | Bacteria | 3084 |
| 25 | Ga0058859_11552955 | 3300004798 | Unclassified | 1976 |
| 26 | Ga0058860_10052366 | 3300004801 | Bacteria | 2652 |
| 27 | Ga0065717_1002020 | 3300005276 | Bacteria | 3534 |
| 28 | Ga0065714_10180179 | 3300005288 | Bacteria | 966 |
| 29 | Ga0065704_10072529 | 3300005289 | Bacteria | 8368 |
| 30 | Ga0065715_10089082 | 3300005293 | Bacteria | 14764 |
| 31 | Ga0065707_10127028 | 3300005295 | Bacteria | 1992 |
| 32 | Ga0065707_10255063 | 3300005295 | Bacteria | 1113 |
| 33 | Ga0070676_10000062 | 3300005328 | Bacteria | 35195 |
| 34 | Ga0070683_100000259 | 3300005329 | Bacteria | 36454 |
| 35 | Ga0070683_100069961 | 3300005329 | Bacteria | 3273 |
| 36 | Ga0070683_100112039 | 3300005329 | Bacteria | 2574 |
| 37 | Ga0070690_100001045 | 3300005330 | Bacteria | 14168 |
| 38 | Ga0070690_100040233 | 3300005330 | Bacteria | 2956 |
| 39 | Ga0070690_100175608 | 3300005330 | Bacteria | 1477 |
| 40 | Ga0070690_100361168 | 3300005330 | Bacteria | 1057 |
| 41 | Ga0070690_100375896 | 3300005330 | Bacteria | 1038 |
| 42 | Ga0070670_100007548 | 3300005331 | Bacteria | 9229 |
| 43 | Ga0070670_100008320 | 3300005331 | Bacteria | 8842 |
| 44 | Ga0070670_100019991 | 3300005331 | Bacteria | 5749 |
| 45 | Ga0070670_100054773 | 3300005331 | Bacteria | 3424 |
| 46 | Ga0070670_100061705 | 3300005331 | Bacteria | 3218 |
| 47 | Ga0070670_100102832 | 3300005331 | Bacteria | 2461 |
| 48 | Ga0070677_10000077 | 3300005333 | Bacteria | 31203 |
| 49 | Ga0070677_10000368 | 3300005333 | Bacteria | 15845 |
| 50 | Ga0070677_10073698 | 3300005333 | Bacteria | 1443 |
| 51 | Ga0068869_100000095 | 3300005334 | Bacteria | 41336 |
| 52 | Ga0068869_100006240 | 3300005334 | Bacteria | 7548 |
| 53 | Ga0068869_100159051 | 3300005334 | Bacteria | 1757 |
| 54 | Ga0070666_10003027 | 3300005335 | Bacteria | 10196 |
| 55 | Ga0070666_10032791 | 3300005335 | Bacteria | 3433 |
| 56 | Ga0070666_10382206 | 3300005335 | Bacteria | 1011 |
| 57 | Ga0070680_100001342 | 3300005336 | Bacteria | 17830 |
| 58 | Ga0070680_100023963 | 3300005336 | Bacteria | 4872 |
| 59 | Ga0070680_100102792 | 3300005336 | Bacteria | 2373 |
| 60 | Ga0070680_100250387 | 3300005336 | Bacteria | 1498 |
| 61 | Ga0070682_100000511 | 3300005337 | Bacteria | 24357 |
| 62 | Ga0068868_100000824 | 3300005338 | Bacteria | 21004 |
| 63 | Ga0068868_100009255 | 3300005338 | Bacteria | 7078 |
| 64 | Ga0068868_100045718 | 3300005338 | Bacteria | 3426 |
| 65 | Ga0068868_100376189 | 3300005338 | Bacteria | 1221 |
| 66 | Ga0070660_100000871 | 3300005339 | Bacteria | 20136 |
| 67 | Ga0070660_100057056 | 3300005339 | Bacteria | 3024 |
| 68 | Ga0070660_100230869 | 3300005339 | Bacteria | 1506 |
| 69 | Ga0070660_100355505 | 3300005339 | Bacteria | 1207 |
| 70 | Ga0070689_100006542 | 3300005340 | Bacteria | 8077 |
| 71 | Ga0070689_100081269 | 3300005340 | Bacteria | 2544 |
| 72 | Ga0070689_100156508 | 3300005340 | Bacteria | 1840 |
| 73 | Ga0070691_10014544 | 3300005341 | Bacteria | 3612 |
| 74 | Ga0070687_100000489 | 3300005343 | Bacteria | 13206 |
| 75 | Ga0070687_100091102 | 3300005343 | Bacteria | 1687 |
| 76 | Ga0070661_100000912 | 3300005344 | Bacteria | 21210 |
| 77 | Ga0070661_100001402 | 3300005344 | Bacteria | 16837 |
| 78 | Ga0070661_100059933 | 3300005344 | Bacteria | 2792 |
| 79 | Ga0070661_100251563 | 3300005344 | Bacteria | 1364 |
| 80 | Ga0070692_10002749 | 3300005345 | Bacteria | 6920 |
| 81 | Ga0070692_10132000 | 3300005345 | Bacteria | 1404 |
| 82 | Ga0070668_100001817 | 3300005347 | Bacteria | 15523 |
| 83 | Ga0070668_100004187 | 3300005347 | Bacteria | 10693 |
| 84 | Ga0070668_100018430 | 3300005347 | Bacteria | 5241 |
| 85 | Ga0070668_100039792 | 3300005347 | Bacteria | 3596 |
| 86 | Ga0070668_100041387 | 3300005347 | Bacteria | 3530 |
| 87 | Ga0070668_100087534 | 3300005347 | Bacteria | 2451 |
| 88 | Ga0070668_100141893 | 3300005347 | Bacteria | 1937 |
| 89 | Ga0070669_100000627 | 3300005353 | Bacteria | 26160 |
| 90 | Ga0070669_100052561 | 3300005353 | Bacteria | 2981 |
| 91 | Ga0070669_100059683 | 3300005353 | Bacteria | 2801 |
| 92 | Ga0070669_100268259 | 3300005353 | Bacteria | 1364 |
| 93 | Ga0070669_100632513 | 3300005353 | Bacteria | 899 |
| 94 | Ga0070675_100000231 | 3300005354 | Bacteria | 35826 |
| 95 | Ga0070675_100000524 | 3300005354 | Bacteria | 26172 |
| 96 | Ga0070675_100011178 | 3300005354 | Bacteria | 7024 |
| 97 | Ga0070675_100194073 | 3300005354 | Bacteria | 1760 |
| 98 | Ga0070675_100346138 | 3300005354 | Bacteria | 1317 |
| 99 | Ga0070671_100000689 | 3300005355 | Bacteria | 24261 |
| 100 | Ga0070671_100000935 | 3300005355 | Bacteria | 21361 |
| 101 | Ga0070671_100008470 | 3300005355 | Bacteria | 8241 |
| 102 | Ga0070671_100023761 | 3300005355 | Bacteria | 5018 |
| 103 | Ga0070671_100716796 | 3300005355 | Bacteria | 868 |
| 104 | Ga0070674_100001658 | 3300005356 | Bacteria | 12014 |
| 105 | Ga0070674_100002295 | 3300005356 | Bacteria | 10558 |
| 106 | Ga0070674_100003262 | 3300005356 | Bacteria | 9061 |
| 107 | Ga0070674_100012945 | 3300005356 | Bacteria | 5138 |
| 108 | Ga0070673_100000144 | 3300005364 | Bacteria | 33872 |
| 109 | Ga0070673_100002654 | 3300005364 | Bacteria | 10944 |
| 110 | Ga0070673_100012746 | 3300005364 | Bacteria | 5783 |
| 111 | Ga0070673_100060368 | 3300005364 | Bacteria | 3004 |
| 112 | Ga0070673_100295331 | 3300005364 | Bacteria | 1425 |
| 113 | Ga0070673_100307921 | 3300005364 | Bacteria | 1396 |
| 114 | Ga0070688_100000524 | 3300005365 | Bacteria | 19410 |
| 115 | Ga0070688_100118796 | 3300005365 | Bacteria | 1768 |
| 116 | Ga0070688_100296014 | 3300005365 | Bacteria | 1168 |
| 117 | Ga0070659_100001134 | 3300005366 | Bacteria | 19419 |
| 118 | Ga0070659_100792638 | 3300005366 | Bacteria | 824 |
| 119 | Ga0070667_100008892 | 3300005367 | Bacteria | 8313 |
| 120 | Ga0070667_100071531 | 3300005367 | Bacteria | 2954 |
| 121 | Ga0070667_100103969 | 3300005367 | Bacteria | 2456 |
| 122 | Ga0070667_100154236 | 3300005367 | Bacteria | 2019 |
| 123 | Ga0070667_100241346 | 3300005367 | Bacteria | 1613 |
| 124 | Ga0070703_10003476 | 3300005406 | Bacteria | 4492 |
| 125 | Ga0070714_100097015 | 3300005435 | Bacteria | 2591 |
| 126 | Ga0070710_10141743 | 3300005437 | Bacteria | 1475 |
| 127 | Ga0070701_10000059 | 3300005438 | Bacteria | 29115 |
| 128 | Ga0070705_100000717 | 3300005440 | Bacteria | 18886 |
| 129 | Ga0070705_100039696 | 3300005440 | Bacteria | 2672 |
| 130 | Ga0070705_100214331 | 3300005440 | Bacteria | 1329 |
| 131 | Ga0070705_100621343 | 3300005440 | Bacteria | 839 |
| 132 | Ga0070700_100002047 | 3300005441 | Bacteria | 10242 |
| 133 | Ga0070700_100149013 | 3300005441 | Bacteria | 1598 |
| 134 | Ga0070700_100286538 | 3300005441 | Bacteria | 1196 |
| 135 | Ga0070700_100310730 | 3300005441 | Bacteria | 1154 |
| 136 | Ga0070694_100001020 | 3300005444 | Bacteria | 15907 |
| 137 | Ga0070694_100105214 | 3300005444 | Bacteria | 2002 |
| 138 | Ga0070694_100601952 | 3300005444 | Bacteria | 885 |
| 139 | Ga0070708_100113828 | 3300005445 | Bacteria | 2488 |
| 140 | Ga0070708_100276280 | 3300005445 | Bacteria | 1581 |
| 141 | Ga0070663_100000339 | 3300005455 | Bacteria | 24358 |
| 142 | Ga0070663_100097157 | 3300005455 | Bacteria | 2192 |
| 143 | Ga0070678_100001198 | 3300005456 | Bacteria | 13787 |
| 144 | Ga0070678_100005238 | 3300005456 | Bacteria | 7464 |
| 145 | Ga0070678_100012230 | 3300005456 | Bacteria | 5326 |
| 146 | Ga0070678_100040159 | 3300005456 | Bacteria | 3308 |
| 147 | Ga0070678_100047325 | 3300005456 | Bacteria | 3089 |
| 148 | Ga0070678_100099528 | 3300005456 | Bacteria | 2250 |
| 149 | Ga0070678_100185416 | 3300005456 | Bacteria | 1707 |
| 150 | Ga0070678_100191041 | 3300005456 | Bacteria | 1684 |
| 151 | Ga0070662_100011568 | 3300005457 | Bacteria | 5823 |
| 152 | Ga0070662_100058230 | 3300005457 | Bacteria | 2811 |
| 153 | Ga0070662_100270900 | 3300005457 | Bacteria | 1371 |
| 154 | Ga0070681_10002595 | 3300005458 | Bacteria | 16576 |
| 155 | Ga0070681_10058787 | 3300005458 | Bacteria | 3824 |
| 156 | Ga0070681_10105771 | 3300005458 | Bacteria | 2756 |
| 157 | Ga0070681_10142015 | 3300005458 | Bacteria | 2330 |
| 158 | Ga0070681_10435174 | 3300005458 | Bacteria | 1224 |
| 159 | Ga0068867_100000325 | 3300005459 | Bacteria | 31413 |
| 160 | Ga0068867_100001776 | 3300005459 | Bacteria | 14990 |
| 161 | Ga0068867_100051479 | 3300005459 | Bacteria | 3037 |
| 162 | Ga0068867_100287783 | 3300005459 | Bacteria | 1350 |
| 163 | Ga0068867_100306259 | 3300005459 | Bacteria | 1311 |
| 164 | Ga0070685_10002882 | 3300005466 | Bacteria | 8794 |
| 165 | Ga0070706_100081665 | 3300005467 | Bacteria | 2994 |
| 166 | Ga0070706_100168769 | 3300005467 | Bacteria | 2043 |
| 167 | Ga0070706_100431386 | 3300005467 | Bacteria | 1226 |
| 168 | Ga0070707_100878257 | 3300005468 | Bacteria | 861 |
| 169 | Ga0070699_100275195 | 3300005518 | Bacteria | 1507 |
| 170 | Ga0070679_100001410 | 3300005530 | Bacteria | 21239 |
| 171 | Ga0070684_100000526 | 3300005535 | Bacteria | 26256 |
| 172 | Ga0070684_100047686 | 3300005535 | Bacteria | 3713 |
| 173 | Ga0070684_100079132 | 3300005535 | Bacteria | 2905 |
| 174 | Ga0068853_100002423 | 3300005539 | Bacteria | 13938 |
| 175 | Ga0068853_100018602 | 3300005539 | Bacteria | 5753 |
| 176 | Ga0068853_100024074 | 3300005539 | Bacteria | 5104 |
| 177 | Ga0068853_100426231 | 3300005539 | Bacteria | 1245 |
| 178 | Ga0070672_100000358 | 3300005543 | Bacteria | 26306 |
| 179 | Ga0070672_100000433 | 3300005543 | Bacteria | 24368 |
| 180 | Ga0070672_100001907 | 3300005543 | Bacteria | 13071 |
| 181 | Ga0070672_100004203 | 3300005543 | Bacteria | 9409 |
| 182 | Ga0070672_100009042 | 3300005543 | Bacteria | 6849 |
| 183 | Ga0070672_100009113 | 3300005543 | Bacteria | 6827 |
| 184 | Ga0070686_100000704 | 3300005544 | Bacteria | 19403 |
| 185 | Ga0070686_100091419 | 3300005544 | Bacteria | 2036 |
| 186 | Ga0070695_100019851 | 3300005545 | Bacteria | 4098 |
| 187 | Ga0070695_100058832 | 3300005545 | Bacteria | 2486 |
| 188 | Ga0070695_100666978 | 3300005545 | Bacteria | 823 |
| 189 | Ga0070696_100012571 | 3300005546 | Bacteria | 5684 |
| 190 | Ga0070693_100017619 | 3300005547 | Bacteria | 3716 |
| 191 | Ga0070693_100139929 | 3300005547 | Bacteria | 1522 |
| 192 | Ga0070665_100288832 | 3300005548 | Bacteria | 1642 |
| 193 | Ga0070665_100320009 | 3300005548 | Bacteria | 1555 |
| 194 | Ga0070665_100541176 | 3300005548 | Bacteria | 1176 |
| 195 | Ga0070665_100546888 | 3300005548 | Bacteria | 1170 |
| 196 | Ga0070704_100000341 | 3300005549 | Bacteria | 21211 |
| 197 | Ga0070704_100039605 | 3300005549 | Bacteria | 3237 |
| 198 | Ga0070704_100225941 | 3300005549 | Bacteria | 1524 |
| 199 | Ga0068855_100006286 | 3300005563 | Bacteria | 14478 |
| 200 | Ga0068855_100013126 | 3300005563 | Bacteria | 9992 |
| 201 | Ga0068855_100871674 | 3300005563 | Bacteria | 953 |
| 202 | Ga0070664_100001370 | 3300005564 | Bacteria | 19408 |
| 203 | Ga0070664_100072053 | 3300005564 | Bacteria | 2962 |
| 204 | Ga0070664_100076766 | 3300005564 | Bacteria | 2871 |
| 205 | Ga0070664_100096792 | 3300005564 | Bacteria | 2562 |
| 206 | Ga0070664_100099808 | 3300005564 | Bacteria | 2523 |
| 207 | Ga0070664_100240821 | 3300005564 | Bacteria | 1624 |
| 208 | Ga0068857_100000521 | 3300005577 | Bacteria | 27715 |
| 209 | Ga0068857_100000558 | 3300005577 | Bacteria | 27209 |
| 210 | Ga0068857_100256915 | 3300005577 | Bacteria | 1603 |
| 211 | Ga0068854_100000532 | 3300005578 | Bacteria | 23105 |
| 212 | Ga0068854_100007092 | 3300005578 | Bacteria | 7154 |
| 213 | Ga0068854_100344566 | 3300005578 | Bacteria | 1218 |
| 214 | Ga0068856_100002364 | 3300005614 | Bacteria | 19400 |
| 215 | Ga0068856_100061032 | 3300005614 | Bacteria | 3724 |
| 216 | Ga0068856_100073582 | 3300005614 | Bacteria | 3383 |
| 217 | Ga0070702_100000207 | 3300005615 | Bacteria | 19394 |
| 218 | Ga0068852_100000954 | 3300005616 | Bacteria | 19044 |
| 219 | Ga0068852_100006852 | 3300005616 | Bacteria | 8279 |
| 220 | Ga0068852_100048811 | 3300005616 | Bacteria | 3618 |
| 221 | Ga0068859_100002298 | 3300005617 | Bacteria | 19408 |
| 222 | Ga0068859_100019725 | 3300005617 | Bacteria | 6770 |
| 223 | Ga0068859_100284169 | 3300005617 | Bacteria | 1747 |
| 224 | Ga0068859_100394422 | 3300005617 | Bacteria | 1480 |
| 225 | Ga0068859_100620337 | 3300005617 | Bacteria | 1174 |
| 226 | Ga0068859_100757944 | 3300005617 | Bacteria | 1059 |
| 227 | Ga0068864_100003173 | 3300005618 | Bacteria | 13595 |
| 228 | Ga0068864_100004967 | 3300005618 | Bacteria | 10906 |
| 229 | Ga0068864_100048094 | 3300005618 | Bacteria | 3666 |
| 230 | Ga0068864_100097466 | 3300005618 | Bacteria | 2603 |
| 231 | Ga0068864_100281229 | 3300005618 | Bacteria | 1553 |
| 232 | Ga0068864_100764493 | 3300005618 | Bacteria | 948 |
| 233 | Ga0068864_100846264 | 3300005618 | Unclassified | 901 |
| 234 | Ga0068866_10000912 | 3300005718 | Bacteria | 12955 |
| 235 | Ga0068861_100000416 | 3300005719 | Bacteria | 24700 |
| 236 | Ga0068861_100018282 | 3300005719 | Bacteria | 4992 |
| 237 | Ga0068861_100127963 | 3300005719 | Bacteria | 2058 |
| 238 | Ga0068861_100172952 | 3300005719 | Bacteria | 1791 |
| 239 | Ga0068861_100674498 | 3300005719 | Bacteria | 958 |
| 240 | Ga0068851_10037574 | 3300005834 | Bacteria | 2428 |
| 241 | Ga0068851_10041248 | 3300005834 | Bacteria | 2320 |
| 242 | Ga0068851_10048291 | 3300005834 | Bacteria | 2157 |
| 243 | Ga0068851_10176076 | 3300005834 | Bacteria | 1183 |
| 244 | Ga0068870_10000034 | 3300005840 | Bacteria | 43913 |
| 245 | Ga0068870_10117303 | 3300005840 | Bacteria | 1528 |
| 246 | Ga0068863_100002182 | 3300005841 | Bacteria | 19408 |
| 247 | Ga0068863_100093442 | 3300005841 | Bacteria | 2854 |
| 248 | Ga0068863_100097753 | 3300005841 | Bacteria | 2788 |
| 249 | Ga0068863_100105059 | 3300005841 | Bacteria | 2687 |
| 250 | Ga0068863_100792730 | 3300005841 | Bacteria | 945 |
| 251 | Ga0068858_100004013 | 3300005842 | Bacteria | 14517 |
| 252 | Ga0068858_100128549 | 3300005842 | Bacteria | 2374 |
| 253 | Ga0068858_100620650 | 3300005842 | Bacteria | 1050 |
| 254 | Ga0068860_100008063 | 3300005843 | Bacteria | 10495 |
| 255 | Ga0068860_100048446 | 3300005843 | Bacteria | 4050 |
| 256 | Ga0068860_100057315 | 3300005843 | Bacteria | 3703 |
| 257 | Ga0068860_100069835 | 3300005843 | Bacteria | 3339 |
| 258 | Ga0068860_100081432 | 3300005843 | Bacteria | 3078 |
| 259 | Ga0068860_100322876 | 3300005843 | Bacteria | 1515 |
| 260 | Ga0068860_100655696 | 3300005843 | Bacteria | 1058 |
| 261 | Ga0068862_100001525 | 3300005844 | Bacteria | 21219 |
| 262 | Ga0068862_100004818 | 3300005844 | Bacteria | 11361 |
| 263 | Ga0068862_100053036 | 3300005844 | Bacteria | 3471 |
| 264 | Ga0068862_100123082 | 3300005844 | Bacteria | 2288 |
| 265 | Ga0068862_100218847 | 3300005844 | Bacteria | 1723 |
| 266 | Ga0081455_10000204 | 3300005937 | Bacteria | 75793 |
| 267 | Ga0081455_10005710 | 3300005937 | Bacteria | 13577 |
| 268 | Ga0081538_10003120 | 3300005981 | Bacteria | 15750 |
| 269 | Ga0081538_10043104 | 3300005981 | Bacteria | 2838 |
| 270 | Ga0081540_1021931 | 3300005983 | Bacteria | 3783 |
| 271 | Ga0081539_10003651 | 3300005985 | Bacteria | 18515 |
| 272 | Ga0075365_10004100 | 3300006038 | Bacteria | 7659 |
| 273 | Ga0075365_10074403 | 3300006038 | Bacteria | 2291 |
| 274 | Ga0075365_10192936 | 3300006038 | Bacteria | 1426 |
| 275 | Ga0075368_10001078 | 3300006042 | Bacteria | 8545 |
| 276 | Ga0075368_10029548 | 3300006042 | Bacteria | 2119 |
| 277 | Ga0075364_10068119 | 3300006051 | Bacteria | 2340 |
| 278 | Ga0075364_10331685 | 3300006051 | Bacteria | 1036 |
| 279 | Ga0075432_10002270 | 3300006058 | Bacteria | 6395 |
| 280 | Ga0070712_100916821 | 3300006175 | Bacteria | 756 |
| 281 | Ga0075362_10065976 | 3300006177 | Bacteria | 1644 |
| 282 | Ga0075367_10028577 | 3300006178 | Bacteria | 3183 |
| 283 | Ga0075367_10031593 | 3300006178 | Bacteria | 3041 |
| 284 | Ga0075367_10034846 | 3300006178 | Bacteria | 2910 |
| 285 | Ga0075367_10063896 | 3300006178 | Bacteria | 2201 |
| 286 | Ga0075427_10002073 | 3300006194 | Bacteria | 2655 |
| 287 | Ga0075366_10061603 | 3300006195 | Bacteria | 2230 |
| 288 | Ga0075366_10329829 | 3300006195 | Bacteria | 935 |
| 289 | Ga0097621_100000010 | 3300006237 | Bacteria | 112867 |
| 290 | Ga0097621_100052380 | 3300006237 | Bacteria | 3325 |
| 291 | Ga0075370_10015066 | 3300006353 | Bacteria | 4133 |
| 292 | Ga0075370_10017847 | 3300006353 | Bacteria | 3839 |
| 293 | Ga0068871_100000193 | 3300006358 | Bacteria | 41878 |
| 294 | Ga0068871_100018026 | 3300006358 | Bacteria | 5358 |
| 295 | Ga0068871_100054187 | 3300006358 | Bacteria | 3253 |
| 296 | Ga0068871_100055683 | 3300006358 | Bacteria | 3211 |
| 297 | Ga0068871_100055704 | 3300006358 | Bacteria | 3211 |
| 298 | Ga0068871_100324958 | 3300006358 | Bacteria | 1356 |
| 299 | Ga0075428_100021307 | 3300006844 | Bacteria | 7176 |
| 300 | Ga0075428_100046620 | 3300006844 | Bacteria | 4760 |
| 301 | Ga0075428_100153765 | 3300006844 | Bacteria | 2499 |
| 302 | Ga0075428_100177449 | 3300006844 | Bacteria | 2307 |
| 303 | Ga0075428_100185745 | 3300006844 | Bacteria | 2249 |
| 304 | Ga0075430_100000112 | 3300006846 | Bacteria | 48871 |
| 305 | Ga0075430_100026999 | 3300006846 | Bacteria | 4883 |
| 306 | Ga0075430_100348418 | 3300006846 | Bacteria | 1223 |
| 307 | Ga0075430_100364924 | 3300006846 | Unclassified | 1192 |
| 308 | Ga0075431_100004280 | 3300006847 | Bacteria | 13986 |
| 309 | Ga0075431_100168059 | 3300006847 | Bacteria | 2254 |
| 310 | Ga0075431_100176379 | 3300006847 | Bacteria | 2195 |
| 311 | Ga0075431_100205794 | 3300006847 | Bacteria | 2012 |
| 312 | Ga0075431_100224512 | 3300006847 | Bacteria | 1915 |
| 313 | Ga0075431_100307511 | 3300006847 | Bacteria | 1601 |
| 314 | Ga0075431_100681393 | 3300006847 | Bacteria | 1007 |
| 315 | Ga0075433_10000639 | 3300006852 | Bacteria | 23475 |
| 316 | Ga0075433_10016732 | 3300006852 | Bacteria | 6054 |
| 317 | Ga0075433_10028231 | 3300006852 | Bacteria | 4769 |
| 318 | Ga0075433_10069403 | 3300006852 | Bacteria | 3096 |
| 319 | Ga0075433_10830418 | 3300006852 | Bacteria | 807 |
| 320 | Ga0075434_100000661 | 3300006871 | Bacteria | 26715 |
| 321 | Ga0075434_100001173 | 3300006871 | Bacteria | 21711 |
| 322 | Ga0075434_100015291 | 3300006871 | Bacteria | 7354 |
| 323 | Ga0075434_100018111 | 3300006871 | Bacteria | 6796 |
| 324 | Ga0075434_100280483 | 3300006871 | Bacteria | 1686 |
| 325 | Ga0075429_100000479 | 3300006880 | Bacteria | 29848 |
| 326 | Ga0075429_100010700 | 3300006880 | Bacteria | 7936 |
| 327 | Ga0075429_100067370 | 3300006880 | Bacteria | 3115 |
| 328 | Ga0075429_100126110 | 3300006880 | Bacteria | 2238 |
| 329 | Ga0075429_100228267 | 3300006880 | Bacteria | 1631 |
| 330 | Ga0068865_100000252 | 3300006881 | Bacteria | 29599 |
| 331 | Ga0068865_100057899 | 3300006881 | Bacteria | 2705 |
| 332 | Ga0075436_100058363 | 3300006914 | Bacteria | 2665 |
| 333 | Ga0097620_100002298 | 3300006931 | Bacteria | 19408 |
| 334 | Ga0097620_100019727 | 3300006931 | Bacteria | 6770 |
| 335 | Ga0097620_100284156 | 3300006931 | Bacteria | 1747 |
| 336 | Ga0097620_100394410 | 3300006931 | Bacteria | 1480 |
| 337 | Ga0097620_100620307 | 3300006931 | Bacteria | 1174 |
| 338 | Ga0097620_100757915 | 3300006931 | Bacteria | 1059 |
| 339 | Ga0075435_100029917 | 3300007076 | Bacteria | 4278 |
| 340 | Ga0075435_100048782 | 3300007076 | Bacteria | 3403 |
| 341 | Ga0075435_100093896 | 3300007076 | Bacteria | 2479 |
| 342 | Ga0075435_100154525 | 3300007076 | Bacteria | 1930 |
| 343 | Ga0075435_100747087 | 3300007076 | Bacteria | 851 |
| 344 | Ga0105240_10042779 | 3300009093 | Bacteria | 5770 |
| 345 | Ga0105240_10289082 | 3300009093 | Bacteria | 1880 |
| 346 | Ga0111539_10003320 | 3300009094 | Bacteria | 21239 |
| 347 | Ga0111539_10004062 | 3300009094 | Bacteria | 19220 |
| 348 | Ga0111539_10005715 | 3300009094 | Bacteria | 16085 |
| 349 | Ga0111539_10088435 | 3300009094 | Bacteria | 3640 |
| 350 | Ga0111539_10103969 | 3300009094 | Bacteria | 3333 |
| 351 | Ga0105247_10001439 | 3300009101 | Bacteria | 17243 |
| 352 | Ga0114129_10004085 | 3300009147 | Bacteria | 20622 |
| 353 | Ga0114129_10010935 | 3300009147 | Bacteria | 12932 |
| 354 | Ga0114129_10025348 | 3300009147 | Bacteria | 8403 |
| 355 | Ga0114129_10055021 | 3300009147 | Bacteria | 5577 |
| 356 | Ga0114129_10066913 | 3300009147 | Bacteria | 5010 |
| 357 | Ga0114129_10129972 | 3300009147 | Bacteria | 3460 |
| 358 | Ga0114129_10142943 | 3300009147 | Bacteria | 3278 |
| 359 | Ga0114129_10437738 | 3300009147 | Bacteria | 1717 |
| 360 | Ga0114129_10818454 | 3300009147 | Bacteria | 1187 |
| 361 | Ga0105243_10002371 | 3300009148 | Bacteria | 15770 |
| 362 | Ga0105241_10000770 | 3300009174 | Bacteria | 24359 |
| 363 | Ga0105241_10252539 | 3300009174 | Bacteria | 1496 |
| 364 | Ga0105242_10002422 | 3300009176 | Bacteria | 14653 |
| 365 | Ga0105242_10934804 | 3300009176 | Bacteria | 870 |
| 366 | Ga0105248_10002790 | 3300009177 | Bacteria | 19413 |
| 367 | Ga0105248_10008272 | 3300009177 | Bacteria | 11429 |
| 368 | Ga0105248_10093446 | 3300009177 | Bacteria | 3387 |
| 369 | Ga0105248_10242071 | 3300009177 | Bacteria | 2031 |
| 370 | Ga0105248_10277453 | 3300009177 | Bacteria | 1887 |
| 371 | Ga0105237_10013310 | 3300009545 | Bacteria | 8629 |
| 372 | Ga0105237_10149771 | 3300009545 | Bacteria | 2329 |
| 373 | Ga0105237_10167776 | 3300009545 | Bacteria | 2195 |
| 374 | Ga0105237_10234058 | 3300009545 | Bacteria | 1838 |
| 375 | Ga0105238_10054770 | 3300009551 | Bacteria | 4005 |
| 376 | Ga0105238_10104413 | 3300009551 | Bacteria | 2814 |
| 377 | Ga0105249_10001686 | 3300009553 | Bacteria | 19382 |
| 378 | Ga0105249_10048918 | 3300009553 | Bacteria | 3855 |
| 379 | Ga0105249_10502274 | 3300009553 | Bacteria | 1258 |
| 380 | Ga0099796_10018269 | 3300010159 | Bacteria | 2102 |
| 381 | Ga0105239_10032940 | 3300010375 | Bacteria | 5693 |
| 382 | Ga0105239_10297547 | 3300010375 | Bacteria | 1817 |
| 383 | Ga0105246_10000081 | 3300011119 | Bacteria | 40525 |
| 384 | Ga0105246_10379094 | 3300011119 | Bacteria | 1168 |
| 385 | Ga0157344_1000345 | 3300012476 | Bacteria | 1741 |
| 386 | Ga0157335_1001295 | 3300012492 | Bacteria | 1346 |
| 387 | Ga0157341_1000159 | 3300012494 | Bacteria | 3005 |
| 388 | Ga0157373_10012612 | 3300013100 | Bacteria | 6213 |
| 389 | Ga0157373_10058688 | 3300013100 | Bacteria | 2727 |
| 390 | Ga0157371_10020506 | 3300013102 | Bacteria | 4864 |
| 391 | Ga0157371_10164913 | 3300013102 | Bacteria | 1582 |
| 392 | Ga0157371_10198703 | 3300013102 | Bacteria | 1437 |
| 393 | Ga0157370_10580206 | 3300013104 | Bacteria | 1027 |
| 394 | Ga0157369_10002671 | 3300013105 | Bacteria | 21264 |
| 395 | Ga0157374_10009607 | 3300013296 | Bacteria | 8309 |
| 396 | Ga0157374_10027881 | 3300013296 | Bacteria | 5099 |
| 397 | Ga0157374_10120006 | 3300013296 | Bacteria | 2536 |
| 398 | Ga0157374_10455124 | 3300013296 | Bacteria | 1281 |
| 399 | Ga0157378_10000990 | 3300013297 | Bacteria | 26013 |
| 400 | Ga0157378_10091118 | 3300013297 | Bacteria | 2771 |
| 401 | Ga0157378_10215132 | 3300013297 | Bacteria | 1824 |
| 402 | Ga0157378_10575632 | 3300013297 | Bacteria | 1134 |
| 403 | Ga0157378_10742239 | 3300013297 | Bacteria | 1004 |
| 404 | Ga0157378_10814204 | 3300013297 | Bacteria | 960 |
| 405 | Ga0163162_10005170 | 3300013306 | Bacteria | 12583 |
| 406 | Ga0163162_10217636 | 3300013306 | Bacteria | 2040 |
| 407 | Ga0163162_11619450 | 3300013306 | Bacteria | 739 |
| 408 | Ga0157372_10012072 | 3300013307 | Bacteria | 9200 |
| 409 | Ga0157372_10016190 | 3300013307 | Bacteria | 8000 |
| 410 | Ga0157372_10132940 | 3300013307 | Bacteria | 2864 |
| 411 | Ga0157375_10000944 | 3300013308 | Bacteria | 25192 |
| 412 | Ga0157375_10002393 | 3300013308 | Bacteria | 16235 |
| 413 | Ga0157375_10033432 | 3300013308 | Bacteria | 4887 |
| 414 | Ga0157375_10108398 | 3300013308 | Bacteria | 2872 |
| 415 | Ga0157375_10129377 | 3300013308 | Bacteria | 2643 |
| 416 | Ga0157375_10180892 | 3300013308 | Bacteria | 2260 |
| 417 | Ga0157375_10375468 | 3300013308 | Bacteria | 1588 |
| 418 | Ga0157375_10949582 | 3300013308 | Bacteria | 1002 |
| 419 | Ga0163163_10010654 | 3300014325 | Bacteria | 8286 |
| 420 | Ga0163163_10032566 | 3300014325 | Bacteria | 5035 |
| 421 | Ga0163163_10507948 | 3300014325 | Bacteria | 1267 |
| 422 | Ga0163163_10586986 | 3300014325 | Bacteria | 1177 |
| 423 | Ga0163163_10903823 | 3300014325 | Bacteria | 946 |
| 424 | Ga0157380_10000321 | 3300014326 | Bacteria | 28973 |
| 425 | Ga0157380_10097037 | 3300014326 | Bacteria | 2445 |
| 426 | Ga0157380_10116040 | 3300014326 | Bacteria | 2259 |
| 427 | Ga0182008_10101751 | 3300014497 | Bacteria | 1420 |
| 428 | Ga0157379_10039887 | 3300014968 | Bacteria | 4190 |
| 429 | Ga0157379_10118758 | 3300014968 | Bacteria | 2378 |
| 430 | Ga0157379_10424071 | 3300014968 | Bacteria | 1225 |
| 431 | Ga0157379_10905851 | 3300014968 | Bacteria | 837 |
| 432 | Ga0157376_10000098 | 3300014969 | Bacteria | 63149 |
| 433 | Ga0157376_10047593 | 3300014969 | Bacteria | 3541 |
| 434 | Ga0157376_10098987 | 3300014969 | Bacteria | 2543 |
| 435 | Ga0157376_10329793 | 3300014969 | Bacteria | 1454 |
| 436 | Ga0163161_10000866 | 3300017792 | Bacteria | 23560 |
| 437 | Ga0163161_10006805 | 3300017792 | Bacteria | 7904 |
| 438 | Ga0163161_10025174 | 3300017792 | Bacteria | 4210 |
| 439 | Ga0163161_10045283 | 3300017792 | Bacteria | 3172 |
| 440 | Ga0206354_11042258 | 3300020081 | Bacteria | 1068 |
| 441 | Ga0206353_12052891 | 3300020082 | Bacteria | 1136 |
| 442 | Ga0213876_10155915 | 3300021384 | Bacteria | 1215 |
| 443 | Ga0209129_1000326 | 3300025258 | Bacteria | 41836 |
| 444 | Ga0209233_1023062 | 3300025261 | Bacteria | 1583 |
| 445 | Ga0207666_1000027 | 3300025271 | Bacteria | 33321 |
| 446 | Ga0209673_1051683 | 3300025273 | Bacteria | 1083 |
| 447 | Ga0209564_1000057 | 3300025295 | Bacteria | 340400 |
| 448 | Ga0209758_1000096 | 3300025297 | Bacteria | 231496 |
| 449 | Ga0209758_1000174 | 3300025297 | Bacteria | 147347 |
| 450 | Ga0209050_1016098 | 3300025298 | Bacteria | 3084 |
| 451 | Ga0207697_10000553 | 3300025315 | Bacteria | 21216 |
| 452 | Ga0207697_10043527 | 3300025315 | Bacteria | 1846 |
| 453 | Ga0207697_10054565 | 3300025315 | Bacteria | 1656 |
| 454 | Ga0207656_10129249 | 3300025321 | Bacteria | 1182 |
| 455 | Ga0207653_10002753 | 3300025885 | Bacteria | 5592 |
| 456 | Ga0207653_10093539 | 3300025885 | Bacteria | 1055 |
| 457 | Ga0207682_10000006 | 3300025893 | Bacteria | 94953 |
| 458 | Ga0207682_10000122 | 3300025893 | Bacteria | 35790 |
| 459 | Ga0207682_10015241 | 3300025893 | Bacteria | 2992 |
| 460 | Ga0207682_10113471 | 3300025893 | Bacteria | 1195 |
| 461 | Ga0207642_10000107 | 3300025899 | Bacteria | 22438 |
| 462 | Ga0207642_10008252 | 3300025899 | Bacteria | 3562 |
| 463 | Ga0207710_10000632 | 3300025900 | Bacteria | 20218 |
| 464 | Ga0207688_10000205 | 3300025901 | Bacteria | 26409 |
| 465 | Ga0207680_10028658 | 3300025903 | Bacteria | 3118 |
| 466 | Ga0207680_10076733 | 3300025903 | Bacteria | 2087 |
| 467 | Ga0207680_10085030 | 3300025903 | Bacteria | 1997 |
| 468 | Ga0207680_10108104 | 3300025903 | Bacteria | 1799 |
| 469 | Ga0207647_10067576 | 3300025904 | Bacteria | 2166 |
| 470 | Ga0207647_10117406 | 3300025904 | Bacteria | 1570 |
| 471 | Ga0207647_10133908 | 3300025904 | Bacteria | 1455 |
| 472 | Ga0207699_10019646 | 3300025906 | Bacteria | 3608 |
| 473 | Ga0207645_10000023 | 3300025907 | Bacteria | 98724 |
| 474 | Ga0207645_10000063 | 3300025907 | Bacteria | 76658 |
| 475 | Ga0207645_10091642 | 3300025907 | Bacteria | 1955 |
| 476 | Ga0207645_10131063 | 3300025907 | Bacteria | 1632 |
| 477 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 478 | Ga0207643_10006191 | 3300025908 | Bacteria | 6404 |
| 479 | Ga0207643_10122334 | 3300025908 | Bacteria | 1542 |
| 480 | Ga0207643_10156866 | 3300025908 | Bacteria | 1367 |
| 481 | Ga0207705_10104709 | 3300025909 | Bacteria | 2085 |
| 482 | Ga0207684_10020525 | 3300025910 | Bacteria | 5645 |
| 483 | Ga0207684_10285449 | 3300025910 | Bacteria | 1423 |
| 484 | Ga0207684_10290266 | 3300025910 | Bacteria | 1410 |
| 485 | Ga0207684_10373988 | 3300025910 | Bacteria | 1226 |
| 486 | Ga0207654_10001016 | 3300025911 | Bacteria | 15352 |
| 487 | Ga0207707_10000786 | 3300025912 | Bacteria | 31086 |
| 488 | Ga0207707_10026873 | 3300025912 | Bacteria | 5030 |
| 489 | Ga0207707_10062947 | 3300025912 | Bacteria | 3229 |
| 490 | Ga0207707_10130681 | 3300025912 | Bacteria | 2196 |
| 491 | Ga0207707_10245998 | 3300025912 | Bacteria | 1554 |
| 492 | Ga0207707_10376271 | 3300025912 | Bacteria | 1221 |
| 493 | Ga0207695_10021722 | 3300025913 | Bacteria | 7315 |
| 494 | Ga0207695_10070670 | 3300025913 | Bacteria | 3567 |
| 495 | Ga0207671_10058655 | 3300025914 | Bacteria | 2854 |
| 496 | Ga0207671_10194970 | 3300025914 | Bacteria | 1580 |
| 497 | Ga0207671_10751091 | 3300025914 | Unclassified | 775 |
| 498 | Ga0207660_10000058 | 3300025917 | Bacteria | 56791 |
| 499 | Ga0207660_10057376 | 3300025917 | Bacteria | 2789 |
| 500 | Ga0207660_10354010 | 3300025917 | Bacteria | 1177 |
| 501 | Ga0207662_10000896 | 3300025918 | Bacteria | 13794 |
| 502 | Ga0207662_10173270 | 3300025918 | Bacteria | 1385 |
| 503 | Ga0207662_10190196 | 3300025918 | Bacteria | 1324 |
| 504 | Ga0207657_10002630 | 3300025919 | Bacteria | 19398 |
| 505 | Ga0207657_10059084 | 3300025919 | Bacteria | 3297 |
| 506 | Ga0207657_10241770 | 3300025919 | Bacteria | 1441 |
| 507 | Ga0207649_10000384 | 3300025920 | Bacteria | 33073 |
| 508 | Ga0207649_10005635 | 3300025920 | Bacteria | 6776 |
| 509 | Ga0207652_10000377 | 3300025921 | Bacteria | 46255 |
| 510 | Ga0207681_10000100 | 3300025923 | Bacteria | 72913 |
| 511 | Ga0207681_10001984 | 3300025923 | Bacteria | 13141 |
| 512 | Ga0207681_10035031 | 3300025923 | Bacteria | 3306 |
| 513 | Ga0207681_10126883 | 3300025923 | Bacteria | 1880 |
| 514 | Ga0207681_10163502 | 3300025923 | Bacteria | 1680 |
| 515 | Ga0207681_10169593 | 3300025923 | Bacteria | 1653 |
| 516 | Ga0207694_10039684 | 3300025924 | Bacteria | 3623 |
| 517 | Ga0207650_10000274 | 3300025925 | Bacteria | 54226 |
| 518 | Ga0207650_10021279 | 3300025925 | Bacteria | 4584 |
| 519 | Ga0207650_10038763 | 3300025925 | Bacteria | 3482 |
| 520 | Ga0207650_10092631 | 3300025925 | Bacteria | 2312 |
| 521 | Ga0207650_10159659 | 3300025925 | Bacteria | 1785 |
| 522 | Ga0207650_10777379 | 3300025925 | Bacteria | 811 |
| 523 | Ga0207659_10000044 | 3300025926 | Bacteria | 88759 |
| 524 | Ga0207659_10001802 | 3300025926 | Bacteria | 12671 |
| 525 | Ga0207659_10004273 | 3300025926 | Bacteria | 8637 |
| 526 | Ga0207659_10203019 | 3300025926 | Bacteria | 1584 |
| 527 | Ga0207687_10001241 | 3300025927 | Bacteria | 17449 |
| 528 | Ga0207700_10126910 | 3300025928 | Bacteria | 2077 |
| 529 | Ga0207664_10011801 | 3300025929 | Bacteria | 6228 |
| 530 | Ga0207644_10000690 | 3300025931 | Bacteria | 21367 |
| 531 | Ga0207644_10004596 | 3300025931 | Bacteria | 8977 |
| 532 | Ga0207644_10014495 | 3300025931 | Bacteria | 5272 |
| 533 | Ga0207644_10180703 | 3300025931 | Bacteria | 1653 |
| 534 | Ga0207644_10756420 | 3300025931 | Bacteria | 812 |
| 535 | Ga0207690_10000601 | 3300025932 | Bacteria | 23359 |
| 536 | Ga0207690_10252935 | 3300025932 | Bacteria | 1362 |
| 537 | Ga0207706_10001769 | 3300025933 | Bacteria | 21216 |
| 538 | Ga0207706_10184470 | 3300025933 | Bacteria | 1832 |
| 539 | Ga0207706_10210632 | 3300025933 | Bacteria | 1704 |
| 540 | Ga0207706_10278191 | 3300025933 | Bacteria | 1460 |
| 541 | Ga0207686_10000222 | 3300025934 | Bacteria | 43531 |
| 542 | Ga0207709_10000154 | 3300025935 | Bacteria | 93456 |
| 543 | Ga0207670_10000129 | 3300025936 | Bacteria | 49928 |
| 544 | Ga0207670_10159585 | 3300025936 | Bacteria | 1682 |
| 545 | Ga0207669_10000160 | 3300025937 | Bacteria | 32152 |
| 546 | Ga0207669_10052574 | 3300025937 | Bacteria | 2448 |
| 547 | Ga0207669_10132916 | 3300025937 | Bacteria | 1713 |
| 548 | Ga0207669_10161723 | 3300025937 | Bacteria | 1582 |
| 549 | Ga0207669_10191086 | 3300025937 | Bacteria | 1477 |
| 550 | Ga0207704_10128918 | 3300025938 | Bacteria | 1747 |
| 551 | Ga0207704_10497974 | 3300025938 | Bacteria | 981 |
| 552 | Ga0207691_10000050 | 3300025940 | Bacteria | 94763 |
| 553 | Ga0207691_10000405 | 3300025940 | Bacteria | 43134 |
| 554 | Ga0207691_10000494 | 3300025940 | Bacteria | 39257 |
| 555 | Ga0207691_10003496 | 3300025940 | Bacteria | 15284 |
| 556 | Ga0207691_10023336 | 3300025940 | Bacteria | 5823 |
| 557 | Ga0207691_10024298 | 3300025940 | Bacteria | 5699 |
| 558 | Ga0207691_10096509 | 3300025940 | Bacteria | 2643 |
| 559 | Ga0207711_10006895 | 3300025941 | Bacteria | 9539 |
| 560 | Ga0207711_10038504 | 3300025941 | Bacteria | 4067 |
| 561 | Ga0207711_10056663 | 3300025941 | Bacteria | 3368 |
| 562 | Ga0207711_10274935 | 3300025941 | Bacteria | 1550 |
| 563 | Ga0207711_10322428 | 3300025941 | Bacteria | 1428 |
| 564 | Ga0207689_10000098 | 3300025942 | Bacteria | 69773 |
| 565 | Ga0207689_10004462 | 3300025942 | Bacteria | 12690 |
| 566 | Ga0207689_10146973 | 3300025942 | Bacteria | 1942 |
| 567 | Ga0207689_10513950 | 3300025942 | Bacteria | 1004 |
| 568 | Ga0207661_10000178 | 3300025944 | Bacteria | 41008 |
| 569 | Ga0207661_10000576 | 3300025944 | Bacteria | 23427 |
| 570 | Ga0207661_10079917 | 3300025944 | Bacteria | 2696 |
| 571 | Ga0207661_10154952 | 3300025944 | Bacteria | 1983 |
| 572 | Ga0207661_10484716 | 3300025944 | Bacteria | 1129 |
| 573 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 574 | Ga0207679_10002734 | 3300025945 | Bacteria | 10908 |
| 575 | Ga0207679_10117306 | 3300025945 | Bacteria | 2112 |
| 576 | Ga0207679_10141454 | 3300025945 | Bacteria | 1945 |
| 577 | Ga0207667_10003212 | 3300025949 | Bacteria | 20183 |
| 578 | Ga0207667_10049074 | 3300025949 | Bacteria | 4461 |
| 579 | Ga0207667_10108943 | 3300025949 | Bacteria | 2857 |
| 580 | Ga0207667_10440914 | 3300025949 | Bacteria | 1324 |
| 581 | Ga0207651_10000031 | 3300025960 | Bacteria | 66688 |
| 582 | Ga0207651_10001168 | 3300025960 | Bacteria | 11757 |
| 583 | Ga0207651_10001963 | 3300025960 | Bacteria | 9673 |
| 584 | Ga0207651_10007821 | 3300025960 | Bacteria | 5722 |
| 585 | Ga0207712_10000129 | 3300025961 | Bacteria | 79246 |
| 586 | Ga0207712_10031710 | 3300025961 | Bacteria | 3562 |
| 587 | Ga0207712_10098538 | 3300025961 | Bacteria | 2168 |
| 588 | Ga0207712_10110049 | 3300025961 | Unclassified | 2065 |
| 589 | Ga0207668_10000158 | 3300025972 | Bacteria | 47189 |
| 590 | Ga0207668_10011562 | 3300025972 | Bacteria | 5369 |
| 591 | Ga0207668_10077299 | 3300025972 | Bacteria | 2399 |
| 592 | Ga0207668_10085635 | 3300025972 | Bacteria | 2300 |
| 593 | Ga0207668_10151481 | 3300025972 | Bacteria | 1796 |
| 594 | Ga0207668_10657839 | 3300025972 | Bacteria | 917 |
| 595 | Ga0207640_10000168 | 3300025981 | Bacteria | 47588 |
| 596 | Ga0207640_10005748 | 3300025981 | Bacteria | 6758 |
| 597 | Ga0207640_10182772 | 3300025981 | Bacteria | 1574 |
| 598 | Ga0207640_10348715 | 3300025981 | Bacteria | 1189 |
| 599 | Ga0207640_10445096 | 3300025981 | Bacteria | 1066 |
| 600 | Ga0207658_10000655 | 3300025986 | Bacteria | 30194 |
| 601 | Ga0207658_10009288 | 3300025986 | Bacteria | 6669 |
| 602 | Ga0207658_10072411 | 3300025986 | Bacteria | 2612 |
| 603 | Ga0207658_10105408 | 3300025986 | Bacteria | 2217 |
| 604 | Ga0207658_10225789 | 3300025986 | Bacteria | 1578 |
| 605 | Ga0207677_10000553 | 3300026023 | Bacteria | 23608 |
| 606 | Ga0207677_10004591 | 3300026023 | Bacteria | 7428 |
| 607 | Ga0207677_10333989 | 3300026023 | Bacteria | 1264 |
| 608 | Ga0207677_10361291 | 3300026023 | Bacteria | 1220 |
| 609 | Ga0207677_10602786 | 3300026023 | Bacteria | 964 |
| 610 | Ga0207703_10000631 | 3300026035 | Bacteria | 35469 |
| 611 | Ga0207703_10383940 | 3300026035 | Bacteria | 1300 |
| 612 | Ga0207639_10001591 | 3300026041 | Bacteria | 15257 |
| 613 | Ga0207639_10051592 | 3300026041 | Bacteria | 3129 |
| 614 | Ga0207639_10055034 | 3300026041 | Bacteria | 3043 |
| 615 | Ga0207639_10271729 | 3300026041 | Bacteria | 1487 |
| 616 | Ga0207678_10001139 | 3300026067 | Bacteria | 24368 |
| 617 | Ga0207678_10004837 | 3300026067 | Bacteria | 12095 |
| 618 | Ga0207678_10470148 | 3300026067 | Bacteria | 1094 |
| 619 | Ga0207708_10000660 | 3300026075 | Bacteria | 26442 |
| 620 | Ga0207708_10031895 | 3300026075 | Bacteria | 4001 |
| 621 | Ga0207708_10197342 | 3300026075 | Bacteria | 1604 |
| 622 | Ga0207708_10285256 | 3300026075 | Bacteria | 1339 |
| 623 | Ga0207702_10000404 | 3300026078 | Bacteria | 49177 |
| 624 | Ga0207702_10014696 | 3300026078 | Bacteria | 6495 |
| 625 | Ga0207702_10147535 | 3300026078 | Bacteria | 2136 |
| 626 | Ga0207641_10000520 | 3300026088 | Bacteria | 43187 |
| 627 | Ga0207641_10008171 | 3300026088 | Bacteria | 8660 |
| 628 | Ga0207641_10010886 | 3300026088 | Bacteria | 7452 |
| 629 | Ga0207641_10145849 | 3300026088 | Bacteria | 2140 |
| 630 | Ga0207641_10294196 | 3300026088 | Bacteria | 1531 |
| 631 | Ga0207648_10000072 | 3300026089 | Bacteria | 94957 |
| 632 | Ga0207648_10047268 | 3300026089 | Bacteria | 3773 |
| 633 | Ga0207648_10055433 | 3300026089 | Bacteria | 3460 |
| 634 | Ga0207648_10096683 | 3300026089 | Bacteria | 2584 |
| 635 | Ga0207648_10125504 | 3300026089 | Bacteria | 2258 |
| 636 | Ga0207648_10179166 | 3300026089 | Bacteria | 1875 |
| 637 | Ga0207676_10000180 | 3300026095 | Bacteria | 55634 |
| 638 | Ga0207676_10043371 | 3300026095 | Bacteria | 3463 |
| 639 | Ga0207676_10100932 | 3300026095 | Bacteria | 2392 |
| 640 | Ga0207676_10268801 | 3300026095 | Bacteria | 1543 |
| 641 | Ga0207676_10269596 | 3300026095 | Bacteria | 1541 |
| 642 | Ga0207676_10552250 | 3300026095 | Bacteria | 1100 |
| 643 | Ga0207676_10770313 | 3300026095 | Unclassified | 937 |
| 644 | Ga0207674_10000049 | 3300026116 | Bacteria | 118784 |
| 645 | Ga0207674_10003433 | 3300026116 | Bacteria | 19398 |
| 646 | Ga0207674_10074109 | 3300026116 | Bacteria | 3417 |
| 647 | Ga0207674_10113871 | 3300026116 | Bacteria | 2677 |
| 648 | Ga0207674_10123631 | 3300026116 | Bacteria | 2553 |
| 649 | Ga0207675_100021979 | 3300026118 | Bacteria | 5939 |
| 650 | Ga0207675_100033128 | 3300026118 | Bacteria | 4814 |
| 651 | Ga0207675_100052678 | 3300026118 | Bacteria | 3797 |
| 652 | Ga0207675_100058840 | 3300026118 | Bacteria | 3586 |
| 653 | Ga0207675_100124676 | 3300026118 | Bacteria | 2439 |
| 654 | Ga0207675_100211395 | 3300026118 | Bacteria | 1866 |
| 655 | Ga0207683_10000029 | 3300026121 | Bacteria | 109665 |
| 656 | Ga0207683_10000521 | 3300026121 | Bacteria | 35599 |
| 657 | Ga0207683_10005585 | 3300026121 | Bacteria | 10781 |
| 658 | Ga0207683_10018977 | 3300026121 | Bacteria | 5868 |
| 659 | Ga0207683_10055869 | 3300026121 | Bacteria | 3462 |
| 660 | Ga0207683_10215857 | 3300026121 | Bacteria | 1747 |
| 661 | Ga0207683_10537019 | 3300026121 | Bacteria | 1081 |
| 662 | Ga0207698_10000682 | 3300026142 | Bacteria | 19692 |
| 663 | Ga0207698_10002475 | 3300026142 | Bacteria | 10953 |
| 664 | Ga0207698_10076422 | 3300026142 | Bacteria | 2680 |
| 665 | Ga0210002_1000485 | 3300027617 | Bacteria | 5400 |
| 666 | Ga0209588_1077418 | 3300027671 | Bacteria | 1075 |
| 667 | Ga0209966_1008488 | 3300027695 | Bacteria | 1825 |
| 668 | Ga0209966_1037871 | 3300027695 | Bacteria | 997 |
| 669 | Ga0209998_10002969 | 3300027717 | Bacteria | 3784 |
| 670 | Ga0209813_10001943 | 3300027866 | Bacteria | 4673 |
| 671 | Ga0209813_10020110 | 3300027866 | Bacteria | 1864 |
| 672 | Ga0209974_10030398 | 3300027876 | Bacteria | 1790 |
| 673 | Ga0209974_10046169 | 3300027876 | Bacteria | 1456 |
| 674 | Ga0207428_10000100 | 3300027907 | Bacteria | 119495 |
| 675 | Ga0207428_10000124 | 3300027907 | Bacteria | 105795 |
| 676 | Ga0207428_10000968 | 3300027907 | Bacteria | 31823 |
| 677 | Ga0207428_10021134 | 3300027907 | Bacteria | 5513 |
| 678 | Ga0268266_10008615 | 3300028379 | Bacteria | 9058 |
| 679 | Ga0268266_10057152 | 3300028379 | Bacteria | 3357 |
| 680 | Ga0268266_10181249 | 3300028379 | Bacteria | 1918 |
| 681 | Ga0268266_10255085 | 3300028379 | Bacteria | 1623 |
| 682 | Ga0268265_10000698 | 3300028380 | Bacteria | 32950 |
| 683 | Ga0268265_10005564 | 3300028380 | Bacteria | 8599 |
| 684 | Ga0268265_10333498 | 3300028380 | Bacteria | 1378 |
| 685 | Ga0268264_10001558 | 3300028381 | Bacteria | 21254 |
| 686 | Ga0268264_10046391 | 3300028381 | Bacteria | 3609 |
| 687 | Ga0268264_10183495 | 3300028381 | Bacteria | 1902 |
| 688 | Ga0268264_10285489 | 3300028381 | Bacteria | 1548 |
| 689 | Ga0268264_10547190 | 3300028381 | Bacteria | 1135 |
| 690 | Ga0265318_10006235 | 3300028577 | Bacteria | 5512 |
| 691 | Ga0307517_10000644 | 3300028786 | Bacteria | 59773 |
| 692 | Ga0307517_10137131 | 3300028786 | Bacteria | 1735 |
| 693 | Ga0307515_10006527 | 3300028794 | Bacteria | 23330 |
| 694 | Ga0307515_10176947 | 3300028794 | Bacteria | 2100 |
| 695 | Ga0307515_10492371 | 3300028794 | Bacteria | 837 |
| 696 | Ga0307512_10112651 | 3300030522 | Bacteria | 1784 |
| 697 | Ga0265332_10063392 | 3300031238 | Bacteria | 1579 |
| 698 | Ga0265328_10006421 | 3300031239 | Unclassified | 4984 |
| 699 | Ga0265320_10023698 | 3300031240 | Bacteria | 3261 |
| 700 | Ga0265325_10006840 | 3300031241 | Bacteria | 6892 |
| 701 | Ga0265325_10073737 | 3300031241 | Bacteria | 1708 |
| 702 | Ga0265329_10031811 | 3300031242 | Bacteria | 1712 |
| 703 | Ga0265340_10040813 | 3300031247 | Bacteria | 2284 |
| 704 | Ga0265340_10205686 | 3300031247 | Bacteria | 884 |
| 705 | Ga0265339_10031699 | 3300031249 | Bacteria | 2986 |
| 706 | Ga0265339_10064302 | 3300031249 | Bacteria | 1969 |
| 707 | Ga0265331_10005867 | 3300031250 | Bacteria | 7351 |
| 708 | Ga0265316_10082981 | 3300031344 | Unclassified | 2455 |
| 709 | Ga0265316_10381201 | 3300031344 | Bacteria | 1017 |
| 710 | Ga0307513_10171324 | 3300031456 | Bacteria | 2048 |
| 711 | Ga0307509_10000041 | 3300031507 | Bacteria | 182302 |
| 712 | Ga0307509_10003100 | 3300031507 | Bacteria | 25816 |
| 713 | Ga0307509_10009112 | 3300031507 | Bacteria | 12477 |
| 714 | Ga0265313_10026426 | 3300031595 | Bacteria | 3057 |
| 715 | Ga0307508_10211428 | 3300031616 | Bacteria | 1540 |
| 716 | Ga0307508_10316998 | 3300031616 | Bacteria | 1151 |
| 717 | Ga0307514_10066812 | 3300031649 | Bacteria | 2717 |
| 718 | Ga0307514_10195461 | 3300031649 | Bacteria | 1281 |
| 719 | Ga0265314_10000992 | 3300031711 | Bacteria | 33381 |
| 720 | Ga0265314_10150180 | 3300031711 | Bacteria | 1430 |
| 721 | Ga0265342_10016326 | 3300031712 | Bacteria | 4858 |
| 722 | Ga0265342_10023182 | 3300031712 | Unclassified | 3933 |
| 723 | Ga0307516_10032420 | 3300031730 | Bacteria | 5262 |
| 724 | Ga0307411_10464830 | 3300032005 | Bacteria | 1062 |
| 725 | Ga0307507_10045329 | 3300033179 | Bacteria | 4328 |
| 726 | Ga0307507_10205846 | 3300033179 | Bacteria | 1352 |
| 727 | Ga0307510_10002283 | 3300033180 | Bacteria | 21628 |
| 728 | Ga0307510_10009870 | 3300033180 | Bacteria | 11360 |
| 729 | Ga0307510_10067350 | 3300033180 | Bacteria | 3605 |
| 730 | Ga0307510_10100119 | 3300033180 | Bacteria | 2693 |
| 731 | Ga0307510_10286362 | 3300033180 | Bacteria | 1115 |
| 732 | Ga0373950_0001825 | 3300034818 | Bacteria | 2848 |
| 733 | Ga0373950_0049201 | 3300034818 | Bacteria | 825 |
| 734 | Ga0373938_0000494 | 3300034957 | Bacteria | 6354 |
| 735 | Ga0373926_0186908 | 3300035083 | Bacteria | 795 |
| 736 | Ga0373928_0009097 | 3300035084 | Bacteria | 1938 |
| 737 | Ga0373929_0001228 | 3300035085 | Bacteria | 4958 |
| 738 | Ga0373934_0010526 | 3300035086 | Bacteria | 3472 |
| 739 | Ga0373940_0035624 | 3300035088 | Bacteria | 1348 |
| 740 | Ga0373940_0081037 | 3300035088 | Bacteria | 959 |
| 741 | Ga0373944_0013956 | 3300035089 | Bacteria | 2237 |
| 742 | Ga0373949_0001228 | 3300035090 | Bacteria | 7565 |
| 743 | Ga0373952_0001688 | 3300035092 | Bacteria | 4017 |
| 744 | Ga0373923_0148735 | 3300035111 | Bacteria | 1062 |
| 745 | Ga0373923_0248304 | 3300035111 | Bacteria | 832 |
| 746 | Ga0373923_0267302 | 3300035111 | Bacteria | 804 |
| 747 | Ga0373936_0068289 | 3300035113 | Bacteria | 1461 |
| 748 | Ga0373939_0012040 | 3300035114 | Bacteria | 2197 |
| 749 | Ga0373941_0015879 | 3300035115 | Bacteria | 2037 |
| 750 | Ga0373953_0043817 | 3300035117 | Bacteria | 1787 |
| 751 | Ga0373953_0109480 | 3300035117 | Bacteria | 1167 |
| 752 | Ga0373954_0006658 | 3300035118 | Bacteria | 5042 |
| 753 | Ga0373954_0029740 | 3300035118 | Bacteria | 2517 |
| 754 | Ga0373954_0045779 | 3300035118 | Bacteria | 2044 |
| 755 | Ga0373954_0281960 | 3300035118 | Unclassified | 819 |
| 756 | Ga0373956_0004764 | 3300035119 | Bacteria | 5428 |
| 757 | Ga0373956_0031015 | 3300035119 | Bacteria | 2339 |
| 758 | Ga0373957_0031414 | 3300035120 | Bacteria | 1951 |
| 759 | Ga0373946_0111546 | 3300035171 | Unclassified | 1238 |
| 760 | Ga0373946_0252714 | 3300035171 | Bacteria | 860 |
| 761 | Ga0373946_0255206 | 3300035171 | Bacteria | 856 |
| 762 | Ga0373955_0022227 | 3300035172 | Bacteria | 3214 |
| 763 | Ga0373942_0001685 | 3300035207 | Bacteria | 5598 |
| 764 | Ga0373961_0014842 | 3300035241 | Bacteria | 1983 |
| 765 | Ga0373962_0000138 | 3300035242 | Bacteria | 14991 |
| 766 | Ga0373924_0101628 | 3300035410 | Bacteria | 1237 |
| 767 | Ga0373931_0000239 | 3300035691 | Bacteria | 23413 |
| 768 | Ga0373935_0039383 | 3300035692 | Bacteria | 2964 |
| 769 | Ga0373935_0074833 | 3300035692 | Bacteria | 2190 |
| 770 | Ga0373935_0134875 | 3300035692 | Unclassified | 1662 |
| 771 | Ga0373927_0022826 | 3300035695 | Unclassified | 4099 |
| 772 | Ga0373933_0114087 | 3300035724 | Bacteria | 1687 |
| 773 | Ga0373933_0132460 | 3300035724 | Bacteria | 1568 |
| 774 | Ga0373947_0345374 | 3300035725 | Bacteria | 998 |
| 775 | Ga0373947_0391886 | 3300035725 | Bacteria | 936 |
| 776 | Ga0373947_0570793 | 3300035725 | Unclassified | 770 |
| 777 | Ga0373937_0051941 | 3300036401 | Bacteria | 3757 |
| 778 | Ga0373937_0193468 | 3300036401 | Bacteria | 1911 |
| 779 | Ga0373937_0226181 | 3300036401 | Bacteria | 1761 |
| 780 | Ga0373937_0545123 | 3300036401 | Bacteria | 1102 |
| 781 | Ga0373937_0687364 | 3300036401 | Bacteria | 969 |
| 782 | Ga0373925_0030541 | 3300037068 | Bacteria | 3955 |
| 783 | Ga0373925_0077575 | 3300037068 | Bacteria | 2522 |
| 784 | Ga0373925_0095744 | 3300037068 | Bacteria | 2275 |
| 785 | Ga0373925_0390326 | 3300037068 | Unclassified | 1134 |
| 786 | Ga0395900_0003717 | 3300037418 | Bacteria | 16401 |
| 787 | Ga0395898_0671469 | 3300037466 | Bacteria | 978 |
| 788 | Ga0395905_0016990 | 3300037471 | Bacteria | 6909 |
| 789 | Ga0395905_0058630 | 3300037471 | Bacteria | 3600 |
| 790 | Ga0395905_0453243 | 3300037471 | Bacteria | 1181 |
| 791 | Ga0395905_0827193 | 3300037471 | Bacteria | 829 |
| 792 | Ga0436364_0517049 | 3300037853 | Bacteria | 1399 |
| 793 | Ga0395901_0011964 | 3300038443 | Bacteria | 8799 |
| 794 | Ga0436365_0019248 | 3300039437 | Bacteria | 1028 |
| 795 | Ga0451802_2066676 | 3300041460 | Bacteria | 1399 |
| 796 | Ga0439450_039217 | 3300042008 | Bacteria | 1094 |
| 797 | Ga0439464_0069682 | 3300042439 | Bacteria | 1039 |
| 798 | Ga0439460_0021573 | 3300042461 | Bacteria | 1761 |
| 799 | Ga0451577_0718923 | 3300042876 | Bacteria | 904 |
| 800 | Ga0453683_0002857 | 3300044673 | Bacteria | 13086 |
| 801 | Ga0466967_0064520 | 3300045976 | Bacteria | 3257 |
| 802 | Ga0495592_0001970 | 3300046454 | Bacteria | 14493 |
| 803 | Ga0495592_0051483 | 3300046454 | Bacteria | 3058 |
| 804 | Ga0495592_0057634 | 3300046454 | Bacteria | 2867 |
| 805 | Ga0495592_0090135 | 3300046454 | Bacteria | 2200 |
| 806 | Ga0495592_0128175 | 3300046454 | Bacteria | 1777 |
| 807 | Ga0495590_0001111 | 3300046457 | Bacteria | 11827 |
| 808 | Ga0495629_0151062 | 3300046459 | Bacteria | 1614 |
| 809 | Ga0495629_0153427 | 3300046459 | Bacteria | 1601 |
| 810 | Ga0495638_0116305 | 3300046460 | Bacteria | 1584 |
| 811 | Ga0495641_0139804 | 3300046461 | Bacteria | 1081 |
| 812 | Ga0495651_0046327 | 3300046462 | Bacteria | 3365 |
| 813 | Ga0495651_0531080 | 3300046462 | Bacteria | 750 |
| 814 | Ga0495653_0264103 | 3300046463 | Bacteria | 1136 |
| 815 | Ga0495580_0000683 | 3300046472 | Bacteria | 28898 |
| 816 | Ga0495580_0128872 | 3300046472 | Bacteria | 1755 |
| 817 | Ga0495582_0104641 | 3300046473 | Unclassified | 1587 |
| 818 | Ga0495605_0230228 | 3300046474 | Bacteria | 798 |
| 819 | Ga0495639_0025312 | 3300046475 | Bacteria | 2616 |
| 820 | Ga0495662_0025409 | 3300046476 | Bacteria | 2860 |
| 821 | Ga0495664_0026882 | 3300046477 | Bacteria | 3353 |
| 822 | Ga0495585_0282240 | 3300046492 | Bacteria | 821 |
| 823 | Ga0495608_0024660 | 3300046511 | Bacteria | 4109 |
| 824 | Ga0495608_0071301 | 3300046511 | Bacteria | 2267 |
| 825 | Ga0495610_0037726 | 3300046512 | Bacteria | 2457 |
| 826 | Ga0495618_0398466 | 3300046514 | Unclassified | 842 |
| 827 | Ga0495628_0015428 | 3300046516 | Bacteria | 6378 |
| 828 | Ga0495628_0018439 | 3300046516 | Bacteria | 5780 |
| 829 | Ga0495628_0194020 | 3300046516 | Bacteria | 1533 |
| 830 | Ga0495628_0312523 | 3300046516 | Bacteria | 1161 |
| 831 | Ga0495628_0433060 | 3300046516 | Unclassified | 957 |
| 832 | Ga0495630_0078045 | 3300046517 | Bacteria | 2497 |
| 833 | Ga0495630_0094796 | 3300046517 | Unclassified | 2256 |
| 834 | Ga0495630_0206881 | 3300046517 | Unclassified | 1498 |
| 835 | Ga0495630_0283597 | 3300046517 | Bacteria | 1265 |
| 836 | Ga0495632_0147584 | 3300046519 | Bacteria | 1088 |
| 837 | Ga0495666_0189118 | 3300046526 | Bacteria | 949 |
| 838 | Ga0495652_0018867 | 3300046529 | Bacteria | 6147 |
| 839 | Ga0495652_0152169 | 3300046529 | Bacteria | 1806 |
| 840 | Ga0495652_0191425 | 3300046529 | Bacteria | 1560 |
| 841 | Ga0495640_0024230 | 3300046533 | Bacteria | 4415 |
| 842 | Ga0495640_0060233 | 3300046533 | Unclassified | 2582 |
| 843 | Ga0495586_0051513 | 3300046535 | Bacteria | 2228 |
| 844 | Ga0495586_0250907 | 3300046535 | Bacteria | 1009 |
| 845 | Ga0495587_0031018 | 3300046536 | Bacteria | 3239 |
| 846 | Ga0495645_0025284 | 3300046543 | Bacteria | 4309 |
| 847 | Ga0495622_0108936 | 3300046557 | Bacteria | 1268 |
| 848 | Ga0495622_0271821 | 3300046557 | Bacteria | 742 |
| 849 | Ga0495667_0036451 | 3300046559 | Bacteria | 3283 |
| 850 | Ga0495667_0047951 | 3300046559 | Bacteria | 2821 |
| 851 | Ga0495667_0050414 | 3300046559 | Bacteria | 2748 |
| 852 | Ga0495634_0257114 | 3300046642 | Bacteria | 1066 |
| 853 | Ga0495635_0050965 | 3300046663 | Bacteria | 2853 |
| 854 | Ga0495635_0064172 | 3300046663 | Bacteria | 2522 |
| 855 | Ga0495659_0020476 | 3300046664 | Bacteria | 2222 |
| 856 | Ga0495657_0077848 | 3300046675 | Bacteria | 2150 |
| 857 | Ga0495599_0037398 | 3300046678 | Bacteria | 3049 |
| 858 | Ga0495646_0100828 | 3300046680 | Bacteria | 1656 |
| 859 | Ga0495647_0023746 | 3300046681 | Bacteria | 2226 |
| 860 | Ga0495658_0128525 | 3300046683 | Bacteria | 1540 |
| 861 | Ga0495658_0135058 | 3300046683 | Bacteria | 1505 |
| 862 | Ga0495669_0110227 | 3300046684 | Bacteria | 1285 |
| 863 | Ga0495613_0066450 | 3300046689 | Bacteria | 2633 |
| 864 | Ga0495624_0037607 | 3300046690 | Bacteria | 3112 |
| 865 | Ga0495624_0429525 | 3300046690 | Bacteria | 792 |
| 866 | Ga0495600_0220919 | 3300046809 | Bacteria | 1212 |
| 867 | Ga0495660_0264306 | 3300046810 | Bacteria | 793 |
| 868 | Ga0495674_0082122 | 3300047319 | Bacteria | 2763 |
| 869 | Ga0495676_0078685 | 3300047321 | Bacteria | 2509 |
| 870 | Ga0495680_0036557 | 3300047322 | Bacteria | 3941 |
| 871 | Ga0495675_0124627 | 3300047444 | Bacteria | 1603 |
| 872 | Ga0495675_0139732 | 3300047444 | Bacteria | 1502 |
| 873 | Ga0495686_0221088 | 3300047472 | Bacteria | 1077 |
| 874 | Ga0495593_0061448 | 3300047673 | Bacteria | 1965 |
| 875 | Ga0495614_0266961 | 3300048089 | Bacteria | 786 |
| 876 | Ga0496100_0002349 | 3300048903 | Bacteria | 9573 |
| 877 | Ga0496101_0000187 | 3300048904 | Bacteria | 48785 |
| 878 | Ga0496101_0014419 | 3300048904 | Bacteria | 5312 |
| 879 | Ga0496102_0002906 | 3300048905 | Bacteria | 14522 |
| 880 | Ga0496103_0000157 | 3300048906 | Bacteria | 71452 |
| 881 | Ga0496104_0383570 | 3300048907 | Bacteria | 1318 |
| 882 | Ga0496105_0250174 | 3300048908 | Bacteria | 1436 |
| 883 | Ga0496106_0006890 | 3300048909 | Bacteria | 8407 |
| 884 | Ga0496107_0000805 | 3300048910 | Bacteria | 18202 |
| 885 | Ga0496108_0234055 | 3300048911 | Bacteria | 1597 |
| 886 | Ga0496108_0805076 | 3300048911 | Bacteria | 811 |
| 887 | Ga0496109_0000313 | 3300048912 | Bacteria | 45501 |
| 888 | Ga0496109_0001125 | 3300048912 | Bacteria | 22254 |
| 889 | Ga0496110_0096825 | 3300048913 | Bacteria | 2644 |
| 890 | Ga0496111_0076468 | 3300048914 | Bacteria | 2440 |
| 891 | Ga0496111_0083795 | 3300048914 | Bacteria | 2330 |
| 892 | Ga0496112_0086476 | 3300048915 | Bacteria | 3102 |
| 893 | Ga0496112_0105664 | 3300048915 | Bacteria | 2785 |
| 894 | Ga0496112_0692166 | 3300048915 | Bacteria | 948 |
| 895 | Ga0496113_0012990 | 3300048916 | Bacteria | 5619 |
| 896 | Ga0496113_0018069 | 3300048916 | Bacteria | 4906 |
| 897 | Ga0496113_0297226 | 3300048916 | Bacteria | 1293 |
| 898 | Ga0496114_0005751 | 3300048917 | Bacteria | 9733 |
| 899 | Ga0496114_0022185 | 3300048917 | Bacteria | 5172 |
| 900 | Ga0496115_0001217 | 3300048918 | Bacteria | 18461 |
| 901 | Ga0496118_0151636 | 3300048921 | Bacteria | 1450 |
| 902 | Ga0496121_0003906 | 3300048924 | Bacteria | 20685 |
| 903 | Ga0496123_0180276 | 3300048926 | Bacteria | 1104 |
| 904 | Ga0496125_0000063 | 3300048928 | Bacteria | 250260 |
| 905 | Ga0496125_0003433 | 3300048928 | Bacteria | 19212 |
| 906 | Ga0496126_0051862 | 3300048929 | Bacteria | 3732 |
| 907 | Ga0501031_0299947 | 3300049568 | Bacteria | 1041 |
| 908 | Ga0501031_0415882 | 3300049568 | Bacteria | 869 |
| 909 | Ga0501034_0010927 | 3300049571 | Bacteria | 9434 |
| 910 | Ga0501038_0017675 | 3300049574 | Bacteria | 6446 |
| 911 | Ga0501039_0084802 | 3300049575 | Bacteria | 2468 |
| 912 | Ga0501040_0012090 | 3300049576 | Bacteria | 5652 |
| 913 | Ga0501040_0012492 | 3300049576 | Bacteria | 5565 |
| 914 | Ga0501041_0043939 | 3300049577 | Bacteria | 2716 |
| 915 | Ga0501041_0073839 | 3300049577 | Bacteria | 2096 |
| 916 | Ga0501042_0003421 | 3300049578 | Bacteria | 9968 |
| 917 | Ga0501046_0350547 | 3300049580 | Bacteria | 1072 |
| 918 | Ga0501048_0342264 | 3300049582 | Bacteria | 1066 |
| 919 | Ga0501067_0089123 | 3300049583 | Bacteria | 1712 |
| 920 | Ga0501068_0368546 | 3300049584 | Bacteria | 924 |
| 921 | Ga0501068_0375390 | 3300049584 | Bacteria | 915 |
| 922 | Ga0501069_0051380 | 3300049585 | Bacteria | 2294 |
| 923 | Ga0501070_0192200 | 3300049586 | Bacteria | 1677 |
| 924 | Ga0501071_0149658 | 3300049587 | Bacteria | 1741 |
| 925 | Ga0501072_0007289 | 3300049588 | Bacteria | 8386 |
| 926 | Ga0501072_0455892 | 3300049588 | Bacteria | 1012 |
| 927 | Ga0501072_0617641 | 3300049588 | Bacteria | 854 |
| 928 | Ga0501074_0158448 | 3300049590 | Bacteria | 1616 |
| 929 | Ga0501074_0415371 | 3300049590 | Bacteria | 954 |
| 930 | Ga0501075_0002401 | 3300049591 | Bacteria | 12446 |
| 931 | Ga0501075_0059850 | 3300049591 | Bacteria | 2870 |
| 932 | Ga0501075_0177917 | 3300049591 | Bacteria | 1623 |
| 933 | Ga0501075_0384908 | 3300049591 | Bacteria | 1069 |
| 934 | Ga0501076_0001488 | 3300049592 | Bacteria | 15703 |
| 935 | Ga0501077_0074645 | 3300049593 | Unclassified | 2148 |
| 936 | Ga0501077_0150832 | 3300049593 | Bacteria | 1475 |
| 937 | Ga0501079_0006001 | 3300049741 | Bacteria | 9098 |
| 938 | Ga0501079_0516427 | 3300049741 | Bacteria | 939 |
| 939 | Ga0501080_0007934 | 3300049742 | Bacteria | 9615 |
| 940 | Ga0501080_0337147 | 3300049742 | Bacteria | 1363 |
| 941 | Ga0501080_0492636 | 3300049742 | Bacteria | 1096 |
| 942 | Ga0501081_0377416 | 3300049743 | Bacteria | 1047 |
| 943 | Ga0501083_0019458 | 3300049744 | Bacteria | 4730 |
| 944 | nmdc:mga00v17_300694_c1 | 3300050491 | Bacteria | 1042 |
| 945 | nmdc:mga00v17_58681_c1 | 3300050491 | Bacteria | 2359 |
| 946 | nmdc:mga0yw44_48593_c1 | 3300050492 | Bacteria | 2558 |
| 947 | nmdc:mga06z11_3482_c1 | 3300050494 | Bacteria | 6096 |
| 948 | nmdc:mga06z11_4358_c1 | 3300050494 | Bacteria | 5566 |
| 949 | nmdc:mga06z11_76410_c1 | 3300050494 | Bacteria | 1786 |
| 950 | nmdc:mga04h51_18807_c1 | 3300050495 | Bacteria | 2040 |
| 951 | nmdc:mga07m45_13302_c1 | 3300050496 | Bacteria | 4364 |
| 952 | nmdc:mga07m45_139695_c1 | 3300050496 | Bacteria | 1403 |
| 953 | nmdc:mga07m45_24947_c1 | 3300050496 | Bacteria | 3277 |
| 954 | nmdc:mga05p37_10207_c1 | 3300050507 | Bacteria | 11151 |
| 955 | nmdc:mga05p37_104271_c1 | 3300050507 | Bacteria | 2339 |
| 956 | nmdc:mga05p37_13916_c1 | 3300050507 | Bacteria | 9642 |
| 957 | nmdc:mga05p37_15856_c1 | 3300050507 | Bacteria | 9064 |
| 958 | nmdc:mga05p37_164938_c1 | 3300050507 | Bacteria | 2704 |
| 959 | nmdc:mga05p37_385834_c1 | 3300050507 | Bacteria | 1640 |
| 960 | nmdc:mga05p37_39063_c1 | 3300050507 | Bacteria | 5824 |
| 961 | nmdc:mga05p37_45_c1 | 3300050507 | Bacteria | 81140 |
| 962 | nmdc:mga05p37_630292_c1 | 3300050507 | Bacteria | 1205 |
| 963 | nmdc:mga05p37_85076_c1 | 3300050507 | Bacteria | 3897 |
| 964 | nmdc:mga09592_169100_c1 | 3300050508 | Bacteria | 1890 |
| 965 | nmdc:mga09592_182663_c1 | 3300050508 | Bacteria | 1815 |
| 966 | nmdc:mga09592_47067_c1 | 3300050508 | Bacteria | 3634 |
| 967 | nmdc:mga09592_5654_c1 | 3300050508 | Bacteria | 10199 |
| 968 | nmdc:mga09592_58667_c1 | 3300050508 | Bacteria | 3255 |
| 969 | nmdc:mga09592_7756_c1 | 3300050508 | Bacteria | 8725 |
| 970 | nmdc:mga09592_81575_c1 | 3300050508 | Bacteria | 2756 |
| 971 | nmdc:mga0qj67_1430_c1 | 3300050509 | Bacteria | 16714 |
| 972 | nmdc:mga0qj67_160268_c1 | 3300050509 | Bacteria | 1826 |
| 973 | nmdc:mga0qj67_348346_c1 | 3300050509 | Unclassified | 1198 |
| 974 | nmdc:mga0qj67_58551_c1 | 3300050509 | Bacteria | 3054 |
| 975 | nmdc:mga0qj67_67253_c1 | 3300050509 | Bacteria | 2855 |
| 976 | nmdc:mga06r32_162043_c1 | 3300050510 | Bacteria | 2219 |
| 977 | nmdc:mga06r32_203418_c1 | 3300050510 | Bacteria | 1968 |
| 978 | nmdc:mga06r32_211300_c1 | 3300050510 | Bacteria | 1928 |
| 979 | nmdc:mga06r32_35577_c1 | 3300050510 | Bacteria | 4699 |
| 980 | nmdc:mga06r32_407_c1 | 3300050510 | Bacteria | 36327 |
| 981 | nmdc:mga06r32_77499_c1 | 3300050510 | Bacteria | 3229 |
| 982 | nmdc:mga08y16_2193_c1 | 3300050511 | Bacteria | 20044 |
| 983 | nmdc:mga08y16_792_c1 | 3300050511 | Bacteria | 30185 |
| 984 | nmdc:mga08y16_91943_c1 | 3300050511 | Bacteria | 3162 |
| 985 | nmdc:mga0n895_1011_c1 | 3300050512 | Bacteria | 20432 |
| 986 | nmdc:mga0n895_10668_c1 | 3300050512 | Bacteria | 8137 |
| 987 | nmdc:mga0n895_15085_c1 | 3300050512 | Bacteria | 7042 |
| 988 | nmdc:mga0n895_254415_c1 | 3300050512 | Bacteria | 1782 |
| 989 | nmdc:mga0n895_8875_c1 | 3300050512 | Bacteria | 8753 |
| 990 | nmdc:mga0rr50_104975_c1 | 3300050513 | Bacteria | 2227 |
| 991 | nmdc:mga0rr50_107066_c1 | 3300050513 | Bacteria | 2207 |
| 992 | nmdc:mga0rr50_135279_c1 | 3300050513 | Bacteria | 1978 |
| 993 | nmdc:mga0rr50_142289_c1 | 3300050513 | Bacteria | 1931 |
| 994 | nmdc:mga0rr50_235104_c1 | 3300050513 | Bacteria | 1517 |
| 995 | nmdc:mga0rr50_43068_c1 | 3300050513 | Bacteria | 3301 |
| 996 | nmdc:mga0rr50_918_c1 | 3300050513 | Bacteria | 15942 |
| 997 | nmdc:mga08x19_170263_c1 | 3300050514 | Bacteria | 1483 |
| 998 | nmdc:mga08x19_29952_c1 | 3300050514 | Bacteria | 3417 |
| 999 | nmdc:mga08x19_63051_c1 | 3300050514 | Bacteria | 2404 |
| 1000 | nmdc:mga0a205_1027039_c1 | 3300050515 | Bacteria | 671 |
| 1001 | nmdc:mga0a205_22216_c1 | 3300050515 | Bacteria | 6007 |
| 1002 | nmdc:mga0a205_242974_c1 | 3300050515 | Unclassified | 1681 |
| 1003 | nmdc:mga0a205_6158_c1 | 3300050515 | Bacteria | 10825 |
| 1004 | nmdc:mga0a205_6355_c1 | 3300050515 | Bacteria | 7369 |
| 1005 | Ga0495601_0001636 | 3300053077 | Bacteria | 12353 |
| 1006 | Ga0495601_0056964 | 3300053077 | Bacteria | 2475 |
| 1007 | Ga0495601_0139901 | 3300053077 | Bacteria | 1578 |
| 1008 | Ga0495595_0008204 | 3300053084 | Bacteria | 4287 |
| 1009 | Ga0495595_0135150 | 3300053084 | Bacteria | 1207 |
| 1010 | Ga0495619_0041195 | 3300053085 | Bacteria | 3020 |
| 1011 | Ga0495619_0191701 | 3300053085 | Unclassified | 1415 |
| 1012 | Ga0500578_0000236 | 3300053086 | Bacteria | 68048 |
| 1013 | Ga0500578_0400015 | 3300053086 | Bacteria | 792 |
| 1014 | Ga0500644_0003109 | 3300053088 | Bacteria | 4109 |
| 1015 | Ga0500651_0023119 | 3300053093 | Bacteria | 3890 |
| 1016 | Ga0500651_0102264 | 3300053093 | Bacteria | 1756 |
| 1017 | Ga0500566_0158488 | 3300053094 | Bacteria | 1182 |
| 1018 | Ga0500594_0017698 | 3300053118 | Bacteria | 1747 |
| 1019 | Ga0500595_002989 | 3300053119 | Bacteria | 8040 |
| 1020 | Ga0500595_010080 | 3300053119 | Bacteria | 3773 |
| 1021 | Ga0500614_013998 | 3300053123 | Bacteria | 1770 |
| 1022 | Ga0500652_000014 | 3300053131 | Bacteria | 147740 |
| 1023 | Ga0500559_0000012 | 3300053136 | Bacteria | 164222 |
| 1024 | Ga0500564_179043 | 3300053138 | Bacteria | 885 |
| 1025 | Ga0500568_0057635 | 3300053139 | Bacteria | 1511 |
| 1026 | Ga0500604_0014218 | 3300053151 | Bacteria | 2165 |
| 1027 | Ga0500604_0014386 | 3300053151 | Bacteria | 2154 |
| 1028 | Ga0500619_050551 | 3300053154 | Bacteria | 1344 |
| 1029 | Ga0500622_0024833 | 3300053156 | Bacteria | 3169 |
| 1030 | Ga0500627_0019136 | 3300053158 | Bacteria | 2723 |
| 1031 | Ga0500636_0030839 | 3300053177 | Bacteria | 3173 |
| 1032 | Ga0500645_025399 | 3300053730 | Bacteria | 1808 |
| 1033 | Ga0500552_000373 | 3300053733 | Bacteria | 4171 |
| 1034 | Ga0500587_022219 | 3300053739 | Bacteria | 833 |
| 1035 | Ga0501084_0039843 | 3300054114 | Bacteria | 3929 |
| 1036 | Ga0501084_0057776 | 3300054114 | Bacteria | 3246 |
| 1037 | Ga0501082_0000007 | 3300060353 | Bacteria | 126506 |
| 1038 | Ga0501082_0009692 | 3300060353 | Bacteria | 8293 |
| 1039 | Ga0501082_0105127 | 3300060353 | Bacteria | 2443 |
| 1040 | Ga0501082_0834466 | 3300060353 | Bacteria | 806 |
| 1041 | Ga0530510_0000125 | 3300061734 | Bacteria | 44341 |
| 1042 | Ga0530510_0070238 | 3300061734 | Bacteria | 2542 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009176 | Ga0105242_10934804 | Ga0105242_109348042 | 178 |
| 2 | 3300048089 | Ga0495614_0266961 | Ga0495614_0266961_195_767 | 187 |
| 3 | 3300050491 | nmdc:mga00v17_58681_c1 | nmdc:mga00v17_58681_c1_27_599 | 187 |
| 4 | 3300048926 | Ga0496123_0180276 | Ga0496123_0180276_396_1085 | 191 |
| 5 | 3300049588 | Ga0501072_0617641 | Ga0501072_0617641_218_814 | 191 |
| 6 | 3300046462 | Ga0495651_0531080 | Ga0495651_0531080_61_660 | 192 |
| 7 | 3300046517 | Ga0495630_0094796 | Ga0495630_0094796_23_619 | 192 |
| 8 | 3300005356 | Ga0070674_100012945 | Ga0070674_1000129453 | 194 |
| 9 | 3300005456 | Ga0070678_100099528 | Ga0070678_1000995281 | 194 |
| 10 | 3300005459 | Ga0068867_100287783 | Ga0068867_1002877832 | 194 |
| 11 | 3300025937 | Ga0207669_10132916 | Ga0207669_101329162 | 194 |
| 12 | 3300026089 | Ga0207648_10047268 | Ga0207648_100472682 | 194 |
| 13 | 3300003323 | rootH1_10002881 | rootH1_100028812 | 195 |
| 14 | 3300048921 | Ga0496118_0151636 | Ga0496118_0151636_641_1411 | 195 |
| 15 | 3300005366 | Ga0070659_100792638 | Ga0070659_1007926381 | 196 |
| 16 | 3300046492 | Ga0495585_0282240 | Ga0495585_0282240_52_714 | 196 |
| 17 | 3300037471 | Ga0395905_0827193 | Ga0395905_0827193_105_779 | 198 |
| 18 | 3300002773 | JGI25152J39213_1005374 | JGI25152J39213_10053743 | 199 |
| 19 | 3300003771 | Ga0055526_1015322 | Ga0055526_10153224 | 199 |
| 20 | 3300025258 | Ga0209129_1000326 | Ga0209129_10003262 | 199 |
| 21 | 3300025273 | Ga0209673_1051683 | Ga0209673_10516832 | 199 |
| 22 | 3300025295 | Ga0209564_1000057 | Ga0209564_1000057276 | 199 |
| 23 | 3300025297 | Ga0209758_1000174 | Ga0209758_10001742 | 199 |
| 24 | 3300031507 | Ga0307509_10003100 | Ga0307509_1000310013 | 199 |
| 25 | 3300033179 | Ga0307507_10205846 | Ga0307507_102058462 | 199 |
| 26 | 3300033180 | Ga0307510_10100119 | Ga0307510_101001192 | 199 |
| 27 | 3300048924 | Ga0496121_0003906 | Ga0496121_0003906_16604_17374 | 199 |
| 28 | 3300009147 | Ga0114129_10818454 | Ga0114129_108184542 | 200 |
| 29 | 3300050507 | nmdc:mga05p37_630292_c1 | nmdc:mga05p37_630292_c1_439_1068 | 200 |
| 30 | 3300050508 | nmdc:mga09592_182663_c1 | nmdc:mga09592_182663_c1_782_1411 | 200 |
| 31 | 3300050508 | nmdc:mga09592_47067_c1 | nmdc:mga09592_47067_c1_2211_2846 | 201 |
| 32 | 3300050509 | nmdc:mga0qj67_67253_c1 | nmdc:mga0qj67_67253_c1_561_1196 | 201 |
| 33 | 3300009551 | Ga0105238_10104413 | Ga0105238_101044132 | 202 |
| 34 | 3300005458 | Ga0070681_10058787 | Ga0070681_100587871 | 203 |
| 35 | 3300025912 | Ga0207707_10062947 | Ga0207707_100629473 | 203 |
| 36 | 3300044673 | Ga0453683_0002857 | Ga0453683_0002857_1516_2190 | 203 |
| 37 | 3300050507 | nmdc:mga05p37_164938_c1 | nmdc:mga05p37_164938_c1_107_745 | 203 |
| 38 | 3300050510 | nmdc:mga06r32_162043_c1 | nmdc:mga06r32_162043_c1_693_1331 | 203 |
| 39 | 3300025912 | Ga0207707_10130681 | Ga0207707_101306813 | 204 |
| 40 | 3300025937 | Ga0207669_10052574 | Ga0207669_100525742 | 204 |
| 41 | 3300035725 | Ga0373947_0345374 | Ga0373947_0345374_12_656 | 204 |
| 42 | 3300046517 | Ga0495630_0283597 | Ga0495630_0283597_611_1255 | 204 |
| 43 | 3300005937 | Ga0081455_10005710 | Ga0081455_1000571012 | 205 |
| 44 | 3300045976 | Ga0466967_0064520 | Ga0466967_0064520_1215_1844 | 205 |
| 45 | 3300048928 | Ga0496125_0000063 | Ga0496125_0000063_85352_86038 | 205 |
| 46 | 3300050515 | nmdc:mga0a205_22216_c1 | nmdc:mga0a205_22216_c1_5358_5987 | 205 |
| 47 | 3300005329 | Ga0070683_100112039 | Ga0070683_1001120392 | 206 |
| 48 | 3300005336 | Ga0070680_100250387 | Ga0070680_1002503871 | 206 |
| 49 | 3300005339 | Ga0070660_100355505 | Ga0070660_1003555051 | 206 |
| 50 | 3300005344 | Ga0070661_100059933 | Ga0070661_1000599332 | 206 |
| 51 | 3300005535 | Ga0070684_100079132 | Ga0070684_1000791321 | 206 |
| 52 | 3300005564 | Ga0070664_100099808 | Ga0070664_1000998083 | 206 |
| 53 | 3300005578 | Ga0068854_100344566 | Ga0068854_1003445662 | 206 |
| 54 | 3300005614 | Ga0068856_100073582 | Ga0068856_1000735822 | 206 |
| 55 | 3300005616 | Ga0068852_100048811 | Ga0068852_1000488112 | 206 |
| 56 | 3300009174 | Ga0105241_10252539 | Ga0105241_102525392 | 206 |
| 57 | 3300009545 | Ga0105237_10167776 | Ga0105237_101677762 | 206 |
| 58 | 3300010375 | Ga0105239_10297547 | Ga0105239_102975472 | 206 |
| 59 | 3300013102 | Ga0157371_10198703 | Ga0157371_101987032 | 206 |
| 60 | 3300013104 | Ga0157370_10580206 | Ga0157370_105802061 | 206 |
| 61 | 3300013307 | Ga0157372_10132940 | Ga0157372_101329402 | 206 |
| 62 | 3300020081 | Ga0206354_11042258 | Ga0206354_110422581 | 206 |
| 63 | 3300020082 | Ga0206353_12052891 | Ga0206353_120528912 | 206 |
| 64 | 3300025904 | Ga0207647_10117406 | Ga0207647_101174062 | 206 |
| 65 | 3300025917 | Ga0207660_10354010 | Ga0207660_103540102 | 206 |
| 66 | 3300025933 | Ga0207706_10210632 | Ga0207706_102106321 | 206 |
| 67 | 3300025944 | Ga0207661_10079917 | Ga0207661_100799172 | 206 |
| 68 | 3300025949 | Ga0207667_10108943 | Ga0207667_101089432 | 206 |
| 69 | 3300025981 | Ga0207640_10348715 | Ga0207640_103487152 | 206 |
| 70 | 3300026041 | Ga0207639_10271729 | Ga0207639_102717292 | 206 |
| 71 | 3300026078 | Ga0207702_10147535 | Ga0207702_101475352 | 206 |
| 72 | 3300026116 | Ga0207674_10113871 | Ga0207674_101138712 | 206 |
| 73 | 3300026142 | Ga0207698_10076422 | Ga0207698_100764222 | 206 |
| 74 | 3300028379 | Ga0268266_10181249 | Ga0268266_101812492 | 206 |
| 75 | 3300035118 | Ga0373954_0045779 | Ga0373954_0045779_770_1420 | 206 |
| 76 | 3300037418 | Ga0395900_0003717 | Ga0395900_0003717_5690_6361 | 206 |
| 77 | 3300038443 | Ga0395901_0011964 | Ga0395901_0011964_3216_3887 | 206 |
| 78 | 3300048928 | Ga0496125_0003433 | Ga0496125_0003433_15185_15871 | 206 |
| 79 | 3300048929 | Ga0496126_0051862 | Ga0496126_0051862_1472_2158 | 206 |
| 80 | 3300050508 | nmdc:mga09592_58667_c1 | nmdc:mga09592_58667_c1_850_1500 | 206 |
| 81 | 3300050509 | nmdc:mga0qj67_348346_c1 | nmdc:mga0qj67_348346_c1_46_696 | 206 |
| 82 | 3300050510 | nmdc:mga06r32_203418_c1 | nmdc:mga06r32_203418_c1_939_1589 | 206 |
| 83 | 3300005347 | Ga0070668_100018430 | Ga0070668_1000184305 | 207 |
| 84 | 3300006844 | Ga0075428_100177449 | Ga0075428_1001774494 | 207 |
| 85 | 3300009147 | Ga0114129_10010935 | Ga0114129_1001093511 | 207 |
| 86 | 3300013297 | Ga0157378_10091118 | Ga0157378_100911181 | 207 |
| 87 | 3300025972 | Ga0207668_10011562 | Ga0207668_100115625 | 207 |
| 88 | 3300031238 | Ga0265332_10063392 | Ga0265332_100633923 | 207 |
| 89 | 3300031240 | Ga0265320_10023698 | Ga0265320_100236983 | 207 |
| 90 | 3300031241 | Ga0265325_10073737 | Ga0265325_100737371 | 207 |
| 91 | 3300031242 | Ga0265329_10031811 | Ga0265329_100318112 | 207 |
| 92 | 3300031247 | Ga0265340_10205686 | Ga0265340_102056861 | 207 |
| 93 | 3300031249 | Ga0265339_10031699 | Ga0265339_100316992 | 207 |
| 94 | 3300031595 | Ga0265313_10026426 | Ga0265313_100264264 | 207 |
| 95 | 3300031711 | Ga0265314_10150180 | Ga0265314_101501802 | 207 |
| 96 | 3300031712 | Ga0265342_10016326 | Ga0265342_100163266 | 207 |
| 97 | 3300036401 | Ga0373937_0687364 | Ga0373937_0687364_177_809 | 207 |
| 98 | 3300046454 | Ga0495592_0057634 | Ga0495592_0057634_2224_2856 | 207 |
| 99 | 3300046457 | Ga0495590_0001111 | Ga0495590_0001111_1866_2531 | 207 |
| 100 | 3300046516 | Ga0495628_0015428 | Ga0495628_0015428_156_806 | 207 |
| 101 | 3300046516 | Ga0495628_0194020 | Ga0495628_0194020_364_996 | 207 |
| 102 | 3300046535 | Ga0495586_0051513 | Ga0495586_0051513_1266_1898 | 207 |
| 103 | 3300046543 | Ga0495645_0025284 | Ga0495645_0025284_1965_2615 | 207 |
| 104 | 3300046559 | Ga0495667_0047951 | Ga0495667_0047951_1490_2122 | 207 |
| 105 | 3300046663 | Ga0495635_0050965 | Ga0495635_0050965_1489_2121 | 207 |
| 106 | 3300046678 | Ga0495599_0037398 | Ga0495599_0037398_1840_2472 | 207 |
| 107 | 3300046809 | Ga0495600_0220919 | Ga0495600_0220919_89_721 | 207 |
| 108 | 3300046810 | Ga0495660_0264306 | Ga0495660_0264306_52_717 | 207 |
| 109 | 3300049568 | Ga0501031_0299947 | Ga0501031_0299947_118_759 | 207 |
| 110 | 3300049574 | Ga0501038_0017675 | Ga0501038_0017675_5708_6349 | 207 |
| 111 | 3300049575 | Ga0501039_0084802 | Ga0501039_0084802_1664_2305 | 207 |
| 112 | 3300049576 | Ga0501040_0012090 | Ga0501040_0012090_15_656 | 207 |
| 113 | 3300049577 | Ga0501041_0043939 | Ga0501041_0043939_489_1130 | 207 |
| 114 | 3300049578 | Ga0501042_0003421 | Ga0501042_0003421_2460_3101 | 207 |
| 115 | 3300049584 | Ga0501068_0368546 | Ga0501068_0368546_223_864 | 207 |
| 116 | 3300049588 | Ga0501072_0007289 | Ga0501072_0007289_2534_3175 | 207 |
| 117 | 3300049590 | Ga0501074_0158448 | Ga0501074_0158448_254_895 | 207 |
| 118 | 3300049591 | Ga0501075_0002401 | Ga0501075_0002401_11680_12321 | 207 |
| 119 | 3300049592 | Ga0501076_0001488 | Ga0501076_0001488_11227_11868 | 207 |
| 120 | 3300049741 | Ga0501079_0006001 | Ga0501079_0006001_4898_5539 | 207 |
| 121 | 3300049742 | Ga0501080_0007934 | Ga0501080_0007934_3468_4109 | 207 |
| 122 | 3300050507 | nmdc:mga05p37_13916_c1 | nmdc:mga05p37_13916_c1_7471_8145 | 207 |
| 123 | 3300053077 | Ga0495601_0056964 | Ga0495601_0056964_161_793 | 207 |
| 124 | 3300053077 | Ga0495601_0139901 | Ga0495601_0139901_843_1493 | 207 |
| 125 | 3300053084 | Ga0495595_0135150 | Ga0495595_0135150_338_970 | 207 |
| 126 | 3300053085 | Ga0495619_0041195 | Ga0495619_0041195_603_1235 | 207 |
| 127 | 3300054114 | Ga0501084_0039843 | Ga0501084_0039843_3064_3705 | 207 |
| 128 | 3300060353 | Ga0501082_0009692 | Ga0501082_0009692_3937_4578 | 207 |
| 129 | 3300061734 | Ga0530510_0000125 | Ga0530510_0000125_43466_44107 | 207 |
| 130 | 3300005330 | Ga0070690_100040233 | Ga0070690_1000402332 | 208 |
| 131 | 3300005333 | Ga0070677_10000368 | Ga0070677_1000036810 | 208 |
| 132 | 3300005334 | Ga0068869_100006240 | Ga0068869_1000062403 | 208 |
| 133 | 3300005334 | Ga0068869_100159051 | Ga0068869_1001590512 | 208 |
| 134 | 3300005335 | Ga0070666_10003027 | Ga0070666_100030278 | 208 |
| 135 | 3300005335 | Ga0070666_10032791 | Ga0070666_100327914 | 208 |
| 136 | 3300005338 | Ga0068868_100000824 | Ga0068868_10000082417 | 208 |
| 137 | 3300005338 | Ga0068868_100376189 | Ga0068868_1003761891 | 208 |
| 138 | 3300005347 | Ga0070668_100001817 | Ga0070668_10000181711 | 208 |
| 139 | 3300005347 | Ga0070668_100039792 | Ga0070668_1000397923 | 208 |
| 140 | 3300005353 | Ga0070669_100632513 | Ga0070669_1006325131 | 208 |
| 141 | 3300005354 | Ga0070675_100000231 | Ga0070675_1000002313 | 208 |
| 142 | 3300005355 | Ga0070671_100000689 | Ga0070671_10000068924 | 208 |
| 143 | 3300005355 | Ga0070671_100716796 | Ga0070671_1007167961 | 208 |
| 144 | 3300005356 | Ga0070674_100003262 | Ga0070674_1000032622 | 208 |
| 145 | 3300005364 | Ga0070673_100060368 | Ga0070673_1000603684 | 208 |
| 146 | 3300005364 | Ga0070673_100295331 | Ga0070673_1002953313 | 208 |
| 147 | 3300005367 | Ga0070667_100154236 | Ga0070667_1001542363 | 208 |
| 148 | 3300005455 | Ga0070663_100097157 | Ga0070663_1000971573 | 208 |
| 149 | 3300005456 | Ga0070678_100001198 | Ga0070678_10000119814 | 208 |
| 150 | 3300005456 | Ga0070678_100012230 | Ga0070678_1000122302 | 208 |
| 151 | 3300005457 | Ga0070662_100058230 | Ga0070662_1000582301 | 208 |
| 152 | 3300005459 | Ga0068867_100051479 | Ga0068867_1000514792 | 208 |
| 153 | 3300005539 | Ga0068853_100018602 | Ga0068853_1000186027 | 208 |
| 154 | 3300005543 | Ga0070672_100004203 | Ga0070672_1000042037 | 208 |
| 155 | 3300005543 | Ga0070672_100009042 | Ga0070672_1000090428 | 208 |
| 156 | 3300005547 | Ga0070693_100139929 | Ga0070693_1001399292 | 208 |
| 157 | 3300005548 | Ga0070665_100288832 | Ga0070665_1002888322 | 208 |
| 158 | 3300005548 | Ga0070665_100541176 | Ga0070665_1005411762 | 208 |
| 159 | 3300005616 | Ga0068852_100000954 | Ga0068852_10000095424 | 208 |
| 160 | 3300005618 | Ga0068864_100004967 | Ga0068864_1000049678 | 208 |
| 161 | 3300005719 | Ga0068861_100018282 | Ga0068861_1000182824 | 208 |
| 162 | 3300005834 | Ga0068851_10041248 | Ga0068851_100412482 | 208 |
| 163 | 3300005840 | Ga0068870_10117303 | Ga0068870_101173032 | 208 |
| 164 | 3300005841 | Ga0068863_100093442 | Ga0068863_1000934422 | 208 |
| 165 | 3300005843 | Ga0068860_100008063 | Ga0068860_1000080633 | 208 |
| 166 | 3300005843 | Ga0068860_100057315 | Ga0068860_1000573154 | 208 |
| 167 | 3300006237 | Ga0097621_100052380 | Ga0097621_1000523803 | 208 |
| 168 | 3300006358 | Ga0068871_100018026 | Ga0068871_1000180262 | 208 |
| 169 | 3300006358 | Ga0068871_100054187 | Ga0068871_1000541872 | 208 |
| 170 | 3300006881 | Ga0068865_100057899 | Ga0068865_1000578992 | 208 |
| 171 | 3300009177 | Ga0105248_10242071 | Ga0105248_102420713 | 208 |
| 172 | 3300013296 | Ga0157374_10027881 | Ga0157374_100278816 | 208 |
| 173 | 3300013297 | Ga0157378_10215132 | Ga0157378_102151322 | 208 |
| 174 | 3300013297 | Ga0157378_10575632 | Ga0157378_105756322 | 208 |
| 175 | 3300013308 | Ga0157375_10002393 | Ga0157375_100023938 | 208 |
| 176 | 3300014968 | Ga0157379_10424071 | Ga0157379_104240711 | 208 |
| 177 | 3300014969 | Ga0157376_10098987 | Ga0157376_100989872 | 208 |
| 178 | 3300014969 | Ga0157376_10329793 | Ga0157376_103297932 | 208 |
| 179 | 3300017792 | Ga0163161_10025174 | Ga0163161_100251741 | 208 |
| 180 | 3300025315 | Ga0207697_10043527 | Ga0207697_100435272 | 208 |
| 181 | 3300025321 | Ga0207656_10129249 | Ga0207656_101292492 | 208 |
| 182 | 3300025893 | Ga0207682_10000122 | Ga0207682_1000012262 | 208 |
| 183 | 3300025899 | Ga0207642_10008252 | Ga0207642_100082523 | 208 |
| 184 | 3300025903 | Ga0207680_10076733 | Ga0207680_100767333 | 208 |
| 185 | 3300025903 | Ga0207680_10085030 | Ga0207680_100850302 | 208 |
| 186 | 3300025907 | Ga0207645_10000063 | Ga0207645_1000006332 | 208 |
| 187 | 3300025907 | Ga0207645_10131063 | Ga0207645_101310632 | 208 |
| 188 | 3300025908 | Ga0207643_10006191 | Ga0207643_100061912 | 208 |
| 189 | 3300025926 | Ga0207659_10001802 | Ga0207659_100018023 | 208 |
| 190 | 3300025926 | Ga0207659_10203019 | Ga0207659_102030192 | 208 |
| 191 | 3300025931 | Ga0207644_10004596 | Ga0207644_1000459612 | 208 |
| 192 | 3300025931 | Ga0207644_10756420 | Ga0207644_107564201 | 208 |
| 193 | 3300025938 | Ga0207704_10128918 | Ga0207704_101289182 | 208 |
| 194 | 3300025940 | Ga0207691_10000050 | Ga0207691_1000005072 | 208 |
| 195 | 3300025940 | Ga0207691_10024298 | Ga0207691_100242984 | 208 |
| 196 | 3300025941 | Ga0207711_10274935 | Ga0207711_102749352 | 208 |
| 197 | 3300025942 | Ga0207689_10004462 | Ga0207689_100044626 | 208 |
| 198 | 3300025942 | Ga0207689_10146973 | Ga0207689_101469732 | 208 |
| 199 | 3300025960 | Ga0207651_10001963 | Ga0207651_100019633 | 208 |
| 200 | 3300025972 | Ga0207668_10077299 | Ga0207668_100772992 | 208 |
| 201 | 3300025972 | Ga0207668_10151481 | Ga0207668_101514812 | 208 |
| 202 | 3300025981 | Ga0207640_10445096 | Ga0207640_104450961 | 208 |
| 203 | 3300025986 | Ga0207658_10009288 | Ga0207658_100092883 | 208 |
| 204 | 3300025986 | Ga0207658_10105408 | Ga0207658_101054082 | 208 |
| 205 | 3300026023 | Ga0207677_10004591 | Ga0207677_100045912 | 208 |
| 206 | 3300026023 | Ga0207677_10333989 | Ga0207677_103339891 | 208 |
| 207 | 3300026041 | Ga0207639_10051592 | Ga0207639_100515922 | 208 |
| 208 | 3300026067 | Ga0207678_10004837 | Ga0207678_100048372 | 208 |
| 209 | 3300026088 | Ga0207641_10008171 | Ga0207641_100081712 | 208 |
| 210 | 3300026089 | Ga0207648_10055433 | Ga0207648_100554332 | 208 |
| 211 | 3300026089 | Ga0207648_10179166 | Ga0207648_101791661 | 208 |
| 212 | 3300026095 | Ga0207676_10268801 | Ga0207676_102688011 | 208 |
| 213 | 3300026095 | Ga0207676_10552250 | Ga0207676_105522501 | 208 |
| 214 | 3300026118 | Ga0207675_100021979 | Ga0207675_1000219794 | 208 |
| 215 | 3300026121 | Ga0207683_10000521 | Ga0207683_1000052111 | 208 |
| 216 | 3300026121 | Ga0207683_10005585 | Ga0207683_100055857 | 208 |
| 217 | 3300028379 | Ga0268266_10008615 | Ga0268266_1000861510 | 208 |
| 218 | 3300028379 | Ga0268266_10255085 | Ga0268266_102550852 | 208 |
| 219 | 3300047472 | Ga0495686_0221088 | Ga0495686_0221088_341_1027 | 208 |
| 220 | 3300049591 | Ga0501075_0384908 | Ga0501075_0384908_369_1016 | 208 |
| 221 | 3300049744 | Ga0501083_0019458 | Ga0501083_0019458_758_1393 | 208 |
| 222 | 3300050515 | nmdc:mga0a205_1027039_c1 | nmdc:mga0a205_1027039_c1_26_661 | 208 |
| 223 | 3300053119 | Ga0500595_002989 | Ga0500595_002989_4707_5393 | 208 |
| 224 | 3300060353 | Ga0501082_0000007 | Ga0501082_0000007_98391_99026 | 208 |
| 225 | 3300005329 | Ga0070683_100069961 | Ga0070683_1000699615 | 209 |
| 226 | 3300005336 | Ga0070680_100023963 | Ga0070680_1000239634 | 209 |
| 227 | 3300005339 | Ga0070660_100057056 | Ga0070660_1000570565 | 209 |
| 228 | 3300005344 | Ga0070661_100001402 | Ga0070661_10000140216 | 209 |
| 229 | 3300005353 | Ga0070669_100052561 | Ga0070669_1000525613 | 209 |
| 230 | 3300005354 | Ga0070675_100194073 | Ga0070675_1001940731 | 209 |
| 231 | 3300005364 | Ga0070673_100307921 | Ga0070673_1003079211 | 209 |
| 232 | 3300005435 | Ga0070714_100097015 | Ga0070714_1000970151 | 209 |
| 233 | 3300005437 | Ga0070710_10141743 | Ga0070710_101417431 | 209 |
| 234 | 3300005441 | Ga0070700_100149013 | Ga0070700_1001490132 | 209 |
| 235 | 3300005444 | Ga0070694_100601952 | Ga0070694_1006019521 | 209 |
| 236 | 3300005456 | Ga0070678_100040159 | Ga0070678_1000401592 | 209 |
| 237 | 3300005458 | Ga0070681_10142015 | Ga0070681_101420154 | 209 |
| 238 | 3300005459 | Ga0068867_100306259 | Ga0068867_1003062592 | 209 |
| 239 | 3300005539 | Ga0068853_100024074 | Ga0068853_1000240747 | 209 |
| 240 | 3300005543 | Ga0070672_100009113 | Ga0070672_1000091134 | 209 |
| 241 | 3300005549 | Ga0070704_100039605 | Ga0070704_1000396054 | 209 |
| 242 | 3300005563 | Ga0068855_100013126 | Ga0068855_1000131262 | 209 |
| 243 | 3300005564 | Ga0070664_100072053 | Ga0070664_1000720533 | 209 |
| 244 | 3300005577 | Ga0068857_100000558 | Ga0068857_1000005585 | 209 |
| 245 | 3300005578 | Ga0068854_100007092 | Ga0068854_1000070923 | 209 |
| 246 | 3300005614 | Ga0068856_100061032 | Ga0068856_1000610323 | 209 |
| 247 | 3300005834 | Ga0068851_10176076 | Ga0068851_101760762 | 209 |
| 248 | 3300009545 | Ga0105237_10149771 | Ga0105237_101497716 | 209 |
| 249 | 3300009551 | Ga0105238_10054770 | Ga0105238_100547703 | 209 |
| 250 | 3300013100 | Ga0157373_10012612 | Ga0157373_100126127 | 209 |
| 251 | 3300013102 | Ga0157371_10164913 | Ga0157371_101649132 | 209 |
| 252 | 3300013105 | Ga0157369_10002671 | Ga0157369_1000267122 | 209 |
| 253 | 3300013296 | Ga0157374_10120006 | Ga0157374_101200062 | 209 |
| 254 | 3300013307 | Ga0157372_10012072 | Ga0157372_100120725 | 209 |
| 255 | 3300013308 | Ga0157375_10375468 | Ga0157375_103754682 | 209 |
| 256 | 3300025906 | Ga0207699_10019646 | Ga0207699_100196464 | 209 |
| 257 | 3300025908 | Ga0207643_10122334 | Ga0207643_101223342 | 209 |
| 258 | 3300025909 | Ga0207705_10104709 | Ga0207705_101047094 | 209 |
| 259 | 3300025912 | Ga0207707_10026873 | Ga0207707_100268734 | 209 |
| 260 | 3300025913 | Ga0207695_10021722 | Ga0207695_100217222 | 209 |
| 261 | 3300025914 | Ga0207671_10194970 | Ga0207671_101949702 | 209 |
| 262 | 3300025917 | Ga0207660_10057376 | Ga0207660_100573762 | 209 |
| 263 | 3300025919 | Ga0207657_10059084 | Ga0207657_100590845 | 209 |
| 264 | 3300025920 | Ga0207649_10005635 | Ga0207649_100056358 | 209 |
| 265 | 3300025923 | Ga0207681_10126883 | Ga0207681_101268832 | 209 |
| 266 | 3300025924 | Ga0207694_10039684 | Ga0207694_100396843 | 209 |
| 267 | 3300025928 | Ga0207700_10126910 | Ga0207700_101269102 | 209 |
| 268 | 3300025929 | Ga0207664_10011801 | Ga0207664_100118016 | 209 |
| 269 | 3300025940 | Ga0207691_10023336 | Ga0207691_100233362 | 209 |
| 270 | 3300025944 | Ga0207661_10154952 | Ga0207661_101549522 | 209 |
| 271 | 3300025945 | Ga0207679_10002734 | Ga0207679_100027342 | 209 |
| 272 | 3300025949 | Ga0207667_10003212 | Ga0207667_100032126 | 209 |
| 273 | 3300025981 | Ga0207640_10005748 | Ga0207640_100057482 | 209 |
| 274 | 3300026041 | Ga0207639_10055034 | Ga0207639_100550346 | 209 |
| 275 | 3300026075 | Ga0207708_10031895 | Ga0207708_100318954 | 209 |
| 276 | 3300026078 | Ga0207702_10014696 | Ga0207702_100146962 | 209 |
| 277 | 3300026116 | Ga0207674_10000049 | Ga0207674_1000004981 | 209 |
| 278 | 3300026142 | Ga0207698_10002475 | Ga0207698_1000247513 | 209 |
| 279 | 3300028786 | Ga0307517_10000644 | Ga0307517_1000064447 | 209 |
| 280 | 3300028786 | Ga0307517_10137131 | Ga0307517_101371312 | 209 |
| 281 | 3300028794 | Ga0307515_10176947 | Ga0307515_101769473 | 209 |
| 282 | 3300030522 | Ga0307512_10112651 | Ga0307512_101126512 | 209 |
| 283 | 3300031456 | Ga0307513_10171324 | Ga0307513_101713243 | 209 |
| 284 | 3300031507 | Ga0307509_10000041 | Ga0307509_100000416 | 209 |
| 285 | 3300031507 | Ga0307509_10009112 | Ga0307509_100091123 | 209 |
| 286 | 3300031616 | Ga0307508_10316998 | Ga0307508_103169983 | 209 |
| 287 | 3300031649 | Ga0307514_10066812 | Ga0307514_100668122 | 209 |
| 288 | 3300031649 | Ga0307514_10195461 | Ga0307514_101954612 | 209 |
| 289 | 3300033179 | Ga0307507_10045329 | Ga0307507_100453294 | 209 |
| 290 | 3300033180 | Ga0307510_10002283 | Ga0307510_100022839 | 209 |
| 291 | 3300033180 | Ga0307510_10009870 | Ga0307510_1000987011 | 209 |
| 292 | 3300033180 | Ga0307510_10067350 | Ga0307510_100673504 | 209 |
| 293 | 3300033180 | Ga0307510_10286362 | Ga0307510_102863621 | 209 |
| 294 | 3300034818 | Ga0373950_0049201 | Ga0373950_0049201_40_699 | 209 |
| 295 | 3300036401 | Ga0373937_0051941 | Ga0373937_0051941_28_666 | 209 |
| 296 | 3300037471 | Ga0395905_0016990 | Ga0395905_0016990_5309_5977 | 209 |
| 297 | 3300041460 | Ga0451802_2066676 | Ga0451802_2066676_501_1160 | 209 |
| 298 | 3300046454 | Ga0495592_0001970 | Ga0495592_0001970_1407_2069 | 209 |
| 299 | 3300046460 | Ga0495638_0116305 | Ga0495638_0116305_522_1181 | 209 |
| 300 | 3300046512 | Ga0495610_0037726 | Ga0495610_0037726_481_1140 | 209 |
| 301 | 3300046519 | Ga0495632_0147584 | Ga0495632_0147584_297_956 | 209 |
| 302 | 3300046526 | Ga0495666_0189118 | Ga0495666_0189118_30_692 | 209 |
| 303 | 3300046680 | Ga0495646_0100828 | Ga0495646_0100828_531_1193 | 209 |
| 304 | 3300050496 | nmdc:mga07m45_24947_c1 | nmdc:mga07m45_24947_c1_100_762 | 209 |
| 305 | 3300053086 | Ga0500578_0400015 | Ga0500578_0400015_17_679 | 209 |
| 306 | 3300053088 | Ga0500644_0003109 | Ga0500644_0003109_2143_2802 | 209 |
| 307 | 3300053093 | Ga0500651_0023119 | Ga0500651_0023119_374_1033 | 209 |
| 308 | 3300053093 | Ga0500651_0102264 | Ga0500651_0102264_393_1055 | 209 |
| 309 | 3300053118 | Ga0500594_0017698 | Ga0500594_0017698_222_881 | 209 |
| 310 | 3300053123 | Ga0500614_013998 | Ga0500614_013998_892_1551 | 209 |
| 311 | 3300053136 | Ga0500559_0000012 | Ga0500559_0000012_3825_4484 | 209 |
| 312 | 3300053138 | Ga0500564_179043 | Ga0500564_179043_26_688 | 209 |
| 313 | 3300053139 | Ga0500568_0057635 | Ga0500568_0057635_449_1108 | 209 |
| 314 | 3300053154 | Ga0500619_050551 | Ga0500619_050551_191_853 | 209 |
| 315 | 3300053156 | Ga0500622_0024833 | Ga0500622_0024833_1187_1846 | 209 |
| 316 | 3300053739 | Ga0500587_022219 | Ga0500587_022219_15_674 | 209 |
| 317 | iso_pu_bacteria | 2643221654 | 2644304114 | 209 |
| 318 | 3300005347 | Ga0070668_100004187 | Ga0070668_1000041876 | 210 |
| 319 | 3300005844 | Ga0068862_100218847 | Ga0068862_1002188472 | 210 |
| 320 | 3300009094 | Ga0111539_10088435 | Ga0111539_100884353 | 210 |
| 321 | 3300013308 | Ga0157375_10033432 | Ga0157375_100334322 | 210 |
| 322 | 3300013308 | Ga0157375_10129377 | Ga0157375_101293772 | 210 |
| 323 | 3300014325 | Ga0163163_10586986 | Ga0163163_105869862 | 210 |
| 324 | 3300014326 | Ga0157380_10097037 | Ga0157380_100970372 | 210 |
| 325 | 3300025923 | Ga0207681_10035031 | Ga0207681_100350312 | 210 |
| 326 | 3300025972 | Ga0207668_10085635 | Ga0207668_100856351 | 210 |
| 327 | 3300026118 | Ga0207675_100033128 | Ga0207675_1000331284 | 210 |
| 328 | 3300028380 | Ga0268265_10333498 | Ga0268265_103334981 | 210 |
| 329 | 3300035083 | Ga0373926_0186908 | Ga0373926_0186908_53_715 | 210 |
| 330 | 3300035086 | Ga0373934_0010526 | Ga0373934_0010526_378_1040 | 210 |
| 331 | 3300035111 | Ga0373923_0148735 | Ga0373923_0148735_49_711 | 210 |
| 332 | 3300035111 | Ga0373923_0248304 | Ga0373923_0248304_62_724 | 210 |
| 333 | 3300035113 | Ga0373936_0068289 | Ga0373936_0068289_785_1447 | 210 |
| 334 | 3300035117 | Ga0373953_0043817 | Ga0373953_0043817_100_762 | 210 |
| 335 | 3300035117 | Ga0373953_0109480 | Ga0373953_0109480_46_708 | 210 |
| 336 | 3300035118 | Ga0373954_0006658 | Ga0373954_0006658_4135_4797 | 210 |
| 337 | 3300035118 | Ga0373954_0029740 | Ga0373954_0029740_57_719 | 210 |
| 338 | 3300035118 | Ga0373954_0281960 | Ga0373954_0281960_91_750 | 210 |
| 339 | 3300035119 | Ga0373956_0004764 | Ga0373956_0004764_3315_3977 | 210 |
| 340 | 3300035119 | Ga0373956_0031015 | Ga0373956_0031015_1001_1663 | 210 |
| 341 | 3300035120 | Ga0373957_0031414 | Ga0373957_0031414_1246_1908 | 210 |
| 342 | 3300035171 | Ga0373946_0252714 | Ga0373946_0252714_141_803 | 210 |
| 343 | 3300035172 | Ga0373955_0022227 | Ga0373955_0022227_178_840 | 210 |
| 344 | 3300035410 | Ga0373924_0101628 | Ga0373924_0101628_285_947 | 210 |
| 345 | 3300035692 | Ga0373935_0074833 | Ga0373935_0074833_244_906 | 210 |
| 346 | 3300035724 | Ga0373933_0114087 | Ga0373933_0114087_164_826 | 210 |
| 347 | 3300035724 | Ga0373933_0132460 | Ga0373933_0132460_833_1495 | 210 |
| 348 | 3300036401 | Ga0373937_0193468 | Ga0373937_0193468_124_786 | 210 |
| 349 | 3300036401 | Ga0373937_0226181 | Ga0373937_0226181_429_1088 | 210 |
| 350 | 3300037068 | Ga0373925_0030541 | Ga0373925_0030541_844_1506 | 210 |
| 351 | 3300046454 | Ga0495592_0051483 | Ga0495592_0051483_1537_2199 | 210 |
| 352 | 3300046454 | Ga0495592_0090135 | Ga0495592_0090135_489_1151 | 210 |
| 353 | 3300046454 | Ga0495592_0128175 | Ga0495592_0128175_81_740 | 210 |
| 354 | 3300046459 | Ga0495629_0151062 | Ga0495629_0151062_335_1000 | 210 |
| 355 | 3300046459 | Ga0495629_0153427 | Ga0495629_0153427_378_1040 | 210 |
| 356 | 3300046461 | Ga0495641_0139804 | Ga0495641_0139804_71_733 | 210 |
| 357 | 3300046462 | Ga0495651_0046327 | Ga0495651_0046327_1489_2151 | 210 |
| 358 | 3300046463 | Ga0495653_0264103 | Ga0495653_0264103_327_989 | 210 |
| 359 | 3300046472 | Ga0495580_0128872 | Ga0495580_0128872_459_1121 | 210 |
| 360 | 3300046475 | Ga0495639_0025312 | Ga0495639_0025312_181_843 | 210 |
| 361 | 3300046476 | Ga0495662_0025409 | Ga0495662_0025409_1312_1974 | 210 |
| 362 | 3300046477 | Ga0495664_0026882 | Ga0495664_0026882_2666_3328 | 210 |
| 363 | 3300046511 | Ga0495608_0024660 | Ga0495608_0024660_122_784 | 210 |
| 364 | 3300046511 | Ga0495608_0071301 | Ga0495608_0071301_1137_1799 | 210 |
| 365 | 3300046516 | Ga0495628_0018439 | Ga0495628_0018439_1280_1942 | 210 |
| 366 | 3300046517 | Ga0495630_0078045 | Ga0495630_0078045_1555_2220 | 210 |
| 367 | 3300046529 | Ga0495652_0018867 | Ga0495652_0018867_1058_1717 | 210 |
| 368 | 3300046529 | Ga0495652_0152169 | Ga0495652_0152169_304_966 | 210 |
| 369 | 3300046529 | Ga0495652_0191425 | Ga0495652_0191425_239_901 | 210 |
| 370 | 3300046535 | Ga0495586_0250907 | Ga0495586_0250907_327_989 | 210 |
| 371 | 3300046536 | Ga0495587_0031018 | Ga0495587_0031018_1453_2115 | 210 |
| 372 | 3300046557 | Ga0495622_0108936 | Ga0495622_0108936_460_1125 | 210 |
| 373 | 3300046557 | Ga0495622_0271821 | Ga0495622_0271821_20_682 | 210 |
| 374 | 3300046559 | Ga0495667_0036451 | Ga0495667_0036451_379_1041 | 210 |
| 375 | 3300046559 | Ga0495667_0050414 | Ga0495667_0050414_883_1545 | 210 |
| 376 | 3300046642 | Ga0495634_0257114 | Ga0495634_0257114_78_740 | 210 |
| 377 | 3300046663 | Ga0495635_0064172 | Ga0495635_0064172_26_688 | 210 |
| 378 | 3300046675 | Ga0495657_0077848 | Ga0495657_0077848_1112_1774 | 210 |
| 379 | 3300046681 | Ga0495647_0023746 | Ga0495647_0023746_131_793 | 210 |
| 380 | 3300046683 | Ga0495658_0128525 | Ga0495658_0128525_420_1085 | 210 |
| 381 | 3300046689 | Ga0495613_0066450 | Ga0495613_0066450_1784_2446 | 210 |
| 382 | 3300046690 | Ga0495624_0037607 | Ga0495624_0037607_1435_2100 | 210 |
| 383 | 3300046690 | Ga0495624_0429525 | Ga0495624_0429525_65_727 | 210 |
| 384 | 3300047319 | Ga0495674_0082122 | Ga0495674_0082122_2055_2717 | 210 |
| 385 | 3300047321 | Ga0495676_0078685 | Ga0495676_0078685_833_1498 | 210 |
| 386 | 3300047322 | Ga0495680_0036557 | Ga0495680_0036557_845_1507 | 210 |
| 387 | 3300047444 | Ga0495675_0124627 | Ga0495675_0124627_704_1366 | 210 |
| 388 | 3300047444 | Ga0495675_0139732 | Ga0495675_0139732_722_1384 | 210 |
| 389 | 3300047673 | Ga0495593_0061448 | Ga0495593_0061448_279_944 | 210 |
| 390 | 3300050511 | nmdc:mga08y16_91943_c1 | nmdc:mga08y16_91943_c1_424_1083 | 210 |
| 391 | 3300053077 | Ga0495601_0001636 | Ga0495601_0001636_7983_8645 | 210 |
| 392 | 3300053084 | Ga0495595_0008204 | Ga0495595_0008204_717_1379 | 210 |
| 393 | 3300053733 | Ga0500552_000373 | Ga0500552_000373_240_938 | 210 |
| 394 | iso_pu_bacteria | 2585428058 | 2587734308 | 210 |
| 395 | iso_pu_bacteria | 2588253510 | 2588295242 | 210 |
| 396 | iso_pu_bacteria | 2643221547 | 2643755448 | 210 |
| 397 | 3300006038 | Ga0075365_10074403 | Ga0075365_100744033 | 211 |
| 398 | 3300021384 | Ga0213876_10155915 | Ga0213876_101559152 | 211 |
| 399 | 3300031730 | Ga0307516_10032420 | Ga0307516_100324204 | 211 |
| 400 | 3300037466 | Ga0395898_0671469 | Ga0395898_0671469_288_965 | 211 |
| 401 | 3300037471 | Ga0395905_0058630 | Ga0395905_0058630_2112_2786 | 211 |
| 402 | 3300037853 | Ga0436364_0517049 | Ga0436364_0517049_155_823 | 211 |
| 403 | 3300039437 | Ga0436365_0019248 | Ga0436365_0019248_250_918 | 211 |
| 404 | 3300048913 | Ga0496110_0096825 | Ga0496110_0096825_962_1717 | 211 |
| 405 | 3300050492 | nmdc:mga0yw44_48593_c1 | nmdc:mga0yw44_48593_c1_1673_2335 | 211 |
| 406 | 3300005355 | Ga0070671_100008470 | Ga0070671_1000084703 | 212 |
| 407 | 3300006051 | Ga0075364_10331685 | Ga0075364_103316852 | 212 |
| 408 | 3300006177 | Ga0075362_10065976 | Ga0075362_100659762 | 212 |
| 409 | 3300006178 | Ga0075367_10034846 | Ga0075367_100348462 | 212 |
| 410 | 3300006195 | Ga0075366_10329829 | Ga0075366_103298291 | 212 |
| 411 | 3300006353 | Ga0075370_10015066 | Ga0075370_100150664 | 212 |
| 412 | 3300013297 | Ga0157378_10742239 | Ga0157378_107422391 | 212 |
| 413 | 3300025297 | Ga0209758_1000096 | Ga0209758_10000962 | 212 |
| 414 | 3300025298 | Ga0209050_1016098 | Ga0209050_10160984 | 212 |
| 415 | 3300025925 | Ga0207650_10777379 | Ga0207650_107773791 | 212 |
| 416 | 3300025931 | Ga0207644_10014495 | Ga0207644_100144955 | 212 |
| 417 | 3300031247 | Ga0265340_10040813 | Ga0265340_100408132 | 212 |
| 418 | 3300048904 | Ga0496101_0014419 | Ga0496101_0014419_2947_3618 | 212 |
| 419 | 3300048907 | Ga0496104_0383570 | Ga0496104_0383570_211_882 | 212 |
| 420 | 3300048908 | Ga0496105_0250174 | Ga0496105_0250174_106_777 | 212 |
| 421 | 3300048911 | Ga0496108_0805076 | Ga0496108_0805076_13_684 | 212 |
| 422 | 3300048917 | Ga0496114_0022185 | Ga0496114_0022185_3912_4583 | 212 |
| 423 | 3300050496 | nmdc:mga07m45_139695_c1 | nmdc:mga07m45_139695_c1_277_942 | 212 |
| 424 | 3300050513 | nmdc:mga0rr50_235104_c1 | nmdc:mga0rr50_235104_c1_90_749 | 212 |
| 425 | 3300053086 | Ga0500578_0000236 | Ga0500578_0000236_2158_2823 | 212 |
| 426 | 3300053094 | Ga0500566_0158488 | Ga0500566_0158488_375_1031 | 212 |
| 427 | 3300053119 | Ga0500595_010080 | Ga0500595_010080_2171_2827 | 212 |
| 428 | 3300053131 | Ga0500652_000014 | Ga0500652_000014_104300_104956 | 212 |
| 429 | 3300053151 | Ga0500604_0014218 | Ga0500604_0014218_274_939 | 212 |
| 430 | 3300053151 | Ga0500604_0014386 | Ga0500604_0014386_269_934 | 212 |
| 431 | 3300053177 | Ga0500636_0030839 | Ga0500636_0030839_2250_2906 | 212 |
| 432 | 3300005331 | Ga0070670_100054773 | Ga0070670_1000547733 | 213 |
| 433 | 3300005333 | Ga0070677_10073698 | Ga0070677_100736981 | 213 |
| 434 | 3300005335 | Ga0070666_10382206 | Ga0070666_103822061 | 213 |
| 435 | 3300005338 | Ga0068868_100045718 | Ga0068868_1000457183 | 213 |
| 436 | 3300005340 | Ga0070689_100156508 | Ga0070689_1001565082 | 213 |
| 437 | 3300005347 | Ga0070668_100141893 | Ga0070668_1001418932 | 213 |
| 438 | 3300005353 | Ga0070669_100059683 | Ga0070669_1000596832 | 213 |
| 439 | 3300005354 | Ga0070675_100346138 | Ga0070675_1003461382 | 213 |
| 440 | 3300005355 | Ga0070671_100023761 | Ga0070671_1000237613 | 213 |
| 441 | 3300005356 | Ga0070674_100002295 | Ga0070674_1000022959 | 213 |
| 442 | 3300005364 | Ga0070673_100002654 | Ga0070673_1000026544 | 213 |
| 443 | 3300005456 | Ga0070678_100047325 | Ga0070678_1000473252 | 213 |
| 444 | 3300005459 | Ga0068867_100001776 | Ga0068867_1000017768 | 213 |
| 445 | 3300005535 | Ga0070684_100047686 | Ga0070684_1000476863 | 213 |
| 446 | 3300005543 | Ga0070672_100001907 | Ga0070672_1000019075 | 213 |
| 447 | 3300005548 | Ga0070665_100320009 | Ga0070665_1003200092 | 213 |
| 448 | 3300005564 | Ga0070664_100096792 | Ga0070664_1000967923 | 213 |
| 449 | 3300005618 | Ga0068864_100048094 | Ga0068864_1000480943 | 213 |
| 450 | 3300005834 | Ga0068851_10048291 | Ga0068851_100482912 | 213 |
| 451 | 3300005841 | Ga0068863_100792730 | Ga0068863_1007927302 | 213 |
| 452 | 3300006042 | Ga0075368_10029548 | Ga0075368_100295482 | 213 |
| 453 | 3300006358 | Ga0068871_100055704 | Ga0068871_1000557044 | 213 |
| 454 | 3300006844 | Ga0075428_100185745 | Ga0075428_1001857452 | 213 |
| 455 | 3300006847 | Ga0075431_100681393 | Ga0075431_1006813932 | 213 |
| 456 | 3300006880 | Ga0075429_100126110 | Ga0075429_1001261102 | 213 |
| 457 | 3300009093 | Ga0105240_10289082 | Ga0105240_102890823 | 213 |
| 458 | 3300009177 | Ga0105248_10277453 | Ga0105248_102774532 | 213 |
| 459 | 3300013296 | Ga0157374_10455124 | Ga0157374_104551242 | 213 |
| 460 | 3300013306 | Ga0163162_10217636 | Ga0163162_102176362 | 213 |
| 461 | 3300014325 | Ga0163163_10903823 | Ga0163163_109038231 | 213 |
| 462 | 3300014968 | Ga0157379_10905851 | Ga0157379_109058511 | 213 |
| 463 | 3300017792 | Ga0163161_10006805 | Ga0163161_100068055 | 213 |
| 464 | 3300025893 | Ga0207682_10015241 | Ga0207682_100152412 | 213 |
| 465 | 3300025907 | Ga0207645_10091642 | Ga0207645_100916422 | 213 |
| 466 | 3300025908 | Ga0207643_10156866 | Ga0207643_101568662 | 213 |
| 467 | 3300025923 | Ga0207681_10001984 | Ga0207681_100019848 | 213 |
| 468 | 3300025925 | Ga0207650_10000274 | Ga0207650_1000027442 | 213 |
| 469 | 3300025926 | Ga0207659_10004273 | Ga0207659_100042735 | 213 |
| 470 | 3300025936 | Ga0207670_10159585 | Ga0207670_101595852 | 213 |
| 471 | 3300025937 | Ga0207669_10161723 | Ga0207669_101617232 | 213 |
| 472 | 3300025940 | Ga0207691_10000494 | Ga0207691_1000049432 | 213 |
| 473 | 3300025944 | Ga0207661_10000576 | Ga0207661_1000057610 | 213 |
| 474 | 3300025960 | Ga0207651_10001168 | Ga0207651_100011684 | 213 |
| 475 | 3300026023 | Ga0207677_10361291 | Ga0207677_103612912 | 213 |
| 476 | 3300026067 | Ga0207678_10470148 | Ga0207678_104701481 | 213 |
| 477 | 3300026089 | Ga0207648_10125504 | Ga0207648_101255043 | 213 |
| 478 | 3300026095 | Ga0207676_10043371 | Ga0207676_100433712 | 213 |
| 479 | 3300026121 | Ga0207683_10018977 | Ga0207683_100189773 | 213 |
| 480 | 3300026121 | Ga0207683_10537019 | Ga0207683_105370192 | 213 |
| 481 | 3300028794 | Ga0307515_10006527 | Ga0307515_100065274 | 213 |
| 482 | 3300035089 | Ga0373944_0013956 | Ga0373944_0013956_29_718 | 213 |
| 483 | 3300048915 | Ga0496112_0692166 | Ga0496112_0692166_133_810 | 213 |
| 484 | 3300048916 | Ga0496113_0297226 | Ga0496113_0297226_462_1139 | 213 |
| 485 | 3300050495 | nmdc:mga04h51_18807_c1 | nmdc:mga04h51_18807_c1_376_1080 | 213 |
| 486 | 3300053730 | Ga0500645_025399 | Ga0500645_025399_1076_1771 | 213 |
| 487 | 3300005331 | Ga0070670_100102832 | Ga0070670_1001028322 | 214 |
| 488 | 3300006038 | Ga0075365_10192936 | Ga0075365_101929361 | 214 |
| 489 | 3300006178 | Ga0075367_10031593 | Ga0075367_100315931 | 214 |
| 490 | 3300006178 | Ga0075367_10063896 | Ga0075367_100638964 | 214 |
| 491 | 3300006358 | Ga0068871_100324958 | Ga0068871_1003249582 | 214 |
| 492 | 3300006871 | Ga0075434_100280483 | Ga0075434_1002804833 | 214 |
| 493 | 3300007076 | Ga0075435_100747087 | Ga0075435_1007470871 | 214 |
| 494 | 3300025261 | Ga0209233_1023062 | Ga0209233_10230621 | 214 |
| 495 | 3300027866 | Ga0209813_10001943 | Ga0209813_100019433 | 214 |
| 496 | 3300027907 | Ga0207428_10021134 | Ga0207428_100211344 | 214 |
| 497 | 3300028577 | Ga0265318_10006235 | Ga0265318_100062358 | 214 |
| 498 | 3300028794 | Ga0307515_10492371 | Ga0307515_104923711 | 214 |
| 499 | 3300031239 | Ga0265328_10006421 | Ga0265328_100064214 | 214 |
| 500 | 3300031250 | Ga0265331_10005867 | Ga0265331_100058676 | 214 |
| 501 | 3300031344 | Ga0265316_10082981 | Ga0265316_100829814 | 214 |
| 502 | 3300031711 | Ga0265314_10000992 | Ga0265314_1000099229 | 214 |
| 503 | 3300031712 | Ga0265342_10023182 | Ga0265342_100231822 | 214 |
| 504 | 3300032005 | Ga0307411_10464830 | Ga0307411_104648301 | 214 |
| 505 | 3300037068 | Ga0373925_0077575 | Ga0373925_0077575_196_882 | 214 |
| 506 | 3300046474 | Ga0495605_0230228 | Ga0495605_0230228_71_742 | 214 |
| 507 | 3300050494 | nmdc:mga06z11_3482_c1 | nmdc:mga06z11_3482_c1_4860_5519 | 214 |
| 508 | 3300050512 | nmdc:mga0n895_254415_c1 | nmdc:mga0n895_254415_c1_35_700 | 214 |
| 509 | 3300005445 | Ga0070708_100276280 | Ga0070708_1002762801 | 215 |
| 510 | 3300005458 | Ga0070681_10105771 | Ga0070681_101057715 | 215 |
| 511 | 3300005458 | Ga0070681_10435174 | Ga0070681_104351741 | 215 |
| 512 | 3300005467 | Ga0070706_100081665 | Ga0070706_1000816655 | 215 |
| 513 | 3300005467 | Ga0070706_100431386 | Ga0070706_1004313862 | 215 |
| 514 | 3300005548 | Ga0070665_100546888 | Ga0070665_1005468882 | 215 |
| 515 | 3300005549 | Ga0070704_100225941 | Ga0070704_1002259412 | 215 |
| 516 | 3300005563 | Ga0068855_100871674 | Ga0068855_1008716742 | 215 |
| 517 | 3300006844 | Ga0075428_100046620 | Ga0075428_1000466202 | 215 |
| 518 | 3300006846 | Ga0075430_100348418 | Ga0075430_1003484181 | 215 |
| 519 | 3300006846 | Ga0075430_100364924 | Ga0075430_1003649241 | 215 |
| 520 | 3300006847 | Ga0075431_100168059 | Ga0075431_1001680592 | 215 |
| 521 | 3300006847 | Ga0075431_100224512 | Ga0075431_1002245122 | 215 |
| 522 | 3300006880 | Ga0075429_100067370 | Ga0075429_1000673704 | 215 |
| 523 | 3300010159 | Ga0099796_10018269 | Ga0099796_100182692 | 215 |
| 524 | 3300025910 | Ga0207684_10290266 | Ga0207684_102902662 | 215 |
| 525 | 3300025910 | Ga0207684_10373988 | Ga0207684_103739881 | 215 |
| 526 | 3300025912 | Ga0207707_10376271 | Ga0207707_103762711 | 215 |
| 527 | 3300025949 | Ga0207667_10440914 | Ga0207667_104409142 | 215 |
| 528 | 3300026023 | Ga0207677_10602786 | Ga0207677_106027861 | 215 |
| 529 | 3300050508 | nmdc:mga09592_81575_c1 | nmdc:mga09592_81575_c1_939_1670 | 215 |
| 530 | 3300050509 | nmdc:mga0qj67_160268_c1 | nmdc:mga0qj67_160268_c1_966_1643 | 215 |
| 531 | 3300005440 | Ga0070705_100621343 | Ga0070705_1006213431 | 216 |
| 532 | 3300005545 | Ga0070695_100666978 | Ga0070695_1006669781 | 216 |
| 533 | 3300005617 | Ga0068859_100019725 | Ga0068859_1000197252 | 216 |
| 534 | 3300005617 | Ga0068859_100757944 | Ga0068859_1007579442 | 216 |
| 535 | 3300005618 | Ga0068864_100764493 | Ga0068864_1007644932 | 216 |
| 536 | 3300005719 | Ga0068861_100172952 | Ga0068861_1001729522 | 216 |
| 537 | 3300005843 | Ga0068860_100081432 | Ga0068860_1000814322 | 216 |
| 538 | 3300005844 | Ga0068862_100004818 | Ga0068862_1000048183 | 216 |
| 539 | 3300006871 | Ga0075434_100015291 | Ga0075434_1000152917 | 216 |
| 540 | 3300006931 | Ga0097620_100019727 | Ga0097620_1000197274 | 216 |
| 541 | 3300006931 | Ga0097620_100757915 | Ga0097620_1007579152 | 216 |
| 542 | 3300025885 | Ga0207653_10093539 | Ga0207653_100935392 | 216 |
| 543 | 3300025941 | Ga0207711_10322428 | Ga0207711_103224282 | 216 |
| 544 | 3300025961 | Ga0207712_10031710 | Ga0207712_100317103 | 216 |
| 545 | 3300026095 | Ga0207676_10100932 | Ga0207676_101009322 | 216 |
| 546 | 3300026116 | Ga0207674_10074109 | Ga0207674_100741091 | 216 |
| 547 | 3300026118 | Ga0207675_100058840 | Ga0207675_1000588401 | 216 |
| 548 | 3300028381 | Ga0268264_10183495 | Ga0268264_101834952 | 216 |
| 549 | 3300050512 | nmdc:mga0n895_8875_c1 | nmdc:mga0n895_8875_c1_4626_5294 | 216 |
| 550 | 3300005295 | Ga0065707_10255063 | Ga0065707_102550631 | 217 |
| 551 | 3300005330 | Ga0070690_100175608 | Ga0070690_1001756082 | 217 |
| 552 | 3300005330 | Ga0070690_100361168 | Ga0070690_1003611682 | 217 |
| 553 | 3300005331 | Ga0070670_100007548 | Ga0070670_1000075482 | 217 |
| 554 | 3300005344 | Ga0070661_100251563 | Ga0070661_1002515632 | 217 |
| 555 | 3300005347 | Ga0070668_100087534 | Ga0070668_1000875341 | 217 |
| 556 | 3300005353 | Ga0070669_100268259 | Ga0070669_1002682592 | 217 |
| 557 | 3300005354 | Ga0070675_100011178 | Ga0070675_1000111784 | 217 |
| 558 | 3300005364 | Ga0070673_100012746 | Ga0070673_1000127463 | 217 |
| 559 | 3300005365 | Ga0070688_100118796 | Ga0070688_1001187961 | 217 |
| 560 | 3300005440 | Ga0070705_100039696 | Ga0070705_1000396962 | 217 |
| 561 | 3300005441 | Ga0070700_100310730 | Ga0070700_1003107301 | 217 |
| 562 | 3300005456 | Ga0070678_100185416 | Ga0070678_1001854162 | 217 |
| 563 | 3300005456 | Ga0070678_100191041 | Ga0070678_1001910413 | 217 |
| 564 | 3300005457 | Ga0070662_100270900 | Ga0070662_1002709002 | 217 |
| 565 | 3300005467 | Ga0070706_100168769 | Ga0070706_1001687692 | 217 |
| 566 | 3300005518 | Ga0070699_100275195 | Ga0070699_1002751951 | 217 |
| 567 | 3300005543 | Ga0070672_100000358 | Ga0070672_10000035823 | 217 |
| 568 | 3300005618 | Ga0068864_100097466 | Ga0068864_1000974662 | 217 |
| 569 | 3300005719 | Ga0068861_100127963 | Ga0068861_1001279632 | 217 |
| 570 | 3300005841 | Ga0068863_100097753 | Ga0068863_1000977532 | 217 |
| 571 | 3300005841 | Ga0068863_100105059 | Ga0068863_1001050592 | 217 |
| 572 | 3300005843 | Ga0068860_100048446 | Ga0068860_1000484464 | 217 |
| 573 | 3300005844 | Ga0068862_100123082 | Ga0068862_1001230822 | 217 |
| 574 | 3300006038 | Ga0075365_10004100 | Ga0075365_100041008 | 217 |
| 575 | 3300006042 | Ga0075368_10001078 | Ga0075368_100010783 | 217 |
| 576 | 3300006051 | Ga0075364_10068119 | Ga0075364_100681192 | 217 |
| 577 | 3300006195 | Ga0075366_10061603 | Ga0075366_100616034 | 217 |
| 578 | 3300006353 | Ga0075370_10017847 | Ga0075370_100178476 | 217 |
| 579 | 3300006358 | Ga0068871_100055683 | Ga0068871_1000556833 | 217 |
| 580 | 3300006847 | Ga0075431_100205794 | Ga0075431_1002057942 | 217 |
| 581 | 3300006852 | Ga0075433_10016732 | Ga0075433_100167323 | 217 |
| 582 | 3300007076 | Ga0075435_100029917 | Ga0075435_1000299173 | 217 |
| 583 | 3300007076 | Ga0075435_100048782 | Ga0075435_1000487823 | 217 |
| 584 | 3300009147 | Ga0114129_10004085 | Ga0114129_100040854 | 217 |
| 585 | 3300009147 | Ga0114129_10437738 | Ga0114129_104377384 | 217 |
| 586 | 3300009177 | Ga0105248_10093446 | Ga0105248_100934462 | 217 |
| 587 | 3300013297 | Ga0157378_10814204 | Ga0157378_108142042 | 217 |
| 588 | 3300014325 | Ga0163163_10507948 | Ga0163163_105079481 | 217 |
| 589 | 3300014969 | Ga0157376_10047593 | Ga0157376_100475933 | 217 |
| 590 | 3300017792 | Ga0163161_10045283 | Ga0163161_100452834 | 217 |
| 591 | 3300025893 | Ga0207682_10113471 | Ga0207682_101134711 | 217 |
| 592 | 3300025903 | Ga0207680_10028658 | Ga0207680_100286581 | 217 |
| 593 | 3300025910 | Ga0207684_10020525 | Ga0207684_100205252 | 217 |
| 594 | 3300025910 | Ga0207684_10285449 | Ga0207684_102854492 | 217 |
| 595 | 3300025918 | Ga0207662_10173270 | Ga0207662_101732702 | 217 |
| 596 | 3300025923 | Ga0207681_10169593 | Ga0207681_101695932 | 217 |
| 597 | 3300025925 | Ga0207650_10092631 | Ga0207650_100926312 | 217 |
| 598 | 3300025931 | Ga0207644_10180703 | Ga0207644_101807032 | 217 |
| 599 | 3300025933 | Ga0207706_10278191 | Ga0207706_102781912 | 217 |
| 600 | 3300025938 | Ga0207704_10497974 | Ga0207704_104979742 | 217 |
| 601 | 3300025940 | Ga0207691_10003496 | Ga0207691_100034965 | 217 |
| 602 | 3300025941 | Ga0207711_10038504 | Ga0207711_100385044 | 217 |
| 603 | 3300025941 | Ga0207711_10056663 | Ga0207711_100566633 | 217 |
| 604 | 3300025942 | Ga0207689_10513950 | Ga0207689_105139502 | 217 |
| 605 | 3300025960 | Ga0207651_10007821 | Ga0207651_100078215 | 217 |
| 606 | 3300025972 | Ga0207668_10657839 | Ga0207668_106578391 | 217 |
| 607 | 3300026075 | Ga0207708_10285256 | Ga0207708_102852562 | 217 |
| 608 | 3300026088 | Ga0207641_10010886 | Ga0207641_100108863 | 217 |
| 609 | 3300026088 | Ga0207641_10294196 | Ga0207641_102941962 | 217 |
| 610 | 3300026089 | Ga0207648_10096683 | Ga0207648_100966832 | 217 |
| 611 | 3300026095 | Ga0207676_10269596 | Ga0207676_102695962 | 217 |
| 612 | 3300026118 | Ga0207675_100052678 | Ga0207675_1000526782 | 217 |
| 613 | 3300026121 | Ga0207683_10055869 | Ga0207683_100558694 | 217 |
| 614 | 3300026121 | Ga0207683_10215857 | Ga0207683_102158572 | 217 |
| 615 | 3300027866 | Ga0209813_10020110 | Ga0209813_100201102 | 217 |
| 616 | 3300028381 | Ga0268264_10046391 | Ga0268264_100463914 | 217 |
| 617 | 3300028381 | Ga0268264_10547190 | Ga0268264_105471902 | 217 |
| 618 | 3300031249 | Ga0265339_10064302 | Ga0265339_100643023 | 217 |
| 619 | 3300031344 | Ga0265316_10381201 | Ga0265316_103812012 | 217 |
| 620 | 3300031616 | Ga0307508_10211428 | Ga0307508_102114282 | 217 |
| 621 | 3300035088 | Ga0373940_0035624 | Ga0373940_0035624_53_715 | 217 |
| 622 | 3300036401 | Ga0373937_0545123 | Ga0373937_0545123_281_946 | 217 |
| 623 | 3300037471 | Ga0395905_0453243 | Ga0395905_0453243_82_768 | 217 |
| 624 | 3300046472 | Ga0495580_0000683 | Ga0495580_0000683_6421_7083 | 217 |
| 625 | 3300046664 | Ga0495659_0020476 | Ga0495659_0020476_532_1194 | 217 |
| 626 | 3300046684 | Ga0495669_0110227 | Ga0495669_0110227_599_1261 | 217 |
| 627 | 3300049576 | Ga0501040_0012492 | Ga0501040_0012492_3643_4326 | 217 |
| 628 | 3300049583 | Ga0501067_0089123 | Ga0501067_0089123_1036_1701 | 217 |
| 629 | 3300049584 | Ga0501068_0375390 | Ga0501068_0375390_235_900 | 217 |
| 630 | 3300049591 | Ga0501075_0059850 | Ga0501075_0059850_126_809 | 217 |
| 631 | 3300049741 | Ga0501079_0516427 | Ga0501079_0516427_222_905 | 217 |
| 632 | 3300050491 | nmdc:mga00v17_300694_c1 | nmdc:mga00v17_300694_c1_275_937 | 217 |
| 633 | 3300050494 | nmdc:mga06z11_76410_c1 | nmdc:mga06z11_76410_c1_387_1049 | 217 |
| 634 | 3300050496 | nmdc:mga07m45_13302_c1 | nmdc:mga07m45_13302_c1_1609_2271 | 217 |
| 635 | 3300050507 | nmdc:mga05p37_385834_c1 | nmdc:mga05p37_385834_c1_111_776 | 217 |
| 636 | 3300050507 | nmdc:mga05p37_39063_c1 | nmdc:mga05p37_39063_c1_276_941 | 217 |
| 637 | 3300050510 | nmdc:mga06r32_211300_c1 | nmdc:mga06r32_211300_c1_925_1590 | 217 |
| 638 | 3300050512 | nmdc:mga0n895_15085_c1 | nmdc:mga0n895_15085_c1_1608_2273 | 217 |
| 639 | 3300050513 | nmdc:mga0rr50_104975_c1 | nmdc:mga0rr50_104975_c1_938_1600 | 217 |
| 640 | 3300050513 | nmdc:mga0rr50_107066_c1 | nmdc:mga0rr50_107066_c1_386_1048 | 217 |
| 641 | 3300050513 | nmdc:mga0rr50_43068_c1 | nmdc:mga0rr50_43068_c1_1368_2033 | 217 |
| 642 | 3300050514 | nmdc:mga08x19_29952_c1 | nmdc:mga08x19_29952_c1_1608_2273 | 217 |
| 643 | 3300050514 | nmdc:mga08x19_63051_c1 | nmdc:mga08x19_63051_c1_149_811 | 217 |
| 644 | 3300053158 | Ga0500627_0019136 | Ga0500627_0019136_1523_2185 | 217 |
| 645 | 3300004798 | Ga0058859_11552955 | Ga0058859_115529551 | 218 |
| 646 | 3300004801 | Ga0058860_10052366 | Ga0058860_100523663 | 218 |
| 647 | 3300005331 | Ga0070670_100019991 | Ga0070670_1000199914 | 218 |
| 648 | 3300005331 | Ga0070670_100061705 | Ga0070670_1000617052 | 218 |
| 649 | 3300005367 | Ga0070667_100103969 | Ga0070667_1001039693 | 218 |
| 650 | 3300005617 | Ga0068859_100394422 | Ga0068859_1003944222 | 218 |
| 651 | 3300005617 | Ga0068859_100620337 | Ga0068859_1006203371 | 218 |
| 652 | 3300005981 | Ga0081538_10003120 | Ga0081538_100031205 | 218 |
| 653 | 3300005981 | Ga0081538_10043104 | Ga0081538_100431042 | 218 |
| 654 | 3300005985 | Ga0081539_10003651 | Ga0081539_1000365116 | 218 |
| 655 | 3300006175 | Ga0070712_100916821 | Ga0070712_1009168211 | 218 |
| 656 | 3300006844 | Ga0075428_100153765 | Ga0075428_1001537655 | 218 |
| 657 | 3300006846 | Ga0075430_100026999 | Ga0075430_1000269994 | 218 |
| 658 | 3300006847 | Ga0075431_100176379 | Ga0075431_1001763792 | 218 |
| 659 | 3300006847 | Ga0075431_100307511 | Ga0075431_1003075112 | 218 |
| 660 | 3300006852 | Ga0075433_10830418 | Ga0075433_108304181 | 218 |
| 661 | 3300006871 | Ga0075434_100018111 | Ga0075434_1000181118 | 218 |
| 662 | 3300006880 | Ga0075429_100010700 | Ga0075429_1000107006 | 218 |
| 663 | 3300006880 | Ga0075429_100228267 | Ga0075429_1002282672 | 218 |
| 664 | 3300006914 | Ga0075436_100058363 | Ga0075436_1000583633 | 218 |
| 665 | 3300006931 | Ga0097620_100394410 | Ga0097620_1003944102 | 218 |
| 666 | 3300006931 | Ga0097620_100620307 | Ga0097620_1006203071 | 218 |
| 667 | 3300007076 | Ga0075435_100093896 | Ga0075435_1000938963 | 218 |
| 668 | 3300009094 | Ga0111539_10103969 | Ga0111539_101039694 | 218 |
| 669 | 3300009147 | Ga0114129_10055021 | Ga0114129_100550212 | 218 |
| 670 | 3300009147 | Ga0114129_10066913 | Ga0114129_100669133 | 218 |
| 671 | 3300009147 | Ga0114129_10129972 | Ga0114129_101299723 | 218 |
| 672 | 3300009147 | Ga0114129_10142943 | Ga0114129_101429432 | 218 |
| 673 | 3300009553 | Ga0105249_10048918 | Ga0105249_100489183 | 218 |
| 674 | 3300013308 | Ga0157375_10108398 | Ga0157375_101083982 | 218 |
| 675 | 3300013308 | Ga0157375_10180892 | Ga0157375_101808922 | 218 |
| 676 | 3300025925 | Ga0207650_10021279 | Ga0207650_100212794 | 218 |
| 677 | 3300025925 | Ga0207650_10159659 | Ga0207650_101596592 | 218 |
| 678 | 3300025940 | Ga0207691_10096509 | Ga0207691_100965092 | 218 |
| 679 | 3300025961 | Ga0207712_10098538 | Ga0207712_100985381 | 218 |
| 680 | 3300027671 | Ga0209588_1077418 | Ga0209588_10774182 | 218 |
| 681 | 3300028380 | Ga0268265_10005564 | Ga0268265_100055642 | 218 |
| 682 | 3300031241 | Ga0265325_10006840 | Ga0265325_100068407 | 218 |
| 683 | 3300035111 | Ga0373923_0267302 | Ga0373923_0267302_23_697 | 218 |
| 684 | 3300035171 | Ga0373946_0111546 | Ga0373946_0111546_25_699 | 218 |
| 685 | 3300035171 | Ga0373946_0255206 | Ga0373946_0255206_160_834 | 218 |
| 686 | 3300035692 | Ga0373935_0039383 | Ga0373935_0039383_1780_2454 | 218 |
| 687 | 3300035692 | Ga0373935_0134875 | Ga0373935_0134875_888_1562 | 218 |
| 688 | 3300035695 | Ga0373927_0022826 | Ga0373927_0022826_3128_3802 | 218 |
| 689 | 3300035725 | Ga0373947_0391886 | Ga0373947_0391886_19_693 | 218 |
| 690 | 3300035725 | Ga0373947_0570793 | Ga0373947_0570793_60_734 | 218 |
| 691 | 3300037068 | Ga0373925_0095744 | Ga0373925_0095744_1375_2049 | 218 |
| 692 | 3300037068 | Ga0373925_0390326 | Ga0373925_0390326_290_964 | 218 |
| 693 | 3300042008 | Ga0439450_039217 | Ga0439450_039217_141_821 | 218 |
| 694 | 3300042876 | Ga0451577_0718923 | Ga0451577_0718923_72_854 | 218 |
| 695 | 3300046473 | Ga0495582_0104641 | Ga0495582_0104641_686_1360 | 218 |
| 696 | 3300046514 | Ga0495618_0398466 | Ga0495618_0398466_72_746 | 218 |
| 697 | 3300046516 | Ga0495628_0312523 | Ga0495628_0312523_87_761 | 218 |
| 698 | 3300046516 | Ga0495628_0433060 | Ga0495628_0433060_199_873 | 218 |
| 699 | 3300046517 | Ga0495630_0206881 | Ga0495630_0206881_654_1328 | 218 |
| 700 | 3300046533 | Ga0495640_0024230 | Ga0495640_0024230_3426_4100 | 218 |
| 701 | 3300046533 | Ga0495640_0060233 | Ga0495640_0060233_1642_2316 | 218 |
| 702 | 3300046683 | Ga0495658_0135058 | Ga0495658_0135058_34_708 | 218 |
| 703 | 3300049568 | Ga0501031_0415882 | Ga0501031_0415882_129_809 | 218 |
| 704 | 3300049577 | Ga0501041_0073839 | Ga0501041_0073839_77_757 | 218 |
| 705 | 3300049582 | Ga0501048_0342264 | Ga0501048_0342264_149_829 | 218 |
| 706 | 3300049587 | Ga0501071_0149658 | Ga0501071_0149658_530_1210 | 218 |
| 707 | 3300049588 | Ga0501072_0455892 | Ga0501072_0455892_209_889 | 218 |
| 708 | 3300049590 | Ga0501074_0415371 | Ga0501074_0415371_254_934 | 218 |
| 709 | 3300049591 | Ga0501075_0177917 | Ga0501075_0177917_468_1148 | 218 |
| 710 | 3300049593 | Ga0501077_0074645 | Ga0501077_0074645_853_1527 | 218 |
| 711 | 3300049742 | Ga0501080_0337147 | Ga0501080_0337147_369_1049 | 218 |
| 712 | 3300049743 | Ga0501081_0377416 | Ga0501081_0377416_114_794 | 218 |
| 713 | 3300050507 | nmdc:mga05p37_10207_c1 | nmdc:mga05p37_10207_c1_4000_4677 | 218 |
| 714 | 3300050507 | nmdc:mga05p37_104271_c1 | nmdc:mga05p37_104271_c1_601_1275 | 218 |
| 715 | 3300050507 | nmdc:mga05p37_15856_c1 | nmdc:mga05p37_15856_c1_952_1626 | 218 |
| 716 | 3300050507 | nmdc:mga05p37_85076_c1 | nmdc:mga05p37_85076_c1_1416_2084 | 218 |
| 717 | 3300050508 | nmdc:mga09592_169100_c1 | nmdc:mga09592_169100_c1_989_1663 | 218 |
| 718 | 3300050508 | nmdc:mga09592_7756_c1 | nmdc:mga09592_7756_c1_5524_6198 | 218 |
| 719 | 3300050509 | nmdc:mga0qj67_58551_c1 | nmdc:mga0qj67_58551_c1_73_747 | 218 |
| 720 | 3300050510 | nmdc:mga06r32_35577_c1 | nmdc:mga06r32_35577_c1_1850_2524 | 218 |
| 721 | 3300050510 | nmdc:mga06r32_77499_c1 | nmdc:mga06r32_77499_c1_1139_1813 | 218 |
| 722 | 3300050513 | nmdc:mga0rr50_135279_c1 | nmdc:mga0rr50_135279_c1_1111_1779 | 218 |
| 723 | 3300050514 | nmdc:mga08x19_170263_c1 | nmdc:mga08x19_170263_c1_497_1165 | 218 |
| 724 | 3300050515 | nmdc:mga0a205_242974_c1 | nmdc:mga0a205_242974_c1_55_729 | 218 |
| 725 | 3300053085 | Ga0495619_0191701 | Ga0495619_0191701_490_1164 | 218 |
| 726 | 3300054114 | Ga0501084_0057776 | Ga0501084_0057776_1342_2022 | 218 |
| 727 | 3300060353 | Ga0501082_0834466 | Ga0501082_0834466_65_745 | 218 |
| 728 | 3300061734 | Ga0530510_0070238 | Ga0530510_0070238_1320_2000 | 218 |
| 729 | 2209111006 | 2214828542 | 2213866878 | 219 |
| 730 | 3300000041 | ARcpr5oldR_c000138 | ARcpr5oldR_0001386 | 219 |
| 731 | 3300000042 | ARSoilYngRDRAFT_c00004 | ARSoilYngRDRAFT_0000419 | 219 |
| 732 | 3300000043 | ARcpr5yngRDRAFT_c000060 | ARcpr5yngRDRAFT_0000609 | 219 |
| 733 | 3300000044 | ARSoilOldRDRAFT_c000133 | ARSoilOldRDRAFT_00013313 | 219 |
| 734 | 3300000045 | ARCol0oldRDRAFT_c00433 | ARCol0oldRDRAFT_004333 | 219 |
| 735 | 3300000652 | ARCol0yngRDRAFT_1000084 | ARCol0yngRDRAFT_100008415 | 219 |
| 736 | 3300001915 | JGI24741J21665_1015598 | JGI24741J21665_10155982 | 219 |
| 737 | 3300001978 | JGI24747J21853_1013193 | JGI24747J21853_10131931 | 219 |
| 738 | 3300001990 | JGI24737J22298_10000934 | JGI24737J22298_100009344 | 219 |
| 739 | 3300001991 | JGI24743J22301_10007855 | JGI24743J22301_100078554 | 219 |
| 740 | 3300002067 | JGI24735J21928_10028325 | JGI24735J21928_100283254 | 219 |
| 741 | 3300002070 | JGI24750J21931_1000032 | JGI24750J21931_10000327 | 219 |
| 742 | 3300002074 | JGI24748J21848_1000782 | JGI24748J21848_10007826 | 219 |
| 743 | 3300002075 | JGI24738J21930_10001211 | JGI24738J21930_100012116 | 219 |
| 744 | 3300002076 | JGI24749J21850_1003266 | JGI24749J21850_10032664 | 219 |
| 745 | 3300002126 | JGI24035J26624_1000066 | JGI24035J26624_10000667 | 219 |
| 746 | 3300002155 | JGI24033J26618_1000292 | JGI24033J26618_10002924 | 219 |
| 747 | 3300002239 | JGI24034J26672_10000075 | JGI24034J26672_1000007524 | 219 |
| 748 | 3300002244 | JGI24742J22300_10000054 | JGI24742J22300_1000005417 | 219 |
| 749 | 3300002459 | JGI24751J29686_10010139 | JGI24751J29686_100101392 | 219 |
| 750 | 3300005276 | Ga0065717_1002020 | Ga0065717_10020203 | 219 |
| 751 | 3300005288 | Ga0065714_10180179 | Ga0065714_101801792 | 219 |
| 752 | 3300005289 | Ga0065704_10072529 | Ga0065704_100725299 | 219 |
| 753 | 3300005293 | Ga0065715_10089082 | Ga0065715_1008908215 | 219 |
| 754 | 3300005295 | Ga0065707_10127028 | Ga0065707_101270281 | 219 |
| 755 | 3300005328 | Ga0070676_10000062 | Ga0070676_100000628 | 219 |
| 756 | 3300005329 | Ga0070683_100000259 | Ga0070683_10000025926 | 219 |
| 757 | 3300005330 | Ga0070690_100001045 | Ga0070690_10000104515 | 219 |
| 758 | 3300005330 | Ga0070690_100375896 | Ga0070690_1003758962 | 219 |
| 759 | 3300005331 | Ga0070670_100008320 | Ga0070670_1000083201 | 219 |
| 760 | 3300005333 | Ga0070677_10000077 | Ga0070677_1000007726 | 219 |
| 761 | 3300005334 | Ga0068869_100000095 | Ga0068869_10000009526 | 219 |
| 762 | 3300005336 | Ga0070680_100001342 | Ga0070680_10000134218 | 219 |
| 763 | 3300005336 | Ga0070680_100102792 | Ga0070680_1001027923 | 219 |
| 764 | 3300005337 | Ga0070682_100000511 | Ga0070682_1000005118 | 219 |
| 765 | 3300005338 | Ga0068868_100009255 | Ga0068868_1000092552 | 219 |
| 766 | 3300005339 | Ga0070660_100000871 | Ga0070660_10000087122 | 219 |
| 767 | 3300005339 | Ga0070660_100230869 | Ga0070660_1002308691 | 219 |
| 768 | 3300005340 | Ga0070689_100006542 | Ga0070689_1000065423 | 219 |
| 769 | 3300005340 | Ga0070689_100081269 | Ga0070689_1000812693 | 219 |
| 770 | 3300005341 | Ga0070691_10014544 | Ga0070691_100145443 | 219 |
| 771 | 3300005343 | Ga0070687_100000489 | Ga0070687_1000004893 | 219 |
| 772 | 3300005343 | Ga0070687_100091102 | Ga0070687_1000911021 | 219 |
| 773 | 3300005344 | Ga0070661_100000912 | Ga0070661_10000091223 | 219 |
| 774 | 3300005345 | Ga0070692_10002749 | Ga0070692_100027496 | 219 |
| 775 | 3300005345 | Ga0070692_10132000 | Ga0070692_101320002 | 219 |
| 776 | 3300005347 | Ga0070668_100041387 | Ga0070668_1000413873 | 219 |
| 777 | 3300005353 | Ga0070669_100000627 | Ga0070669_10000062723 | 219 |
| 778 | 3300005354 | Ga0070675_100000524 | Ga0070675_1000005248 | 219 |
| 779 | 3300005355 | Ga0070671_100000935 | Ga0070671_10000093513 | 219 |
| 780 | 3300005356 | Ga0070674_100001658 | Ga0070674_1000016588 | 219 |
| 781 | 3300005364 | Ga0070673_100000144 | Ga0070673_10000014426 | 219 |
| 782 | 3300005365 | Ga0070688_100000524 | Ga0070688_1000005243 | 219 |
| 783 | 3300005365 | Ga0070688_100296014 | Ga0070688_1002960142 | 219 |
| 784 | 3300005366 | Ga0070659_100001134 | Ga0070659_10000113421 | 219 |
| 785 | 3300005367 | Ga0070667_100008892 | Ga0070667_10000889210 | 219 |
| 786 | 3300005367 | Ga0070667_100071531 | Ga0070667_1000715313 | 219 |
| 787 | 3300005367 | Ga0070667_100241346 | Ga0070667_1002413463 | 219 |
| 788 | 3300005406 | Ga0070703_10003476 | Ga0070703_100034762 | 219 |
| 789 | 3300005438 | Ga0070701_10000059 | Ga0070701_1000005930 | 219 |
| 790 | 3300005440 | Ga0070705_100000717 | Ga0070705_10000071720 | 219 |
| 791 | 3300005440 | Ga0070705_100214331 | Ga0070705_1002143311 | 219 |
| 792 | 3300005441 | Ga0070700_100002047 | Ga0070700_10000204711 | 219 |
| 793 | 3300005441 | Ga0070700_100286538 | Ga0070700_1002865382 | 219 |
| 794 | 3300005444 | Ga0070694_100001020 | Ga0070694_1000010203 | 219 |
| 795 | 3300005444 | Ga0070694_100105214 | Ga0070694_1001052142 | 219 |
| 796 | 3300005445 | Ga0070708_100113828 | Ga0070708_1001138283 | 219 |
| 797 | 3300005455 | Ga0070663_100000339 | Ga0070663_1000003398 | 219 |
| 798 | 3300005456 | Ga0070678_100005238 | Ga0070678_1000052385 | 219 |
| 799 | 3300005457 | Ga0070662_100011568 | Ga0070662_1000115683 | 219 |
| 800 | 3300005458 | Ga0070681_10002595 | Ga0070681_100025953 | 219 |
| 801 | 3300005459 | Ga0068867_100000325 | Ga0068867_10000032516 | 219 |
| 802 | 3300005466 | Ga0070685_10002882 | Ga0070685_100028825 | 219 |
| 803 | 3300005468 | Ga0070707_100878257 | Ga0070707_1008782571 | 219 |
| 804 | 3300005530 | Ga0070679_100001410 | Ga0070679_1000014103 | 219 |
| 805 | 3300005535 | Ga0070684_100000526 | Ga0070684_1000005263 | 219 |
| 806 | 3300005539 | Ga0068853_100002423 | Ga0068853_10000242311 | 219 |
| 807 | 3300005539 | Ga0068853_100426231 | Ga0068853_1004262311 | 219 |
| 808 | 3300005543 | Ga0070672_100000433 | Ga0070672_1000004339 | 219 |
| 809 | 3300005544 | Ga0070686_100000704 | Ga0070686_10000070421 | 219 |
| 810 | 3300005544 | Ga0070686_100091419 | Ga0070686_1000914192 | 219 |
| 811 | 3300005545 | Ga0070695_100019851 | Ga0070695_1000198513 | 219 |
| 812 | 3300005545 | Ga0070695_100058832 | Ga0070695_1000588323 | 219 |
| 813 | 3300005546 | Ga0070696_100012571 | Ga0070696_1000125716 | 219 |
| 814 | 3300005547 | Ga0070693_100017619 | Ga0070693_1000176193 | 219 |
| 815 | 3300005549 | Ga0070704_100000341 | Ga0070704_1000003413 | 219 |
| 816 | 3300005563 | Ga0068855_100006286 | Ga0068855_1000062869 | 219 |
| 817 | 3300005564 | Ga0070664_100001370 | Ga0070664_10000137021 | 219 |
| 818 | 3300005564 | Ga0070664_100076766 | Ga0070664_1000767663 | 219 |
| 819 | 3300005564 | Ga0070664_100240821 | Ga0070664_1002408212 | 219 |
| 820 | 3300005577 | Ga0068857_100000521 | Ga0068857_10000052117 | 219 |
| 821 | 3300005577 | Ga0068857_100256915 | Ga0068857_1002569152 | 219 |
| 822 | 3300005578 | Ga0068854_100000532 | Ga0068854_10000053224 | 219 |
| 823 | 3300005614 | Ga0068856_100002364 | Ga0068856_1000023644 | 219 |
| 824 | 3300005615 | Ga0070702_100000207 | Ga0070702_10000020715 | 219 |
| 825 | 3300005616 | Ga0068852_100006852 | Ga0068852_1000068529 | 219 |
| 826 | 3300005617 | Ga0068859_100002298 | Ga0068859_1000022984 | 219 |
| 827 | 3300005617 | Ga0068859_100284169 | Ga0068859_1002841691 | 219 |
| 828 | 3300005618 | Ga0068864_100003173 | Ga0068864_1000031734 | 219 |
| 829 | 3300005618 | Ga0068864_100281229 | Ga0068864_1002812292 | 219 |
| 830 | 3300005618 | Ga0068864_100846264 | Ga0068864_1008462641 | 219 |
| 831 | 3300005718 | Ga0068866_10000912 | Ga0068866_1000091214 | 219 |
| 832 | 3300005719 | Ga0068861_100000416 | Ga0068861_1000004164 | 219 |
| 833 | 3300005719 | Ga0068861_100674498 | Ga0068861_1006744981 | 219 |
| 834 | 3300005834 | Ga0068851_10037574 | Ga0068851_100375741 | 219 |
| 835 | 3300005840 | Ga0068870_10000034 | Ga0068870_1000003426 | 219 |
| 836 | 3300005841 | Ga0068863_100002182 | Ga0068863_1000021824 | 219 |
| 837 | 3300005842 | Ga0068858_100004013 | Ga0068858_10000401315 | 219 |
| 838 | 3300005842 | Ga0068858_100128549 | Ga0068858_1001285492 | 219 |
| 839 | 3300005842 | Ga0068858_100620650 | Ga0068858_1006206502 | 219 |
| 840 | 3300005843 | Ga0068860_100069835 | Ga0068860_1000698353 | 219 |
| 841 | 3300005843 | Ga0068860_100322876 | Ga0068860_1003228762 | 219 |
| 842 | 3300005843 | Ga0068860_100655696 | Ga0068860_1006556962 | 219 |
| 843 | 3300005844 | Ga0068862_100001525 | Ga0068862_10000152524 | 219 |
| 844 | 3300005844 | Ga0068862_100053036 | Ga0068862_1000530363 | 219 |
| 845 | 3300005937 | Ga0081455_10000204 | Ga0081455_1000020412 | 219 |
| 846 | 3300005983 | Ga0081540_1021931 | Ga0081540_10219312 | 219 |
| 847 | 3300006058 | Ga0075432_10002270 | Ga0075432_100022703 | 219 |
| 848 | 3300006178 | Ga0075367_10028577 | Ga0075367_100285772 | 219 |
| 849 | 3300006194 | Ga0075427_10002073 | Ga0075427_100020732 | 219 |
| 850 | 3300006237 | Ga0097621_100000010 | Ga0097621_100000010111 | 219 |
| 851 | 3300006358 | Ga0068871_100000193 | Ga0068871_10000019328 | 219 |
| 852 | 3300006844 | Ga0075428_100021307 | Ga0075428_1000213077 | 219 |
| 853 | 3300006846 | Ga0075430_100000112 | Ga0075430_10000011221 | 219 |
| 854 | 3300006847 | Ga0075431_100004280 | Ga0075431_10000428013 | 219 |
| 855 | 3300006852 | Ga0075433_10000639 | Ga0075433_1000063911 | 219 |
| 856 | 3300006852 | Ga0075433_10028231 | Ga0075433_100282315 | 219 |
| 857 | 3300006852 | Ga0075433_10069403 | Ga0075433_100694033 | 219 |
| 858 | 3300006871 | Ga0075434_100000661 | Ga0075434_10000066117 | 219 |
| 859 | 3300006871 | Ga0075434_100001173 | Ga0075434_1000011735 | 219 |
| 860 | 3300006880 | Ga0075429_100000479 | Ga0075429_10000047917 | 219 |
| 861 | 3300006881 | Ga0068865_100000252 | Ga0068865_10000025221 | 219 |
| 862 | 3300006931 | Ga0097620_100002298 | Ga0097620_10000229821 | 219 |
| 863 | 3300006931 | Ga0097620_100284156 | Ga0097620_1002841561 | 219 |
| 864 | 3300007076 | Ga0075435_100154525 | Ga0075435_1001545254 | 219 |
| 865 | 3300009093 | Ga0105240_10042779 | Ga0105240_100427796 | 219 |
| 866 | 3300009094 | Ga0111539_10003320 | Ga0111539_1000332023 | 219 |
| 867 | 3300009094 | Ga0111539_10004062 | Ga0111539_100040628 | 219 |
| 868 | 3300009094 | Ga0111539_10005715 | Ga0111539_1000571517 | 219 |
| 869 | 3300009101 | Ga0105247_10001439 | Ga0105247_100014393 | 219 |
| 870 | 3300009147 | Ga0114129_10025348 | Ga0114129_100253489 | 219 |
| 871 | 3300009148 | Ga0105243_10002371 | Ga0105243_1000237114 | 219 |
| 872 | 3300009174 | Ga0105241_10000770 | Ga0105241_100007709 | 219 |
| 873 | 3300009176 | Ga0105242_10002422 | Ga0105242_100024224 | 219 |
| 874 | 3300009177 | Ga0105248_10002790 | Ga0105248_100027904 | 219 |
| 875 | 3300009177 | Ga0105248_10008272 | Ga0105248_100082728 | 219 |
| 876 | 3300009545 | Ga0105237_10013310 | Ga0105237_100133101 | 219 |
| 877 | 3300009545 | Ga0105237_10234058 | Ga0105237_102340581 | 219 |
| 878 | 3300009553 | Ga0105249_10001686 | Ga0105249_1000168621 | 219 |
| 879 | 3300009553 | Ga0105249_10502274 | Ga0105249_105022742 | 219 |
| 880 | 3300010375 | Ga0105239_10032940 | Ga0105239_100329402 | 219 |
| 881 | 3300011119 | Ga0105246_10000081 | Ga0105246_100000819 | 219 |
| 882 | 3300011119 | Ga0105246_10379094 | Ga0105246_103790942 | 219 |
| 883 | 3300012476 | Ga0157344_1000345 | Ga0157344_10003452 | 219 |
| 884 | 3300012492 | Ga0157335_1001295 | Ga0157335_10012952 | 219 |
| 885 | 3300012494 | Ga0157341_1000159 | Ga0157341_10001592 | 219 |
| 886 | 3300013100 | Ga0157373_10058688 | Ga0157373_100586883 | 219 |
| 887 | 3300013102 | Ga0157371_10020506 | Ga0157371_100205065 | 219 |
| 888 | 3300013296 | Ga0157374_10009607 | Ga0157374_1000960710 | 219 |
| 889 | 3300013297 | Ga0157378_10000990 | Ga0157378_100009902 | 219 |
| 890 | 3300013306 | Ga0163162_10005170 | Ga0163162_100051707 | 219 |
| 891 | 3300013306 | Ga0163162_11619450 | Ga0163162_116194501 | 219 |
| 892 | 3300013307 | Ga0157372_10016190 | Ga0157372_100161909 | 219 |
| 893 | 3300013308 | Ga0157375_10000944 | Ga0157375_100009449 | 219 |
| 894 | 3300013308 | Ga0157375_10949582 | Ga0157375_109495821 | 219 |
| 895 | 3300014325 | Ga0163163_10010654 | Ga0163163_100106549 | 219 |
| 896 | 3300014325 | Ga0163163_10032566 | Ga0163163_100325667 | 219 |
| 897 | 3300014326 | Ga0157380_10000321 | Ga0157380_1000032127 | 219 |
| 898 | 3300014326 | Ga0157380_10116040 | Ga0157380_101160403 | 219 |
| 899 | 3300014497 | Ga0182008_10101751 | Ga0182008_101017511 | 219 |
| 900 | 3300014968 | Ga0157379_10039887 | Ga0157379_100398874 | 219 |
| 901 | 3300014968 | Ga0157379_10118758 | Ga0157379_101187583 | 219 |
| 902 | 3300014969 | Ga0157376_10000098 | Ga0157376_1000009852 | 219 |
| 903 | 3300017792 | Ga0163161_10000866 | Ga0163161_1000086625 | 219 |
| 904 | 3300025271 | Ga0207666_1000027 | Ga0207666_10000279 | 219 |
| 905 | 3300025315 | Ga0207697_10000553 | Ga0207697_100005534 | 219 |
| 906 | 3300025315 | Ga0207697_10054565 | Ga0207697_100545653 | 219 |
| 907 | 3300025885 | Ga0207653_10002753 | Ga0207653_100027533 | 219 |
| 908 | 3300025893 | Ga0207682_10000006 | Ga0207682_1000000679 | 219 |
| 909 | 3300025899 | Ga0207642_10000107 | Ga0207642_100001074 | 219 |
| 910 | 3300025900 | Ga0207710_10000632 | Ga0207710_100006323 | 219 |
| 911 | 3300025901 | Ga0207688_10000205 | Ga0207688_100002054 | 219 |
| 912 | 3300025903 | Ga0207680_10108104 | Ga0207680_101081041 | 219 |
| 913 | 3300025904 | Ga0207647_10067576 | Ga0207647_100675764 | 219 |
| 914 | 3300025904 | Ga0207647_10133908 | Ga0207647_101339082 | 219 |
| 915 | 3300025907 | Ga0207645_10000023 | Ga0207645_1000002397 | 219 |
| 916 | 3300025908 | Ga0207643_10000007 | Ga0207643_1000000788 | 219 |
| 917 | 3300025911 | Ga0207654_10001016 | Ga0207654_100010166 | 219 |
| 918 | 3300025912 | Ga0207707_10000786 | Ga0207707_1000078626 | 219 |
| 919 | 3300025912 | Ga0207707_10245998 | Ga0207707_102459982 | 219 |
| 920 | 3300025913 | Ga0207695_10070670 | Ga0207695_100706703 | 219 |
| 921 | 3300025914 | Ga0207671_10058655 | Ga0207671_100586553 | 219 |
| 922 | 3300025914 | Ga0207671_10751091 | Ga0207671_107510911 | 219 |
| 923 | 3300025917 | Ga0207660_10000058 | Ga0207660_1000005827 | 219 |
| 924 | 3300025918 | Ga0207662_10000896 | Ga0207662_100008964 | 219 |
| 925 | 3300025918 | Ga0207662_10190196 | Ga0207662_101901962 | 219 |
| 926 | 3300025919 | Ga0207657_10002630 | Ga0207657_100026304 | 219 |
| 927 | 3300025919 | Ga0207657_10241770 | Ga0207657_102417702 | 219 |
| 928 | 3300025920 | Ga0207649_10000384 | Ga0207649_1000038432 | 219 |
| 929 | 3300025921 | Ga0207652_10000377 | Ga0207652_1000037729 | 219 |
| 930 | 3300025923 | Ga0207681_10000100 | Ga0207681_100001008 | 219 |
| 931 | 3300025923 | Ga0207681_10163502 | Ga0207681_101635022 | 219 |
| 932 | 3300025925 | Ga0207650_10038763 | Ga0207650_100387633 | 219 |
| 933 | 3300025926 | Ga0207659_10000044 | Ga0207659_1000004423 | 219 |
| 934 | 3300025927 | Ga0207687_10001241 | Ga0207687_100012412 | 219 |
| 935 | 3300025931 | Ga0207644_10000690 | Ga0207644_100006905 | 219 |
| 936 | 3300025932 | Ga0207690_10000601 | Ga0207690_100006015 | 219 |
| 937 | 3300025932 | Ga0207690_10252935 | Ga0207690_102529352 | 219 |
| 938 | 3300025933 | Ga0207706_10001769 | Ga0207706_100017694 | 219 |
| 939 | 3300025933 | Ga0207706_10184470 | Ga0207706_101844702 | 219 |
| 940 | 3300025934 | Ga0207686_10000222 | Ga0207686_1000022225 | 219 |
| 941 | 3300025935 | Ga0207709_10000154 | Ga0207709_1000015426 | 219 |
| 942 | 3300025936 | Ga0207670_10000129 | Ga0207670_1000012927 | 219 |
| 943 | 3300025937 | Ga0207669_10000160 | Ga0207669_100001606 | 219 |
| 944 | 3300025937 | Ga0207669_10191086 | Ga0207669_101910862 | 219 |
| 945 | 3300025940 | Ga0207691_10000405 | Ga0207691_100004059 | 219 |
| 946 | 3300025941 | Ga0207711_10006895 | Ga0207711_100068959 | 219 |
| 947 | 3300025942 | Ga0207689_10000098 | Ga0207689_1000009821 | 219 |
| 948 | 3300025944 | Ga0207661_10000178 | Ga0207661_1000017823 | 219 |
| 949 | 3300025944 | Ga0207661_10484716 | Ga0207661_104847161 | 219 |
| 950 | 3300025945 | Ga0207679_10000029 | Ga0207679_10000029110 | 219 |
| 951 | 3300025945 | Ga0207679_10117306 | Ga0207679_101173062 | 219 |
| 952 | 3300025945 | Ga0207679_10141454 | Ga0207679_101414543 | 219 |
| 953 | 3300025949 | Ga0207667_10049074 | Ga0207667_100490745 | 219 |
| 954 | 3300025960 | Ga0207651_10000031 | Ga0207651_1000003123 | 219 |
| 955 | 3300025961 | Ga0207712_10000129 | Ga0207712_1000012914 | 219 |
| 956 | 3300025961 | Ga0207712_10110049 | Ga0207712_101100492 | 219 |
| 957 | 3300025972 | Ga0207668_10000158 | Ga0207668_1000015838 | 219 |
| 958 | 3300025981 | Ga0207640_10000168 | Ga0207640_1000016832 | 219 |
| 959 | 3300025981 | Ga0207640_10182772 | Ga0207640_101827722 | 219 |
| 960 | 3300025986 | Ga0207658_10000655 | Ga0207658_100006553 | 219 |
| 961 | 3300025986 | Ga0207658_10072411 | Ga0207658_100724113 | 219 |
| 962 | 3300025986 | Ga0207658_10225789 | Ga0207658_102257891 | 219 |
| 963 | 3300026023 | Ga0207677_10000553 | Ga0207677_1000055323 | 219 |
| 964 | 3300026035 | Ga0207703_10000631 | Ga0207703_100006319 | 219 |
| 965 | 3300026035 | Ga0207703_10383940 | Ga0207703_103839402 | 219 |
| 966 | 3300026041 | Ga0207639_10001591 | Ga0207639_1000159111 | 219 |
| 967 | 3300026067 | Ga0207678_10001139 | Ga0207678_1000113921 | 219 |
| 968 | 3300026075 | Ga0207708_10000660 | Ga0207708_100006604 | 219 |
| 969 | 3300026075 | Ga0207708_10197342 | Ga0207708_101973423 | 219 |
| 970 | 3300026078 | Ga0207702_10000404 | Ga0207702_1000040415 | 219 |
| 971 | 3300026088 | Ga0207641_10000520 | Ga0207641_1000052040 | 219 |
| 972 | 3300026088 | Ga0207641_10145849 | Ga0207641_101458493 | 219 |
| 973 | 3300026089 | Ga0207648_10000072 | Ga0207648_1000007287 | 219 |
| 974 | 3300026095 | Ga0207676_10000180 | Ga0207676_1000018040 | 219 |
| 975 | 3300026095 | Ga0207676_10770313 | Ga0207676_107703131 | 219 |
| 976 | 3300026116 | Ga0207674_10003433 | Ga0207674_1000343321 | 219 |
| 977 | 3300026116 | Ga0207674_10123631 | Ga0207674_101236313 | 219 |
| 978 | 3300026118 | Ga0207675_100124676 | Ga0207675_1001246764 | 219 |
| 979 | 3300026118 | Ga0207675_100211395 | Ga0207675_1002113952 | 219 |
| 980 | 3300026121 | Ga0207683_10000029 | Ga0207683_1000002997 | 219 |
| 981 | 3300026142 | Ga0207698_10000682 | Ga0207698_100006821 | 219 |
| 982 | 3300027617 | Ga0210002_1000485 | Ga0210002_10004854 | 219 |
| 983 | 3300027695 | Ga0209966_1008488 | Ga0209966_10084883 | 219 |
| 984 | 3300027695 | Ga0209966_1037871 | Ga0209966_10378711 | 219 |
| 985 | 3300027717 | Ga0209998_10002969 | Ga0209998_100029693 | 219 |
| 986 | 3300027876 | Ga0209974_10030398 | Ga0209974_100303984 | 219 |
| 987 | 3300027876 | Ga0209974_10046169 | Ga0209974_100461692 | 219 |
| 988 | 3300027907 | Ga0207428_10000100 | Ga0207428_1000010040 | 219 |
| 989 | 3300027907 | Ga0207428_10000124 | Ga0207428_1000012417 | 219 |
| 990 | 3300027907 | Ga0207428_10000968 | Ga0207428_1000096825 | 219 |
| 991 | 3300028379 | Ga0268266_10057152 | Ga0268266_100571524 | 219 |
| 992 | 3300028380 | Ga0268265_10000698 | Ga0268265_1000069823 | 219 |
| 993 | 3300028381 | Ga0268264_10001558 | Ga0268264_1000155823 | 219 |
| 994 | 3300028381 | Ga0268264_10285489 | Ga0268264_102854892 | 219 |
| 995 | 3300034818 | Ga0373950_0001825 | Ga0373950_0001825_318_977 | 219 |
| 996 | 3300034957 | Ga0373938_0000494 | Ga0373938_0000494_862_1521 | 219 |
| 997 | 3300035084 | Ga0373928_0009097 | Ga0373928_0009097_647_1306 | 219 |
| 998 | 3300035085 | Ga0373929_0001228 | Ga0373929_0001228_3404_4063 | 219 |
| 999 | 3300035088 | Ga0373940_0081037 | Ga0373940_0081037_24_683 | 219 |
| 1000 | 3300035090 | Ga0373949_0001228 | Ga0373949_0001228_1977_2636 | 219 |
| 1001 | 3300035092 | Ga0373952_0001688 | Ga0373952_0001688_2951_3610 | 219 |
| 1002 | 3300035114 | Ga0373939_0012040 | Ga0373939_0012040_1309_1968 | 219 |
| 1003 | 3300035115 | Ga0373941_0015879 | Ga0373941_0015879_414_1073 | 219 |
| 1004 | 3300035207 | Ga0373942_0001685 | Ga0373942_0001685_2818_3477 | 219 |
| 1005 | 3300035241 | Ga0373961_0014842 | Ga0373961_0014842_1064_1723 | 219 |
| 1006 | 3300035242 | Ga0373962_0000138 | Ga0373962_0000138_6694_7353 | 219 |
| 1007 | 3300035691 | Ga0373931_0000239 | Ga0373931_0000239_19681_20340 | 219 |
| 1008 | 3300042439 | Ga0439464_0069682 | Ga0439464_0069682_61_720 | 219 |
| 1009 | 3300042461 | Ga0439460_0021573 | Ga0439460_0021573_26_685 | 219 |
| 1010 | 3300048903 | Ga0496100_0002349 | Ga0496100_0002349_8749_9408 | 219 |
| 1011 | 3300048904 | Ga0496101_0000187 | Ga0496101_0000187_19300_19959 | 219 |
| 1012 | 3300048905 | Ga0496102_0002906 | Ga0496102_0002906_10918_11577 | 219 |
| 1013 | 3300048906 | Ga0496103_0000157 | Ga0496103_0000157_18373_19032 | 219 |
| 1014 | 3300048909 | Ga0496106_0006890 | Ga0496106_0006890_4872_5531 | 219 |
| 1015 | 3300048910 | Ga0496107_0000805 | Ga0496107_0000805_8182_8841 | 219 |
| 1016 | 3300048911 | Ga0496108_0234055 | Ga0496108_0234055_82_741 | 219 |
| 1017 | 3300048912 | Ga0496109_0000313 | Ga0496109_0000313_17644_18303 | 219 |
| 1018 | 3300048912 | Ga0496109_0001125 | Ga0496109_0001125_935_1594 | 219 |
| 1019 | 3300048914 | Ga0496111_0076468 | Ga0496111_0076468_394_1053 | 219 |
| 1020 | 3300048914 | Ga0496111_0083795 | Ga0496111_0083795_1518_2177 | 219 |
| 1021 | 3300048915 | Ga0496112_0086476 | Ga0496112_0086476_898_1557 | 219 |
| 1022 | 3300048915 | Ga0496112_0105664 | Ga0496112_0105664_594_1253 | 219 |
| 1023 | 3300048916 | Ga0496113_0012990 | Ga0496113_0012990_3751_4410 | 219 |
| 1024 | 3300048916 | Ga0496113_0018069 | Ga0496113_0018069_3378_4037 | 219 |
| 1025 | 3300048917 | Ga0496114_0005751 | Ga0496114_0005751_804_1463 | 219 |
| 1026 | 3300048918 | Ga0496115_0001217 | Ga0496115_0001217_4877_5536 | 219 |
| 1027 | 3300049571 | Ga0501034_0010927 | Ga0501034_0010927_1084_1752 | 219 |
| 1028 | 3300049580 | Ga0501046_0350547 | Ga0501046_0350547_36_704 | 219 |
| 1029 | 3300049585 | Ga0501069_0051380 | Ga0501069_0051380_1593_2261 | 219 |
| 1030 | 3300049586 | Ga0501070_0192200 | Ga0501070_0192200_895_1563 | 219 |
| 1031 | 3300049593 | Ga0501077_0150832 | Ga0501077_0150832_772_1431 | 219 |
| 1032 | 3300049742 | Ga0501080_0492636 | Ga0501080_0492636_293_952 | 219 |
| 1033 | 3300050494 | nmdc:mga06z11_4358_c1 | nmdc:mga06z11_4358_c1_2431_3090 | 219 |
| 1034 | 3300050507 | nmdc:mga05p37_45_c1 | nmdc:mga05p37_45_c1_18968_19627 | 219 |
| 1035 | 3300050508 | nmdc:mga09592_5654_c1 | nmdc:mga09592_5654_c1_3682_4341 | 219 |
| 1036 | 3300050509 | nmdc:mga0qj67_1430_c1 | nmdc:mga0qj67_1430_c1_12398_13057 | 219 |
| 1037 | 3300050510 | nmdc:mga06r32_407_c1 | nmdc:mga06r32_407_c1_10314_10973 | 219 |
| 1038 | 3300050511 | nmdc:mga08y16_2193_c1 | nmdc:mga08y16_2193_c1_2913_3572 | 219 |
| 1039 | 3300050511 | nmdc:mga08y16_792_c1 | nmdc:mga08y16_792_c1_10450_11109 | 219 |
| 1040 | 3300050512 | nmdc:mga0n895_1011_c1 | nmdc:mga0n895_1011_c1_18743_19402 | 219 |
| 1041 | 3300050512 | nmdc:mga0n895_10668_c1 | nmdc:mga0n895_10668_c1_5662_6321 | 219 |
| 1042 | 3300050513 | nmdc:mga0rr50_142289_c1 | nmdc:mga0rr50_142289_c1_870_1529 | 219 |
| 1043 | 3300050513 | nmdc:mga0rr50_918_c1 | nmdc:mga0rr50_918_c1_989_1648 | 219 |
| 1044 | 3300050515 | nmdc:mga0a205_6158_c1 | nmdc:mga0a205_6158_c1_8882_9541 | 219 |
| 1045 | 3300050515 | nmdc:mga0a205_6355_c1 | nmdc:mga0a205_6355_c1_2876_3535 | 219 |
| 1046 | 3300060353 | Ga0501082_0105127 | Ga0501082_0105127_1065_1724 | 219 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1bnl-assembly1.cif.gz_A | zinc dependent dimers observed in crystals of human endostatin | 0.717 | 28 | 217 |
| 1dy0-assembly1.cif.gz_A | murine endostatin, crystal form ii | 0.711 | 30 | 217 |
| 1koe-assembly1.cif.gz_A | endostatin | 0.6885 | 29 | 217 |
| 1dy2-assembly1.cif.gz_A | murine collagen alpha1(xv), endostatin domain | 0.6842 | 29 | 217 |
| 1bnl-assembly1.cif.gz_A | zinc dependent dimers observed in crystals of human endostatin | 0.6827 | 28 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_G5EGA4_982_1161_3.10.100.10 | Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A | 0.7406 | 24 | 217 | 3.10.100.10 |
| af_M9ND55_829_1006_3.10.100.10 | Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A | 0.7377 | 30 | 218 | 3.10.100.10 |
| af_P39059_1210_1388_3.10.100.10 | Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A | 0.7125 | 28 | 219 | 3.10.100.10 |
| af_G5EGA4_982_1161_3.10.100.10 | Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A | 0.7041 | 24 | 217 | 3.10.100.10 |
| af_M9ND55_829_1006_3.10.100.10 | Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A | 0.6935 | 30 | 218 | 3.10.100.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6TI47-F1-model_v4 | Lectin | 0.9855 | 16 | 219 |
|
| AF-A0A1L3LXF0-F1-model_v4 | Lectin | 0.9663 | 29 | 219 |
|
| AF-A0A528EI03-F1-model_v4 | Lectin | 0.9661 | 25 | 219 |
|
| AF-A0A560B6C2-F1-model_v4 | Lectin | 0.9655 | 29 | 219 |
|
| AF-A0A2V6TI47-F1-model_v4 | Lectin | 0.9621 | 16 | 219 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar